3BR0A

Crystal structure of the complex of malachite green bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br0A02
1AU7A 4BBSJ 1GVDA 2NX4A 3KKDA 2LR8A 1WGXA 1ZR2A 4DZPA 1HDPA 2EZLA 2Y30A 4A3EJ 5K58A 3LOCA 1BL0A 5EFYA 3KKCA 1H89C 3EGQA 2ME0A 5D1RA 5D19A 5C44J 1D5YA 3OSGA 1MBJA 3G7RA 5DAJA 4M3EA 5HBUA 2REKA 4LOCA 1OCPA 1K83J 3BRUA 4M3FA 5FLVA 2XGEA 2L9RA 4L5EA 2NVTJ 1UI6A 3S5RA 4DYCA 1TWCJ 4B4CA 3HOWJ 1XG1A 1VI0A 3VPRA 4BBRJ 5FLMJ 2QKOA 3M4OJ 2ZCNA 4FE7A 2RASA 2XDNA 3Q3SA 3MN2A 1MBEA 4C3JJ 1PUFA 1R9TJ 3BJBA 1P7IA 1ORKA 2OF7A 3VW2A 1TC3C 4A3DJ 2ZOZA 2M34A 2NS8A 2R5YA 4M3DA 2X6OA 3BTCA 1A6IA 1JUSA 2E2IJ 3LHQA 4C3HJ 2YVEA 4RBOA 3GEUA 5F0HA 3WHCA 5GPCA 4V2GA 2DJNA 2NVYJ 5HAWA 2DG7A 2G7GA 2HXIA 3HBLA 3MVPA 3CMYA 4I6ZA 1I6HJ 2JA6J 2CU7A 1Z77A 3VVXA 3O60A 3BR1A 3S15J 1IV6A 3LSRA 1BW6A 1T56A 5IP7J 2D6YA 4BY1J 4XRMA 3B6CA 1JKOC 2ZOYA 3TEDA 3H3VK 4DZJA 3AQSA 2Y31A 2X48A 5M5WJ 4XICA 2R93J 2M8GX 2ELKA 2DA6A 3S14J 3VUQA 2D5VA 1ETOA 4YZEA 4FTHA 4W1UA 2QWTA 4HKUA 1QRYA 3RZDJ 3HTHA 2LY9A 2MSYA 1JTXA 4XIDA 1LE8B 4JP0A 5EYRA 1QVTA 2OERA 2O8KA 4IHVA 3RZOJ 2TCTA 2GENA 2YUSA 1ETVA 5C3EJ 1B8IB 2M2EA 2DMNA 2IBDA 1ZR4A 1JT6A 1H88C 2E2JJ 3RD3A 4JX6A 3FRQA 3LSGA 5EG0B 2L7FP 3BTJA 3O8GA 4MXMA 2H8RA 4X6AJ 1U9NA 4GFLA 2CJJA 3LSPA 3COLA 4CGRA 2G7LA 5EDNA 2CUFA 4V2FA 2Y9ZA 4MLOA 3ZQFA 4A93J 3HOYJ 4X1EA 1GV2A 1HLVA 4UUTA 2VPRA 1LFUP 4FCYA 2N8GA 3A01B 3JRGA 1XS9A 3IH3A 1SANA 2ME6A 5EF6A 5EGOA 3HEFA 2LKXA 2P81A 2IU5A 2CQXA 3FK7A 3QQAA 3V6GA 5H9TA 3BTIA 2HQ5A 2M0CA 1MH4A 2NVQJ 2AHQA 2LVSA 2EZIA 1JJ6C 3HTAA 1FIPA 2QTQA 3AQTA 5K7HA 2EBIA 2O9LA 2EQRA 3E7QA 3RQIA 4G12A 2I10A 1YRNB 2WB1N 2XPVA 1MNMC 4NELA 1PUFB 3JRCA 4GCLA 2COBA 1X2NA 3S1MJ 5K7FA 2IEKA 3PO3J 2V57A 2B63J 4XRSA 2G7SA 1IRZA 1GT0C 2ID6A 2LLKA 5E3MA 1U9OA 3LNQA 4UUSA 3JRIA 3S16J 1H8AC 2K9SA 2UXOA 2L0KA 5EZHA 1VNDA 3VP5A 2QOPA 1AKHA 3LJLA 1O4XA 4QIWN 3T6NA 1GUUA 1FJLA 1TWHJ 4FISA 1U8BA 3NXCA 1MH3A 5C4JJ 5M3FJ 1YRNA 2RHAA 3E7LA 1MBFA 1ZGWA 2EZKA 3KNWA 3G1LA 1FEXA 3F1BA 5F04A 1WH5A 4D5FA 2DA2A 2IAIA 3S1NJ 3NAUA 4B1RA 3JRBA 4A3CJ 5IYCJ 1E3OC 3OOUA 3NI7A 1IDYA 5F27A 2EH3A 3BT9A 3GTGJ 1OCTC 4ME9A 1OFCX 2ECCA 2PBXA 3JRHA 4A3LJ 3K7AJ 1IG7A 4A69C 2UXPA 2DA3A 1W0TA 2VKVA 1XC5A 1TWGJ 4NN1A 4XK4A 3NRGA 2HYTA 3HOZJ 1FIAA 2MW8A 3BR2A 3VVZA 3EUPA 1GDTA 3PM1A 3VOKA 4Y52J 2K40A 3DEWA 3BQYA 4IHXA 2R7ZJ 2GLOA 2HYJA 4DYQA 4A3IJ 1JT0A 4JL3A 3HGYA 5F1JA 2VUMJ 2PMZN 4BKXA 1ETXA 2VI6A 3PO2J 3P9TA 4M6VA 1P7JA 1RKWA 1FTZA 5J1RA 5DS9A 2OI8A 9ANTA 2XGDA 1IGNA 3JRAA 2UXIA 2R92J 1BW5A 1VF9A 2FD5A 3Q0VA 2L7MP 2M9HA 3BQZA 3JRFA 2UXHA 4KWAA 1JUMA 5IOYA 2DA1A 2ID3A 4J19A 5D18A 3JREA 1BJZA 4Y7NJ 4QSHA 2CUEA 2MG4A 4D5CA 1I3QJ 1X2MA 2E19A 3D1NI 4M3GA 1QPIA 3S17J 4EEFG 3SJMA 2DG8A 1DU0A 1RR7A 2FX0A 3RH2A 3LSJA 3TW7A 5FKKA 2O7OA 3C2BA 3TP0A 4ICHA 4CYCA 3ON2A 5J3LA 5IYBJ 2K9NA 4GCTA 2LFBA 3BG5A 2XPWA 5EEAA 2Q24A 4NDLA 1JKQC 2XRLA 3S1RJ 2GBYA 2QCOA 3O8HA 1SFOJ 1HOMA 2GUHA 3VVYA 4S0HB 5E3OA 3G1MA 4AC0A 3W6VA 4D7MA 1HCRA 1MBKA 1IUFA 2G0EA 5F0FA 3SDGA 2R0QC 3RKQA 1BA5A 1S7EA 4JNNA 4C3IJ 3QPLA 3I4MJ 2LD5A 4UUSB 2W53A 1WCMJ 3HDDA 5HODA 3OSFA 1IC8A 3ZQHA 5EGOB 3SFIA 1WH7A 4AC6A 2FQ4A 2NS7A 3S1QJ 3HTJA 2F07A 1RESA 2QIBA 3GTPJ 2JN6A 3NARA 2PZ9A 3GTQJ 3TW6A 2DN0A 4L62A 3HE0A 3JSJA 5GPAA 2Y0SN 1B72A 1K61A 1RKTA 1TWFJ 4BY7J 1G2HA 1NK3P 2YVHA 2XGCA 2GFNA 1LFBA 3VOXA 5F0CA 3IV5A 4MK6A 1OJLA 3BR0A 4DW6A 4QTRA 2KDZA 3HOUJ 3H0GJ 3CRJA 4BXXJ 4MFDA 2FJ1A 3HM5A 2K9QA 2Y2ZA 2HOAA 3ZQGA 2R5ZB 4IEJA 1ZKGA 3L1PA 1CQTA 2HOSA 3FK6A 2W48A 3JR9A 1ZQ3P 4PXIA 3WHBA 2H1KA 2WGBA 3CCYA 3VW1A 2LK2A 3GTKJ 1B72B 2JWTA 4MO7A 3FIWA 1TWAJ 2XB5A 3BG9A 1AHDP 1AKHB 5GP9A 3CWRA 2DA7A 2ZB9A 5M5XJ 3Q0UA 1GV5A 5FKOA 4JYKA 2GM4A 2NOGA 1POGA 1UG2A 3OIOA 5J1UA 1UHSA 4IHWA 3IUVA 3HOXJ 3NNRA 5BNGA 4A3BJ 3PASA 2CRGA 5IP9J 1DU6A 5FJ8J 2CQQA 1HF0A 4ABZA 4A3JJ 5JLWA 1U78A 3M3YJ 4M3BA 2ECBA 4GFKA 5K7ZA 5J1YA 2X9DA 3QBMA 2HI3A 1ZK8A 2ZCXA 1WI3A 3QPSA 4MFEA 4JKZA 5AQCA 3FKIJ 2WUIA 4AF5A 1JKRC 3QKXA 4DYRA 3CDLA 3IH2A 1JJ8C 1ETKA 4GFBA 3I4NJ 4FE4A 1ENHA 5JLXA 4IHYA 2NP3A 2E2HJ 2YS9A 4CYCB 5FKLA 1UI5A 3ZQIA 4XRSG 2DMUA 4AUXA 2MGQA 2E1OA 4ACIA 5M3MJ 1SGMA 2EZHA 1T33A 2UXUA 1X58A 3S2HJ 5FMPA 1IJWC 2RAEA 2WV1A 5E3NA 2YU9J 1ETQA 5C4XJ 1A5JA 1QVUA 1IDZA 3GZIA 3ON4A 4RDUA 3KZ9A 4A3FJ 3BR3A 4HNVA 3ZOBA 3HGGA 5IYDJ 3BCGA 1MSFC 2OPTA 2JK3A 4JX5A 1JTYA 2L7ZA 5IP6A 2XPUA 3A02A 2G3BA 2XSDC 5CXIA 5DTDA 1Y1VJ 5FKNA 3G56A 5CXGA 5FGLA 2O7TA 2FBQA 4A3KJ 2HKUA 3VIBA 3MKLA 2AO9A 3B6AA 3BTLA 2JA8J 3G1OA 2DTZA 4UDSA 3A03A 5IPAA 3NPIA 2JA5J 1JUPA 1Z0XA 3F0CA 1ZTRA 3DCFA 5FHPA 4AYBN 3JRDA 1ETWA 1RPWA 4A3GJ 1ITYA 2KT0A 1VFCA 1HDDC 1LE8A 3BR5A 5FKMA 2DMPA 1NK2P 2JA7J 3PPBA 5F08A 3GTMJ 1B8IA 3HB9A 4W97A 2JMWA 1F43A 3UKGA 4B3AA 1W0UA 1NTCA 3LWJA 2TRTA 5EG0A 2DA5A 1JKPC 2NVXJ 2XB0X 3GTJJ 3DPJA 2NP5A 5CW8A 3GBGA 3ANGA 3HOVJ 3FISA 3ANPA 1EF4A 5C4YA 3HKZN 1FTTA 3B81A 3K2AA 1Y1WJ 1F36A 4JX4A 1RETA 3BG3A 3Q0WA 4GCKA 2LP0A 2DMTA 2DA4A 3HIMA 2QF7A 1UMQA 1MBGA 3BR6A 2R5YB 2WAQN 3C07A 3BNIA 3A01A 1MBHA 5HSZA 3ZQCA 4I76A 3CJDA 3S2DJ 5EZGA 3CQZJ 1I50J 2DMQA 1ETYA 2VKEA 1MSEC 1WPKA 2R5ZA 3ZQLA 4MIMA 2Y9YA 3BHQA 1APLC 5M5YJ 3MNLA 3GTLJ 2LTPA 5IOZA 2HXOA 2HOTA 3V78A 2HDDA 3VW0A 2ZCMA 1Q1VA 3GTOJ 4A3MJ 3HTIA 1JGGA 2JJ7A 4D7NA 3TP3A 5E3LA 3IH4A 4C2MJ
chains in the Genus database with same CATH superfamily
5J6XA 2BZTA 4BBSJ 4UXNA 1GVDA 2ZXJA 2NX4A 2LR8A 3IL2A 1WGXA 3QAHA 3WTXC 1ZR2A 4ZTJA 4L0ZB 3FXOA 3KYCB 2Y30A 1ZREA 3AKZA 4FX0A 3K4MA 3LOCA 5EFYA 3EGQA 2Y48A 4XSZF 2D1HA 5DDGA 1FMWA 4KDPA 3G7RA 5HBUA 2Z2SB 1OCPA 1A04A 3MZYA 1IW7F 2P6SA 2P8TA 2XGEA 2W84A 4WX9A 2DPUA 3CCRI 1PJRA 2VBXA 4DBRA 3KZIC 4DYCA 4WXHA 5DUKA 4XLFA 4B4CA 3HOWJ 3DPTA 4LFUA 4MHGA 2CUJA 5FLMJ 1SMTA 4PJMA 1HSTA 4YFKF 1B4AA 3HTUA 2RASA 3MN2A 4DJAA 1R9TJ 3EYYA 2NVUB 2OF7A 2ZOZA 2M34A 1XGMA 3VOEA 4ZZDA 3PJRA 2NS0A 1A6IA 1EV7A 1HXDA 1JUSA 2E2IJ 2YVEA 3K4JA 5ICCA 2R7VA 2UXNA 5DCMB 2ZJRF 5GPCA 3I56I 1V5FA 4V2GA 2QBYA 2NVYJ 1D8KA 3A0HC 2G7GA 3CMYA 4I6ZA 2A69F 5JVTA 2CU7A 4PZJA 2GOMA 3VVXA 3O60A 2DOAA 5ICGA 1G4DA 5TISC 2HNHA 3BLYA 4XRMA 3KP7A 2K02A 3B6CA 2ZOYA 3FMRA 3RSNA 1I1GA 4ITVA 3C2GA 2Y31A 5M5WJ 5ERIA 5D8KB 1X1AA 2PFBA 5HDKA 1T95A 5K1YA 4YZEA 3CO6C 1QZYA 3ABKH 4ZDOA 2MSYA 4KN4X 4AIHA 1XDUA 1PUEE 1WHUA 4RM3A 2OERA 2O8KA 1VQ5I 2EJRA 2E1CA 1WVRA 1A6QA 4XLCA 2R4GA 4XORA 1TNSA 2GENA 1S8NA 4UB8C 4CHUA 4RGXA 3DKWA 1HKQA 1X1DA 3A4CA 4UVCA 3BPXA 1FPQA 1WJBA 3DEEA 2L7FP 3M1EA 3SYTA 1YITI 4HF2A 3KYDB 2L3DA 3IWZA 1Z05A 4WK8F 3TL4X 2CJJA 4KITB 3LSPA 1XTAA 3K4CA 4NC8A 3COLA 4CGRA 3DQVC 3QOPA 4V2FA 3HOSA 4BE2A 4MLOA 3ZQFA 4KMFA 2EFNA 5D5WB 3OYDA 3E0JB 1K7AA 1IN6A 2GAUA 2UWMA 2VIXA 2F6CA 4I99C 1R58A 2M45A 3JRGA 1XS9A 2H6CA 3JSPA 3PIOF 5EGOA 1JGSA 2ICWG 2ZNZA 2OZUA 5J47A 3KP2A 4M71A 2CQXA 4PJ0C 4BQAA 5H9TA 1XCBA 2AHQA 1YOVB 1FX7A 1YQAA 3BZ6A 3SZGA 1VQOI 4IRIA 1ZGJA 3HPGA 1D1BA 4OU0A 3QPTA 3R61A 1DP7P 4G12A 2GXAA 2O3FA 1Z6TA 1R7JA 4UVBA 1YRNB 2LKSA 1MZBA 2WADA 1E3PA 2KPMA 2VC0A 3S1MJ 2IS4A 3RKXA 2L9VA 2HZDA 2V57A 1E17A 1VQKI 3P9CA 3QOEA 1IRZA 1LVKA 2ID6A 5ICFA 2LLKA 5L3BA 2DQRA 2DJIA 3S16J 2EB7A 2K9SA 2L9NA 2CW8A 2L0KA 1YS7A 2QSFX 2HVRA 1DQUA 3W6KB 1R00A 1R6RA 3CMAI 1FJLA 3L2CA 1X1CA 4FISA 1IO2A 1U8BA 1EKEA 5M3FJ 5DD4A 3K0LA 3GUDA 4AIKA 4MNUA 2XC7A 3CUQC 3E7LA 1R71A 3BOQA 4I98B 3QPHA 3IRQA 5F04A 4KA4A 2DA2A 2IAIA 3TGNA 3ZQ7A 1DPUA 2DODA 3CCSI 2GIZA 4KIBA 2RNJA 4EGYA 3JSOA 3GTGJ 1R1TA 4RGRA 2JUGA 2VBWA 4RB2C 2UXPA 3C3WA 3KZZA 2VKVA 3HSFA 4XK4A 1TQIA 5DEQA 3NRGA 3HOZJ 2VJIA 2MW8A 1OQYA 3VVZA 3EUPA 1IXSB 4CA0A 4AIJA 2O8XA 2V4JC 1QBJA 1YS6A 2DYSH 2O03A 4HA8A 1N77A 4Y52J 2GA1A 4Q48A 4IHXA 1UFMA 1Y0NA 1F4KA 4HV5A 4A5NA 4A3IJ 4JL3A 3ZN1A 2NXNB 4ENJA 2VUMJ 3DTIA 3SZPA 4BKXA 1FSHA 2O5RA 3CESA 3OR1C 4I7HA 3G6EI 1FYMA 3IAM2 2NNYA 2R3SA 2UXIA 4OOIA 3Q0VA 5JVGF 5F6FA 1X19A 3BQZA 3GZNB 4CICA 4KWAA 2D1VA 1JUMA 5IOYA 1BC8C 1XDSA 2QVOA 1IF1A 1BJZA 4Y7NJ 2CUEA 4XKBA 3D1NI 3LSIA 5LGUA 2P7VB 4IRGA 4YRVA 3PQJA 5LFAA 1DU0A 2OTLI 2DG8A 4U9NA 1U6GA 1E2XA 5CPRB 3K1MA 3RH2A 3LSJA 5H20A 3FXJA 3WU1B 2KL4A 3HRUA 1VQLI 2F4OB 4A2UA 5IYBJ 3GFJA 1YX3A 1VTNC 4E7LA 3BG5A 2XPWA 3I53A 3M8FA 4NDLA 4PDKA 4BNCA 4BAYA 3MQ0A 2IA1A 2GBYA 3MKZA 2QCOA 3O8HA 4LLGF 1SFOJ 3VVYA 4M9XA 2HDCA 5LHGA 1WJAA 4D7MA 1BA5A 3MCZA 4JNNA 4C3IJ 2GIVA 3QPLA 3TOBA 4UUSB 1WCMJ 1OPCA 5HODA 3OSFA 4BXFA 1LNWA 2FOWA 3SFIA 4UB6C 2VLAA 1I3AA 3K1PA 2FQ4A 1GXPA 2LF8A 4G6DA 3NARA 3AG1H 1XB4A 4X0GA 3HE0A 4L62A 1WKMA 3AAFA 1O3SA 2KZVA 1G2HA 1NK3P 2VT2A 4R79A 2OQRA 3VOXA 2DAOA 5F0CA 4MK6A 5FLXK 1MW7A 2FU4A 2QUFA 4YEJA 4BQQA 3CRJA 2IGOA 3FXUA 3SQNA 4CCOA 4CXFA 4MFDA 3V8JA 2G9WA 4IEJA 4H0EA 4Q5SF 5JHUA 3OYJA 1D0ZA 2OD5A 2HOSA 1BC7C 1CF7B 4C2MA 3FK6A 1KA8A 2K5CA 1ZQ3P 2WY8Q 3VB2A 1BIAA 1XD7A 2I8DA 2RV8A 1R36A 3GTKJ 4XSXF 1QA6A 5BQTA 4BHBA 1TWAJ 3TDUC 5E1XA 5GP9A 3GVAA 3WTYC 4BEHB 1ODDA 2DO7A 2VL8A 2NOGA 2OCCH 2VB6A 1YYVA 1YLFA 3OIOA 4GYIA 5BOXA 4IHWA 4LLNA 3J7AY 5BNGA 3TBIA 2Q0OA 4FASD 2IGNA 2CQQA 5D6EA 4DIQA 1HF0A 5JLWA 5BMZA 2DFIA 2PLYA 4GFKA 2E34A 4EMSA 2JUCA 1PP8F 2ZCXA 2KP6A 3WTSC 4JKZA 4E7ZA 3GLXA 1XX5A 2W00A 3CDLA 3RI4A 5IY5H 5AIQA 3ROUA 5JLXA 4LIVA 2DK8A 2NAZA 3QRFF 2OV7A 1WJFA 5H6QA 2VODA 5DUIA 5FKLA 2R7UA 1OYWA 3ONQA 2ZFUA 3C18A 2MC3A 3CF2A 5JR3A 3GXOA 1A35A 4ACIA 2EZHA 2M30A 5DM6F 3LAPA 2V79A 2IS2A 1Z21A 2PN6A 3S2HJ 4PGGA 2YU3A 2I5UA 2W57A 4I0BA 5E20A 2QA4I 1SFXA 3FMQA 1KQ9A 1S6LA 4PSWA 3CTAA 2PFVA 5C4XJ 4NC6A 1ZRFA 1A5JA 3CLOA 1QVUA 2R7RA 1YX5A 3KFWX 3DBRB 3EUHA 3L7WA 3EUHC 2OC6A 3CC7I 1K78B 2LRDA 4HX4A 3HHHA 3FZVA 1MSFC 4QPQA 4JX5A 2H8WA 2IJLA 2L7ZA 2E5NA 2AS5F 4WXCA 3A02A 1WQ2A 2K7LA 5CXIA 5BPIA 4HF0A 5CXGA 1BN5A 5DCFA 3SEZA 2M3AA 2R7WA 2GXGA 1OYIA 2HKUA 3F21A 3BTLA 3B6AA 3HSEA 1SD5A 1G59A 2JA8J 4UDSA 1YTYA 4RB1A 3FHZA 4E7HA 3DCFA 5AIPA 2JSPA 4AYBN 4M9SA 2FNPA 2BW3A 4G6QA 1IAWA 1ZYRF 3O3KA 2DMPA 2JSCA 3ZMSA 3H9QA 3OS0A 3SZTA 3GZ5A 3GTMJ 5ILSA 2GZWA 2JMWA 1F43A 4HZFA 3UKGA 2LREA 1W0UA 2OZ6A 2TRTA 3OIPA 2Z5UA 5GAEJ 3GTJJ 4IX7A 1FY7A 3LMMA 2RREA 2EV5A 3JW4A 4ZJZA 1G3WA 3OYNA 5L3GA 3OYEA 1MNEA 5CQEA 3CCJI 5IT3A 2Z9OA 3D5RC 3B81A 3MZHA 1Y1WJ 3AG3H 3BG3A 3RYPA 1V5GA 3J7ZI 2LH9A 1BI0A 2JPCA 3F6VA 3BR6A 1FBUA 2V6CA 2WAQN 4HW0A 1G8XA 4HX8A 2X6WA 2RKHA 2ZNYA 3OYKA 4LB5A 1UHMA 1TW3A 2A07F 3CJDA 3S2DJ 3CQZJ 1I50J 2VKEA 2FBHA 2M7AA 2E60A 3K4NA 2A5YB 1LB2A 2LTPA 2BOLA 1ZH5A 2HXOA 1TLHB 4M9ZA 1UAAA 1S5LC 1D3YA 2MC4A 2EWNA 5HOOA 4D7NA 3PFIA 5E3LA 2TDXA 2E1MB 2O6GE 2DT7B 1AU7A 5E8GA 4I2OA 2P5KA 2PX9A 2DFEA 3H9JA 3S8PA 4ENMA 4CZZA 5K58A 2YX4A 4D9JA 2LSOA 3A1YA 2DBBA 4IZZA 2FMLA 1X3ZB 1D5YA 2HVQA 3DU6A 1MBJA 5E17F 1U8RA 3J7YJ 2REKA 4LOCA 1K83J 5B3SH 4HAMA 4LB6B 3MWMA 1XMAA 5FLVA 2Y69H 3DBLB 2KJCA 4II3A 4L5EA 3FM3A 3F23A 4YELA 4HSTA 1TWCJ 1T0FC 2K4JA 2PMHA 2ZCNA 4FE7A 4U87A 4NQWA 3FWEA 4C3JJ 1R5HA 1P7IA 3H1CA 3KPHA 3VDXA 3VW2A 3PFYA 3ZMTA 1R1VA 1TC3C 3X2QH 2VJ4A 3M07A 2HYGD 5JHFA 1YE9A 4C3HJ 3ELKA 3WU0A 4IPAA 3GEUA 3L2RA 2X6XA 4B47A 3K69A 5LD2C 1I6HJ 4I0AA 3VYSB 3DBHB 1Z77A 4BL0B 1MGTA 3LSRA 1T56A 5FRMA 4N4OB 2J5OA 1JKOC 3IP4B 3TEDA 2HVSA 4Y4RA 3H3VK 4DZJA 3ABLH 1KYWA 2IP2A 2X48A 1LQ1A 1G3SA 2M8GX 2COMA 2FRHA 3H3ZA 2EV0A 1QRYA 4HKUA 3RZDJ 3HTHA 1R1UA 2LY9A 3KYLA 2DU9A 4L9NA 1YW7A 3V42A 1QVTA 3J81K 1V5EA 1J2XA 1ZG5A 1OLTA 3NWTA 2ISYA 3OWTA 2TCTA 5FROA 4EGZA 3M8JA 1ETVA 3QWLA 1KU3A 2IBDA 1JT6A 3OYFA 2B0LA 3TMOA 2GOXB 5CKTA 4G6TB 3P9IA 2H8RA 4X6AJ 1U9NA 1IN5A 3BZCA 4A5MA 4GFLA 3CUQA 4BJTA 2XSJC 3K4BA 5EDNA 1ZGAA 3KP5A 4XKCA 5B66C 3F72A 4A93J 3WTTC 4X1EA 4UUTA 2FE3A 3BCBA 1SMYF 2P5LC 2BY3A 2RC4A 4FCYA 2LF7A 2N8GA 3OS2A 4K2EA 1GLNA 1U5TB 4KJZA 3IH3A 1SANA 1VQMI 3AL0C 1FP1D 5EF6A 4CYDA 3L2QA 3E6CC 5DYMA 2P81A 1MMAA 2IU5A 1NG6A 3FK7A 2HDWA 3VWBA 2RN7A 2ZSHB 1MH4A 1UZCA 2VKHA 3LSHA 5JI6A 1JJ6C 2NVQJ 5KAIC 2BVMA 3ISPA 1GXQA 3CUOA 5K7HA 1WRJA 3RQIA 1LPQA 2V7FA 2XVCA 3ZGKA 2I10A 3K9TA 3RQ4A 2FXAA 1ZLKA 3RYRA 2CSOA 2VT3A 3OYLA 2W1OA 1BIBA 1KU7A 1PUFB 2M4GA 4GCLA 3FKJA 3I9V2 3FXKA 4GYGA 5K7FA 5LEJA 3PO3J 2H94A 3PNYA 3H0DA 3EYIA 4XRSA 1GT0C 3NEUA 2H6BA 4OAYA 5E3MA 3RPUD 2H27A 2UXOA 5EZHA 2RNGA 4F52A 3I54A 1AKHA 3PL8A 4HRIA 1BI3A 1GUUA 2F5CA 2W24A 5KK1A 3CD6I 2IS6A 3OY9A 2VONA 3NXCA 2BE5F 5IT9K 1YRNA 4BEHA 3IWFA 1FP2A 3W6JB 4A6DA 2BVLA 5E18F 1Z9CA 1MBFA 1ZGWA 2DTRA 4HSRA 3MFKA 3KNWA 3G1LA 1FEXA 2GXBA 2KKOA 3MD2A 5ICEA 3VTIA 1WH5A 2XV4S 3NAUA 4B1RA 2EA2A 5CVUA 3WGGA 1E3OC 2DLLA 2IS1A 3BWGA 1OCTC 3FXQA 1OFCX 1I5ZA 2PBXA 5GTIC 3ASNH 3K7AJ 2UUZA 4A69C 2DA3A 2MH2A 2P6TA 4L9VA 2ZSIB 2MABA 1XC5A 1G3TA 2OTJI 1RRJA 3FM5A 4QPOA 1SD4A 1FIAA 1ONVA 3BR2A 1IN8A 1VQ7I 1GDTA 2YX7A 1FMVA 3RPUA 3BJ6A 4P55A 1FYLA 3B02A 3VOKA 3MKWB 3CJNA 3GFLA 3V7SA 4IJAA 2HYJA 4C2TA 1B59A 3WE3A 5GAHJ 2F48A 1SAUA 1X1BA 5F1JA 1JT0A 2PMZN 2R7FA 2KDOA 1X4OA 1FTZA 3IKVA 4DGWB 9ANTA 1SVOA 3H35A 1IGNA 1G6NA 1XSVA 1GVJA 2QKMB 1OR7C 1VF9A 2JPBA 1HSJA 2L7MP 2HKOA 4AIDA 4AVPA 1I27A 3JREA 4QSHA 4NBQA 3U9GA 2CV0A 2F4IA 2WB1A 4E7IA 3E6MA 1QPIA 5HDNA 3SJMA 4CUGA 3G71I 1MIJA 3KP6A 2CYYA 2BXYA 2FX0A 4L5IA 4ENKA 3TW7A 4M73A 2WA0A 5DM7F 1R49A 4ICHA 4XQFA 2A6TA 2DI3A 3ZP5A 1QPMA 2X4HA 2K9MA 4HQMA 4Z2YA 2Q24A 3LSMA 1JKQC 2XRLA 2GUHA 1HOMA 2MLKA 4KN7X 5E3OA 3G1MA 2XF6A 3RTRA 4O5VA 3RKQA 4GRIA 3TDZC 1Z3XA 4BQOA 2V1NA 2FF4A 3HDDA 4OD4A 3QU6A 3HHGA 1WH7A 2K85A 5HNFA 3S1QJ 3OL4A 2LDUA 2QGUA 3KEQA 4IOCF 5GTHC 2VXDA 4IL6C 2PZ9A 4MTEA 3VEPA 4BGDA 5DD8A 3JSJA 4LG0A 1B72A 3D5LA 3DLAA 3L2UA 4BY7J 2YVHA 4MGRA 2XGCA 2KIFA 5A2QZ 4XOPA 4LITA 2GFNA 4HYEA 4DW6A 4QTRA 2KDZA 4XLAA 2DQLA 3R60A 4XR6A 1S29A 2D2WA 1Z6RA 3TO7A 2R5ZB 3LA3A 1RI7A 3BY6A 2CV1A 1L0OC 3L1PA 2NNNA 3JR9A 2R7DA 3WHBA 1WJCA 3CCUI 4OINF 2H1KA 2XRNA 2LK2A 2XKPA 3G2BA 3PSFA 4I02A 3QYEA 2XROA 2XUBA 3FIWA 3L2WA 2XB5A 1AHDP 2XF5A 3V7RA 3CWRA 5BS6A 2B1EA 2DA7A 2ZB9A 4YFNF 4I01A 1X1PA 1IZ1A 4ZYGA 1W7PA 3W2WA 1GV5A 4JYKA 4UVAA 3T1BA 3E1SA 3I0TA 1YW9A 2UZKA 5J1UA 3IUVA 3QODA 3NNRA 4A3BJ 1NG7A 2CRGA 1S3JA 5B1BH 3BDDA 4ABZA 4A3JJ 1BI2A 3M3YJ 3COAC 4U88A 1QU3A 5K7ZA 2DW4A 2DOEA 2KHMA 1ZK8A 1MNDA 1FOKA 5FD6A 2WUIA 1EH7A 2QSGX 4AF5A 1MJ9A 3V7CA 4DYRA 4HNUA 4XN3A 3F3XA 1JJ8C 4GFBA 4FE4A 2FUG2 2FA5A 5D6FA 1OCCH 2BYVE 2VQGA 2YS9A 1UI5A 2F5FA 3ZQIA 5K5RA 3IUOA 2R7XA 2E5ZA 2CH0A 1BR2A 2MGQA 2E1OA 1VQPI 5M3MJ 2L2OA 5CVRA 5HS8A 4CCJA 3OS1A 3NRVA 3H3UA 5FMPA 1R23A 1HW1A 3I3LA 4YIRX 2WV1A 1IJWC 5E3NA 2HEOA 3H36A 2JRMA 2E71A 2GA2A 2MYSA 4JQFA 2STTA 1ZARA 4KMUX 1W7PD 1XN7A 1O3RA 2QYOA 2V9PA 2CS3A 3WGHA 3FF5A 3GZIA 3DKXA 4RDUA 1IRFA 2KZGA 1RR8C 1VQ4I 3E5XA 3V4GA 2XIGA 2CQKA 3ZOBA 2A05A 2FSWA 2VJJA 3BCGA 1L3LA 1HA8A 1K6OA 4UNOA 2H09A 2MH9A 4I09A 4F91B 2XSDC 1Y1VJ 3G56A 2O7TA 1ZLJA 3B73A 2LY1A 1K4TA 4A3KJ 1PP7U 4HDUA 1SFUA 3MKLA 2AO9A 2MA3A 3G1OA 2DTZA 1NHAA 4O6JA 4P96A 4XL9A 1LEAA 2QQBA 2JA5J 2HQNA 3F0CA 4E7JA 5FHPA 4LMYA 2K3PA 1RPWA 5B5EC 4A3GJ 3WGIA 1ITYA 2KT0A 2HPMA 3FDYA 5FKMA 5E1WA 3GYHX 5K5OA 1LKXA 1IN7A 5KAFC 1B9NA 1OISA 3KIOA 4B09A 1UCRA 1DDNA 1J0RA 4EATA 4F92B 4ETSA 2NVXJ 2GQQA 1FYKA 2VOOA 4AU7A 3DPJA 2A5WA 4HF1A 5CW8A 4RAGA 4PJJA 1J59A 3ANGA 2DT5A 3FISA 3ANPA 2C6YA 4BH9A 4M6XA 1LJ9A 3VFZA 3QYFA 3K2AA 4XBFA 1OR7A 4JX4A 4RB3C 1RETA 4GCKA 4BE0A 2DMTA 3HIMA 1P9QC 1W5CC 3A01A 4PJLA 4XLEA 4N9HA 1OKRA 3JAMZ 1MSEC 3HRSA 4KIGA 5CVJA 2QZ8A 3HXLA 1WPKA 3DPUA 1A31A 4OMZA 3ZQLA 1Z91A 1O7LA 1APLC 2FEZA 3RCOA 1KONA 3MNLA 3G4SI 2YR2A 1IUYA 4EJWA 1Z7LA 3V78A 2UV1A 3BPVA 2ZCMA 1IRXA 3CJQB 3CZ6A 5HLTA 2H1LA 3L2VA 4A3MJ 2ZY9A 4CCNA 2JJ7A 2L9SA 2OU2A 3H5RA 1YJWI 1FOXA 1ON1A 1W36D 4XKWA 4EJUA 2JRTA 1YIOA 3DWLE 1HDPA 5HS9A 1M1EB 1N25A 4RB0A 3CO7C 4XOTA 1BL0A 1PDNC 1H89C 3LA7A 3A2KA 2ME0A 4AM3A 3IAS2 5C44J 5A2QK 3OSGA 5DAJA 2JZYA 1BR1A 4ASNA 2JQ7A 2V1DA 4MTDA 1H9GA 5ED4A 4PUSA 4KT6A 2QEXI 4M3FA 5BPDA 1UI6A 1XCVA 1ZHFA 3S5RA 4FT8A 3AG2H 2W7NA 2OBPA 2FMYA 2ZMEA 1VI0A 3P7NA 2CG4A 4PK4A 2RQPA 2QKOA 3DFGA 2J5PA 2O0YA 3Q3SA 4L18B 4WXDA 1PUFA 1U0JA 5HLGA 1J9IA 4NC7A 3C7JA 3GW2A 4LGWA 3J7AO 2A3SA 2NS8A 2XAGA 2AXTC 3BTCA 2RQQA 5ILUA 1HBXG 5H6RA 5LLQA 2Y75A 2DXIA 3F8CA 1K6YA 1P92A 2CFOA 2DJNA 3PUBA 2CGPA 5HAWA 2HXIA 1DGWY 4EVIA 2JA6J 1WI9A 1DPRA 3KEOA 1OMIA 2PMUA 5CLSA 3S15J 1UJ8A 1IV6A 1BW6A 2KRHA 2V9KA 4DVYP 4BY1J 2EIMH 2RVCA 1WZ2A 5KHDA 3AQSA 2VE8A 4A6EA 1SFKA 1R4NB 1YW8A 2ELKA 2DA6A 4G94A 1DP3A 4HLYA 4FTHA 1I39A 4W1UA 5EEGA 2V6EA 1AA7A 1JTXA 4XIDA 2FQ3A 1LE8B 4JP0A 3KETA 1QZEA 2XAUA 1VZ0A 3DTEA 2MD5A 3OMYA 2WAFA 4Y15A 2XDVA 4YIIA 2YUSA 4OMYA 3LA2A 2M2EA 2DMNA 3BG6A 2E2JJ 2E36A 4JX6A 1YIJI 3FRQA 2HPIA 3LWFA 4JOMA 3TO9A 2OUMA 4IXAA 4P1WA 3O8GA 5D5VB 5HDGA 3BCAA 4HQEA 2CUFA 3RDIA 1XSDA 2Y9ZA 1V55H 4HG2A 2VQLA 3HOYJ 3I5UA 2EV6A 3VYRB 2BGCA 5DV5A 4XLNF 1J75A 2BHYA 3QP6A 1LFUP 4UY8I 1ZG1A 4EQQA 1R22A 2WWYA 2ME6A 3ZMZA 3HEFA 2LKXA 3SFZA 2M87A 1S9HA 2X1EA 5J4VA 3QQAA 3IRRA 2RDPA 3W2VA 2E7WA 2EZIA 3HTAA 5IT9Z 3WG9A 1BOAA 4RS8A 5H2FC 2QTQA 4OD5A 3CUQB 5LRSA 2K9LA 4KUMA 1UHWA 3JAMK 1BBYA 4BACA 2K4BA 3ZQQA 4F55A 3GF2A 1YJ9I 4NNJA 1MNMC 4Y33A 3A0BC 4XONA 4C30A 4EV0A 3JRCA 1MMDA 2COBA 1X2NA 1SFEA 1JHHA 4LK1F 2LBFB 1LDKB 2LKPA 5FGMA 1ZRCA 2G7SA 2ISZA 3L00A 3PSIA 3WU2C 1U9OA 1EA3A 4UUSA 1XGSA 1H8AC 1WJEA 3RKWA 1BR4A 3L09A 2QOPA 2VBYA 3VYTB 4G8XA 4L5JA 3WTUC 1QNTA 4UV8A 4QIWN 1TWHJ 1J09A 2FBIA 2HTSA 1MH3A 3K8PC 2IA2A 3HIFA 1W7PB 4ENNA 4L0YB 4ZDPA 2ELJA 2EZKA 3F1BA 2QWWA 4CDGA 3E3VA 3KP4A 3ZRGA 3MAJA 3CCEI 4A3CJ 3JRBA 3ECOA 1U5TC 2LC2A 3ESWB 5E1ZB 4BU2A 3GX4X 1YHQI 2STWA 2ADUA 4ME9A 3DPLC 2M4KA 3JRHA 4A3LJ 1KU9A 3RKYA 1IG7A 2OQGA 2DT6A 2KQRA 1E0EA 1STZA 2QSHX 4L9TA 2XAFA 2CUZA 2HYTA 4DQ2A 4XM3A 2LY2A 3BJAA 2IT0A 4LIUA 1VQ8I 4O3MA 4CO8A 3PUFA 2Z3YA 2K40A 1AWCA 4MQ9F 3BQYA 3OV8A 1YG2A 3LSTA 2LYCA 3HGYA 3LSKA 1ETXA 2VI6A 2Q1ZB 1LVAA 4M6VA 1RKWA 3F22A 2OI8A 5J40A 2XGDA 1Z67A 5LRRA 2FD5A 1D0XA 4ZYAA 2LNBA 4JBAA 2GWRA 4IOAF 5D18A 2VASA 4IO9F 1K78A 4D5CA 1I3QJ 1X2MA 2QKLB 2DPDA 4M3GA 3TO6A 1XMKA 3BJOA 4RAZA 2BY0A 3HC7A 3GMEA 1ACIA 5FKKA 2O7OA 4V19K 3TP0A 1FC3A 3DF8A 5CQGA 1QO0D 2K3FA 3HPHA 4BYYA 2QQAA 5TGTA 1AOYA 4GCTA 1N78A 1XMXA 1J7KA 1T98A 3K1NA 4EM0B 5EEAA 1SVLA 2IRFG 2YVXA 3S1RJ 2HS5A 4G7HF 2QM3A 3E5UA 4MQVA 2DFFA 4Y17A 4S0HB 4AC0A 1ON2A 1HCRA 1Y6IA 2G0EA 3SDGA 2R0QC 4HPQA 1F9NA 2ZJQF 4XRFA 4PCQA 2CWEA 3LQRA 1LDJA 3R4KA 2LD5A 2KRFA 3AFHA 2VBZA 1IC8A 3ZQHA 5EGOB 5EJCA 2NS7A 2P7CB 5CYVA 3HTJA 2F07A 4HNTA 1W5SA 1RESA 3OYAA 2QIBA 1UB9A 2JN6A 4HDVA 4MEYF 4R1HA 3GTQJ 4BDYA 3OIQA 4PFPA 3ZR8X 2HWVA 5GPAA 2A68F 2Y0SN 1K61A 3GCMA 3ZMDA 2XKOA 1HC8A 1TWFJ 2G7UA 1LFBA 5FB2A 3T5XA 3GWZA 1U2WA 3HOUJ 3N4MA 3ABUA 4BXXJ 2FOKA 3QP5A 4BQNA 1RIOH 1W4MA 2W25A 2FJ1A 3F6OA 2K9QA 2Y2ZA 3HM5A 2HOAA 3ZQGA 3I55I 1DGRM 1REPC 1ZKGA 1CQTA 1USTA 3CC4I 3GLLA 2WGBA 2VC1A 3CCYA 3VW1A 4Q47A 3DEUA 3C1DA 1MMGA 2W82A 2KLOA 3KLOA 1B72B 2ZJ2A 3F9KA 4HBLA 3BG9A 4M74A 3DLLF 4C2UA 4IRHA 3CC2I 1XGNA 5J8CA 4A0ZA 5D5UB 3S3MA 1RUNA 1POGA 1UG2A 1UHSA 2VN2A 3HOXJ 3RJPA 3PASA 4IKFA 1P2FA 1D0YA 2L02A 3D5SC 3I4PA 3I64A 4UV9A 5IP9J 5FJ8J 3ZPLA 3Q9VA 2XAJA 4ZTFA 4P9UA 1U78A 1HW5A 1X3UA 3CP2A 3ECHA 3DTKA 2ECBA 1WFXA 4GCVA 5J1YA 4PSXA 5FD5A 3OYBA 4LD5A 3OL3A 1TQMA 3QPSA 5TJJA 1VQ6I 4CCKA 3IH2A 1ETKA 3I4NJ 3WE2A 3HTSB 4U9LA 2NP3A 3CCVI 1T6SA 1MMNA 2ZXIA 1TBXA 4CYCB 2E2HJ 4EJTA 3OOPA 4XRSG 1V54H 1T08B 2E7XA 3MEXA 4AUXA 2HQRA 4LJZF 4KISA 1SGMA 5LHIA 1T33A 3DXJF 3CDHA 5FRNA 2L5QA 1KQ8A 3LQQA 2M1BA 2L4MA 2EIKH 4OWRB 3FBNB 3HJEA 5FLXZ 1ETQA 3CF5F 1E3HA 2NRAC 4PJNA 3ABMH 3F8NA 1FNNA 4GGGA 3GFIA 3I59A 2EILH 3KZ9A 3BR3A 1BI1A 1D1AA 1BM9A 2EA4A 2EIJH 4JK1X 5IP6A 1JTYA 1LUJB 2XPUA 5J4YA 2G3BA 5CJ9A 5GADJ 5FKNA 3I71A 3DV8A 1MDMA 4RGUA 2L54A 4HEA2 1SAXA 3ML6A 2DFHA 1O3TA 1W5TA 3CMEI 5IPAA 1WJDA 3K4LA 3J81Z 3ABTA 1T8IA 2E35A 3F8MA 1V3FA 1FOYA 1JUPA 1FWZA 1Z0XA 4KT5C 5HS7A 2ESNA 2A61A 2ELHA 2WTEA 3JRDA 4EM2A 2ZC2A 1ETWA 1FBSA 2EFWA 2HTJA 3MKYB 3SHFA 1TQPA 1JI8A 1VFCA 2ZBKA 1HDDC 3PPBA 2JA7J 1EH6A 3ERED 3LFKA 1TT0A 1D1CA 1B1BA 2A6HF 4W97A 2DOFA 1P6RA 3S3OA 4ZH4F 2VKDA 3ZCOA 4B3AA 1NTCA 1PYVA 3KZYA 4M6YA 4OIQF 1JKPC 5JFRA 3VODA 4AD9A 3CJTB 3FXMA 1BOBA 4RM2A 2AQEA 3MMYB 5E79C 3HOVJ 3FBIB 1MKMA 2E1MC 3U1DA 4HLXA 3WTVC 4PGHA 3M7GA 4LG0B 3O6BB 4XLHA 5F1RA 1QQIA 3Q0WA 2B3WA 2VOPA 2LP0A 2HGCA 1MBGA 2R5YB 2IGMA 3C07A 4Y13A 1F5TA 5HLHA 2F5DA 4I76A 5EZGA 3NQOA 3I59B 3R6SA 3S3NA 3DP7A 3EDPA 2PBIA 3DKYA 2QBYB 4MIMA 1OCOH 4YG2F 5L3EA 4KIFA 4XKVA 1IN4A 4RGSA 3GTLJ 5L3CA 1S7AA 2HOTA 3CMMA 1IXRC 2HDDA 1Q1VA 3UNGC 2IVMA 1KYZA 3U2RA 2A2FX 3HTIA 1Z3YA 1EH8A 4GXOA 3JRIA 4C2MJ 3P5JA 2LBFA 1H0MA 1O7FA 3KKDA 5KNLA 4ZDLA 1X3WB 3KCCA 4CGZA 4DZPA 4A0YA 2EFOA 2EZLA 4B3XA 4A3EJ 3KKCA 1WSUA 2KMUA 2ZKZA 5LHHA 1T38A 5D1RA 5D19A 4IQ4A 5D4SA 2MBFA 2HOEA 4M3EA 2HQAA 3LL7A 4ON0A 1VQNI 2DDBA 1MJBA 4KICA 4FETA 3BRUA 2JT1A 1CGPA 1TNTA 2EK5A 4LG3A 4CCLA 2L9RA 2DDAA 2NVTJ 4R8HA 3OYHA 4C9YA 4CCMA 2ETHA 5TRDA 1XG1A 4KFCA 3S32A 2WBMA 3VPRA 4BBRJ 2K27A 3PIPF 2JTVA 3M4OJ 2XDNA 1MBEA 3N97A 4ESJA 3BJBA 3ZMVA 4U7BA 1ORKA 4QWQA 4A3DJ 4ESBA 2R5YA 5AONA 1B9MA 2X6OA 3HYIA 4M3DA 2Z33A 3KE2A 4RAYA 1TZLA 1W1WE 4U0WA 3LHQA 5L3FA 4RBOA 2HFHA 3RPQA 5F0HA 3WHCA 2QQ9A 3JTGA 2EFPA 3EUAA 3LFUA 4CSWA 2IW5A 2B9SA 2DG7A 3HBLA 3MVPA 2ACJA 3OYGA 2ZMEB 1MJAA 3IHUA 1S72I 3BR1A 2CO5A 5IP7J 2D6YA 3TOAA 4HX7A 1S7OA 3VYUB 1FT9A 4XICA 2R93J 3VUQA 3S14J 3TQNA 1U3EM 5HVQC 1ETOA 2D5VA 4EJVA 4IVNA 2QWTA 3VSLA 5LBQA 2RGVA 2ZJPF 6PAXA 5HNHA 5LGTA 5EYRA 2W4SA 2X6YA 3JCUC 5D5XB 2BW3B 4EM1A 4CZCA 3HOTA 4IHVA 4P9FA 3RZOJ 1D8JA 1P4XA 4WIBA 3PNVA 5C3EJ 3E5QA 1B8IB 3OYIA 1ZR4A 3RD3A 1H88C 4XNFA 2CW0F 2JVHA 1O3QA 3LSGA 5EG0B 3GZ6A 3BTJA 4KNYA 4E7SA 1IXCA 3I58A 2M0MA 4MXMA 3QU3A 2XF7A 2G7LA 3EETA 1HKTA 1GV2A 2M5WA 1HLVA 4HV6A 2VPRA 1K4SA 3A01B 2Y0SA 1G3YA 4FHTA 3K4KA 3V6GA 3J80Z 4ANJA 3BTIA 2HQ5A 1XGOA 2M0CA 3IC7A 3W2AA 1UG0A 2LVSA 4RA2A 4D0PA 1ZRDA 1FIPA 2YSRA 4P5OA 3AQTA 2O9LA 2EBIA 3BROA 2EQRA 3E7QA 1WJ5A 4KYWA 1W36C 2R7OA 2F2EA 2CQNA 4BHCA 1LFPA 2VJ5A 1VQ9I 1OCRH 2WB1N 2XPVA 3V8LA 4NELA 3HUGB 3GFMA 3N05A 4IHSA 2IEKA 3GEZA 1BJAA 2IA0A 3K10A 3M1CA 4OAZA 5F64A 3ULQB 2B63J 4YFXF 5LGNA 2D45A 1Z7UA 3FX3A 1N75A 5K5QA 4U0YA 3LNQA 1TP4A 3TKYA 3F8BA 2ZXHA 5HLIA 4ZYDA 4WF2A 3K2ZA 3T8RA 1VNDA 3AL0B 3VP5A 4BDZA 1R4MB 1SVMA 2FBKA 4E6KG 3EPZA 4Q4ZF 1RZ4A 2XAHA 3P9KA 2XGXA 3H9GA 4ZYHA 1SD6A 3ASOH 3LJLA 1O4XA 1QHHD 4ZC3A 3T6NA 1RNLA 4RLQA 1KQ0A 4RAFA 4U0VA 5C4JJ 3T0YA 2RHAA 1QZZA 3R0AA 4E4HA 3KP3A 3IKTA 4XN0A 2L7KA 4D5FA 3S1NJ 1HKSA 2VQCA 2Q8KA 4U7DA 4S05A 3WODF 3SDBA 5IYCJ 3NI7A 3OOUA 3OR2C 3ZMUA 1IDYA 5F27A 2EH3A 1WWXA 3BT9A 5J8FA 3K70C 2Y0MA 2PMZA 2ECCA 4B8XA 3ZN0A 3AG4H 2BEOA 4A0XA 1Y8QB 3SEQA 3NWSA 1T39A 1QGPA 4YIFA 2F5VA 1W0TA 2ZFWA 2ZO4A 2VE9A 1TWGJ 4NN1A 4Z6YA 2BXZA 2KFDA 2VPLA 3J80K 2Z1DA 2O61A 3E6DA 3PM1A 2NOJB 1MMSA 3CJRB 3ZXSA 3DEWA 3H5NA 2R7ZJ 2GLOA 4DYQA 4AYBA 3JTHA 3PO2J 1SC7A 3P9TA 2ESHA 1P7JA 2V9VA 2MD0A 2W85A 2R7QA 3E6BA 3HUGA 4L9JA 5J1RA 3CLQA 5DS9A 2XAQA 4UUVA 3DU5A 2L4AA 4TV7A 3JRAA 3R0JA 2R92J 1BW5A 3HZJA 1RUOA 4IF4A 2M9HA 3JRFA 3CCMI 2UXHA 1ZG3A 3BG7A 2DA1A 3O2PE 2ID3A 1HW2A 2AQFA 4J19A 4BE1A 2PI0A 2VXZA 2HU9A 2B7EA 5GAGJ 2MG4A 2OJED 2F5EA 2E19A 4N4NB 2A6EF 1R5GA 4EEFG 3S17J 4A12A 1RR7A 3CCQI 2HR3A 3E97A 2XHKA 3C2BA 3T8TA 4CYCA 3H5AA 5J3LA 3WTWC 3ON2A 2ZMEC 1F1ZA 2K9NA 2ZCWA 1I6XA 3OYMA 2LFBA 1IRGA 4B48A 3V8KA 1YO5C 3W6VA 1MBKA 1IUFA 5F0FA 4F7ZA 1OCZH 2QQ8A 3KEYA 1S7EA 1JXSA 4M72A 3BP8A 3I4MJ 4CH7A 3Q9SA 2W53A 1ZELA 1ERDA 5B1AH 3WTZA 2VQHA 1XPXA 1ZAOA 3BC8A 2LOOA 2AXLA 4OIPF 2Q2EA 5CVVA 1KZHA 1LDDA 4AC6A 1HQCA 1FZPB 5E8IA 3GTPJ 2QENA 1UELB 1CF7A 2X1CA 3PNTA 1TT5B 3LAJA 1H9TA 3TW6A 2DN0A 4XMYA 1A36A 1Y56A 3H92A 2FJI1 1O57A 4OIOF 3ERMA 3RIRA 1TL8A 1RKTA 1NH3A 4DOZA 4GO1A 2R7TA 2K86A 2P0WA 4AWXB 3IV5A 5ILVA 1OJLA 3BR0A 4G9YA 3REOA 1XSXA 3H0GJ 1J5YA 3KX2A 2DK5A 2WV0A 1LEBA 1I1SA 4IRVA 1SEUA 1RC9A 4PFOA 2V26A 1PVEA 2X85A 2FNAA 2W48A 3C2HA 4PXIA 1R5ID 4J01A 4BXUA 1KU2A 5L3DA 3QYBA 2V1UA 2BY1A 2JWTA 2L01A 2UXXA 4MO7A 4UHTA 1TW2A 3M8EA 3VSKA 1AKHB 1IV8A 5M5XJ 3Q0UA 4NUBA 2HZTA 5FKOA 4BJ6C 2F4MB 1MD0A 4G7ZF 2GM4A 1EJ9A 4IQJA 2NYXA 2EINH 1DU6A 2WY7Q 2BV6A 4FQGA 1D5VA 3W3CA 1K79A 1C0WA 2KIMA 2CW7A 4M3BA 3WG7H 4F3QA 1ULYA 2X51A 2Z99A 1FLIA 2X9DA 1YJNI 4BHPA 4NB5A 3QBMA 2HI3A 4DNCA 4DBQA 1WI3A 4MFEA 3OYCA 5FO5A 2MLGA 2Q2EB 3FKIJ 5AQCA 1SD7A 4HOBA 2V1XA 3FHNA 1JKRC 4GDFA 3QKXA 5LEKA 2CMPA 2OCEA 2LG4A 4IHYA 1ENHA 1Y39A 4G7OF 1DUXC 3FXLA 2IXSA 1FBQA 2P4WA 4H4KC 5D4RA 3G3ZA 4WCGA 1JE8A 2QLZA 2DMUA 2PJRA 2IPQX 4XLPF 2UXUA 1X58A 5KVRA 3CDIA 2RAEA 1V4RA 2YU9J 4FX4A 4BUPA 1FOWA 1Z1DA 3KLNA 3U21A 3CP8A 3G73A 3FMSA 1IDZA 5FFZA 4OIRF 4D1QA 1T2KA 2PJPA 4ESFA 2OAZA 3ON4A 2X1DA 4A3FJ 3HSRA 2EPFA 3S93A 4HNVA 2PQ8A 3HGGA 4LLLA 4LK0F 5IYDJ 4E7KA 2OPTA 1Y0UA 4RLFA 4RMNA 2JK3A 2BBYA 1P4AA 2JA2A 1JHFA 2ZXWH 2DCEA 3K6GA 4Y3OA 1KGSA 5DTDA 2R7SA 5FGLA 1ZN2A 1TTYA 2FBQA 4S04A 4BJ5C 2DYRH 2KJBA 2CFXA 1T0FA 5FFXA 5EEHA 3VIBA 4BS9A 2PEXA 4QLCU 3A03A 4ZYEA 3HRMA 3NPIA 2Z16A 3HRTA 4II2A 1ZTRA 2EFQA 3L9FA 1U5TA 3GO5A 2P5VA 3Q5FA 2M8EA 3UR3C 1X4PA 3SWHA 1LE8A 3BR5A 1NK2P 3FXRA 3HKZA 5F08A 1B8IA 3HB9A 3D0SA 4NHJA 2XASA 3BZKA 3LWJA 2BY2A 3K70D 1MDMB 2G7HA 2M7BA 1P4WA 2DA5A 3EUKL 3PQKA 5EG0A 2XB0X 3HL2A 2BHZA 4B43A 2NP5A 1Y8RB 2WAQA 2HKXA 3GBGA 4F93B 3M9AA 4AVZA 3SXYA 4WWCA 4IHTA 2LMDA 2PJRB 1EF4A 2YPRA 5C4YA 3CCLI 3NS4A 2KIQA 3HKZN 4N9IA 1YFHA 4MEXF 1FTTA 2KIUA 2WAEA 1FSEA 4NQWB 4J00A 1F36A 2PG4A 2OA4A 2IGKA 2WC2A 2DA4A 2QF7A 3MZ8A 1UMQA 4E70A 1GHCA 2E1NA 2KRCA 2CQ7A 2X0LA 3BNIA 1MBHA 5HSZA 3ZQCA 1Q1HA 5DCMA 2DMQA 1ETYA 1B6AA 4ZZLA 2R5ZA 2MFZA 2CV2A 4EJOA 3HG9A 2Y9YA 3BHQA 5KCMA 2KISA 1YI2I 5M5YJ 3EQLF 4N0BA 4B44A 2HYFA 3S2WA 3U1KA 5IOZA 3VW0A 1QHGA 1OYYA 3GTOJ 2JVGA 1USSA 5D8LB 1JGGA 3F8FA 5CVIA 3TP3A 3IH4A
chains in the Genus database with same CATH topology
1AU7A 4BBSJ 1GVDA 2NX4A 3KKDA 2LR8A 1WGXA 1ZR2A 4DZPA 1HDPA 2EZLA 2Y30A 4A3EJ 5K58A 3LOCA 1BL0A 5EFYA 3KKCA 1H89C 3EGQA 2ME0A 5D1RA 5D19A 5C44J 1D5YA 3OSGA 1MBJA 3G7RA 5DAJA 4M3EA 5HBUA 2REKA 4LOCA 1OCPA 1K83J 3BRUA 4M3FA 5FLVA 2XGEA 2L9RA 4L5EA 2NVTJ 1UI6A 3S5RA 4DYCA 1TWCJ 4B4CA 3HOWJ 1XG1A 1VI0A 3VPRA 4BBRJ 5FLMJ 2QKOA 3M4OJ 2ZCNA 4FE7A 2RASA 2XDNA 3Q3SA 3MN2A 1MBEA 4C3JJ 1PUFA 1R9TJ 3BJBA 1P7IA 1ORKA 2OF7A 3VW2A 1TC3C 4A3DJ 2ZOZA 2M34A 2NS8A 2R5YA 4M3DA 2X6OA 3BTCA 1A6IA 1JUSA 2E2IJ 3LHQA 4C3HJ 2YVEA 4RBOA 3GEUA 5F0HA 3WHCA 5GPCA 4V2GA 2DJNA 2NVYJ 5HAWA 2DG7A 2G7GA 2HXIA 3HBLA 3MVPA 3CMYA 4I6ZA 1I6HJ 2JA6J 2CU7A 1Z77A 3VVXA 3O60A 3BR1A 3S15J 1IV6A 3LSRA 1BW6A 1T56A 5IP7J 2D6YA 4BY1J 4XRMA 3B6CA 1JKOC 2ZOYA 3TEDA 3H3VK 4DZJA 3AQSA 2Y31A 2X48A 5M5WJ 4XICA 2R93J 2M8GX 2ELKA 2DA6A 3S14J 3VUQA 2D5VA 1ETOA 4YZEA 4FTHA 4W1UA 2QWTA 4HKUA 1QRYA 3RZDJ 3HTHA 2LY9A 2MSYA 1JTXA 4XIDA 1LE8B 4JP0A 5EYRA 1QVTA 2OERA 2O8KA 4IHVA 3RZOJ 2TCTA 2GENA 2YUSA 1ETVA 5C3EJ 1B8IB 2M2EA 2DMNA 2IBDA 1ZR4A 1JT6A 1H88C 2E2JJ 3RD3A 4JX6A 3FRQA 3LSGA 5EG0B 2L7FP 3BTJA 3O8GA 4MXMA 2H8RA 4X6AJ 1U9NA 4GFLA 2CJJA 3LSPA 3COLA 4CGRA 2G7LA 5EDNA 2CUFA 4V2FA 2Y9ZA 4MLOA 3ZQFA 4A93J 3HOYJ 4X1EA 1GV2A 1HLVA 4UUTA 2VPRA 1LFUP 4FCYA 2N8GA 3A01B 3JRGA 1XS9A 3IH3A 1SANA 2ME6A 5EF6A 5EGOA 3HEFA 2LKXA 2P81A 2IU5A 2CQXA 3FK7A 3QQAA 3V6GA 5H9TA 3BTIA 2HQ5A 2M0CA 1MH4A 2NVQJ 2AHQA 2LVSA 2EZIA 1JJ6C 3HTAA 1FIPA 2QTQA 3AQTA 5K7HA 2EBIA 2O9LA 2EQRA 3E7QA 3RQIA 4G12A 2I10A 1YRNB 2WB1N 2XPVA 1MNMC 4NELA 1PUFB 3JRCA 4GCLA 2COBA 1X2NA 3S1MJ 5K7FA 2IEKA 3PO3J 2V57A 2B63J 4XRSA 2G7SA 1IRZA 1GT0C 2ID6A 2LLKA 5E3MA 1U9OA 3LNQA 4UUSA 3JRIA 3S16J 1H8AC 2K9SA 2UXOA 2L0KA 5EZHA 1VNDA 3VP5A 2QOPA 1AKHA 3LJLA 1O4XA 4QIWN 3T6NA 1GUUA 1FJLA 1TWHJ 4FISA 1U8BA 3NXCA 1MH3A 5C4JJ 5M3FJ 1YRNA 2RHAA 3E7LA 1MBFA 1ZGWA 2EZKA 3KNWA 3G1LA 1FEXA 3F1BA 5F04A 1WH5A 4D5FA 2DA2A 2IAIA 3S1NJ 3NAUA 4B1RA 3JRBA 4A3CJ 5IYCJ 1E3OC 3OOUA 3NI7A 1IDYA 5F27A 2EH3A 3BT9A 3GTGJ 1OCTC 4ME9A 1OFCX 2ECCA 2PBXA 3JRHA 4A3LJ 3K7AJ 1IG7A 4A69C 2UXPA 2DA3A 1W0TA 2VKVA 1XC5A 1TWGJ 4NN1A 4XK4A 3NRGA 2HYTA 3HOZJ 1FIAA 2MW8A 3BR2A 3VVZA 3EUPA 1GDTA 3PM1A 3VOKA 4Y52J 2K40A 3DEWA 3BQYA 4IHXA 2R7ZJ 2GLOA 2HYJA 4DYQA 4A3IJ 1JT0A 4JL3A 3HGYA 5F1JA 2VUMJ 2PMZN 4BKXA 1ETXA 2VI6A 3PO2J 3P9TA 4M6VA 1P7JA 1RKWA 1FTZA 5J1RA 5DS9A 2OI8A 9ANTA 2XGDA 1IGNA 3JRAA 2UXIA 2R92J 1BW5A 1VF9A 2FD5A 3Q0VA 2L7MP 2M9HA 3BQZA 3JRFA 2UXHA 4KWAA 1JUMA 5IOYA 2DA1A 2ID3A 4J19A 5D18A 3JREA 1BJZA 4Y7NJ 4QSHA 2CUEA 2MG4A 4D5CA 1I3QJ 1X2MA 2E19A 3D1NI 4M3GA 1QPIA 3S17J 4EEFG 3SJMA 2DG8A 1DU0A 1RR7A 2FX0A 3RH2A 3LSJA 3TW7A 5FKKA 2O7OA 3C2BA 3TP0A 4ICHA 4CYCA 3ON2A 5J3LA 5IYBJ 2K9NA 4GCTA 2LFBA 3BG5A 2XPWA 5EEAA 2Q24A 4NDLA 1JKQC 2XRLA 3S1RJ 2GBYA 2QCOA 3O8HA 1SFOJ 1HOMA 2GUHA 3VVYA 4S0HB 5E3OA 3G1MA 4AC0A 3W6VA 4D7MA 1HCRA 1MBKA 1IUFA 2G0EA 5F0FA 3SDGA 2R0QC 3RKQA 1BA5A 1S7EA 4JNNA 4C3IJ 3QPLA 3I4MJ 2LD5A 4UUSB 2W53A 1WCMJ 3HDDA 5HODA 3OSFA 1IC8A 3ZQHA 5EGOB 3SFIA 1WH7A 4AC6A 2FQ4A 2NS7A 3S1QJ 3HTJA 2F07A 1RESA 2QIBA 3GTPJ 2JN6A 3NARA 2PZ9A 3GTQJ 3TW6A 2DN0A 4L62A 3HE0A 3JSJA 5GPAA 2Y0SN 1B72A 1K61A 1RKTA 1TWFJ 4BY7J 1G2HA 1NK3P 2YVHA 2XGCA 2GFNA 1LFBA 3VOXA 5F0CA 3IV5A 4MK6A 1OJLA 3BR0A 4DW6A 4QTRA 2KDZA 3HOUJ 3H0GJ 3CRJA 4BXXJ 4MFDA 2FJ1A 3HM5A 2K9QA 2Y2ZA 2HOAA 3ZQGA 2R5ZB 4IEJA 1ZKGA 3L1PA 1CQTA 2HOSA 3FK6A 2W48A 3JR9A 1ZQ3P 4PXIA 3WHBA 2H1KA 2WGBA 3CCYA 3VW1A 2LK2A 3GTKJ 1B72B 2JWTA 4MO7A 3FIWA 1TWAJ 2XB5A 3BG9A 1AHDP 1AKHB 5GP9A 3CWRA 2DA7A 2ZB9A 5M5XJ 3Q0UA 1GV5A 5FKOA 4JYKA 2GM4A 2NOGA 1POGA 1UG2A 3OIOA 5J1UA 1UHSA 4IHWA 3IUVA 3HOXJ 3NNRA 5BNGA 4A3BJ 3PASA 2CRGA 5IP9J 1DU6A 5FJ8J 2CQQA 1HF0A 4ABZA 4A3JJ 5JLWA 1U78A 3M3YJ 4M3BA 2ECBA 4GFKA 5K7ZA 5J1YA 2X9DA 3QBMA 2HI3A 1ZK8A 2ZCXA 1WI3A 3QPSA 4MFEA 4JKZA 5AQCA 3FKIJ 2WUIA 4AF5A 1JKRC 3QKXA 4DYRA 3CDLA 3IH2A 1JJ8C 1ETKA 4GFBA 3I4NJ 4FE4A 1ENHA 5JLXA 4IHYA 2NP3A 2E2HJ 2YS9A 4CYCB 5FKLA 1UI5A 3ZQIA 4XRSG 2DMUA 4AUXA 2MGQA 2E1OA 4ACIA 5M3MJ 1SGMA 2EZHA 1T33A 2UXUA 1X58A 3S2HJ 5FMPA 1IJWC 2RAEA 2WV1A 5E3NA 2YU9J 1ETQA 5C4XJ 1A5JA 1QVUA 1IDZA 3GZIA 3ON4A 4RDUA 3KZ9A 4A3FJ 3BR3A 4HNVA 3ZOBA 3HGGA 5IYDJ 3BCGA 1MSFC 2OPTA 2JK3A 4JX5A 1JTYA 2L7ZA 5IP6A 2XPUA 3A02A 2G3BA 2XSDC 5CXIA 5DTDA 1Y1VJ 5FKNA 3G56A 5CXGA 5FGLA 2O7TA 2FBQA 4A3KJ 2HKUA 3VIBA 3MKLA 2AO9A 3B6AA 3BTLA 2JA8J 3G1OA 2DTZA 4UDSA 3A03A 5IPAA 3NPIA 2JA5J 1JUPA 1Z0XA 3F0CA 1ZTRA 3DCFA 5FHPA 4AYBN 3JRDA 1ETWA 1RPWA 4A3GJ 1ITYA 2KT0A 1VFCA 1HDDC 1LE8A 3BR5A 5FKMA 2DMPA 1NK2P 2JA7J 3PPBA 5F08A 3GTMJ 1B8IA 3HB9A 4W97A 2JMWA 1F43A 3UKGA 4B3AA 1W0UA 1NTCA 3LWJA 2TRTA 5EG0A 2DA5A 1JKPC 2NVXJ 2XB0X 3GTJJ 3DPJA 2NP5A 5CW8A 3GBGA 3ANGA 3HOVJ 3FISA 3ANPA 1EF4A 5C4YA 3HKZN 1FTTA 3B81A 3K2AA 1Y1WJ 1F36A 4JX4A 1RETA 3BG3A 3Q0WA 4GCKA 2LP0A 2DMTA 2DA4A 3HIMA 2QF7A 1UMQA 1MBGA 3BR6A 2R5YB 2WAQN 3C07A 3BNIA 3A01A 1MBHA 5HSZA 3ZQCA 4I76A 3CJDA 3S2DJ 5EZGA 3CQZJ 1I50J 2DMQA 1ETYA 2VKEA 1MSEC 1WPKA 2R5ZA 3ZQLA 4MIMA 2Y9YA 3BHQA 1APLC 5M5YJ 3MNLA 3GTLJ 2LTPA 5IOZA 2HXOA 2HOTA 3V78A 2HDDA 3VW0A 2ZCMA 1Q1VA 3GTOJ 4A3MJ 3HTIA 1JGGA 2JJ7A 4D7NA 3TP3A 5E3LA 3IH4A 4C2MJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AU7 A;  4BBS J;  1GVD A;  2NX4 A;  3KKD A;  2LR8 A;  1WGX A;  1ZR2 A;  4DZP A;  1HDP A;  2EZL A;  2Y30 A;  4A3E J;  5K58 A;  3LOC A;  1BL0 A;  5EFY A;  3KKC A;  1H89 C;  3EGQ A;  2ME0 A;  5D1R A;  5D19 A;  5C44 J;  1D5Y A;  3OSG A;  1MBJ A;  3G7R A;  5DAJ A;  4M3E A;  5HBU A;  2REK A;  4LOC A;  1OCP A;  1K83 J;  3BRU A;  4M3F A;  5FLV A;  2XGE A;  2L9R A;  4L5E A;  2NVT J;  1UI6 A;  3S5R A;  4DYC A;  1TWC J;  4B4C A;  3HOW J;  1XG1 A;  1VI0 A;  3VPR A;  4BBR J;  5FLM J;  2QKO A;  3M4O J;  2ZCN A;  4FE7 A;  2RAS A;  2XDN A;  3Q3S A;  3MN2 A;  1MBE A;  4C3J J;  1PUF A;  1R9T J;  3BJB A;  1P7I A;  1ORK A;  2OF7 A;  3VW2 A;  1TC3 C;  4A3D J;  2ZOZ A;  2M34 A;  2NS8 A;  2R5Y A;  4M3D A;  2X6O A;  3BTC A;  1A6I A;  1JUS A;  2E2I J;  3LHQ A;  4C3H J;  2YVE A;  4RBO A;  3GEU A;  5F0H A;  3WHC A;  5GPC A;  4V2G A;  2DJN A;  2NVY J;  5HAW A;  2DG7 A;  2G7G A;  2HXI A;  3HBL A;  3MVP A;  3CMY A;  4I6Z A;  1I6H J;  2JA6 J;  2CU7 A;  1Z77 A;  3VVX A;  3O60 A;  3BR1 A;  3S15 J;  1IV6 A;  3LSR A;  1BW6 A;  1T56 A;  5IP7 J;  2D6Y A;  4BY1 J;  4XRM A;  3B6C A;  1JKO C;  2ZOY A;  3TED A;  3H3V K;  4DZJ A;  3AQS A;  2Y31 A;  2X48 A;  5M5W J;  4XIC A;  2R93 J;  2M8G X;  2ELK A;  2DA6 A;  3S14 J;  3VUQ A;  2D5V A;  1ETO A;  4YZE A;  4FTH A;  4W1U A;  2QWT A;  4HKU A;  1QRY A;  3RZD J;  3HTH A;  2LY9 A;  2MSY A;  1JTX A;  4XID A;  1LE8 B;  4JP0 A;  5EYR A;  1QVT A;  2OER A;  2O8K A;  4IHV A;  3RZO J;  2TCT A;  2GEN A;  2YUS A;  1ETV A;  5C3E J;  1B8I B;  2M2E A;  2DMN A;  2IBD A;  1ZR4 A;  1JT6 A;  1H88 C;  2E2J J;  3RD3 A;  4JX6 A;  3FRQ A;  3LSG A;  5EG0 B;  2L7F P;  3BTJ A;  3O8G A;  4MXM A;  2H8R A;  4X6A J;  1U9N A;  4GFL A;  2CJJ A;  3LSP A;  3COL A;  4CGR A;  2G7L A;  5EDN A;  2CUF A;  4V2F A;  2Y9Z A;  4MLO A;  3ZQF A;  4A93 J;  3HOY J;  4X1E A;  1GV2 A;  1HLV A;  4UUT A;  2VPR A;  1LFU P;  4FCY A;  2N8G A;  3A01 B;  3JRG A;  1XS9 A;  3IH3 A;  1SAN A;  2ME6 A;  5EF6 A;  5EGO A;  3HEF A;  2LKX A;  2P81 A;  2IU5 A;  2CQX A;  3FK7 A;  3QQA A;  3V6G A;  5H9T A;  3BTI A;  2HQ5 A;  2M0C A;  1MH4 A;  2NVQ J;  2AHQ A;  2LVS A;  2EZI A;  1JJ6 C;  3HTA A;  1FIP A;  2QTQ A;  3AQT A;  5K7H A;  2EBI A;  2O9L A;  2EQR A;  3E7Q A;  3RQI A;  4G12 A;  2I10 A;  1YRN B;  2WB1 N;  2XPV A;  1MNM C;  4NEL A;  1PUF B;  3JRC A;  4GCL A;  2COB A;  1X2N A;  3S1M J;  5K7F A;  2IEK A;  3PO3 J;  2V57 A;  2B63 J;  4XRS A;  2G7S A;  1IRZ A;  1GT0 C;  2ID6 A;  2LLK A;  5E3M A;  1U9O A;  3LNQ A;  4UUS A;  3JRI A;  3S16 J;  1H8A C;  2K9S A;  2UXO A;  2L0K A;  5EZH A;  1VND A;  3VP5 A;  2QOP A;  1AKH A;  3LJL A;  1O4X A;  4QIW N;  3T6N A;  1GUU A;  1FJL A;  1TWH J;  4FIS A;  1U8B A;  3NXC A;  1MH3 A;  5C4J J;  5M3F J;  1YRN A;  2RHA A;  3E7L A;  1MBF A;  1ZGW A;  2EZK A;  3KNW A;  3G1L A;  1FEX A;  3F1B A;  5F04 A;  1WH5 A;  4D5F A;  2DA2 A;  2IAI A;  3S1N J;  3NAU A;  4B1R A;  3JRB A;  4A3C J;  5IYC J;  1E3O C;  3OOU A;  3NI7 A;  1IDY A;  5F27 A;  2EH3 A;  3BT9 A;  3GTG J;  1OCT C;  4ME9 A;  1OFC X;  2ECC A;  2PBX A;  3JRH A;  4A3L J;  3K7A J;  1IG7 A;  4A69 C;  2UXP A;  2DA3 A;  1W0T A;  2VKV A;  1XC5 A;  1TWG J;  4NN1 A;  4XK4 A;  3NRG A;  2HYT A;  3HOZ J;  1FIA A;  2MW8 A;  3BR2 A;  3VVZ A;  3EUP A;  1GDT A;  3PM1 A;  3VOK A;  4Y52 J;  2K40 A;  3DEW A;  3BQY A;  4IHX A;  2R7Z J;  2GLO A;  2HYJ A;  4DYQ A;  4A3I J;  1JT0 A;  4JL3 A;  3HGY A;  5F1J A;  2VUM J;  2PMZ N;  4BKX A;  1ETX A;  2VI6 A;  3PO2 J;  3P9T A;  4M6V A;  1P7J A;  1RKW A;  1FTZ A;  5J1R A;  5DS9 A;  2OI8 A;  9ANT A;  2XGD A;  1IGN A;  3JRA A;  2UXI A;  2R92 J;  1BW5 A;  1VF9 A;  2FD5 A;  3Q0V A;  2L7M P;  2M9H A;  3BQZ A;  3JRF A;  2UXH A;  4KWA A;  1JUM A;  5IOY A;  2DA1 A;  2ID3 A;  4J19 A;  5D18 A;  3JRE A;  1BJZ A;  4Y7N J;  4QSH A;  2CUE A;  2MG4 A;  4D5C A;  1I3Q J;  1X2M A;  2E19 A;  3D1N I;  4M3G A;  1QPI A;  3S17 J;  4EEF G;  3SJM A;  2DG8 A;  1DU0 A;  1RR7 A;  2FX0 A;  3RH2 A;  3LSJ A;  3TW7 A;  5FKK A;  2O7O A;  3C2B A;  3TP0 A;  4ICH A;  4CYC A;  3ON2 A;  5J3L A;  5IYB J;  2K9N A;  4GCT A;  2LFB A;  3BG5 A;  2XPW A;  5EEA A;  2Q24 A;  4NDL A;  1JKQ C;  2XRL A;  3S1R J;  2GBY A;  2QCO A;  3O8H A;  1SFO J;  1HOM A;  2GUH A;  3VVY A;  4S0H B;  5E3O A;  3G1M A;  4AC0 A;  3W6V A;  4D7M A;  1HCR A;  1MBK A;  1IUF A;  2G0E A;  5F0F A;  3SDG A;  2R0Q C;  3RKQ A;  1BA5 A;  1S7E A;  4JNN A;  4C3I J;  3QPL A;  3I4M J;  2LD5 A;  4UUS B;  2W53 A;  1WCM J;  3HDD A;  5HOD A;  3OSF A;  1IC8 A;  3ZQH A;  5EGO B;  3SFI A;  1WH7 A;  4AC6 A;  2FQ4 A;  2NS7 A;  3S1Q J;  3HTJ A;  2F07 A;  1RES A;  2QIB A;  3GTP J;  2JN6 A;  3NAR A;  2PZ9 A;  3GTQ J;  3TW6 A;  2DN0 A;  4L62 A;  3HE0 A;  3JSJ A;  5GPA A;  2Y0S N;  1B72 A;  1K61 A;  1RKT A;  1TWF J;  4BY7 J;  1G2H A;  1NK3 P;  2YVH A;  2XGC A;  2GFN A;  1LFB A;  3VOX A;  5F0C A;  3IV5 A;  4MK6 A;  1OJL A;  3BR0 A;  4DW6 A;  4QTR A;  2KDZ A;  3HOU J;  3H0G J;  3CRJ A;  4BXX J;  4MFD A;  2FJ1 A;  3HM5 A;  2K9Q A;  2Y2Z A;  2HOA A;  3ZQG A;  2R5Z B;  4IEJ A;  1ZKG A;  3L1P A;  1CQT A;  2HOS A;  3FK6 A;  2W48 A;  3JR9 A;  1ZQ3 P;  4PXI A;  3WHB A;  2H1K A;  2WGB A;  3CCY A;  3VW1 A;  2LK2 A;  3GTK J;  1B72 B;  2JWT A;  4MO7 A;  3FIW A;  1TWA J;  2XB5 A;  3BG9 A;  1AHD P;  1AKH B;  5GP9 A;  3CWR A;  2DA7 A;  2ZB9 A;  5M5X J;  3Q0U A;  1GV5 A;  5FKO A;  4JYK A;  2GM4 A;  2NOG A;  1POG A;  1UG2 A;  3OIO A;  5J1U A;  1UHS A;  4IHW A;  3IUV A;  3HOX J;  3NNR A;  5BNG A;  4A3B J;  3PAS A;  2CRG A;  5IP9 J;  1DU6 A;  5FJ8 J;  2CQQ A;  1HF0 A;  4ABZ A;  4A3J J;  5JLW A;  1U78 A;  3M3Y J;  4M3B A;  2ECB A;  4GFK A;  5K7Z A;  5J1Y A;  2X9D A;  3QBM A;  2HI3 A;  1ZK8 A;  2ZCX A;  1WI3 A;  3QPS A;  4MFE A;  4JKZ A;  5AQC A;  3FKI J;  2WUI A;  4AF5 A;  1JKR C;  3QKX A;  4DYR A;  3CDL A;  3IH2 A;  1JJ8 C;  1ETK A;  4GFB A;  3I4N J;  4FE4 A;  1ENH A;  5JLX A;  4IHY A;  2NP3 A;  2E2H J;  2YS9 A;  4CYC B;  5FKL A;  1UI5 A;  3ZQI A;  4XRS G;  2DMU A;  4AUX A;  2MGQ A;  2E1O A;  4ACI A;  5M3M J;  1SGM A;  2EZH A;  1T33 A;  2UXU A;  1X58 A;  3S2H J;  5FMP A;  1IJW C;  2RAE A;  2WV1 A;  5E3N A;  2YU9 J;  1ETQ A;  5C4X J;  1A5J A;  1QVU A;  1IDZ A;  3GZI A;  3ON4 A;  4RDU A;  3KZ9 A;  4A3F J;  3BR3 A;  4HNV A;  3ZOB A;  3HGG A;  5IYD J;  3BCG A;  1MSF C;  2OPT A;  2JK3 A;  4JX5 A;  1JTY A;  2L7Z A;  5IP6 A;  2XPU A;  3A02 A;  2G3B A;  2XSD C;  5CXI A;  5DTD A;  1Y1V J;  5FKN A;  3G56 A;  5CXG A;  5FGL A;  2O7T A;  2FBQ A;  4A3K J;  2HKU A;  3VIB A;  3MKL A;  2AO9 A;  3B6A A;  3BTL A;  2JA8 J;  3G1O A;  2DTZ A;  4UDS A;  3A03 A;  5IPA A;  3NPI A;  2JA5 J;  1JUP A;  1Z0X A;  3F0C A;  1ZTR A;  3DCF A;  5FHP A;  4AYB N;  3JRD A;  1ETW A;  1RPW A;  4A3G J;  1ITY A;  2KT0 A;  1VFC A;  1HDD C;  1LE8 A;  3BR5 A;  5FKM A;  2DMP A;  1NK2 P;  2JA7 J;  3PPB A;  5F08 A;  3GTM J;  1B8I A;  3HB9 A;  4W97 A;  2JMW A;  1F43 A;  3UKG A;  4B3A A;  1W0U A;  1NTC A;  3LWJ A;  2TRT A;  5EG0 A;  2DA5 A;  1JKP C;  2NVX J;  2XB0 X;  3GTJ J;  3DPJ A;  2NP5 A;  5CW8 A;  3GBG A;  3ANG A;  3HOV J;  3FIS A;  3ANP A;  1EF4 A;  5C4Y A;  3HKZ N;  1FTT A;  3B81 A;  3K2A A;  1Y1W J;  1F36 A;  4JX4 A;  1RET A;  3BG3 A;  3Q0W A;  4GCK A;  2LP0 A;  2DMT A;  2DA4 A;  3HIM A;  2QF7 A;  1UMQ A;  1MBG A;  3BR6 A;  2R5Y B;  2WAQ N;  3C07 A;  3BNI A;  3A01 A;  1MBH A;  5HSZ A;  3ZQC A;  4I76 A;  3CJD A;  3S2D J;  5EZG A;  3CQZ J;  1I50 J;  2DMQ A;  1ETY A;  2VKE A;  1MSE C;  1WPK A;  2R5Z A;  3ZQL A;  4MIM A;  2Y9Y A;  3BHQ A;  1APL C;  5M5Y J;  3MNL A;  3GTL J;  2LTP A;  5IOZ A;  2HXO A;  2HOT A;  3V78 A;  2HDD A;  3VW0 A;  2ZCM A;  1Q1V A;  3GTO J;  4A3M J;  3HTI A;  1JGG A;  2JJ7 A;  4D7N A;  3TP3 A;  5E3L A;  3IH4 A;  4C2M J; 
#chains in the Genus database with same CATH topology
 5J6X A;  2BZT A;  4BBS J;  4UXN A;  1GVD A;  2ZXJ A;  2NX4 A;  2LR8 A;  3IL2 A;  1WGX A;  3QAH A;  3WTX C;  1ZR2 A;  4ZTJ A;  4L0Z B;  3FXO A;  3KYC B;  2Y30 A;  1ZRE A;  3AKZ A;  4FX0 A;  3K4M A;  3LOC A;  5EFY A;  3EGQ A;  2Y48 A;  4XSZ F;  2D1H A;  5DDG A;  1FMW A;  4KDP A;  3G7R A;  5HBU A;  2Z2S B;  1OCP A;  1A04 A;  3MZY A;  1IW7 F;  2P6S A;  2P8T A;  2XGE A;  2W84 A;  4WX9 A;  2DPU A;  3CCR I;  1PJR A;  2VBX A;  4DBR A;  3KZI C;  4DYC A;  4WXH A;  5DUK A;  4XLF A;  4B4C A;  3HOW J;  3DPT A;  4LFU A;  4MHG A;  2CUJ A;  5FLM J;  1SMT A;  4PJM A;  1HST A;  4YFK F;  1B4A A;  3HTU A;  2RAS A;  3MN2 A;  4DJA A;  1R9T J;  3EYY A;  2NVU B;  2OF7 A;  2ZOZ A;  2M34 A;  1XGM A;  3VOE A;  4ZZD A;  3PJR A;  2NS0 A;  1A6I A;  1EV7 A;  1HXD A;  1JUS A;  2E2I J;  2YVE A;  3K4J A;  5ICC A;  2R7V A;  2UXN A;  5DCM B;  2ZJR F;  5GPC A;  3I56 I;  1V5F A;  4V2G A;  2QBY A;  2NVY J;  1D8K A;  3A0H C;  2G7G A;  3CMY A;  4I6Z A;  2A69 F;  5JVT A;  2CU7 A;  4PZJ A;  2GOM A;  3VVX A;  3O60 A;  2DOA A;  5ICG A;  1G4D A;  5TIS C;  2HNH A;  3BLY A;  4XRM A;  3KP7 A;  2K02 A;  3B6C A;  2ZOY A;  3FMR A;  3RSN A;  1I1G A;  4ITV A;  3C2G A;  2Y31 A;  5M5W J;  5ERI A;  5D8K B;  1X1A A;  2PFB A;  5HDK A;  1T95 A;  5K1Y A;  4YZE A;  3CO6 C;  1QZY A;  3ABK H;  4ZDO A;  2MSY A;  4KN4 X;  4AIH A;  1XDU A;  1PUE E;  1WHU A;  4RM3 A;  2OER A;  2O8K A;  1VQ5 I;  2EJR A;  2E1C A;  1WVR A;  1A6Q A;  4XLC A;  2R4G A;  4XOR A;  1TNS A;  2GEN A;  1S8N A;  4UB8 C;  4CHU A;  4RGX A;  3DKW A;  1HKQ A;  1X1D A;  3A4C A;  4UVC A;  3BPX A;  1FPQ A;  1WJB A;  3DEE A;  2L7F P;  3M1E A;  3SYT A;  1YIT I;  4HF2 A;  3KYD B;  2L3D A;  3IWZ A;  1Z05 A;  4WK8 F;  3TL4 X;  2CJJ A;  4KIT B;  3LSP A;  1XTA A;  3K4C A;  4NC8 A;  3COL A;  4CGR A;  3DQV C;  3QOP A;  4V2F A;  3HOS A;  4BE2 A;  4MLO A;  3ZQF A;  4KMF A;  2EFN A;  5D5W B;  3OYD A;  3E0J B;  1K7A A;  1IN6 A;  2GAU A;  2UWM A;  2VIX A;  2F6C A;  4I99 C;  1R58 A;  2M45 A;  3JRG A;  1XS9 A;  2H6C A;  3JSP A;  3PIO F;  5EGO A;  1JGS A;  2ICW G;  2ZNZ A;  2OZU A;  5J47 A;  3KP2 A;  4M71 A;  2CQX A;  4PJ0 C;  4BQA A;  5H9T A;  1XCB A;  2AHQ A;  1YOV B;  1FX7 A;  1YQA A;  3BZ6 A;  3SZG A;  1VQO I;  4IRI A;  1ZGJ A;  3HPG A;  1D1B A;  4OU0 A;  3QPT A;  3R61 A;  1DP7 P;  4G12 A;  2GXA A;  2O3F A;  1Z6T A;  1R7J A;  4UVB A;  1YRN B;  2LKS A;  1MZB A;  2WAD A;  1E3P A;  2KPM A;  2VC0 A;  3S1M J;  2IS4 A;  3RKX A;  2L9V A;  2HZD A;  2V57 A;  1E17 A;  1VQK I;  3P9C A;  3QOE A;  1IRZ A;  1LVK A;  2ID6 A;  5ICF A;  2LLK A;  5L3B A;  2DQR A;  2DJI A;  3S16 J;  2EB7 A;  2K9S A;  2L9N A;  2CW8 A;  2L0K A;  1YS7 A;  2QSF X;  2HVR A;  1DQU A;  3W6K B;  1R00 A;  1R6R A;  3CMA I;  1FJL A;  3L2C A;  1X1C A;  4FIS A;  1IO2 A;  1U8B A;  1EKE A;  5M3F J;  5DD4 A;  3K0L A;  3GUD A;  4AIK A;  4MNU A;  2XC7 A;  3CUQ C;  3E7L A;  1R71 A;  3BOQ A;  4I98 B;  3QPH A;  3IRQ A;  5F04 A;  4KA4 A;  2DA2 A;  2IAI A;  3TGN A;  3ZQ7 A;  1DPU A;  2DOD A;  3CCS I;  2GIZ A;  4KIB A;  2RNJ A;  4EGY A;  3JSO A;  3GTG J;  1R1T A;  4RGR A;  2JUG A;  2VBW A;  4RB2 C;  2UXP A;  3C3W A;  3KZZ A;  2VKV A;  3HSF A;  4XK4 A;  1TQI A;  5DEQ A;  3NRG A;  3HOZ J;  2VJI A;  2MW8 A;  1OQY A;  3VVZ A;  3EUP A;  1IXS B;  4CA0 A;  4AIJ A;  2O8X A;  2V4J C;  1QBJ A;  1YS6 A;  2DYS H;  2O03 A;  4HA8 A;  1N77 A;  4Y52 J;  2GA1 A;  4Q48 A;  4IHX A;  1UFM A;  1Y0N A;  1F4K A;  4HV5 A;  4A5N A;  4A3I J;  4JL3 A;  3ZN1 A;  2NXN B;  4ENJ A;  2VUM J;  3DTI A;  3SZP A;  4BKX A;  1FSH A;  2O5R A;  3CES A;  3OR1 C;  4I7H A;  3G6E I;  1FYM A;  3IAM 2;  2NNY A;  2R3S A;  2UXI A;  4OOI A;  3Q0V A;  5JVG F;  5F6F A;  1X19 A;  3BQZ A;  3GZN B;  4CIC A;  4KWA A;  2D1V A;  1JUM A;  5IOY A;  1BC8 C;  1XDS A;  2QVO A;  1IF1 A;  1BJZ A;  4Y7N J;  2CUE A;  4XKB A;  3D1N I;  3LSI A;  5LGU A;  2P7V B;  4IRG A;  4YRV A;  3PQJ A;  5LFA A;  1DU0 A;  2OTL I;  2DG8 A;  4U9N A;  1U6G A;  1E2X A;  5CPR B;  3K1M A;  3RH2 A;  3LSJ A;  5H20 A;  3FXJ A;  3WU1 B;  2KL4 A;  3HRU A;  1VQL I;  2F4O B;  4A2U A;  5IYB J;  3GFJ A;  1YX3 A;  1VTN C;  4E7L A;  3BG5 A;  2XPW A;  3I53 A;  3M8F A;  4NDL A;  4PDK A;  4BNC A;  4BAY A;  3MQ0 A;  2IA1 A;  2GBY A;  3MKZ A;  2QCO A;  3O8H A;  4LLG F;  1SFO J;  3VVY A;  4M9X A;  2HDC A;  5LHG A;  1WJA A;  4D7M A;  1BA5 A;  3MCZ A;  4JNN A;  4C3I J;  2GIV A;  3QPL A;  3TOB A;  4UUS B;  1WCM J;  1OPC A;  5HOD A;  3OSF A;  4BXF A;  1LNW A;  2FOW A;  3SFI A;  4UB6 C;  2VLA A;  1I3A A;  3K1P A;  2FQ4 A;  1GXP A;  2LF8 A;  4G6D A;  3NAR A;  3AG1 H;  1XB4 A;  4X0G A;  3HE0 A;  4L62 A;  1WKM A;  3AAF A;  1O3S A;  2KZV A;  1G2H A;  1NK3 P;  2VT2 A;  4R79 A;  2OQR A;  3VOX A;  2DAO A;  5F0C A;  4MK6 A;  5FLX K;  1MW7 A;  2FU4 A;  2QUF A;  4YEJ A;  4BQQ A;  3CRJ A;  2IGO A;  3FXU A;  3SQN A;  4CCO A;  4CXF A;  4MFD A;  3V8J A;  2G9W A;  4IEJ A;  4H0E A;  4Q5S F;  5JHU A;  3OYJ A;  1D0Z A;  2OD5 A;  2HOS A;  1BC7 C;  1CF7 B;  4C2M A;  3FK6 A;  1KA8 A;  2K5C A;  1ZQ3 P;  2WY8 Q;  3VB2 A;  1BIA A;  1XD7 A;  2I8D A;  2RV8 A;  1R36 A;  3GTK J;  4XSX F;  1QA6 A;  5BQT A;  4BHB A;  1TWA J;  3TDU C;  5E1X A;  5GP9 A;  3GVA A;  3WTY C;  4BEH B;  1ODD A;  2DO7 A;  2VL8 A;  2NOG A;  2OCC H;  2VB6 A;  1YYV A;  1YLF A;  3OIO A;  4GYI A;  5BOX A;  4IHW A;  4LLN A;  3J7A Y;  5BNG A;  3TBI A;  2Q0O A;  4FAS D;  2IGN A;  2CQQ A;  5D6E A;  4DIQ A;  1HF0 A;  5JLW A;  5BMZ A;  2DFI A;  2PLY A;  4GFK A;  2E34 A;  4EMS A;  2JUC A;  1PP8 F;  2ZCX A;  2KP6 A;  3WTS C;  4JKZ A;  4E7Z A;  3GLX A;  1XX5 A;  2W00 A;  3CDL A;  3RI4 A;  5IY5 H;  5AIQ A;  3ROU A;  5JLX A;  4LIV A;  2DK8 A;  2NAZ A;  3QRF F;  2OV7 A;  1WJF A;  5H6Q A;  2VOD A;  5DUI A;  5FKL A;  2R7U A;  1OYW A;  3ONQ A;  2ZFU A;  3C18 A;  2MC3 A;  3CF2 A;  5JR3 A;  3GXO A;  1A35 A;  4ACI A;  2EZH A;  2M30 A;  5DM6 F;  3LAP A;  2V79 A;  2IS2 A;  1Z21 A;  2PN6 A;  3S2H J;  4PGG A;  2YU3 A;  2I5U A;  2W57 A;  4I0B A;  5E20 A;  2QA4 I;  1SFX A;  3FMQ A;  1KQ9 A;  1S6L A;  4PSW A;  3CTA A;  2PFV A;  5C4X J;  4NC6 A;  1ZRF A;  1A5J A;  3CLO A;  1QVU A;  2R7R A;  1YX5 A;  3KFW X;  3DBR B;  3EUH A;  3L7W A;  3EUH C;  2OC6 A;  3CC7 I;  1K78 B;  2LRD A;  4HX4 A;  3HHH A;  3FZV A;  1MSF C;  4QPQ A;  4JX5 A;  2H8W A;  2IJL A;  2L7Z A;  2E5N A;  2AS5 F;  4WXC A;  3A02 A;  1WQ2 A;  2K7L A;  5CXI A;  5BPI A;  4HF0 A;  5CXG A;  1BN5 A;  5DCF A;  3SEZ A;  2M3A A;  2R7W A;  2GXG A;  1OYI A;  2HKU A;  3F21 A;  3BTL A;  3B6A A;  3HSE A;  1SD5 A;  1G59 A;  2JA8 J;  4UDS A;  1YTY A;  4RB1 A;  3FHZ A;  4E7H A;  3DCF A;  5AIP A;  2JSP A;  4AYB N;  4M9S A;  2FNP A;  2BW3 A;  4G6Q A;  1IAW A;  1ZYR F;  3O3K A;  2DMP A;  2JSC A;  3ZMS A;  3H9Q A;  3OS0 A;  3SZT A;  3GZ5 A;  3GTM J;  5ILS A;  2GZW A;  2JMW A;  1F43 A;  4HZF A;  3UKG A;  2LRE A;  1W0U A;  2OZ6 A;  2TRT A;  3OIP A;  2Z5U A;  5GAE J;  3GTJ J;  4IX7 A;  1FY7 A;  3LMM A;  2RRE A;  2EV5 A;  3JW4 A;  4ZJZ A;  1G3W A;  3OYN A;  5L3G A;  3OYE A;  1MNE A;  5CQE A;  3CCJ I;  5IT3 A;  2Z9O A;  3D5R C;  3B81 A;  3MZH A;  1Y1W J;  3AG3 H;  3BG3 A;  3RYP A;  1V5G A;  3J7Z I;  2LH9 A;  1BI0 A;  2JPC A;  3F6V A;  3BR6 A;  1FBU A;  2V6C A;  2WAQ N;  4HW0 A;  1G8X A;  4HX8 A;  2X6W A;  2RKH A;  2ZNY A;  3OYK A;  4LB5 A;  1UHM A;  1TW3 A;  2A07 F;  3CJD A;  3S2D J;  3CQZ J;  1I50 J;  2VKE A;  2FBH A;  2M7A A;  2E60 A;  3K4N A;  2A5Y B;  1LB2 A;  2LTP A;  2BOL A;  1ZH5 A;  2HXO A;  1TLH B;  4M9Z A;  1UAA A;  1S5L C;  1D3Y A;  2MC4 A;  2EWN A;  5HOO A;  4D7N A;  3PFI A;  5E3L A;  2TDX A;  2E1M B;  2O6G E;  2DT7 B;  1AU7 A;  5E8G A;  4I2O A;  2P5K A;  2PX9 A;  2DFE A;  3H9J A;  3S8P A;  4ENM A;  4CZZ A;  5K58 A;  2YX4 A;  4D9J A;  2LSO A;  3A1Y A;  2DBB A;  4IZZ A;  2FML A;  1X3Z B;  1D5Y A;  2HVQ A;  3DU6 A;  1MBJ A;  5E17 F;  1U8R A;  3J7Y J;  2REK A;  4LOC A;  1K83 J;  5B3S H;  4HAM A;  4LB6 B;  3MWM A;  1XMA A;  5FLV A;  2Y69 H;  3DBL B;  2KJC A;  4II3 A;  4L5E A;  3FM3 A;  3F23 A;  4YEL A;  4HST A;  1TWC J;  1T0F C;  2K4J A;  2PMH A;  2ZCN A;  4FE7 A;  4U87 A;  4NQW A;  3FWE A;  4C3J J;  1R5H A;  1P7I A;  3H1C A;  3KPH A;  3VDX A;  3VW2 A;  3PFY A;  3ZMT A;  1R1V A;  1TC3 C;  3X2Q H;  2VJ4 A;  3M07 A;  2HYG D;  5JHF A;  1YE9 A;  4C3H J;  3ELK A;  3WU0 A;  4IPA A;  3GEU A;  3L2R A;  2X6X A;  4B47 A;  3K69 A;  5LD2 C;  1I6H J;  4I0A A;  3VYS B;  3DBH B;  1Z77 A;  4BL0 B;  1MGT A;  3LSR A;  1T56 A;  5FRM A;  4N4O B;  2J5O A;  1JKO C;  3IP4 B;  3TED A;  2HVS A;  4Y4R A;  3H3V K;  4DZJ A;  3ABL H;  1KYW A;  2IP2 A;  2X48 A;  1LQ1 A;  1G3S A;  2M8G X;  2COM A;  2FRH A;  3H3Z A;  2EV0 A;  1QRY A;  4HKU A;  3RZD J;  3HTH A;  1R1U A;  2LY9 A;  3KYL A;  2DU9 A;  4L9N A;  1YW7 A;  3V42 A;  1QVT A;  3J81 K;  1V5E A;  1J2X A;  1ZG5 A;  1OLT A;  3NWT A;  2ISY A;  3OWT A;  2TCT A;  5FRO A;  4EGZ A;  3M8J A;  1ETV A;  3QWL A;  1KU3 A;  2IBD A;  1JT6 A;  3OYF A;  2B0L A;  3TMO A;  2GOX B;  5CKT A;  4G6T B;  3P9I A;  2H8R A;  4X6A J;  1U9N A;  1IN5 A;  3BZC A;  4A5M A;  4GFL A;  3CUQ A;  4BJT A;  2XSJ C;  3K4B A;  5EDN A;  1ZGA A;  3KP5 A;  4XKC A;  5B66 C;  3F72 A;  4A93 J;  3WTT C;  4X1E A;  4UUT A;  2FE3 A;  3BCB A;  1SMY F;  2P5L C;  2BY3 A;  2RC4 A;  4FCY A;  2LF7 A;  2N8G A;  3OS2 A;  4K2E A;  1GLN A;  1U5T B;  4KJZ A;  3IH3 A;  1SAN A;  1VQM I;  3AL0 C;  1FP1 D;  5EF6 A;  4CYD A;  3L2Q A;  3E6C C;  5DYM A;  2P81 A;  1MMA A;  2IU5 A;  1NG6 A;  3FK7 A;  2HDW A;  3VWB A;  2RN7 A;  2ZSH B;  1MH4 A;  1UZC A;  2VKH A;  3LSH A;  5JI6 A;  1JJ6 C;  2NVQ J;  5KAI C;  2BVM A;  3ISP A;  1GXQ A;  3CUO A;  5K7H A;  1WRJ A;  3RQI A;  1LPQ A;  2V7F A;  2XVC A;  3ZGK A;  2I10 A;  3K9T A;  3RQ4 A;  2FXA A;  1ZLK A;  3RYR A;  2CSO A;  2VT3 A;  3OYL A;  2W1O A;  1BIB A;  1KU7 A;  1PUF B;  2M4G A;  4GCL A;  3FKJ A;  3I9V 2;  3FXK A;  4GYG A;  5K7F A;  5LEJ A;  3PO3 J;  2H94 A;  3PNY A;  3H0D A;  3EYI A;  4XRS A;  1GT0 C;  3NEU A;  2H6B A;  4OAY A;  5E3M A;  3RPU D;  2H27 A;  2UXO A;  5EZH A;  2RNG A;  4F52 A;  3I54 A;  1AKH A;  3PL8 A;  4HRI A;  1BI3 A;  1GUU A;  2F5C A;  2W24 A;  5KK1 A;  3CD6 I;  2IS6 A;  3OY9 A;  2VON A;  3NXC A;  2BE5 F;  5IT9 K;  1YRN A;  4BEH A;  3IWF A;  1FP2 A;  3W6J B;  4A6D A;  2BVL A;  5E18 F;  1Z9C A;  1MBF A;  1ZGW A;  2DTR A;  4HSR A;  3MFK A;  3KNW A;  3G1L A;  1FEX A;  2GXB A;  2KKO A;  3MD2 A;  5ICE A;  3VTI A;  1WH5 A;  2XV4 S;  3NAU A;  4B1R A;  2EA2 A;  5CVU A;  3WGG A;  1E3O C;  2DLL A;  2IS1 A;  3BWG A;  1OCT C;  3FXQ A;  1OFC X;  1I5Z A;  2PBX A;  5GTI C;  3ASN H;  3K7A J;  2UUZ A;  4A69 C;  2DA3 A;  2MH2 A;  2P6T A;  4L9V A;  2ZSI B;  2MAB A;  1XC5 A;  1G3T A;  2OTJ I;  1RRJ A;  3FM5 A;  4QPO A;  1SD4 A;  1FIA A;  1ONV A;  3BR2 A;  1IN8 A;  1VQ7 I;  1GDT A;  2YX7 A;  1FMV A;  3RPU A;  3BJ6 A;  4P55 A;  1FYL A;  3B02 A;  3VOK A;  3MKW B;  3CJN A;  3GFL A;  3V7S A;  4IJA A;  2HYJ A;  4C2T A;  1B59 A;  3WE3 A;  5GAH J;  2F48 A;  1SAU A;  1X1B A;  5F1J A;  1JT0 A;  2PMZ N;  2R7F A;  2KDO A;  1X4O A;  1FTZ A;  3IKV A;  4DGW B;  9ANT A;  1SVO A;  3H35 A;  1IGN A;  1G6N A;  1XSV A;  1GVJ A;  2QKM B;  1OR7 C;  1VF9 A;  2JPB A;  1HSJ A;  2L7M P;  2HKO A;  4AID A;  4AVP A;  1I27 A;  3JRE A;  4QSH A;  4NBQ A;  3U9G A;  2CV0 A;  2F4I A;  2WB1 A;  4E7I A;  3E6M A;  1QPI A;  5HDN A;  3SJM A;  4CUG A;  3G71 I;  1MIJ A;  3KP6 A;  2CYY A;  2BXY A;  2FX0 A;  4L5I A;  4ENK A;  3TW7 A;  4M73 A;  2WA0 A;  5DM7 F;  1R49 A;  4ICH A;  4XQF A;  2A6T A;  2DI3 A;  3ZP5 A;  1QPM A;  2X4H A;  2K9M A;  4HQM A;  4Z2Y A;  2Q24 A;  3LSM A;  1JKQ C;  2XRL A;  2GUH A;  1HOM A;  2MLK A;  4KN7 X;  5E3O A;  3G1M A;  2XF6 A;  3RTR A;  4O5V A;  3RKQ A;  4GRI A;  3TDZ C;  1Z3X A;  4BQO A;  2V1N A;  2FF4 A;  3HDD A;  4OD4 A;  3QU6 A;  3HHG A;  1WH7 A;  2K85 A;  5HNF A;  3S1Q J;  3OL4 A;  2LDU A;  2QGU A;  3KEQ A;  4IOC F;  5GTH C;  2VXD A;  4IL6 C;  2PZ9 A;  4MTE A;  3VEP A;  4BGD A;  5DD8 A;  3JSJ A;  4LG0 A;  1B72 A;  3D5L A;  3DLA A;  3L2U A;  4BY7 J;  2YVH A;  4MGR A;  2XGC A;  2KIF A;  5A2Q Z;  4XOP A;  4LIT A;  2GFN A;  4HYE A;  4DW6 A;  4QTR A;  2KDZ A;  4XLA A;  2DQL A;  3R60 A;  4XR6 A;  1S29 A;  2D2W A;  1Z6R A;  3TO7 A;  2R5Z B;  3LA3 A;  1RI7 A;  3BY6 A;  2CV1 A;  1L0O C;  3L1P A;  2NNN A;  3JR9 A;  2R7D A;  3WHB A;  1WJC A;  3CCU I;  4OIN F;  2H1K A;  2XRN A;  2LK2 A;  2XKP A;  3G2B A;  3PSF A;  4I02 A;  3QYE A;  2XRO A;  2XUB A;  3FIW A;  3L2W A;  2XB5 A;  1AHD P;  2XF5 A;  3V7R A;  3CWR A;  5BS6 A;  2B1E A;  2DA7 A;  2ZB9 A;  4YFN F;  4I01 A;  1X1P A;  1IZ1 A;  4ZYG A;  1W7P A;  3W2W A;  1GV5 A;  4JYK A;  4UVA A;  3T1B A;  3E1S A;  3I0T A;  1YW9 A;  2UZK A;  5J1U A;  3IUV A;  3QOD A;  3NNR A;  4A3B J;  1NG7 A;  2CRG A;  1S3J A;  5B1B H;  3BDD A;  4ABZ A;  4A3J J;  1BI2 A;  3M3Y J;  3COA C;  4U88 A;  1QU3 A;  5K7Z A;  2DW4 A;  2DOE A;  2KHM A;  1ZK8 A;  1MND A;  1FOK A;  5FD6 A;  2WUI A;  1EH7 A;  2QSG X;  4AF5 A;  1MJ9 A;  3V7C A;  4DYR A;  4HNU A;  4XN3 A;  3F3X A;  1JJ8 C;  4GFB A;  4FE4 A;  2FUG 2;  2FA5 A;  5D6F A;  1OCC H;  2BYV E;  2VQG A;  2YS9 A;  1UI5 A;  2F5F A;  3ZQI A;  5K5R A;  3IUO A;  2R7X A;  2E5Z A;  2CH0 A;  1BR2 A;  2MGQ A;  2E1O A;  1VQP I;  5M3M J;  2L2O A;  5CVR A;  5HS8 A;  4CCJ A;  3OS1 A;  3NRV A;  3H3U A;  5FMP A;  1R23 A;  1HW1 A;  3I3L A;  4YIR X;  2WV1 A;  1IJW C;  5E3N A;  2HEO A;  3H36 A;  2JRM A;  2E71 A;  2GA2 A;  2MYS A;  4JQF A;  2STT A;  1ZAR A;  4KMU X;  1W7P D;  1XN7 A;  1O3R A;  2QYO A;  2V9P A;  2CS3 A;  3WGH A;  3FF5 A;  3GZI A;  3DKX A;  4RDU A;  1IRF A;  2KZG A;  1RR8 C;  1VQ4 I;  3E5X A;  3V4G A;  2XIG A;  2CQK A;  3ZOB A;  2A05 A;  2FSW A;  2VJJ A;  3BCG A;  1L3L A;  1HA8 A;  1K6O A;  4UNO A;  2H09 A;  2MH9 A;  4I09 A;  4F91 B;  2XSD C;  1Y1V J;  3G56 A;  2O7T A;  1ZLJ A;  3B73 A;  2LY1 A;  1K4T A;  4A3K J;  1PP7 U;  4HDU A;  1SFU A;  3MKL A;  2AO9 A;  2MA3 A;  3G1O A;  2DTZ A;  1NHA A;  4O6J A;  4P96 A;  4XL9 A;  1LEA A;  2QQB A;  2JA5 J;  2HQN A;  3F0C A;  4E7J A;  5FHP A;  4LMY A;  2K3P A;  1RPW A;  5B5E C;  4A3G J;  3WGI A;  1ITY A;  2KT0 A;  2HPM A;  3FDY A;  5FKM A;  5E1W A;  3GYH X;  5K5O A;  1LKX A;  1IN7 A;  5KAF C;  1B9N A;  1OIS A;  3KIO A;  4B09 A;  1UCR A;  1DDN A;  1J0R A;  4EAT A;  4F92 B;  4ETS A;  2NVX J;  2GQQ A;  1FYK A;  2VOO A;  4AU7 A;  3DPJ A;  2A5W A;  4HF1 A;  5CW8 A;  4RAG A;  4PJJ A;  1J59 A;  3ANG A;  2DT5 A;  3FIS A;  3ANP A;  2C6Y A;  4BH9 A;  4M6X A;  1LJ9 A;  3VFZ A;  3QYF A;  3K2A A;  4XBF A;  1OR7 A;  4JX4 A;  4RB3 C;  1RET A;  4GCK A;  4BE0 A;  2DMT A;  3HIM A;  1P9Q C;  1W5C C;  3A01 A;  4PJL A;  4XLE A;  4N9H A;  1OKR A;  3JAM Z;  1MSE C;  3HRS A;  4KIG A;  5CVJ A;  2QZ8 A;  3HXL A;  1WPK A;  3DPU A;  1A31 A;  4OMZ A;  3ZQL A;  1Z91 A;  1O7L A;  1APL C;  2FEZ A;  3RCO A;  1KON A;  3MNL A;  3G4S I;  2YR2 A;  1IUY A;  4EJW A;  1Z7L A;  3V78 A;  2UV1 A;  3BPV A;  2ZCM A;  1IRX A;  3CJQ B;  3CZ6 A;  5HLT A;  2H1L A;  3L2V A;  4A3M J;  2ZY9 A;  4CCN A;  2JJ7 A;  2L9S A;  2OU2 A;  3H5R A;  1YJW I;  1FOX A;  1ON1 A;  1W36 D;  4XKW A;  4EJU A;  2JRT A;  1YIO A;  3DWL E;  1HDP A;  5HS9 A;  1M1E B;  1N25 A;  4RB0 A;  3CO7 C;  4XOT A;  1BL0 A;  1PDN C;  1H89 C;  3LA7 A;  3A2K A;  2ME0 A;  4AM3 A;  3IAS 2;  5C44 J;  5A2Q K;  3OSG A;  5DAJ A;  2JZY A;  1BR1 A;  4ASN A;  2JQ7 A;  2V1D A;  4MTD A;  1H9G A;  5ED4 A;  4PUS A;  4KT6 A;  2QEX I;  4M3F A;  5BPD A;  1UI6 A;  1XCV A;  1ZHF A;  3S5R A;  4FT8 A;  3AG2 H;  2W7N A;  2OBP A;  2FMY A;  2ZME A;  1VI0 A;  3P7N A;  2CG4 A;  4PK4 A;  2RQP A;  2QKO A;  3DFG A;  2J5P A;  2O0Y A;  3Q3S A;  4L18 B;  4WXD A;  1PUF A;  1U0J A;  5HLG A;  1J9I A;  4NC7 A;  3C7J A;  3GW2 A;  4LGW A;  3J7A O;  2A3S A;  2NS8 A;  2XAG A;  2AXT C;  3BTC A;  2RQQ A;  5ILU A;  1HBX G;  5H6R A;  5LLQ A;  2Y75 A;  2DXI A;  3F8C A;  1K6Y A;  1P92 A;  2CFO A;  2DJN A;  3PUB A;  2CGP A;  5HAW A;  2HXI A;  1DGW Y;  4EVI A;  2JA6 J;  1WI9 A;  1DPR A;  3KEO A;  1OMI A;  2PMU A;  5CLS A;  3S15 J;  1UJ8 A;  1IV6 A;  1BW6 A;  2KRH A;  2V9K A;  4DVY P;  4BY1 J;  2EIM H;  2RVC A;  1WZ2 A;  5KHD A;  3AQS A;  2VE8 A;  4A6E A;  1SFK A;  1R4N B;  1YW8 A;  2ELK A;  2DA6 A;  4G94 A;  1DP3 A;  4HLY A;  4FTH A;  1I39 A;  4W1U A;  5EEG A;  2V6E A;  1AA7 A;  1JTX A;  4XID A;  2FQ3 A;  1LE8 B;  4JP0 A;  3KET A;  1QZE A;  2XAU A;  1VZ0 A;  3DTE A;  2MD5 A;  3OMY A;  2WAF A;  4Y15 A;  2XDV A;  4YII A;  2YUS A;  4OMY A;  3LA2 A;  2M2E A;  2DMN A;  3BG6 A;  2E2J J;  2E36 A;  4JX6 A;  1YIJ I;  3FRQ A;  2HPI A;  3LWF A;  4JOM A;  3TO9 A;  2OUM A;  4IXA A;  4P1W A;  3O8G A;  5D5V B;  5HDG A;  3BCA A;  4HQE A;  2CUF A;  3RDI A;  1XSD A;  2Y9Z A;  1V55 H;  4HG2 A;  2VQL A;  3HOY J;  3I5U A;  2EV6 A;  3VYR B;  2BGC A;  5DV5 A;  4XLN F;  1J75 A;  2BHY A;  3QP6 A;  1LFU P;  4UY8 I;  1ZG1 A;  4EQQ A;  1R22 A;  2WWY A;  2ME6 A;  3ZMZ A;  3HEF A;  2LKX A;  3SFZ A;  2M87 A;  1S9H A;  2X1E A;  5J4V A;  3QQA A;  3IRR A;  2RDP A;  3W2V A;  2E7W A;  2EZI A;  3HTA A;  5IT9 Z;  3WG9 A;  1BOA A;  4RS8 A;  5H2F C;  2QTQ A;  4OD5 A;  3CUQ B;  5LRS A;  2K9L A;  4KUM A;  1UHW A;  3JAM K;  1BBY A;  4BAC A;  2K4B A;  3ZQQ A;  4F55 A;  3GF2 A;  1YJ9 I;  4NNJ A;  1MNM C;  4Y33 A;  3A0B C;  4XON A;  4C30 A;  4EV0 A;  3JRC A;  1MMD A;  2COB A;  1X2N A;  1SFE A;  1JHH A;  4LK1 F;  2LBF B;  1LDK B;  2LKP A;  5FGM A;  1ZRC A;  2G7S A;  2ISZ A;  3L00 A;  3PSI A;  3WU2 C;  1U9O A;  1EA3 A;  4UUS A;  1XGS A;  1H8A C;  1WJE A;  3RKW A;  1BR4 A;  3L09 A;  2QOP A;  2VBY A;  3VYT B;  4G8X A;  4L5J A;  3WTU C;  1QNT A;  4UV8 A;  4QIW N;  1TWH J;  1J09 A;  2FBI A;  2HTS A;  1MH3 A;  3K8P C;  2IA2 A;  3HIF A;  1W7P B;  4ENN A;  4L0Y B;  4ZDP A;  2ELJ A;  2EZK A;  3F1B A;  2QWW A;  4CDG A;  3E3V A;  3KP4 A;  3ZRG A;  3MAJ A;  3CCE I;  4A3C J;  3JRB A;  3ECO A;  1U5T C;  2LC2 A;  3ESW B;  5E1Z B;  4BU2 A;  3GX4 X;  1YHQ I;  2STW A;  2ADU A;  4ME9 A;  3DPL C;  2M4K A;  3JRH A;  4A3L J;  1KU9 A;  3RKY A;  1IG7 A;  2OQG A;  2DT6 A;  2KQR A;  1E0E A;  1STZ A;  2QSH X;  4L9T A;  2XAF A;  2CUZ A;  2HYT A;  4DQ2 A;  4XM3 A;  2LY2 A;  3BJA A;  2IT0 A;  4LIU A;  1VQ8 I;  4O3M A;  4CO8 A;  3PUF A;  2Z3Y A;  2K40 A;  1AWC A;  4MQ9 F;  3BQY A;  3OV8 A;  1YG2 A;  3LST A;  2LYC A;  3HGY A;  3LSK A;  1ETX A;  2VI6 A;  2Q1Z B;  1LVA A;  4M6V A;  1RKW A;  3F22 A;  2OI8 A;  5J40 A;  2XGD A;  1Z67 A;  5LRR A;  2FD5 A;  1D0X A;  4ZYA A;  2LNB A;  4JBA A;  2GWR A;  4IOA F;  5D18 A;  2VAS A;  4IO9 F;  1K78 A;  4D5C A;  1I3Q J;  1X2M A;  2QKL B;  2DPD A;  4M3G A;  3TO6 A;  1XMK A;  3BJO A;  4RAZ A;  2BY0 A;  3HC7 A;  3GME A;  1ACI A;  5FKK A;  2O7O A;  4V19 K;  3TP0 A;  1FC3 A;  3DF8 A;  5CQG A;  1QO0 D;  2K3F A;  3HPH A;  4BYY A;  2QQA A;  5TGT A;  1AOY A;  4GCT A;  1N78 A;  1XMX A;  1J7K A;  1T98 A;  3K1N A;  4EM0 B;  5EEA A;  1SVL A;  2IRF G;  2YVX A;  3S1R J;  2HS5 A;  4G7H F;  2QM3 A;  3E5U A;  4MQV A;  2DFF A;  4Y17 A;  4S0H B;  4AC0 A;  1ON2 A;  1HCR A;  1Y6I A;  2G0E A;  3SDG A;  2R0Q C;  4HPQ A;  1F9N A;  2ZJQ F;  4XRF A;  4PCQ A;  2CWE A;  3LQR A;  1LDJ A;  3R4K A;  2LD5 A;  2KRF A;  3AFH A;  2VBZ A;  1IC8 A;  3ZQH A;  5EGO B;  5EJC A;  2NS7 A;  2P7C B;  5CYV A;  3HTJ A;  2F07 A;  4HNT A;  1W5S A;  1RES A;  3OYA A;  2QIB A;  1UB9 A;  2JN6 A;  4HDV A;  4MEY F;  4R1H A;  3GTQ J;  4BDY A;  3OIQ A;  4PFP A;  3ZR8 X;  2HWV A;  5GPA A;  2A68 F;  2Y0S N;  1K61 A;  3GCM A;  3ZMD A;  2XKO A;  1HC8 A;  1TWF J;  2G7U A;  1LFB A;  5FB2 A;  3T5X A;  3GWZ A;  1U2W A;  3HOU J;  3N4M A;  3ABU A;  4BXX J;  2FOK A;  3QP5 A;  4BQN A;  1RIO H;  1W4M A;  2W25 A;  2FJ1 A;  3F6O A;  2K9Q A;  2Y2Z A;  3HM5 A;  2HOA A;  3ZQG A;  3I55 I;  1DGR M;  1REP C;  1ZKG A;  1CQT A;  1UST A;  3CC4 I;  3GLL A;  2WGB A;  2VC1 A;  3CCY A;  3VW1 A;  4Q47 A;  3DEU A;  3C1D A;  1MMG A;  2W82 A;  2KLO A;  3KLO A;  1B72 B;  2ZJ2 A;  3F9K A;  4HBL A;  3BG9 A;  4M74 A;  3DLL F;  4C2U A;  4IRH A;  3CC2 I;  1XGN A;  5J8C A;  4A0Z A;  5D5U B;  3S3M A;  1RUN A;  1POG A;  1UG2 A;  1UHS A;  2VN2 A;  3HOX J;  3RJP A;  3PAS A;  4IKF A;  1P2F A;  1D0Y A;  2L02 A;  3D5S C;  3I4P A;  3I64 A;  4UV9 A;  5IP9 J;  5FJ8 J;  3ZPL A;  3Q9V A;  2XAJ A;  4ZTF A;  4P9U A;  1U78 A;  1HW5 A;  1X3U A;  3CP2 A;  3ECH A;  3DTK A;  2ECB A;  1WFX A;  4GCV A;  5J1Y A;  4PSX A;  5FD5 A;  3OYB A;  4LD5 A;  3OL3 A;  1TQM A;  3QPS A;  5TJJ A;  1VQ6 I;  4CCK A;  3IH2 A;  1ETK A;  3I4N J;  3WE2 A;  3HTS B;  4U9L A;  2NP3 A;  3CCV I;  1T6S A;  1MMN A;  2ZXI A;  1TBX A;  4CYC B;  2E2H J;  4EJT A;  3OOP A;  4XRS G;  1V54 H;  1T08 B;  2E7X A;  3MEX A;  4AUX A;  2HQR A;  4LJZ F;  4KIS A;  1SGM A;  5LHI A;  1T33 A;  3DXJ F;  3CDH A;  5FRN A;  2L5Q A;  1KQ8 A;  3LQQ A;  2M1B A;  2L4M A;  2EIK H;  4OWR B;  3FBN B;  3HJE A;  5FLX Z;  1ETQ A;  3CF5 F;  1E3H A;  2NRA C;  4PJN A;  3ABM H;  3F8N A;  1FNN A;  4GGG A;  3GFI A;  3I59 A;  2EIL H;  3KZ9 A;  3BR3 A;  1BI1 A;  1D1A A;  1BM9 A;  2EA4 A;  2EIJ H;  4JK1 X;  5IP6 A;  1JTY A;  1LUJ B;  2XPU A;  5J4Y A;  2G3B A;  5CJ9 A;  5GAD J;  5FKN A;  3I71 A;  3DV8 A;  1MDM A;  4RGU A;  2L54 A;  4HEA 2;  1SAX A;  3ML6 A;  2DFH A;  1O3T A;  1W5T A;  3CME I;  5IPA A;  1WJD A;  3K4L A;  3J81 Z;  3ABT A;  1T8I A;  2E35 A;  3F8M A;  1V3F A;  1FOY A;  1JUP A;  1FWZ A;  1Z0X A;  4KT5 C;  5HS7 A;  2ESN A;  2A61 A;  2ELH A;  2WTE A;  3JRD A;  4EM2 A;  2ZC2 A;  1ETW A;  1FBS A;  2EFW A;  2HTJ A;  3MKY B;  3SHF A;  1TQP A;  1JI8 A;  1VFC A;  2ZBK A;  1HDD C;  3PPB A;  2JA7 J;  1EH6 A;  3ERE D;  3LFK A;  1TT0 A;  1D1C A;  1B1B A;  2A6H F;  4W97 A;  2DOF A;  1P6R A;  3S3O A;  4ZH4 F;  2VKD A;  3ZCO A;  4B3A A;  1NTC A;  1PYV A;  3KZY A;  4M6Y A;  4OIQ F;  1JKP C;  5JFR A;  3VOD A;  4AD9 A;  3CJT B;  3FXM A;  1BOB A;  4RM2 A;  2AQE A;  3MMY B;  5E79 C;  3HOV J;  3FBI B;  1MKM A;  2E1M C;  3U1D A;  4HLX A;  3WTV C;  4PGH A;  3M7G A;  4LG0 B;  3O6B B;  4XLH A;  5F1R A;  1QQI A;  3Q0W A;  2B3W A;  2VOP A;  2LP0 A;  2HGC A;  1MBG A;  2R5Y B;  2IGM A;  3C07 A;  4Y13 A;  1F5T A;  5HLH A;  2F5D A;  4I76 A;  5EZG A;  3NQO A;  3I59 B;  3R6S A;  3S3N A;  3DP7 A;  3EDP A;  2PBI A;  3DKY A;  2QBY B;  4MIM A;  1OCO H;  4YG2 F;  5L3E A;  4KIF A;  4XKV A;  1IN4 A;  4RGS A;  3GTL J;  5L3C A;  1S7A A;  2HOT A;  3CMM A;  1IXR C;  2HDD A;  1Q1V A;  3UNG C;  2IVM A;  1KYZ A;  3U2R A;  2A2F X;  3HTI A;  1Z3Y A;  1EH8 A;  4GXO A;  3JRI A;  4C2M J;  3P5J A;  2LBF A;  1H0M A;  1O7F A;  3KKD A;  5KNL A;  4ZDL A;  1X3W B;  3KCC A;  4CGZ A;  4DZP A;  4A0Y A;  2EFO A;  2EZL A;  4B3X A;  4A3E J;  3KKC A;  1WSU A;  2KMU A;  2ZKZ A;  5LHH A;  1T38 A;  5D1R A;  5D19 A;  4IQ4 A;  5D4S A;  2MBF A;  2HOE A;  4M3E A;  2HQA A;  3LL7 A;  4ON0 A;  1VQN I;  2DDB A;  1MJB A;  4KIC A;  4FET A;  3BRU A;  2JT1 A;  1CGP A;  1TNT A;  2EK5 A;  4LG3 A;  4CCL A;  2L9R A;  2DDA A;  2NVT J;  4R8H A;  3OYH A;  4C9Y A;  4CCM A;  2ETH A;  5TRD A;  1XG1 A;  4KFC A;  3S32 A;  2WBM A;  3VPR A;  4BBR J;  2K27 A;  3PIP F;  2JTV A;  3M4O J;  2XDN A;  1MBE A;  3N97 A;  4ESJ A;  3BJB A;  3ZMV A;  4U7B A;  1ORK A;  4QWQ A;  4A3D J;  4ESB A;  2R5Y A;  5AON A;  1B9M A;  2X6O A;  3HYI A;  4M3D A;  2Z33 A;  3KE2 A;  4RAY A;  1TZL A;  1W1W E;  4U0W A;  3LHQ A;  5L3F A;  4RBO A;  2HFH A;  3RPQ A;  5F0H A;  3WHC A;  2QQ9 A;  3JTG A;  2EFP A;  3EUA A;  3LFU A;  4CSW A;  2IW5 A;  2B9S A;  2DG7 A;  3HBL A;  3MVP A;  2ACJ A;  3OYG A;  2ZME B;  1MJA A;  3IHU A;  1S72 I;  3BR1 A;  2CO5 A;  5IP7 J;  2D6Y A;  3TOA A;  4HX7 A;  1S7O A;  3VYU B;  1FT9 A;  4XIC A;  2R93 J;  3VUQ A;  3S14 J;  3TQN A;  1U3E M;  5HVQ C;  1ETO A;  2D5V A;  4EJV A;  4IVN A;  2QWT A;  3VSL A;  5LBQ A;  2RGV A;  2ZJP F;  6PAX A;  5HNH A;  5LGT A;  5EYR A;  2W4S A;  2X6Y A;  3JCU C;  5D5X B;  2BW3 B;  4EM1 A;  4CZC A;  3HOT A;  4IHV A;  4P9F A;  3RZO J;  1D8J A;  1P4X A;  4WIB A;  3PNV A;  5C3E J;  3E5Q A;  1B8I B;  3OYI A;  1ZR4 A;  3RD3 A;  1H88 C;  4XNF A;  2CW0 F;  2JVH A;  1O3Q A;  3LSG A;  5EG0 B;  3GZ6 A;  3BTJ A;  4KNY A;  4E7S A;  1IXC A;  3I58 A;  2M0M A;  4MXM A;  3QU3 A;  2XF7 A;  2G7L A;  3EET A;  1HKT A;  1GV2 A;  2M5W A;  1HLV A;  4HV6 A;  2VPR A;  1K4S A;  3A01 B;  2Y0S A;  1G3Y A;  4FHT A;  3K4K A;  3V6G A;  3J80 Z;  4ANJ A;  3BTI A;  2HQ5 A;  1XGO A;  2M0C A;  3IC7 A;  3W2A A;  1UG0 A;  2LVS A;  4RA2 A;  4D0P A;  1ZRD A;  1FIP A;  2YSR A;  4P5O A;  3AQT A;  2O9L A;  2EBI A;  3BRO A;  2EQR A;  3E7Q A;  1WJ5 A;  4KYW A;  1W36 C;  2R7O A;  2F2E A;  2CQN A;  4BHC A;  1LFP A;  2VJ5 A;  1VQ9 I;  1OCR H;  2WB1 N;  2XPV A;  3V8L A;  4NEL A;  3HUG B;  3GFM A;  3N05 A;  4IHS A;  2IEK A;  3GEZ A;  1BJA A;  2IA0 A;  3K10 A;  3M1C A;  4OAZ A;  5F64 A;  3ULQ B;  2B63 J;  4YFX F;  5LGN A;  2D45 A;  1Z7U A;  3FX3 A;  1N75 A;  5K5Q A;  4U0Y A;  3LNQ A;  1TP4 A;  3TKY A;  3F8B A;  2ZXH A;  5HLI A;  4ZYD A;  4WF2 A;  3K2Z A;  3T8R A;  1VND A;  3AL0 B;  3VP5 A;  4BDZ A;  1R4M B;  1SVM A;  2FBK A;  4E6K G;  3EPZ A;  4Q4Z F;  1RZ4 A;  2XAH A;  3P9K A;  2XGX A;  3H9G A;  4ZYH A;  1SD6 A;  3ASO H;  3LJL A;  1O4X A;  1QHH D;  4ZC3 A;  3T6N A;  1RNL A;  4RLQ A;  1KQ0 A;  4RAF A;  4U0V A;  5C4J J;  3T0Y A;  2RHA A;  1QZZ A;  3R0A A;  4E4H A;  3KP3 A;  3IKT A;  4XN0 A;  2L7K A;  4D5F A;  3S1N J;  1HKS A;  2VQC A;  2Q8K A;  4U7D A;  4S05 A;  3WOD F;  3SDB A;  5IYC J;  3NI7 A;  3OOU A;  3OR2 C;  3ZMU A;  1IDY A;  5F27 A;  2EH3 A;  1WWX A;  3BT9 A;  5J8F A;  3K70 C;  2Y0M A;  2PMZ A;  2ECC A;  4B8X A;  3ZN0 A;  3AG4 H;  2BEO A;  4A0X A;  1Y8Q B;  3SEQ A;  3NWS A;  1T39 A;  1QGP A;  4YIF A;  2F5V A;  1W0T A;  2ZFW A;  2ZO4 A;  2VE9 A;  1TWG J;  4NN1 A;  4Z6Y A;  2BXZ A;  2KFD A;  2VPL A;  3J80 K;  2Z1D A;  2O61 A;  3E6D A;  3PM1 A;  2NOJ B;  1MMS A;  3CJR B;  3ZXS A;  3DEW A;  3H5N A;  2R7Z J;  2GLO A;  4DYQ A;  4AYB A;  3JTH A;  3PO2 J;  1SC7 A;  3P9T A;  2ESH A;  1P7J A;  2V9V A;  2MD0 A;  2W85 A;  2R7Q A;  3E6B A;  3HUG A;  4L9J A;  5J1R A;  3CLQ A;  5DS9 A;  2XAQ A;  4UUV A;  3DU5 A;  2L4A A;  4TV7 A;  3JRA A;  3R0J A;  2R92 J;  1BW5 A;  3HZJ A;  1RUO A;  4IF4 A;  2M9H A;  3JRF A;  3CCM I;  2UXH A;  1ZG3 A;  3BG7 A;  2DA1 A;  3O2P E;  2ID3 A;  1HW2 A;  2AQF A;  4J19 A;  4BE1 A;  2PI0 A;  2VXZ A;  2HU9 A;  2B7E A;  5GAG J;  2MG4 A;  2OJE D;  2F5E A;  2E19 A;  4N4N B;  2A6E F;  1R5G A;  4EEF G;  3S17 J;  4A12 A;  1RR7 A;  3CCQ I;  2HR3 A;  3E97 A;  2XHK A;  3C2B A;  3T8T A;  4CYC A;  3H5A A;  5J3L A;  3WTW C;  3ON2 A;  2ZME C;  1F1Z A;  2K9N A;  2ZCW A;  1I6X A;  3OYM A;  2LFB A;  1IRG A;  4B48 A;  3V8K A;  1YO5 C;  3W6V A;  1MBK A;  1IUF A;  5F0F A;  4F7Z A;  1OCZ H;  2QQ8 A;  3KEY A;  1S7E A;  1JXS A;  4M72 A;  3BP8 A;  3I4M J;  4CH7 A;  3Q9S A;  2W53 A;  1ZEL A;  1ERD A;  5B1A H;  3WTZ A;  2VQH A;  1XPX A;  1ZAO A;  3BC8 A;  2LOO A;  2AXL A;  4OIP F;  2Q2E A;  5CVV A;  1KZH A;  1LDD A;  4AC6 A;  1HQC A;  1FZP B;  5E8I A;  3GTP J;  2QEN A;  1UEL B;  1CF7 A;  2X1C A;  3PNT A;  1TT5 B;  3LAJ A;  1H9T A;  3TW6 A;  2DN0 A;  4XMY A;  1A36 A;  1Y56 A;  3H92 A;  2FJI 1;  1O57 A;  4OIO F;  3ERM A;  3RIR A;  1TL8 A;  1RKT A;  1NH3 A;  4DOZ A;  4GO1 A;  2R7T A;  2K86 A;  2P0W A;  4AWX B;  3IV5 A;  5ILV A;  1OJL A;  3BR0 A;  4G9Y A;  3REO A;  1XSX A;  3H0G J;  1J5Y A;  3KX2 A;  2DK5 A;  2WV0 A;  1LEB A;  1I1S A;  4IRV A;  1SEU A;  1RC9 A;  4PFO A;  2V26 A;  1PVE A;  2X85 A;  2FNA A;  2W48 A;  3C2H A;  4PXI A;  1R5I D;  4J01 A;  4BXU A;  1KU2 A;  5L3D A;  3QYB A;  2V1U A;  2BY1 A;  2JWT A;  2L01 A;  2UXX A;  4MO7 A;  4UHT A;  1TW2 A;  3M8E A;  3VSK A;  1AKH B;  1IV8 A;  5M5X J;  3Q0U A;  4NUB A;  2HZT A;  5FKO A;  4BJ6 C;  2F4M B;  1MD0 A;  4G7Z F;  2GM4 A;  1EJ9 A;  4IQJ A;  2NYX A;  2EIN H;  1DU6 A;  2WY7 Q;  2BV6 A;  4FQG A;  1D5V A;  3W3C A;  1K79 A;  1C0W A;  2KIM A;  2CW7 A;  4M3B A;  3WG7 H;  4F3Q A;  1ULY A;  2X51 A;  2Z99 A;  1FLI A;  2X9D A;  1YJN I;  4BHP A;  4NB5 A;  3QBM A;  2HI3 A;  4DNC A;  4DBQ A;  1WI3 A;  4MFE A;  3OYC A;  5FO5 A;  2MLG A;  2Q2E B;  3FKI J;  5AQC A;  1SD7 A;  4HOB A;  2V1X A;  3FHN A;  1JKR C;  4GDF A;  3QKX A;  5LEK A;  2CMP A;  2OCE A;  2LG4 A;  4IHY A;  1ENH A;  1Y39 A;  4G7O F;  1DUX C;  3FXL A;  2IXS A;  1FBQ A;  2P4W A;  4H4K C;  5D4R A;  3G3Z A;  4WCG A;  1JE8 A;  2QLZ A;  2DMU A;  2PJR A;  2IPQ X;  4XLP F;  2UXU A;  1X58 A;  5KVR A;  3CDI A;  2RAE A;  1V4R A;  2YU9 J;  4FX4 A;  4BUP A;  1FOW A;  1Z1D A;  3KLN A;  3U21 A;  3CP8 A;  3G73 A;  3FMS A;  1IDZ A;  5FFZ A;  4OIR F;  4D1Q A;  1T2K A;  2PJP A;  4ESF A;  2OAZ A;  3ON4 A;  2X1D A;  4A3F J;  3HSR A;  2EPF A;  3S93 A;  4HNV A;  2PQ8 A;  3HGG A;  4LLL A;  4LK0 F;  5IYD J;  4E7K A;  2OPT A;  1Y0U A;  4RLF A;  4RMN A;  2JK3 A;  2BBY A;  1P4A A;  2JA2 A;  1JHF A;  2ZXW H;  2DCE A;  3K6G A;  4Y3O A;  1KGS A;  5DTD A;  2R7S A;  5FGL A;  1ZN2 A;  1TTY A;  2FBQ A;  4S04 A;  4BJ5 C;  2DYR H;  2KJB A;  2CFX A;  1T0F A;  5FFX A;  5EEH A;  3VIB A;  4BS9 A;  2PEX A;  4QLC U;  3A03 A;  4ZYE A;  3HRM A;  3NPI A;  2Z16 A;  3HRT A;  4II2 A;  1ZTR A;  2EFQ A;  3L9F A;  1U5T A;  3GO5 A;  2P5V A;  3Q5F A;  2M8E A;  3UR3 C;  1X4P A;  3SWH A;  1LE8 A;  3BR5 A;  1NK2 P;  3FXR A;  3HKZ A;  5F08 A;  1B8I A;  3HB9 A;  3D0S A;  4NHJ A;  2XAS A;  3BZK A;  3LWJ A;  2BY2 A;  3K70 D;  1MDM B;  2G7H A;  2M7B A;  1P4W A;  2DA5 A;  3EUK L;  3PQK A;  5EG0 A;  2XB0 X;  3HL2 A;  2BHZ A;  4B43 A;  2NP5 A;  1Y8R B;  2WAQ A;  2HKX A;  3GBG A;  4F93 B;  3M9A A;  4AVZ A;  3SXY A;  4WWC A;  4IHT A;  2LMD A;  2PJR B;  1EF4 A;  2YPR A;  5C4Y A;  3CCL I;  3NS4 A;  2KIQ A;  3HKZ N;  4N9I A;  1YFH A;  4MEX F;  1FTT A;  2KIU A;  2WAE A;  1FSE A;  4NQW B;  4J00 A;  1F36 A;  2PG4 A;  2OA4 A;  2IGK A;  2WC2 A;  2DA4 A;  2QF7 A;  3MZ8 A;  1UMQ A;  4E70 A;  1GHC A;  2E1N A;  2KRC A;  2CQ7 A;  2X0L A;  3BNI A;  1MBH A;  5HSZ A;  3ZQC A;  1Q1H A;  5DCM A;  2DMQ A;  1ETY A;  1B6A A;  4ZZL A;  2R5Z A;  2MFZ A;  2CV2 A;  4EJO A;  3HG9 A;  2Y9Y A;  3BHQ A;  5KCM A;  2KIS A;  1YI2 I;  5M5Y J;  3EQL F;  4N0B A;  4B44 A;  2HYF A;  3S2W A;  3U1K A;  5IOZ A;  3VW0 A;  1QHG A;  1OYY A;  3GTO J;  2JVG A;  1USS A;  5D8L B;  1JGG A;  3F8F A;  5CVI A;  3TP3 A;  3IH4 A; 
#chains in the Genus database with same CATH homology
 1AU7 A;  4BBS J;  1GVD A;  2NX4 A;  3KKD A;  2LR8 A;  1WGX A;  1ZR2 A;  4DZP A;  1HDP A;  2EZL A;  2Y30 A;  4A3E J;  5K58 A;  3LOC A;  1BL0 A;  5EFY A;  3KKC A;  1H89 C;  3EGQ A;  2ME0 A;  5D1R A;  5D19 A;  5C44 J;  1D5Y A;  3OSG A;  1MBJ A;  3G7R A;  5DAJ A;  4M3E A;  5HBU A;  2REK A;  4LOC A;  1OCP A;  1K83 J;  3BRU A;  4M3F A;  5FLV A;  2XGE A;  2L9R A;  4L5E A;  2NVT J;  1UI6 A;  3S5R A;  4DYC A;  1TWC J;  4B4C A;  3HOW J;  1XG1 A;  1VI0 A;  3VPR A;  4BBR J;  5FLM J;  2QKO A;  3M4O J;  2ZCN A;  4FE7 A;  2RAS A;  2XDN A;  3Q3S A;  3MN2 A;  1MBE A;  4C3J J;  1PUF A;  1R9T J;  3BJB A;  1P7I A;  1ORK A;  2OF7 A;  3VW2 A;  1TC3 C;  4A3D J;  2ZOZ A;  2M34 A;  2NS8 A;  2R5Y A;  4M3D A;  2X6O A;  3BTC A;  1A6I A;  1JUS A;  2E2I J;  3LHQ A;  4C3H J;  2YVE A;  4RBO A;  3GEU A;  5F0H A;  3WHC A;  5GPC A;  4V2G A;  2DJN A;  2NVY J;  5HAW A;  2DG7 A;  2G7G A;  2HXI A;  3HBL A;  3MVP A;  3CMY A;  4I6Z A;  1I6H J;  2JA6 J;  2CU7 A;  1Z77 A;  3VVX A;  3O60 A;  3BR1 A;  3S15 J;  1IV6 A;  3LSR A;  1BW6 A;  1T56 A;  5IP7 J;  2D6Y A;  4BY1 J;  4XRM A;  3B6C A;  1JKO C;  2ZOY A;  3TED A;  3H3V K;  4DZJ A;  3AQS A;  2Y31 A;  2X48 A;  5M5W J;  4XIC A;  2R93 J;  2M8G X;  2ELK A;  2DA6 A;  3S14 J;  3VUQ A;  2D5V A;  1ETO A;  4YZE A;  4FTH A;  4W1U A;  2QWT A;  4HKU A;  1QRY A;  3RZD J;  3HTH A;  2LY9 A;  2MSY A;  1JTX A;  4XID A;  1LE8 B;  4JP0 A;  5EYR A;  1QVT A;  2OER A;  2O8K A;  4IHV A;  3RZO J;  2TCT A;  2GEN A;  2YUS A;  1ETV A;  5C3E J;  1B8I B;  2M2E A;  2DMN A;  2IBD A;  1ZR4 A;  1JT6 A;  1H88 C;  2E2J J;  3RD3 A;  4JX6 A;  3FRQ A;  3LSG A;  5EG0 B;  2L7F P;  3BTJ A;  3O8G A;  4MXM A;  2H8R A;  4X6A J;  1U9N A;  4GFL A;  2CJJ A;  3LSP A;  3COL A;  4CGR A;  2G7L A;  5EDN A;  2CUF A;  4V2F A;  2Y9Z A;  4MLO A;  3ZQF A;  4A93 J;  3HOY J;  4X1E A;  1GV2 A;  1HLV A;  4UUT A;  2VPR A;  1LFU P;  4FCY A;  2N8G A;  3A01 B;  3JRG A;  1XS9 A;  3IH3 A;  1SAN A;  2ME6 A;  5EF6 A;  5EGO A;  3HEF A;  2LKX A;  2P81 A;  2IU5 A;  2CQX A;  3FK7 A;  3QQA A;  3V6G A;  5H9T A;  3BTI A;  2HQ5 A;  2M0C A;  1MH4 A;  2NVQ J;  2AHQ A;  2LVS A;  2EZI A;  1JJ6 C;  3HTA A;  1FIP A;  2QTQ A;  3AQT A;  5K7H A;  2EBI A;  2O9L A;  2EQR A;  3E7Q A;  3RQI A;  4G12 A;  2I10 A;  1YRN B;  2WB1 N;  2XPV A;  1MNM C;  4NEL A;  1PUF B;  3JRC A;  4GCL A;  2COB A;  1X2N A;  3S1M J;  5K7F A;  2IEK A;  3PO3 J;  2V57 A;  2B63 J;  4XRS A;  2G7S A;  1IRZ A;  1GT0 C;  2ID6 A;  2LLK A;  5E3M A;  1U9O A;  3LNQ A;  4UUS A;  3JRI A;  3S16 J;  1H8A C;  2K9S A;  2UXO A;  2L0K A;  5EZH A;  1VND A;  3VP5 A;  2QOP A;  1AKH A;  3LJL A;  1O4X A;  4QIW N;  3T6N A;  1GUU A;  1FJL A;  1TWH J;  4FIS A;  1U8B A;  3NXC A;  1MH3 A;  5C4J J;  5M3F J;  1YRN A;  2RHA A;  3E7L A;  1MBF A;  1ZGW A;  2EZK A;  3KNW A;  3G1L A;  1FEX A;  3F1B A;  5F04 A;  1WH5 A;  4D5F A;  2DA2 A;  2IAI A;  3S1N J;  3NAU A;  4B1R A;  3JRB A;  4A3C J;  5IYC J;  1E3O C;  3OOU A;  3NI7 A;  1IDY A;  5F27 A;  2EH3 A;  3BT9 A;  3GTG J;  1OCT C;  4ME9 A;  1OFC X;  2ECC A;  2PBX A;  3JRH A;  4A3L J;  3K7A J;  1IG7 A;  4A69 C;  2UXP A;  2DA3 A;  1W0T A;  2VKV A;  1XC5 A;  1TWG J;  4NN1 A;  4XK4 A;  3NRG A;  2HYT A;  3HOZ J;  1FIA A;  2MW8 A;  3BR2 A;  3VVZ A;  3EUP A;  1GDT A;  3PM1 A;  3VOK A;  4Y52 J;  2K40 A;  3DEW A;  3BQY A;  4IHX A;  2R7Z J;  2GLO A;  2HYJ A;  4DYQ A;  4A3I J;  1JT0 A;  4JL3 A;  3HGY A;  5F1J A;  2VUM J;  2PMZ N;  4BKX A;  1ETX A;  2VI6 A;  3PO2 J;  3P9T A;  4M6V A;  1P7J A;  1RKW A;  1FTZ A;  5J1R A;  5DS9 A;  2OI8 A;  9ANT A;  2XGD A;  1IGN A;  3JRA A;  2UXI A;  2R92 J;  1BW5 A;  1VF9 A;  2FD5 A;  3Q0V A;  2L7M P;  2M9H A;  3BQZ A;  3JRF A;  2UXH A;  4KWA A;  1JUM A;  5IOY A;  2DA1 A;  2ID3 A;  4J19 A;  5D18 A;  3JRE A;  1BJZ A;  4Y7N J;  4QSH A;  2CUE A;  2MG4 A;  4D5C A;  1I3Q J;  1X2M A;  2E19 A;  3D1N I;  4M3G A;  1QPI A;  3S17 J;  4EEF G;  3SJM A;  2DG8 A;  1DU0 A;  1RR7 A;  2FX0 A;  3RH2 A;  3LSJ A;  3TW7 A;  5FKK A;  2O7O A;  3C2B A;  3TP0 A;  4ICH A;  4CYC A;  3ON2 A;  5J3L A;  5IYB J;  2K9N A;  4GCT A;  2LFB A;  3BG5 A;  2XPW A;  5EEA A;  2Q24 A;  4NDL A;  1JKQ C;  2XRL A;  3S1R J;  2GBY A;  2QCO A;  3O8H A;  1SFO J;  1HOM A;  2GUH A;  3VVY A;  4S0H B;  5E3O A;  3G1M A;  4AC0 A;  3W6V A;  4D7M A;  1HCR A;  1MBK A;  1IUF A;  2G0E A;  5F0F A;  3SDG A;  2R0Q C;  3RKQ A;  1BA5 A;  1S7E A;  4JNN A;  4C3I J;  3QPL A;  3I4M J;  2LD5 A;  4UUS B;  2W53 A;  1WCM J;  3HDD A;  5HOD A;  3OSF A;  1IC8 A;  3ZQH A;  5EGO B;  3SFI A;  1WH7 A;  4AC6 A;  2FQ4 A;  2NS7 A;  3S1Q J;  3HTJ A;  2F07 A;  1RES A;  2QIB A;  3GTP J;  2JN6 A;  3NAR A;  2PZ9 A;  3GTQ J;  3TW6 A;  2DN0 A;  4L62 A;  3HE0 A;  3JSJ A;  5GPA A;  2Y0S N;  1B72 A;  1K61 A;  1RKT A;  1TWF J;  4BY7 J;  1G2H A;  1NK3 P;  2YVH A;  2XGC A;  2GFN A;  1LFB A;  3VOX A;  5F0C A;  3IV5 A;  4MK6 A;  1OJL A;  3BR0 A;  4DW6 A;  4QTR A;  2KDZ A;  3HOU J;  3H0G J;  3CRJ A;  4BXX J;  4MFD A;  2FJ1 A;  3HM5 A;  2K9Q A;  2Y2Z A;  2HOA A;  3ZQG A;  2R5Z B;  4IEJ A;  1ZKG A;  3L1P A;  1CQT A;  2HOS A;  3FK6 A;  2W48 A;  3JR9 A;  1ZQ3 P;  4PXI A;  3WHB A;  2H1K A;  2WGB A;  3CCY A;  3VW1 A;  2LK2 A;  3GTK J;  1B72 B;  2JWT A;  4MO7 A;  3FIW A;  1TWA J;  2XB5 A;  3BG9 A;  1AHD P;  1AKH B;  5GP9 A;  3CWR A;  2DA7 A;  2ZB9 A;  5M5X J;  3Q0U A;  1GV5 A;  5FKO A;  4JYK A;  2GM4 A;  2NOG A;  1POG A;  1UG2 A;  3OIO A;  5J1U A;  1UHS A;  4IHW A;  3IUV A;  3HOX J;  3NNR A;  5BNG A;  4A3B J;  3PAS A;  2CRG A;  5IP9 J;  1DU6 A;  5FJ8 J;  2CQQ A;  1HF0 A;  4ABZ A;  4A3J J;  5JLW A;  1U78 A;  3M3Y J;  4M3B A;  2ECB A;  4GFK A;  5K7Z A;  5J1Y A;  2X9D A;  3QBM A;  2HI3 A;  1ZK8 A;  2ZCX A;  1WI3 A;  3QPS A;  4MFE A;  4JKZ A;  5AQC A;  3FKI J;  2WUI A;  4AF5 A;  1JKR C;  3QKX A;  4DYR A;  3CDL A;  3IH2 A;  1JJ8 C;  1ETK A;  4GFB A;  3I4N J;  4FE4 A;  1ENH A;  5JLX A;  4IHY A;  2NP3 A;  2E2H J;  2YS9 A;  4CYC B;  5FKL A;  1UI5 A;  3ZQI A;  4XRS G;  2DMU A;  4AUX A;  2MGQ A;  2E1O A;  4ACI A;  5M3M J;  1SGM A;  2EZH A;  1T33 A;  2UXU A;  1X58 A;  3S2H J;  5FMP A;  1IJW C;  2RAE A;  2WV1 A;  5E3N A;  2YU9 J;  1ETQ A;  5C4X J;  1A5J A;  1QVU A;  1IDZ A;  3GZI A;  3ON4 A;  4RDU A;  3KZ9 A;  4A3F J;  3BR3 A;  4HNV A;  3ZOB A;  3HGG A;  5IYD J;  3BCG A;  1MSF C;  2OPT A;  2JK3 A;  4JX5 A;  1JTY A;  2L7Z A;  5IP6 A;  2XPU A;  3A02 A;  2G3B A;  2XSD C;  5CXI A;  5DTD A;  1Y1V J;  5FKN A;  3G56 A;  5CXG A;  5FGL A;  2O7T A;  2FBQ A;  4A3K J;  2HKU A;  3VIB A;  3MKL A;  2AO9 A;  3B6A A;  3BTL A;  2JA8 J;  3G1O A;  2DTZ A;  4UDS A;  3A03 A;  5IPA A;  3NPI A;  2JA5 J;  1JUP A;  1Z0X A;  3F0C A;  1ZTR A;  3DCF A;  5FHP A;  4AYB N;  3JRD A;  1ETW A;  1RPW A;  4A3G J;  1ITY A;  2KT0 A;  1VFC A;  1HDD C;  1LE8 A;  3BR5 A;  5FKM A;  2DMP A;  1NK2 P;  2JA7 J;  3PPB A;  5F08 A;  3GTM J;  1B8I A;  3HB9 A;  4W97 A;  2JMW A;  1F43 A;  3UKG A;  4B3A A;  1W0U A;  1NTC A;  3LWJ A;  2TRT A;  5EG0 A;  2DA5 A;  1JKP C;  2NVX J;  2XB0 X;  3GTJ J;  3DPJ A;  2NP5 A;  5CW8 A;  3GBG A;  3ANG A;  3HOV J;  3FIS A;  3ANP A;  1EF4 A;  5C4Y A;  3HKZ N;  1FTT A;  3B81 A;  3K2A A;  1Y1W J;  1F36 A;  4JX4 A;  1RET A;  3BG3 A;  3Q0W A;  4GCK A;  2LP0 A;  2DMT A;  2DA4 A;  3HIM A;  2QF7 A;  1UMQ A;  1MBG A;  3BR6 A;  2R5Y B;  2WAQ N;  3C07 A;  3BNI A;  3A01 A;  1MBH A;  5HSZ A;  3ZQC A;  4I76 A;  3CJD A;  3S2D J;  5EZG A;  3CQZ J;  1I50 J;  2DMQ A;  1ETY A;  2VKE A;  1MSE C;  1WPK A;  2R5Z A;  3ZQL A;  4MIM A;  2Y9Y A;  3BHQ A;  1APL C;  5M5Y J;  3MNL A;  3GTL J;  2LTP A;  5IOZ A;  2HXO A;  2HOT A;  3V78 A;  2HDD A;  3VW0 A;  2ZCM A;  1Q1V A;  3GTO J;  4A3M J;  3HTI A;  1JGG A;  2JJ7 A;  4D7N A;  3TP3 A;  5E3L A;  3IH4 A;  4C2M J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...