3BR0A

Crystal structure of the complex of malachite green bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br0A02
2DA4A 3S1RJ 2H1KA 3JRIA 1ENHA 2RAEA 1HCRA 4NDLA 1OCPA 2M9HA 2IEKA 1XS9A 2K9SA 4BBSJ 2WGBA 1LFBA 5DS9A 4V2GA 1QVUA 2GUHA 4A3FJ 4B3AA 3IUVA 5K7HA 2G7LA 1TWCJ 4QSHA 3BQYA 5BNGA 2EZLA 1NK3P 2DMPA 1S7EA 3RZDJ 3P9TA 5DTDA 3O8HA 4M3GA 2JA6J 3LNQA 1JKPC 3CRJA 5K7FA 4MXMA 3BR5A 3HBLA 2HOSA 2E19A 4MO7A 2JA5J 4IHYA 4XIDA 3VOXA 3L1PA 4MIMA 3ON4A 1HF0A 3S1MJ 1WH7A 3A01B 1GV2A 4M3BA 1DU0A 2LY9A 2RASA 4DZPA 2PZ9A 4AC0A 2JA8J 1UI6A 2CUEA 1ZR4A 3BTLA 2Y0SN 3JR9A 2D6YA 3GEUA 5HAWA 3JRBA 4JNNA 2LTPA 3S15J 3BRUA 3HE0A 2CQXA 5FGLA 4CYCB 1RPWA 5M3FJ 2MG4A 4D5FA 1DU6A 4PXIA 2L7ZA 4BKXA 5EF6A 4UUTA 4M6VA 5F27A 1VI0A 2XGCA 4ICHA 4IHVA 4BY1J 2R0QC 2LFBA 2X6OA 4LOCA 1FTZA 3HTIA 1K61A 5EFYA 2XPVA 2DJNA 3S2DJ 3H0GJ 2XDNA 2NVTJ 2NP3A 3VUQA 2E1OA 3RQIA 1HDDC 3HB9A 2CRGA 4M3EA 1BJZA 3VVYA 4A3IJ 3BNIA 2IAIA 4XRSG 2LP0A 3S14J 2M2EA 2NS7A 2Q24A 4AF5A 5FJ8J 1X2MA 1JGGA 2DA2A 4GCTA 4BY7J 3A03A 3GTOJ 4UUSB 5GPAA 4A3GJ 2ZB9A 1JT0A 1AU7A 3TW6A 5IYCJ 2D5VA 3ANPA 1MH3A 3CDLA 1H89C 1U9OA 2XB5A 2Y9ZA 3MNLA 3SFIA 3V6GA 3QKXA 2TCTA 1ZKGA 3VVZA 1JT6A 3BR0A 2EH3A 1NTCA 5JLXA 1IV6A 1JKQC 2O8KA 2IU5A 5FKMA 1MNMC 1NK2P 2UXHA 3Q0VA 2HKUA 5JLWA 2VKEA 5C44J 2TRTA 2XPUA 1JUSA 3S2HJ 1RESA 2NX4A 3JRCA 4UUSA 5CW8A 4D7NA 3PPBA 4GFKA 3RH2A 5IOYA 4HNVA 2I10A 2HYTA 2DTZA 1E3OC 2O9LA 1WH5A 2RHAA 5J1YA 2HYJA 2E2IJ 4BXXJ 3BG5A 3CCYA 5GPCA 3BTIA 3BR1A 1POGA 2ZOZA 2LR8A 2L7MP 2L0KA 5IP9J 3BJBA 1GV5A 4YZEA 1FEXA 2CQQA 2R5ZA 4GFLA 4KWAA 1ETYA 4C2MJ 1IDZA 4NELA 4CGRA 1MBFA 3FKIJ 3HOWJ 1VFCA 4IHXA 2M8GX 1ORKA 3GZIA 2W48A 3NXCA 5IPAA 4MFEA 3G1MA 4AYBN 4W97A 5E3MA 4BBRJ 2W53A 5D18A 3OSGA 3NARA 3SJMA 2JWTA 3JSJA 1FJLA 5E3OA 3NI7A 1UG2A 3E7QA 3V78A 4X1EA 5IP6A 1IGNA 3WHCA 2LLKA 4S0HB 1TWHJ 3VW2A 3G56A 3I4NJ 3HEFA 2DA5A 2GM4A 3HIMA 5D19A 2Y31A 3K7AJ 4RDUA 2JJ7A 3ZQLA 4UDSA 1LE8A 3Q3SA 3LSRA 5IYDJ 5K7ZA 3E7LA 3GTLJ 3BR6A 1JUMA 1T33A 3IH3A 3AQSA 1ZK8A 2CJJA 2XPWA 4W1UA 4NN1A 2DN0A 1IG7A 1GT0C 5F0CA 1APLC 3WHBA 4MLOA 1U8BA 3ZOBA 5FLMJ 2GENA 4C3JJ 5GP9A 4GCKA 1P7JA 2G3BA 4JX5A 2HXOA 3QBMA 5FMPA 3KKDA 3MVPA 2QIBA 3EUPA 3PM1A 1MSEC 3S16J 1MBJA 3BR3A 1U9NA 3ZQGA 2UXUA 2WUIA 2AHQA 3Q0UA 3NNRA 2ME0A 2FBQA 1HDPA 3BTCA 1AKHB 1JUPA 2P81A 5IP7J 2HQ5A 4AUXA 1ZTRA 3LWJA 2DA3A 1Y1WJ 2QF7A 3FIWA 2QWTA 2L9RA 3TEDA 1GVDA 3VP5A 2OI8A 3RZOJ 2FQ4A 4Y7NJ 2JN6A 3O60A 2QKOA 4C3IJ 3HTJA 3JRGA 3B81A 5C4YA 3HOYJ 2UXPA 2N8GA 1HOMA 1OJLA 5EG0A 4V2FA 3GTKJ 2VKVA 5FKKA 2EQRA 4DYCA 4A69C 2DMUA 3HTAA 1ETVA 1AKHA 3W6VA 2XSDC 1RR7A 2FD5A 3HGYA 3CMYA 4JL3A 2WV1A 2UXIA 5D1RA 4A93J 2O7TA 1O4XA 2QTQA 3RD3A 1ETOA 3BR2A 2NVXJ 2R5ZB 4JX6A 2JK3A 4M3FA 1Z77A 3TP3A 1YRNA 1FIAA 1UHSA 4JP0A 2Y9YA 5HODA 2OF7A 3LSGA 2VI6A 4DZJA 2PBXA 5EDNA 4I76A 3HGGA 4C3HJ 1BA5A 4GCLA 2MGQA 1B8IB 2R93J 5EZGA 3ANGA 3IV5A 1ETXA 3VPRA 3MKLA 1JTXA 1FTTA 1TWGJ 1WI3A 2LVSA 4D5CA 4L62A 2L7FP 3K2AA 1QRYA 2PMZN 2X48A 2ZCXA 1JJ6C 4B1RA 3HOXJ 5IYBJ 5EGOB 1B72A 1LFUP 3GTMJ 3B6CA 3VVXA 2ECCA 1MBHA 3FK7A 3LSPA 3ON2A 3A02A 2HXIA 4RBOA 2AO9A 2ELKA 3S17J 1PUFB 2X9DA 1H8AC 2CUFA 2R5YB 3C2BA 5EEAA 2YVEA 2WAQN 1F36A 2DA6A 2KT0A 2G7SA 3EGQA 3I4MJ 5J1UA 4Y52J 2M0CA 4JYKA 1BW6A 1WGXA 4IEJA 3HOUJ 3BG3A 2CU7A 2QCOA 1JKRC 2YU9J 2KDZA 4A3DJ 2NS8A 2ID6A 3F1BA 2DMQA 5E3NA 2R92J 1EF4A 4XK4A 1IC8A 2VUMJ 2JMWA 3CQZJ 2XB0X 3GBGA 1TWFJ 4QIWN 1JTYA 1PUFA 3DEWA 5C3EJ 2XGEA 4D7MA 5FKLA 1W0TA 2K9NA 3G1OA 1MBKA 3SDGA 1I50J 2YUSA 4ABZA 3LSJA 2K9QA 1CQTA 2YS9A 3S1QJ 9ANTA 2ZCMA 2O7OA 4A3LJ 3C07A 3KNWA 5K58A 1SGMA 1G2HA 3BG9A 2NVQJ 2F07A 3H3VK 3AQTA 1T56A 1MBEA 1A6IA 1RKTA 2FX0A 3BHQA 1D5YA 1K83J 5AQCA 4A3KJ 3HKZN 3GTPJ 2YVHA 5FKOA 1RKWA 4IHWA 3PO3J 1B8IA 1UMQA 1BW5A 3JRAA 2EZHA 2LK2A 3JRHA 3TW7A 4JX4A 1HLVA 1MBGA 2DMTA 5E3LA 5EG0B 2GBYA 4XRMA 1ETQA 5EGOA 2GFNA 1QVTA 2NP5A 1JKOC 5CXGA 1OCTC 5FHPA 1VNDA 1ZQ3P 3VW0A 5M5XJ 2XRLA 3G1LA 4DYQA 1ZR2A 3G7RA 1UI5A 2DG7A 2VPRA 1JJ8C 3ZQHA 3IH2A 3BCGA 4CYCA 1F43A 4A3MJ 2H8RA 3NPIA 3VIBA 5C4JJ 3KKCA 3GTJJ 3ZQCA 4FTHA 3M4OJ 1OFCX 3DPJA 4FE4A 2WB1N 3IH4A 3HOZJ 1SANA 5F0HA 1WPKA 1Z0XA 2DA7A 3OSFA 2R5YA 1YRNB 2ECBA 2E2JJ 3VW1A 1FIPA 3GTQJ 3LJLA 5H9TA 3HTHA 1A5JA 2FJ1A 2NOGA 3S5RA 5M3MJ 5M5WJ 3RKQA 3BT9A 4XRSA 2LD5A 1RETA 1X2NA 1I3QJ 2R7ZJ 2B63J 3HDDA 3FRQA 3B6AA 4EEFG 4ME9A 3M3YJ 2DG8A 3FISA 5J3LA 5IOZA 2M34A 3LHQA 4I6ZA 1GDTA 2HDDA 1MSFC 2UXOA 4FCYA 5F04A 4HKUA 2HI3A 2Y30A 2ID3A 1TWAJ 4XICA 1P7IA 1GUUA 3OIOA 1B72B 1AHDP 2EBIA 5HSZA 3VOKA 4L5EA 5F08A 1IUFA 1X58A 3COLA 4FE7A 2COBA 3TP0A 3ZQFA 2REKA 2G0EA 2DMNA 1XG1A 1I6HJ 5J1RA 1MH4A 2G7GA 3QPLA 2QOPA 2ZCNA 3NRGA 5C4XJ 2MW8A 5DAJA 3O8GA 3JRDA 2LKXA 3NAUA 1TC3C 5F0FA 1H88C 4J19A 1ZGWA 2NVYJ 1ETKA 2ME6A 2OERA 1Y1VJ 5EZHA 2Y2ZA 3ZQIA 1IRZA 1XC5A 1VF9A 2MSYA 3HM5A 2ZOYA 1ITYA 3KZ9A 1SFOJ 1IJWC 3HOVJ 4ACIA 4A3BJ 2EZIA 2K40A 5HBUA 5FLVA 4G12A 3A01A 3S1NJ 2DA1A 1ETWA 5FKNA 4A3CJ 1Q1VA 4B4CA 3DCFA 1U78A 3PO2J 3FK6A 3OOUA 2V57A 3Q0WA 1IDYA 2HOTA 5F1JA 3CJDA 4FISA 1R9TJ 2EZKA 2IBDA 4GFBA 2GLOA 2OPTA 3LOCA 4QTRA 5CXIA 4M3DA 4JKZA 3JRFA 1WCMJ 4A3JJ 3MN2A 3PASA 4AC6A 2JA7J 1BL0A 4DYRA 3F0CA 3JREA 2E2HJ 1QPIA 1W0UA 2HOAA 4MK6A 3GTGJ 4X6AJ 4A3EJ 3CWRA 3D1NI 2XGDA 3T6NA 3QPSA 3UKGA 3BTJA 5M5YJ 5EYRA 4MFDA 3BQZA 1LE8B 3QQAA 4DW6A
chains in the Genus database with same CATH superfamily
3S1RJ 4AIHA 3VB2A 3RKXA 1XS9A 2VJ5A 2G7HA 1R36A 5DS9A 1WJ5A 4DQ2A 2GUHA 3OYAA 3FM3A 2MC3A 2MBFA 4Q48A 2H8WA 5K7HA 5L3FA 4FHTA 2GQQA 3BQYA 5EJCA 3FKJA 5HNFA 2G7LA 4UHTA 1S7EA 3ZMTA 1LKXA 2Z9OA 3LA2A 1JKPC 5K7FA 4KFCA 2LMDA 3HBLA 2XIGA 2YR2A 2Q0OA 2E19A 5D6FA 2DT7B 3F8BA 3VOXA 4ZJZA 3TOAA 2ZFUA 1BM9A 2Q2EB 3DKYA 1OYWA 4RGUA 1HF0A 3BCAA 3PJRA 3S1MJ 1I1SA 2XUBA 1GV2A 2VB6A 4M3BA 5LBQA 1T6SA 2LY9A 4IOCF 2RASA 2JA8J 2CUEA 3AKZA 2XDVA 1NH3A 1P4AA 2ZJ2A 2ZNYA 4A12A 2D6YA 5DD4A 4PFOA 5BQTA 3P9CA 2LTPA 4JNNA 3SYTA 4BJ5C 3HL2A 1HKQA 5DM6F 3IRRA 5EF6A 3HRMA 1W7PA 5F27A 4ICHA 1VQMI 4BY1J 1KYWA 2ADUA 4CCOA 3WU1B 3MAJA 1XGSA 1M1EB 2DJNA 3E5UA 3MCZA 2H94A 5H2FC 5IT3A 2RV8A 2RN7A 1GHCA 4OAZA 3VUQA 4HSTA 1YX3A 3PNTA 3BLYA 1HDDC 2KLOA 4L9JA 1AA7A 1ZRDA 1BJZA 2EILH 1KU2A 1X1BA 2QQAA 3FXMA 2IAIA 2LSOA 2YPRA 3PUFA 2EJRA 3N4MA 1ZH5A 3MKZA 2NS7A 1A31A 2Q24A 4AF5A 1X4PA 1X2MA 4J00A 1B1BA 4BY7J 4UUSB 4L5JA 4B09A 4II2A 5ERIA 4KYWA 5IYCJ 2D5VA 4P9UA 1F9NA 3K4JA 3LQRA 1FOKA 3MNLA 2Y9ZA 3V6GA 3SFIA 5LLQA 1PP7U 2TCTA 1ZKGA 1JT6A 2FEZA 1MDMB 2O8KA 4EJTA 1O7LA 1GXQA 2HKUA 5JLWA 2GAUA 5F1RA 1VZ0A 2TRTA 1JUSA 3H5AA 4BDZA 3I4PA 3PPBA 2HVQA 2X4HA 4HNVA 2KRHA 2DTZA 4R1HA 4UVAA 1E3OC 4OIRF 2CWEA 3S2WA 4BXXJ 3BG5A 4NC6A 2WADA 5GPCA 1POGA 4YELA 5IT9K 3Q5FA 2PG4A 4CCMA 3ERMA 2Z1DA 3DPUA 5HNHA 5HS8A 4KT5C 4KICA 3K4NA 1FEXA 4MHGA 4GFLA 1WRJA 1YW8A 1VFCA 4IHXA 4AIKA 2LOOA 4N9IA 3G4SI 2M8GX 3HHGA 3GZIA 1JXSA 4D1QA 2ZMEA 4BQNA 3H3ZA 3DKXA 3L2CA 5E3MA 1Y0UA 4BBRJ 2W53A 4CHUA 3OSGA 4LLLA 4RLFA 3JSJA 1FJLA 1SMTA 3E7QA 2CSOA 5GAHJ 4OD4A 1IGNA 4BE0A 3OL3A 1TWHJ 3G56A 3I5UA 3HEFA 3VDXA 2H1LA 2GM4A 2BVLA 1F1ZA 2V1UA 5D19A 1B4AA 1WQ2A 2Y31A 3K7AJ 1YYVA 1NG7A 2JJ7A 4HPQA 4PGGA 2DDAA 3ZQLA 3Q3SA 2HDWA 3F8FA 3LSRA 2VIXA 1A04A 2F48A 1JUMA 3IH3A 4P5OA 5D4SA 2HR3A 2JT1A 3NWTA 2XPWA 4C2TA 2DPUA 1IG7A 1IV8A 3CCQI 4ETSA 1X19A 3JTHA 3WHBA 5AONA 1SD5A 4EM1A 3ZOBA 1YIOA 5FLMJ 4C3JJ 2P5VA 2PQ8A 5GP9A 5IY5H 5D8LB 5KHDA 4YRVA 4I98B 2UV1A 2G3BA 4JX5A 2HYGD 5ILSA 5CLSA 3MVPA 3C3WA 4MQVA 3PIOF 5B3SH 3SFZA 3EUHC 3EUPA 4XONA 2H6BA 3BR3A 2M1BA 4WXCA 3EDPA 2UXUA 5E18F 1KU7A 3Q0UA 1R4NB 3H36A 4N0BA 3J80K 4AVPA 3QYBA 5HVQC 5GAGJ 2ME0A 3QP6A 1HDPA 2BY0A 1YHQI 1JUPA 2P81A 2QWWA 5IP7J 4OIOF 4AUXA 4V19K 2QLZA 2K02A 1JI8A 3O6BB 3WTTC 4ON0A 2L4MA 1R1TA 1V5GA 3FWEA 4LG0A 1GVDA 2OI8A 4Y7NJ 1TBXA 2JN6A 2QKOA 1KQ8A 2Y48A 4BEHA 3C1DA 3QYEA 3HTJA 1O57A 4KMUX 1FSHA 4V2FA 5FKKA 2CV1A 2WV0A 3W6VA 2MH9A 2O8XA 1RR7A 4NBQA 4X0GA 4AIJA 1JHHA 3SWHA 1S7AA 1O4XA 4BQQA 1ETOA 2FBKA 3E3VA 2HVRA 4M3FA 3ZMVA 1UG0A 1T38A 3SZGA 2JPBA 2OF7A 3TO9A 5HODA 1W5TA 2PBXA 3WTZA 2LKSA 3H92A 4C3HJ 4GCLA 1IRGA 3K1NA 3IV5A 3T8RA 1FPQA 1ETXA 1FSEA 1DQUA 2AQEA 2XAUA 3E97A 5ILVA 3M8EA 2LVSA 2VBZA 2VQLA 3FXJA 2L7FP 2VJ4A 4D5CA 3G71I 4L62A 3KEOA 2R7WA 4KIBA 2A69F 1STZA 5DCFA 3OV8A 3BC8A 3OR1C 5EGOB 1Z67A 1WVRA 1LFUP 3B6CA 4PFPA 3ON2A 1R5GA 3A02A 5DCMA 6PAXA 1T0FA 4ZC3A 5E1WA 2ELKA 2EV6A 3KP6A 4F7ZA 3KIOA 4EJWA 1EJ9A 2YVEA 3I59B 4IVNA 4I2OA 1RIOH 2DA6A 2V1NA 3P7NA 3I4MJ 5J1UA 2GWRA 1FC3A 5BPDA 4JYKA 2OCEA 1MMAA 3FXKA 2W84A 5GTHC 2JA2A 3BZ6A 4FX4A 4XM3A 3FXLA 2R7FA 1JKRC 2YU9J 3AG1H 1E17A 4RMNA 2L9VA 1XSDA 3FBIB 3DLLF 1ZRCA 2JUGA 3ABLH 2W00A 1Z1DA 3R61A 5C3EJ 4I01A 3K4MA 2XGEA 3ZMDA 5FKLA 4B48A 1OISA 1W1WE 4PJMA 4I99C 3KEQA 3NQOA 3KZYA 5KK1A 5KAIC 4PGHA 5E8GA 4XKCA 1DUXC 2O7OA 3HZJA 4A2UA 3OY9A 3BDDA 1D1AA 1SGMA 3FDYA 3BG9A 2W24A 1GXPA 1FNNA 4UV8A 2V9PA 5BMZA 1MBEA 2FX0A 4CCNA 1K83J 5AQCA 4A3KJ 3HKZN 3BJ6A 1RKWA 3BOQA 4OIPF 1UMQA 4XL9A 1R5HA 1RUOA 3JRAA 2VJJA 1KQ0A 3LWFA 5J8FA 4QPOA 2LK2A 3E5QA 4P1WA 1HLVA 1I5ZA 3T1BA 3TL4X 4XRMA 5EGOA 1A36A 3M7GA 3ZN1A 5CXGA 5FFZA 5FHPA 1ZQ3P 1PUEE 3WG9A 3WTSC 4EJVA 2F5EA 2VPRA 4HLYA 2L02A 2F5DA 3BCGA 2H8RA 3VIBA 2A07F 1WSUA 1S3JA 5AIPA 1LNWA 3D5LA 2HTJA 5FRMA 4KIFA 4WF2A 5CVUA 3M4OJ 1I6XA 5F0HA 1NHAA 2WA0A 1Z0XA 3OSFA 2R5YA 1MMDA 5E20A 4C9YA 4GDFA 2CV2A 4HBLA 2FMLA 2BE5F 2FJ1A 1ZHFA 2DOEA 5M3MJ 3RKQA 4XRSA 1RETA 5LRRA 1HW5A 2B63J 3WE2A 2DG8A 3FISA 3LL7A 5IOZA 2JRMA 2GOXB 4I6ZA 3ONQA 1V55H 1GDTA 3ML6A 1J9IA 4LGWA 5F04A 3ELKA 3GW2A 1P7IA 2HTSA 4E7IA 1B72B 3IRQA 5HSZA 2ELHA 4IQ4A 4PJNA 4I0AA 3H5RA 4G7OF 3TP0A 2REKA 1XG1A 2QOPA 4DVYP 1LEBA 5JVTA 4F93B 3CP2A 1ULYA 3A4CA 5DAJA 5HLHA 3NAUA 3GZNB 3K8PC 4BL0B 2GA1A 1H88C 4OMZA 4LJZF 1HW1A 3LMMA 2RKHA 3AFHA 4N4NB 5EZHA 2Y2ZA 2ISYA 5HDNA 4XOPA 1FOWA 2K4BA 5DV5A 3KP5A 2J5PA 2MSYA 2ZBKA 1ITYA 4G6TB 1Z7UA 2RQQA 4DBRA 4ZYDA 3VSLA 5D5WB 2EZIA 5FLVA 4G12A 1Z91A 2MABA 1YW9A 3TMOA 2XKPA 3S1NJ 1MJ9A 2MH2A 4S05A 3TDUC 4IO9F 3V8LA 5DYMA 2W25A 4I09A 2F5VA 3IKVA 1K6YA 1U78A 1XX5A 1XMXA 5LGUA 2L3DA 3RPUA 2V57A 1E3PA 3AAFA 4CCLA 4FISA 2DXIA 3C7JA 1LB2A 3GLXA 2KISA 2EIJH 2XF6A 4GFBA 4FASD 2OPTA 2GLOA 2E34A 4BH9A 2XKOA 1VQPI 1YG2A 5CXIA 4JKZA 4ESJA 2R7SA 1WCMJ 2W4SA 2XSJC 1SFKA 2GOMA 4DYRA 2LDUA 2V6CA 3L00A 3O2PE 3JREA 2E2HJ 2GZWA 3KETA 4EJOA 4AU7A 4LD5A 4F52A 1W0UA 2HOAA 3ABTA 4MK6A 4G7ZF 1MW7A 1XN7A 4LITA 3VTIA 2HZTA 1WJCA 1NG6A 3QPSA 2DO7A 3BTJA 4UUVA 2M4KA 5EYRA 1OQYA 3QQAA 3RPQA 4DW6A 1P92A 3PNVA 4L9TA 5K5OA 4PSWA 5LGNA 4BHCA 2E71A 2VBWA 3I9V2 2R7TA 3GWZA 2IEKA 4CCJA 1IRFA 2EINH 2M30A 1A35A 4BBSJ 2WGBA 2UUZA 1QVUA 4H0EA 3F8NA 2CQNA 2TDXA 3GFMA 2ESNA 5E8IA 3K70C 1NK3P 1O3RA 1KYZA 2DT5A 2EZLA 2KRFA 1CF7A 2YVXA 4IF4A 2B3WA 2KPMA 1I1GA 2ZMEB 3LNQA 3V7SA 3LAJA 2IP2A 2BZTA 3K4KA 2HOSA 2IGOA 2KDOA 4RB2C 2R7UA 2MLKA 3QPHA 4MO7A 1U0JA 2HKOA 1REPC 4OINF 4IZZA 1U3EM 1QZZA 3KP2A 2IJLA 2RDPA 4NNJA 3A01B 2H27A 1W7PD 4XLPF 4HRIA 3QRFF 2V9VA 4Y3OA 2LYCA 4MNUA 2QSGX 3W2AA 4KUMA 1GLNA 3J81Z 3CDHA 2CW7A 2QUFA 2VKHA 4XKWA 1E2XA 1VQNI 3S15J 3BRUA 5LEKA 4CYCB 2XHKA 5M3FJ 2MG4A 4M71A 3U1DA 1BIBA 2Y75A 3RDIA 4BKXA 2OAZA 3KP3A 1FT9A 4WX9A 1QQIA 2Q2EA 3RYPA 2XGCA 4IHVA 3I0TA 2R0QC 2LFBA 1TQIA 1S5LC 1S6LA 1K61A 1USTA 1X1AA 3RCOA 4Q5SF 1WHUA 1Z9CA 1YJWI 3QWLA 4RAZA 2XDNA 2NVTJ 2NP3A 3RQIA 3IWFA 1JHFA 2CRGA 2QVOA 3DU5A 2UXXA 3RQ4A 3BPXA 4A3IJ 4D9JA 1D3YA 4HDUA 2LP0A 1K79A 4U9NA 3CUQC 1FYMA 2VQCA 2HEOA 1OYIA 5KNLA 3GTOJ 5GPAA 4RA2A 3L2UA 3TW6A 2MLGA 1W36C 1VQ6I 3CDLA 3IAM2 1H89C 2RNGA 1RZ4A 4NQWB 1BBYA 3QKXA 3J7YJ 1U2WA 3VVZA 4YFKF 3I53A 1NTCA 1IV6A 2IU5A 2LC2A 3HIFA 3H9JA 3Q0VA 4O3MA 2KIMA 4LMYA 3JW4A 3IP4B 2VXZA 2OV7A 1T8IA 4ANJA 4KN4X 1L3LA 5TISC 4UUSA 3QOPA 4D7NA 5CW8A 3RH2A 1Z05A 5IOYA 1SVLA 1R7JA 3H9GA 5DUKA 5JFRA 2O9LA 2R7VA 1IXCA 3HRUA 5J1YA 2IT0A 3D5RC 3WGGA 3BTIA 1N78A 2W1OA 3HJEA 2ZOZA 3PUBA 2ZFWA 3FMRA 1SVMA 2QSHX 3CD6I 2K3FA 4K2EA 1ZRFA 2R4GA 2ZXIA 4ZYHA 4RB0A 5K1YA 2R5ZA 1ZYRF 2XF5A 2WAQA 2GXBA 1IDZA 1DPRA 4CGRA 4XLCA 5CVIA 2W48A 1G3TA 3NXCA 3OYNA 5IPAA 3GFLA 3PSIA 3F3XA 4ZYGA 4AYBN 3O3KA 2HQNA 1UCRA 3GF2A 4ZYEA 2VOPA 2RQPA 4BU2A 2FOKA 2Y0MA 3NARA 3SJMA 2JWTA 3K69A 5E3OA 2PJPA 2MA3A 3FXQA 4X1EA 3WHCA 5LGTA 4MQ9F 1BI0A 3K4CA 3CLQA 1QA6A 5JR3A 1H9TA 4UDSA 2YSRA 3HTSB 1MJAA 1XSXA 3E7LA 2M5WA 3QAHA 2M0MA 3AQSA 4OD5A 1ZK8A 4U9LA 3A0BC 3W2WA 2LNBA 2Y0SA 2WC2A 4W1UA 5D5VB 3FX3A 4J01A 5F0CA 1O3SA 3CMEI 1SAXA 3OYHA 3CCUI 3DU6A 2ZXJA 3REOA 2HZDA 2V9KA 4HV5A 2GENA 3IUOA 3OIPA 3CJNA 5AIQA 1P7JA 1R23A 4BAYA 3QBMA 5FMPA 3KKDA 3PNYA 3A2KA 3U1KA 2E1NA 1KGSA 1E3HA 2V26A 1IN4A 4BHPA 2K5CA 3FHNA 2QQ8A 3LA3A 1U9NA 3OYMA 3ZQGA 2NS0A 4ENNA 2WUIA 2AHQA 1HSJA 1XD7A 4UXNA 5L3EA 5FD5A 5FO5A 2CW8A 2NNNA 1AKHB 4XKBA 2ZY9A 2KIQA 2HQ5A 2V7FA 3V42A 3LWJA 1MZBA 1Y1WJ 2JVHA 2YU3A 2QWTA 1XPXA 2L9RA 1OR7C 3OWTA 4KITB 1PP8F 4C3IJ 1OYYA 3JRGA 3B81A 4BDYA 1LVKA 3RTRA 2N8GA 1HOMA 1OJLA 4EM0B 3GTKJ 2VKVA 3CCSI 3COAC 2EQRA 2FXAA 4PDKA 1ETVA 1YOVB 2P6SA 1AKHA 2D45A 2PI0A 3CJRB 4JL3A 1XTAA 4PUSA 1BJAA 5E1XA 2UXIA 4Y17A 1K6OA 1IO2A 4A93J 4JOMA 3RD3A 1FY7A 2DI3A 3DKWA 2NVXJ 3R0AA 4JX6A 1YTYA 3R60A 4HZFA 3F22A 1QBJA 3K9TA 4HSRA 3DPTA 4RAGA 3B73A 1UHSA 3GXOA 2QSFX 2Y9YA 4P55A 4RGRA 3V4GA 2GXGA 2ZCWA 3LSGA 2VI6A 1P4WA 5EDNA 4I76A 3HGGA 3CCVI 1BA5A 2MGQA 5H6RA 1XMKA 3UR3C 2RVCA 3HPHA 2H09A 1FTTA 2I5UA 1N75A 3ZR8X 4XLFA 1QRYA 2NYXA 2PMZN 1SFXA 4JK1X 3GYHX 2VC1A 3K0LA 3MFKA 4B1RA 3SZPA 3HOXJ 1V3FA 3JAMZ 1YJ9I 2IS4A 4HF0A 2B0LA 2DQLA 3SXYA 3JSOA 2DAOA 2L9NA 2HXIA 3HC7A 4G7HF 1D0YA 3G73A 3L2WA 1SFEA 3VYTB 2HFHA 2X1EA 2GA2A 2WY8Q 2M0CA 4PJJA 4ENKA 5ILUA 1WGXA 4DIQA 3OYFA 4ZH4F 2O61A 4IEJA 3L09A 3R4KA 2CU7A 3MQ0A 1WZ2A 4IL6C 3P9KA 3VYRB 2NS8A 1BOAA 2ID6A 3F1BA 4A0ZA 4BE2A 3OS2A 4BS9A 3S32A 1TL8A 1EKEA 3CQZJ 3BZCA 3GBGA 1JTYA 4BXFA 3DEWA 5DM7F 3H1CA 3IC7A 1D8JA 1J59A 1R5ID 2XAHA 1X1PA 3J7ZI 1Q1HA 1I50J 3SDGA 3LFKA 4ABZA 2QKLB 3CO6C 2NXNB 5ICEA 1CQTA 3S1QJ 3C07A 2DFEA 4DBQA 4A3LJ 2ZCMA 5K58A 1G2HA 2OCCH 4HEA2 2NVQJ 3J7AY 2F07A 3H3VK 4RLQA 2ZC2A 5LEJA 1RKTA 4A5NA 2CO5A 1G59A 3CUOA 1WJDA 3PFYA 4CO8A 2ISZA 5FKOA 3PO3J 1SVOA 1BW5A 3EUHA 1H0MA 2PJRA 3TW7A 1BR2A 2M87A 2ZJRF 2DMTA 4EMSA 1ETQA 2M3AA 2GFNA 5BS6A 4EGYA 5FRNA 1PJRA 3AL0B 2XF7A 4Y15A 3ASNH 3BG6A 3G1LA 4UB6C 4DYQA 3G7RA 2DG7A 1JJ8C 2AQFA 3QP5A 4HX8A 1Z6RA 3LSMA 3L7WA 4FTHA 2F6CA 2IW5A 2A5WA 4FE4A 3AG3H 3IH4A 2DPDA 1IN7A 1SANA 1S9HA 2DA7A 2XROA 2EV5A 3HTUA 3LFUA 3BJOA 3HTHA 2IVMA 4FETA 5CKTA 1A5JA 1YIJI 2ZJQF 5M5WJ 1Y8QB 3QODA 2R7QA 1RUNA 4M6XA 3GFIA 5GAEJ 4CZZA 2K27A 2JVGA 3B6AA 4EEFG 3CLOA 1S29A 1FX7A 1IN6A 3BWGA 3HKZA 2V79A 2M34A 2P6TA 1T95A 4HV6A 1X3WB 4G6QA 2FE3A 2RNJA 4FCYA 3DP7A 2O0YA 1W5CC 2ID3A 2COMA 3JAMK 4KNYA 3OIOA 1X1CA 5KVRA 3SZTA 2PEXA 1O3TA 3VOKA 2JTVA 1IUFA 2A3SA 4FE7A 4RM3A 2DOFA 5GADJ 3CCRI 4XBFA 1ZLJA 2JQ7A 4Q47A 3UNGC 5J1RA 2A61A 3NRGA 5FLXZ 1C0WA 4MEXF 1U5TC 4CDGA 1TW3A 1Z3YA 2VL8A 1VQLI 4BHBA 4MEYF 1ZGWA 1D0XA 3I64A 2NVYJ 1ETKA 2BHYA 2OERA 5ED4A 3F9KA 1CF7B 2FBHA 3IAS2 3VSKA 3S3OA 1XC5A 1WI9A 4BJ6C 1BR1A 1SD4A 4CYDA 5JVGF 2DYSH 1SFOJ 3KZ9A 2ETHA 3K4BA 1WJEA 2K86A 2HPMA 4EV0A 2ZO4A 4IOAF 1OMIA 2F2EA 2DA1A 4PJLA 3KZIC 2VN2A 4ZYAA 4CH7A 1BC8C 2CS3A 3J7AO 3DCFA 3WTYC 4GO1A 2L5QA 2HOTA 1IDYA 5F1JA 3NEUA 1ZGJA 2IGKA 4M6YA 3ABKH 3GO5A 1YFHA 1T98A 2HKXA 4QTRA 1YI2I 4LIVA 3TGNA 2K3PA 3MN2A 4IRVA 3GFJA 1HW2A 2DBBA 1Z3XA 2W57A 3Q9VA 2EPFA 3WGIA 3KZZA 1YJNI 3AG2H 1TZLA 2KJBA 4HW0A 2O3FA 3GTGJ 5HOOA 4CZCA 3D1NI 2F4IA 5M5YJ 2QM3A 1MIJA 2DA4A 3JRIA 2RAEA 3N05A 1ONVA 4L9VA 3LAPA 3OS0A 1KONA 2O03A 3OYLA 5E17F 1LFBA 1BOBA 3CMAI 2BGCA 4A3FJ 2OC6A 5K5QA 4C2MA 1TWCJ 2WB1A 4QSHA 1LQ1A 2P4WA 4A6DA 2X0LA 3RZDJ 5JHUA 4S04A 3P9TA 4R8HA 1MDMA 3V7RA 2JA6J 1EV7A 3CRJA 2ZSIB 3A0HC 3BR5A 4HYEA 4ASNA 4PK4A 5ICGA 3V8KA 2HU9A 1BI2A 3GCMA 2IS1A 3FZVA 1OCRH 3U21A 3N97A 2Z5UA 2EB7A 3L1PA 4MIMA 5LHHA 3ON4A 2M45A 4NC7A 4PJ0C 2DT6A 1WH7A 2OD5A 2IS2A 3CC4I 3ZP5A 2PZ9A 2LF7A 3OYKA 3BTLA 3SEZA 2I8DA 1SD7A 4E7LA 2Y0SN 3JR9A 4XMYA 4P96A 4AD9A 4HNUA 2WTEA 5FGLA 1LJ9A 1I3AA 4PXIA 1VQ8I 2OA4A 4UUTA 3GZ6A 2R3SA 4M6VA 2M8EA 2PFVA 4HQEA 2VQGA 2X6OA 3ESWB 3G2BA 4LOCA 3HTIA 5TRDA 3S2DJ 3H0GJ 5DCMB 3K1PA 4JBAA 3RKYA 1D0ZA 4QLCU 2GIVA 4LIUA 1ZARA 5A2QK 2VC0A 2VT2A 1HC8A 3E0JB 3I71A 4HOBA 4XRSG 3S14J 3D0SA 4E7JA 1UHWA 1W36D 4IHTA 4ZDLA 2DLLA 2UZKA 1FP1D 2IGMA 4A3GJ 3OL4A 1YLFA 3BY6A 2ZB9A 1V5EA 1JT0A 4E7ZA 4BE1A 3ANPA 3HOTA 1MH3A 2HOEA 1TT5B 1EH8A 4ZTJA 2ZKZA 2KFDA 3ABUA 4EGZA 1U5TB 4MTEA 2FNAA 1VQ9I 1JKQC 3MZ8A 5FKMA 2OBPA 2UXHA 2DFIA 3S2HJ 1G3YA 5B66C 2WWYA 1Y8RB 1RESA 2CQKA 3HHHA 3F8MA 1Y56A 4AWXB 4GFKA 2I10A 4U0VA 2RHAA 2E2IJ 5FROA 1XDSA 3TDZC 2LR8A 2L7MP 1B9NA 2HGCA 2A68F 3GMEA 4Z2YA 1Z21A 5IP9J 3BJBA 2VT3A 4D0PA 4YZEA 3CF5F 1G3SA 1TT0A 2CQQA 1J2XA 4L0ZB 1ZELA 4CICA 1OKRA 5A2QZ 1VQ7I 3ABMH 1ETYA 2OJED 4C2MJ 4KWAA 3LSTA 3TO6A 4NELA 2BXYA 3L2RA 1BI1A 1MBFA 1QZYA 3C2HA 3FKIJ 3DEUA 1U8RA 1UAAA 4XQFA 2BY2A 1VTNC 1XGNA 4MFEA 3G1MA 4YEJA 2VOOA 4EQQA 4XKVA 1G8XA 2G9WA 2FA5A 5D18A 5EEHA 2KHMA 4B43A 4G94A 1WKMA 1IRXA 1S7OA 2BW3A 2FJI1 3H5NA 3CC2I 1LEAA 1BIAA 3G3ZA 3NI7A 1UG2A 3V78A 2LBFB 3L9FA 4LK0F 5IP6A 2NRAC 2LLKA 3KFWX 4S0HB 3DTEA 3DWLE 3J81K 4IPAA 1ERDA 4RDUA 4XN0A 1LE8A 3DBRB 2A6EF 1KZHA 2F5FA 3EQLF 4KN7X 5K7ZA 3GTLJ 2D2WA 1DGWY 3KCCA 1J09A 3WU0A 1R71A 4IJAA 2JPCA 4NN1A 1Y6IA 2CYYA 2OUMA 2BEOA 1S72I 1APLC 2HYFA 4FX0A 5D8KB 1R22A 1U8BA 2L01A 3DBLB 1D1BA 4GCKA 1QNTA 4Y4RA 4HDVA 4A5MA 2HXOA 2UWMA 2E1CA 2RGVA 2MD0A 5ICCA 2QIBA 5HLIA 1MSEC 3S16J 1MBJA 2DTRA 3DEEA 1XDUA 2CW0F 4M9SA 1OLTA 3FHZA 1BR4A 1DP3A 3PFIA 4BQAA 5LRSA 2E1MC 1V4RA 2LKPA 1TTYA 4P9FA 3BTCA 2EA4A 2EWNA 2M7BA 2DJIA 3E1SA 5ICFA 4ZDOA 2BY3A 2XAQA 2QF7A 2E60A 1OCCH 3VOEA 4CCKA 2FQ4A 1WFXA 3O60A 4WK8F 1ON2A 2KKOA 2OTJI 5FD6A 2LREA 5C4YA 3BZKA 2V4JC 3DTKA 4U0WA 3HOYJ 4XN3A 2UXPA 1ZG3A 3TOBA 2L2OA 4RGXA 3LSIA 2DMUA 3HTAA 3E6MA 1ZN2A 2MYSA 3W6JB 2FD5A 3BROA 4DNCA 3CMYA 1RC9A 3ECOA 1Z7LA 1PDNC 1P2FA 4N9HA 4LG3A 4L9NA 2VBYA 2MC4A 5D1RA 2QTQA 2K4JA 4KA4A 2CV0A 2Z3YA 2VKDA 2R5ZB 3KP7A 2P7VB 3E5XA 4CSWA 3FM5A 2EFQA 2X85A 2JK3A 2OZ6A 3CP8A 1YRNA 1FIAA 2CQ7A 4JP0A 4AVZA 2XC7A 1S8NA 3EUAA 2VBXA 2PX9A 2PLYA 2FF4A 2DODA 1A6QA 2IA1A 2R93J 5EZGA 4F55A 3LQQA 5FLXK 2BBYA 1TLHB 3SDBA 5CPRB 5LHGA 3WU2C 3K2AA 1HBXG 1K78A 1N77A 1J7KA 2X48A 4E70A 1BC7C 3WE3A 2EV0A 5IYBJ 3GTMJ 4OOIA 2XVCA 2ECCA 1MBHA 3FK7A 4WXHA 2P7CB 1VQOI 1R4MB 3OYDA 1YITI 3JCUC 1PUFB 1QZEA 3BG7A 2CUFA 3DXJF 1FMVA 2R5YB 1LFPA 3C2BA 2WAQN 2E7XA 3V7CA 2G7SA 3EGQA 3DV8A 4Y52J 2BYVE 2JRTA 2XAFA 3VFZA 3HOUJ 3BG3A 2A6HF 2K9LA 1MMSA 3C18A 2KDZA 3EYYA 5E3NA 2R92J 1EF4A 4XK4A 2VUMJ 1R6RA 3TQNA 2MD5A 3BCBA 2ZXWH 4D7MA 4BUPA 2VE8A 1W0TA 2QYOA 3KLNA 1EA3A 3G1OA 1MBKA 2HQAA 1Y39A 1F5TA 2YUSA 3LSJA 2CG4A 2DK8A 3TBIA 5JHFA 2XAJA 5L3CA 4L0YB 2YX7A 4LK1F 3KNWA 4BNCA 3FF5A 3WG7H 2P5LC 3WTVC 4B44A 1LDDA 2CFXA 1T56A 2HQRA 2L7KA 4B47A 1D1CA 3WTUC 4U0YA 3U2RA 1D5YA 2E5NA 4XORA 4Q4ZF 4II3A 3GTPJ 3ISPA 2QZ8A 3K2ZA 1RR8C 4E7HA 1LVAA 2OZUA 1B8IA 2EZHA 1DDNA 1B59A 4JX4A 1MBGA 5E3LA 2UXNA 4I7HA 4QPQA 2Q8KA 1FOXA 2XV4S 2W7NA 3ZQQA 1QVTA 1G4DA 3CJTB 1VNDA 3VW0A 5M5XJ 2XRLA 2EFOA 4XLNF 3R0JA 5CVRA 3KYDB 3SHFA 4LLNA 1ZR2A 1UI5A 5CQGA 4ZDPA 3AL0C 5DD8A 5B1AH 4CYCA 1R58A 1L0OC 3BP8A 1FBQA 1F43A 2STWA 1QHHD 2P5KA 3FXRA 5CQEA 1OR7A 2FNPA 1OFCX 3DPJA 2WB1N 5D6EA 3HOZJ 3P5JA 3A1YA 4ENJA 1YRNB 1TQMA 1MJBA 1TW2A 3VW1A 1FIPA 1FBUA 3M07A 5H9TA 3S5RA 4RB1A 2F4OB 3BT9A 2LD5A 2BHZA 1X2NA 3CF2A 1I3QJ 1TQPA 2LY1A 4LB6B 2B9SA 2R7ZJ 3HDDA 4IRIA 2KZGA 1N25A 3HSEA 5J3LA 4AIDA 3OS1A 4HX7A 3ZXSA 2FSWA 4RAYA 2HDDA 1MSFC 2PBIA 2UXOA 3NRVA 2QQBA 4OU0A 3MKYB 3M1CA 4GRIA 2IXSA 2A05A 2AXLA 2DCEA 3PL8A 4XICA 3PQKA 1GUUA 1X3ZB 4CXFA 1AHDP 1QHGA 4FQGA 2EBIA 3ZPLA 3ASOH 1T2KA 3H9QA 2DQRA 4DOZA 3K1MA 4XLAA 3H0DA 1E0EA 2AXTC 2G0EA 2DMNA 3BPVA 1SC7A 4F3QA 1I6HJ 4EJUA 1I39A 4YG2F 4CA0A 4YIIA 5C4XJ 2MW8A 2FUG2 1Z6TA 4KDPA 3CCLI 3O8GA 3JRDA 2A2FX 3L2QA 2LKXA 2VJIA 3ZN0A 4M74A 5F0FA 4DGWB 1QGPA 2ME6A 4B3XA 3WTWC 5TJJA 3ZQIA 1IRZA 1VF9A 2K9MA 4YFNF 1WJBA 4ACIA 4A3BJ 5D5XB 4CGZA 5LFAA 1KU3A 2IA2A 1GVJA 3A01A 2QKMB 2M7AA 4RB3C 1MMGA 5FKNA 1Q1VA 2BV6A 2C6YA 1TNSA 1IF1A 1OCOH 1F4KA 4E4HA 3HXLA 2X1DA 3CJDA 1O7FA 3QU6A 3HPGA 4MTDA 2EIKH 2XGXA 2BOLA 1SMYF 3KYCB 4XOTA 1QU3A 4M3DA 2RC4A 3JRFA 1MGTA 4A3JJ 3OYBA 3PASA 3F8CA 4AC6A 3F0CA 1FLIA 3RIRA 1ZLKA 2A6TA 5FGMA 4HLXA 3W2VA 2EFNA 3CWRA 4NUBA 1P9QC 3HUGA 4I0BA 3T6NA 3UKGA 2IGNA 2D1HA 2H1KA 1ENHA 1HXDA 5DDGA 1HCRA 5CVJA 4BEHB 4NDLA 1OCPA 2M9HA 2K9SA 2FQ3A 4V2GA 3F6VA 3DPLC 3MKWB 3B02A 4B3AA 3IUVA 2VE9A 3CZ6A 1YS6A 5BNGA 2JSCA 2DMPA 3EPZA 5HS9A 4G9YA 4PSXA 1XGMA 3D5SC 3O8HA 4M3GA 5DTDA 2ACJA 2CH0A 3EYIA 1ZREA 4MXMA 2QA4I 2VXDA 2E7WA 3GZ5A 2XRNA 2JA5J 4IHYA 4XIDA 1VQ4I 2QGUA 4PCQA 2X6XA 3HSFA 3ZMUA 2LBFA 1W7PB 3OYEA 4WCGA 4YIFA 3MZYA 2W82A 1DU0A 1TP4A 4DZPA 4R79A 2XAGA 3CUQA 4KT6A 4AC0A 5J8CA 5DEQA 3KP4A 1UI6A 1ZR4A 1HSTA 2X1CA 3DLAA 3GEUA 3IHUA 5HAWA 3JRBA 1UHMA 1SAUA 1KQ9A 3HE0A 2CQXA 1RPWA 3RJPA 1R1VA 4D5FA 4IRHA 1DU6A 3U9GA 4E7SA 3S3NA 5CJ9A 3ZMSA 3KX2A 1VI0A 3DTIA 4L5IA 3KPHA 5HLGA 3F6OA 2E35A 1OPCA 1JE8A 4Y13A 4F92B 1FTZA 5EFYA 1P6RA 3FMSA 2XPVA 2BVMA 1QPMA 2K7LA 3NS4A 1EH7A 2E1OA 2H6CA 5CYVA 3SQNA 3HB9A 3V8JA 5L3DA 2OQRA 4M3EA 3VVYA 3OMYA 2ZXHA 3BNIA 2ICWG 2M2EA 3ZMZA 3M9AA 5IT9Z 5FJ8J 2KL4A 2HWVA 1JGGA 2DA2A 2O6GE 1P4XA 1XCBA 4GCTA 3A03A 4U7BA 3HRSA 1AU7A 1IXSB 3K10A 5D5UB 1FZPB 2QBYB 1U9OA 2XB5A 3VYSB 3ROUA 3WTXC 2LG4A 3M8FA 4UY8I 1HA8A 3VEPA 4ZTFA 3BR0A 1AWCA 2EH3A 5JLXA 2CFOA 2X51A 4QWQA 1MNMC 2X6WA 1NK2P 5C44J 2VKEA 4ENMA 1ON1A 2XPUA 1JGSA 1XGOA 3DBHB 1FMWA 2ESHA 2NX4A 1HKSA 2L9SA 3JRCA 5D4RA 5L3BA 3ZCOA 2VONA 3CDIA 4RAFA 3RPUD 2HYTA 5J6XA 1WH5A 2HYJA 3IWZA 4G8XA 3CCYA 3BR1A 4H4KC 2KJCA 1FYLA 1I27A 2R7DA 1RRJA 2L0KA 2PMHA 4OAYA 2KP6A 1GV5A 2PN6A 3W3CA 3DF8A 2R7RA 1ZAOA 3I55I 3QYFA 3H35A 4YFXF 2FRHA 4UNOA 3HOWJ 1ORKA 1RI7A 2E5ZA 4KIGA 2B1EA 2OTLI 3QU3A 3QPTA 4W97A 5HLTA 1VQKI 2PFBA 4FT8A 1Y0NA 5KAFC 3K70D 4HQMA 2DFFA 1RNLA 1V5FA 4GXOA 4UB8C 2VLAA 3T8TA 3PIPF 2D1VA 3VW2A 2DW4A 3I4NJ 5EEGA 2DA5A 2RREA 1FP2A 3HIMA 1KA8A 4BXUA 5B1BH 1W4MA 1FYKA 4HAMA 4UV9A 1SEUA 5J4YA 4U87A 4O5VA 5IYDJ 3HSRA 3HG9A 2IRFG 4G6DA 2STTA 3BR6A 4I02A 1T33A 2KZVA 4LLGF 4NQWA 1WJFA 2CJJA 3X2QH 1FOYA 3SEQA 2DN0A 5DUIA 1GT0C 3ZRGA 4M9XA 4M72A 5H20A 2Q1ZB 3RKWA 3I56I 4MLOA 3HYIA 4U7DA 3E6DA 4LFUA 3KEYA 3RYRA 1USSA 2L54A 4KJZA 1XCVA 4U88A 4IKFA 4BGDA 2DDBA 3CC7I 3ULQB 2NNYA 2NVUB 4A6EA 3WGHA 3PM1A 1K4SA 2LRDA 2G7UA 4LB5A 2HDCA 2GXAA 4C2UA 1YQAA 1UZCA 3NNRA 1K78B 4GYIA 4XRFA 5J4VA 3IL2A 1ZG1A 2ZMEC 2FBQA 3I58A 5KCMA 3HOSA 3FXUA 2FBIA 5FB2A 3CCJI 1ZTRA 2DA3A 2E1MB 3FIWA 5J47A 3GUDA 3LSKA 3TEDA 1HKTA 3VP5A 3RZOJ 4N4OB 4M9ZA 2P8TA 2PMUA 3E6CC 3W6KB 1G6NA 2WAEA 3K6GA 1OCZH 4EM2A 2EFWA 1DGRM 3E6BA 3OYGA 1ZGAA 2WBMA 5EG0A 4DYCA 4A0YA 4A69C 2B7EA 3CESA 2E36A 1R49A 1XB4A 3HGYA 2M4GA 5F64A 5TGTA 2WV1A 1LDKB 3KE2A 1YO5C 1IAWA 1UELB 2VPLA 2O7TA 1MMNA 2R7OA 1BN5A 2DYRH 3BR2A 3CO7C 1CGPA 5J40A 1J5YA 3ZQ7A 1FWZA 4E6KG 3EETA 1Z77A 3TP3A 2ELJA 2L4AA 4PZJA 5F6FA 2DK5A 4B8XA 4WIBA 1IW7F 2QEXI 4DZJA 5LD2C 1H9GA 4GCVA 4MGRA 3RSNA 5CVVA 3WODF 3NWSA 1B8IB 1XMAA 5E79C 2QENA 3ANGA 4EVIA 2JSPA 3L2VA 2Y69H 2HNHA 1W5SA 3VPRA 3MKLA 1D5VA 1V54H 1JTXA 5HDKA 1TWGJ 1WI3A 3I59A 2X6YA 4AYBA 3RI4A 2ZCXA 1JJ6C 3OYJA 1IN5A 1LUJB 1B72A 2BXZA 3F21A 4M73A 4RS8A 3VWBA 1FBSA 3VVXA 1U6GA 3LSPA 4XLEA 2KMUA 4RBOA 4TV7A 2AO9A 1QO0D 1MD0A 3S17J 2X9DA 1XSVA 3MEXA 1O3QA 1H8AC 1BI3A 3T0YA 5EEAA 4Y33A 1F36A 3HRTA 2KT0A 4KISA 2VASA 2FOWA 3M8JA 4F91B 3G6EI 4ITVA 3MMYB 1BW6A 3CMMA 1WJAA 4BYYA 3CCEI 3MZHA 2QCOA 3I3LA 2LY2A 4A3DJ 2JUCA 2EK5A 3Q9SA 2DMQA 2Z2SB 1ODDA 5LHIA 2JZYA 1IC8A 2JMWA 2YX4A 2HVSA 5K5RA 2XB0X 4NHJA 1TWFJ 3OYIA 4QIWN 1PUFA 2EA2A 4UVBA 4OMYA 4IXAA 2O5RA 2Z33A 4EATA 1IZ1A 2K9NA 3FBNB 3JSPA 3KLOA 1LDJA 4HF2A 4IQJA 2K9QA 3PQJA 2YS9A 2NAZA 4BJTA 9ANTA 2F4MB 2CUZA 4NC8A 2IS6A 4IRGA 3DFGA 2CMPA 3S8PA 4DJAA 2K85A 3AQTA 3QOEA 1A6IA 3BHQA 1X3UA 3OYCA 4LG0B 2KQRA 2YVHA 4IHWA 2CUJA 1UFMA 3ZGKA 1YX5A 1B9MA 3OOPA 3F23A 3JRHA 5EG0B 2GBYA 4YIRX 2EFPA 4RGSA 4A0XA 2KRCA 1JKOC 2NP5A 3CUQB 2DOAA 2WY7Q 1OCTC 1WWXA 3LSHA 1IXRC 3MD2A 4ZZDA 3ZQHA 3IH2A 5GTIC 1PVEA 3OIQA 1AOYA 4KMFA 5BPIA 4CUGA 2ZNZA 3HUGB 3LA7A 4HG2A 4HX4A 4A3MJ 3NPIA 5C4JJ 4HNTA 3KKCA 2BY1A 5JI6A 3GTJJ 3ZQCA 3FMQA 2MFZA 2AS5F 4O6JA 1UB9A 1YE9A 3GVAA 1WPKA 3JTGA 5FFXA 3VYUB 1DPUA 2ECBA 2CGPA 4ESFA 2E2JJ 4ZZLA 4WWCA 4IX7A 3GTQJ 3LJLA 1J75A 2NOJB 2NOGA 2QQ9A 3ERED 2KIFA 2Z99A 3GLLA 2P0WA 3S93A 2VODA 2WAFA 3IKTA 3FRQA 4ME9A 3M3YJ 1MNEA 4WXDA 3LHQA 2V1DA 3EUKL 1UJ8A 3M1EA 4HA8A 4HF1A 1SFUA 4HKUA 2HI3A 2Y30A 2EIMH 3GEZA 1G3WA 1TWAJ 1K4TA 3VODA 4GYGA 4L5EA 5F08A 4C30A 1X58A 3COLA 2COBA 2HS5A 3CTAA 5HS7A 4XR6A 2PMZA 3CJQB 3ZQFA 3K4LA 1KU9A 1LPQA 1MH4A 3FXOA 3QPLA 4IHSA 4L18B 2G7GA 2ZCNA 2FMYA 3DQVC 3H3UA 1YS7A 2ZJPF 4E7KA 3PSFA 2IA0A 4BQOA 3C2GA 5L3GA 2V6EA 1DP7P 3OR2C 4XSXF 1PYVA 1TC3C 2LF8A 1YW7A 1X4OA 2PJRB 2IPQX 4JQFA 4J19A 1MKMA 3T5XA 1Y1VJ 1R00A 2HPIA 5B5EC 1TNTA 2W85A 3ECHA 5E1ZB 4NB5A 3TKYA 3HM5A 2LH9A 2ZOYA 1T0FC 3TO7A 1IJWC 3HOVJ 2J5OA 3CCMI 3BJAA 1IN8A 2K40A 5HBUA 1SD6A 1X1DA 2A5YB 3S3MA 4XSZF 4XNFA 1T39A 2OU2A 1ETWA 2Z16A 4A3CJ 2DFHA 1MNDA 3P9IA 4BACA 4B4CA 3KYLA 3PO2J 3MWMA 3AG4H 3FK6A 3OOUA 3Q0WA 4ESBA 1J0RA 1U5TA 2EZKA 2BW3B 1R9TJ 2QBYA 1ZG5A 4OIQF 1D8KA 2IBDA 4Z6YA 1B6AA 2XASA 3LOCA 2V1XA 2F5CA 5BOXA 2R7XA 3GX4X 5H6QA 4RM2A 2JA7J 3I54A 1BL0A 2DU9A 4XLHA 2ZSHB 1T08B 4UVCA 2KIUA 1QPIA 5HDGA 1R1UA 1HQCA 2OQGA 3F72A 3J80Z 4X6AJ 4A3EJ 1VQ5I 3R6SA 2XGDA 4GGGA 1ACIA 1K7AA 1EH6A 4AM3A 2FU4A 1IUYA 4MFDA 2GIZA 3BQZA 2L7ZA 2XSDC 1LE8B 4OWRB 2VQHA
chains in the Genus database with same CATH topology
2DA4A 3S1RJ 2H1KA 3JRIA 1ENHA 2RAEA 1HCRA 4NDLA 1OCPA 2M9HA 2IEKA 1XS9A 2K9SA 4BBSJ 2WGBA 1LFBA 5DS9A 4V2GA 1QVUA 2GUHA 4A3FJ 4B3AA 3IUVA 5K7HA 2G7LA 1TWCJ 4QSHA 3BQYA 5BNGA 2EZLA 1NK3P 2DMPA 1S7EA 3RZDJ 3P9TA 5DTDA 3O8HA 4M3GA 2JA6J 3LNQA 1JKPC 3CRJA 5K7FA 4MXMA 3BR5A 3HBLA 2HOSA 2E19A 4MO7A 2JA5J 4IHYA 4XIDA 3VOXA 3L1PA 4MIMA 3ON4A 1HF0A 3S1MJ 1WH7A 3A01B 1GV2A 4M3BA 1DU0A 2LY9A 2RASA 4DZPA 2PZ9A 4AC0A 2JA8J 1UI6A 2CUEA 1ZR4A 3BTLA 2Y0SN 3JR9A 2D6YA 3GEUA 5HAWA 3JRBA 4JNNA 2LTPA 3S15J 3BRUA 3HE0A 2CQXA 5FGLA 4CYCB 1RPWA 5M3FJ 2MG4A 4D5FA 1DU6A 4PXIA 2L7ZA 4BKXA 5EF6A 4UUTA 4M6VA 5F27A 1VI0A 2XGCA 4ICHA 4IHVA 4BY1J 2R0QC 2LFBA 2X6OA 4LOCA 1FTZA 3HTIA 1K61A 5EFYA 2XPVA 2DJNA 3S2DJ 3H0GJ 2XDNA 2NVTJ 2NP3A 3VUQA 2E1OA 3RQIA 1HDDC 3HB9A 2CRGA 4M3EA 1BJZA 3VVYA 4A3IJ 3BNIA 2IAIA 4XRSG 2LP0A 3S14J 2M2EA 2NS7A 2Q24A 4AF5A 5FJ8J 1X2MA 1JGGA 2DA2A 4GCTA 4BY7J 3A03A 3GTOJ 4UUSB 5GPAA 4A3GJ 2ZB9A 1JT0A 1AU7A 3TW6A 5IYCJ 2D5VA 3ANPA 1MH3A 3CDLA 1H89C 1U9OA 2XB5A 2Y9ZA 3MNLA 3SFIA 3V6GA 3QKXA 2TCTA 1ZKGA 3VVZA 1JT6A 3BR0A 2EH3A 1NTCA 5JLXA 1IV6A 1JKQC 2O8KA 2IU5A 5FKMA 1MNMC 1NK2P 2UXHA 3Q0VA 2HKUA 5JLWA 2VKEA 5C44J 2TRTA 2XPUA 1JUSA 3S2HJ 1RESA 2NX4A 3JRCA 4UUSA 5CW8A 4D7NA 3PPBA 4GFKA 3RH2A 5IOYA 4HNVA 2I10A 2HYTA 2DTZA 1E3OC 2O9LA 1WH5A 2RHAA 5J1YA 2HYJA 2E2IJ 4BXXJ 3BG5A 3CCYA 5GPCA 3BTIA 3BR1A 1POGA 2ZOZA 2LR8A 2L7MP 2L0KA 5IP9J 3BJBA 1GV5A 4YZEA 1FEXA 2CQQA 2R5ZA 4GFLA 4KWAA 1ETYA 4C2MJ 1IDZA 4NELA 4CGRA 1MBFA 3FKIJ 3HOWJ 1VFCA 4IHXA 2M8GX 1ORKA 3GZIA 2W48A 3NXCA 5IPAA 4MFEA 3G1MA 4AYBN 4W97A 5E3MA 4BBRJ 2W53A 5D18A 3OSGA 3NARA 3SJMA 2JWTA 3JSJA 1FJLA 5E3OA 3NI7A 1UG2A 3E7QA 3V78A 4X1EA 5IP6A 1IGNA 3WHCA 2LLKA 4S0HB 1TWHJ 3VW2A 3G56A 3I4NJ 3HEFA 2DA5A 2GM4A 3HIMA 5D19A 2Y31A 3K7AJ 4RDUA 2JJ7A 3ZQLA 4UDSA 1LE8A 3Q3SA 3LSRA 5IYDJ 5K7ZA 3E7LA 3GTLJ 3BR6A 1JUMA 1T33A 3IH3A 3AQSA 1ZK8A 2CJJA 2XPWA 4W1UA 4NN1A 2DN0A 1IG7A 1GT0C 5F0CA 1APLC 3WHBA 4MLOA 1U8BA 3ZOBA 5FLMJ 2GENA 4C3JJ 5GP9A 4GCKA 1P7JA 2G3BA 4JX5A 2HXOA 3QBMA 5FMPA 3KKDA 3MVPA 2QIBA 3EUPA 3PM1A 1MSEC 3S16J 1MBJA 3BR3A 1U9NA 3ZQGA 2UXUA 2WUIA 2AHQA 3Q0UA 3NNRA 2ME0A 2FBQA 1HDPA 3BTCA 1AKHB 1JUPA 2P81A 5IP7J 2HQ5A 4AUXA 1ZTRA 3LWJA 2DA3A 1Y1WJ 2QF7A 3FIWA 2QWTA 2L9RA 3TEDA 1GVDA 3VP5A 2OI8A 3RZOJ 2FQ4A 4Y7NJ 2JN6A 3O60A 2QKOA 4C3IJ 3HTJA 3JRGA 3B81A 5C4YA 3HOYJ 2UXPA 2N8GA 1HOMA 1OJLA 5EG0A 4V2FA 3GTKJ 2VKVA 5FKKA 2EQRA 4DYCA 4A69C 2DMUA 3HTAA 1ETVA 1AKHA 3W6VA 2XSDC 1RR7A 2FD5A 3HGYA 3CMYA 4JL3A 2WV1A 2UXIA 5D1RA 4A93J 2O7TA 1O4XA 2QTQA 3RD3A 1ETOA 3BR2A 2NVXJ 2R5ZB 4JX6A 2JK3A 4M3FA 1Z77A 3TP3A 1YRNA 1FIAA 1UHSA 4JP0A 2Y9YA 5HODA 2OF7A 3LSGA 2VI6A 4DZJA 2PBXA 5EDNA 4I76A 3HGGA 4C3HJ 1BA5A 4GCLA 2MGQA 1B8IB 2R93J 5EZGA 3ANGA 3IV5A 1ETXA 3VPRA 3MKLA 1JTXA 1FTTA 1TWGJ 1WI3A 2LVSA 4D5CA 4L62A 2L7FP 3K2AA 1QRYA 2PMZN 2X48A 2ZCXA 1JJ6C 4B1RA 3HOXJ 5IYBJ 5EGOB 1B72A 1LFUP 3GTMJ 3B6CA 3VVXA 2ECCA 1MBHA 3FK7A 3LSPA 3ON2A 3A02A 2HXIA 4RBOA 2AO9A 2ELKA 3S17J 1PUFB 2X9DA 1H8AC 2CUFA 2R5YB 3C2BA 5EEAA 2YVEA 2WAQN 1F36A 2DA6A 2KT0A 2G7SA 3EGQA 3I4MJ 5J1UA 4Y52J 2M0CA 4JYKA 1BW6A 1WGXA 4IEJA 3HOUJ 3BG3A 2CU7A 2QCOA 1JKRC 2YU9J 2KDZA 4A3DJ 2NS8A 2ID6A 3F1BA 2DMQA 5E3NA 2R92J 1EF4A 4XK4A 1IC8A 2VUMJ 2JMWA 3CQZJ 2XB0X 3GBGA 1TWFJ 4QIWN 1JTYA 1PUFA 3DEWA 5C3EJ 2XGEA 4D7MA 5FKLA 1W0TA 2K9NA 3G1OA 1MBKA 3SDGA 1I50J 2YUSA 4ABZA 3LSJA 2K9QA 1CQTA 2YS9A 3S1QJ 9ANTA 2ZCMA 2O7OA 4A3LJ 3C07A 3KNWA 5K58A 1SGMA 1G2HA 3BG9A 2NVQJ 2F07A 3H3VK 3AQTA 1T56A 1MBEA 1A6IA 1RKTA 2FX0A 3BHQA 1D5YA 1K83J 5AQCA 4A3KJ 3HKZN 3GTPJ 2YVHA 5FKOA 1RKWA 4IHWA 3PO3J 1B8IA 1UMQA 1BW5A 3JRAA 2EZHA 2LK2A 3JRHA 3TW7A 4JX4A 1HLVA 1MBGA 2DMTA 5E3LA 5EG0B 2GBYA 4XRMA 1ETQA 5EGOA 2GFNA 1QVTA 2NP5A 1JKOC 5CXGA 1OCTC 5FHPA 1VNDA 1ZQ3P 3VW0A 5M5XJ 2XRLA 3G1LA 4DYQA 1ZR2A 3G7RA 1UI5A 2DG7A 2VPRA 1JJ8C 3ZQHA 3IH2A 3BCGA 4CYCA 1F43A 4A3MJ 2H8RA 3NPIA 3VIBA 5C4JJ 3KKCA 3GTJJ 3ZQCA 4FTHA 3M4OJ 1OFCX 3DPJA 4FE4A 2WB1N 3IH4A 3HOZJ 1SANA 5F0HA 1WPKA 1Z0XA 2DA7A 3OSFA 2R5YA 1YRNB 2ECBA 2E2JJ 3VW1A 1FIPA 3GTQJ 3LJLA 5H9TA 3HTHA 1A5JA 2FJ1A 2NOGA 3S5RA 5M3MJ 5M5WJ 3RKQA 3BT9A 4XRSA 2LD5A 1RETA 1X2NA 1I3QJ 2R7ZJ 2B63J 3HDDA 3FRQA 3B6AA 4EEFG 4ME9A 3M3YJ 2DG8A 3FISA 5J3LA 5IOZA 2M34A 3LHQA 4I6ZA 1GDTA 2HDDA 1MSFC 2UXOA 4FCYA 5F04A 4HKUA 2HI3A 2Y30A 2ID3A 1TWAJ 4XICA 1P7IA 1GUUA 3OIOA 1B72B 1AHDP 2EBIA 5HSZA 3VOKA 4L5EA 5F08A 1IUFA 1X58A 3COLA 4FE7A 2COBA 3TP0A 3ZQFA 2REKA 2G0EA 2DMNA 1XG1A 1I6HJ 5J1RA 1MH4A 2G7GA 3QPLA 2QOPA 2ZCNA 3NRGA 5C4XJ 2MW8A 5DAJA 3O8GA 3JRDA 2LKXA 3NAUA 1TC3C 5F0FA 1H88C 4J19A 1ZGWA 2NVYJ 1ETKA 2ME6A 2OERA 1Y1VJ 5EZHA 2Y2ZA 3ZQIA 1IRZA 1XC5A 1VF9A 2MSYA 3HM5A 2ZOYA 1ITYA 3KZ9A 1SFOJ 1IJWC 3HOVJ 4ACIA 4A3BJ 2EZIA 2K40A 5HBUA 5FLVA 4G12A 3A01A 3S1NJ 2DA1A 1ETWA 5FKNA 4A3CJ 1Q1VA 4B4CA 3DCFA 1U78A 3PO2J 3FK6A 3OOUA 2V57A 3Q0WA 1IDYA 2HOTA 5F1JA 3CJDA 4FISA 1R9TJ 2EZKA 2IBDA 4GFBA 2GLOA 2OPTA 3LOCA 4QTRA 5CXIA 4M3DA 4JKZA 3JRFA 1WCMJ 4A3JJ 3MN2A 3PASA 4AC6A 2JA7J 1BL0A 4DYRA 3F0CA 3JREA 2E2HJ 1QPIA 1W0UA 2HOAA 4MK6A 3GTGJ 4X6AJ 4A3EJ 3CWRA 3D1NI 2XGDA 3T6NA 3QPSA 3UKGA 3BTJA 5M5YJ 5EYRA 4MFDA 3BQZA 1LE8B 3QQAA 4DW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA4 A;  3S1R J;  2H1K A;  3JRI A;  1ENH A;  2RAE A;  1HCR A;  4NDL A;  1OCP A;  2M9H A;  2IEK A;  1XS9 A;  2K9S A;  4BBS J;  2WGB A;  1LFB A;  5DS9 A;  4V2G A;  1QVU A;  2GUH A;  4A3F J;  4B3A A;  3IUV A;  5K7H A;  2G7L A;  1TWC J;  4QSH A;  3BQY A;  5BNG A;  2EZL A;  1NK3 P;  2DMP A;  1S7E A;  3RZD J;  3P9T A;  5DTD A;  3O8H A;  4M3G A;  2JA6 J;  3LNQ A;  1JKP C;  3CRJ A;  5K7F A;  4MXM A;  3BR5 A;  3HBL A;  2HOS A;  2E19 A;  4MO7 A;  2JA5 J;  4IHY A;  4XID A;  3VOX A;  3L1P A;  4MIM A;  3ON4 A;  1HF0 A;  3S1M J;  1WH7 A;  3A01 B;  1GV2 A;  4M3B A;  1DU0 A;  2LY9 A;  2RAS A;  4DZP A;  2PZ9 A;  4AC0 A;  2JA8 J;  1UI6 A;  2CUE A;  1ZR4 A;  3BTL A;  2Y0S N;  3JR9 A;  2D6Y A;  3GEU A;  5HAW A;  3JRB A;  4JNN A;  2LTP A;  3S15 J;  3BRU A;  3HE0 A;  2CQX A;  5FGL A;  4CYC B;  1RPW A;  5M3F J;  2MG4 A;  4D5F A;  1DU6 A;  4PXI A;  2L7Z A;  4BKX A;  5EF6 A;  4UUT A;  4M6V A;  5F27 A;  1VI0 A;  2XGC A;  4ICH A;  4IHV A;  4BY1 J;  2R0Q C;  2LFB A;  2X6O A;  4LOC A;  1FTZ A;  3HTI A;  1K61 A;  5EFY A;  2XPV A;  2DJN A;  3S2D J;  3H0G J;  2XDN A;  2NVT J;  2NP3 A;  3VUQ A;  2E1O A;  3RQI A;  1HDD C;  3HB9 A;  2CRG A;  4M3E A;  1BJZ A;  3VVY A;  4A3I J;  3BNI A;  2IAI A;  4XRS G;  2LP0 A;  3S14 J;  2M2E A;  2NS7 A;  2Q24 A;  4AF5 A;  5FJ8 J;  1X2M A;  1JGG A;  2DA2 A;  4GCT A;  4BY7 J;  3A03 A;  3GTO J;  4UUS B;  5GPA A;  4A3G J;  2ZB9 A;  1JT0 A;  1AU7 A;  3TW6 A;  5IYC J;  2D5V A;  3ANP A;  1MH3 A;  3CDL A;  1H89 C;  1U9O A;  2XB5 A;  2Y9Z A;  3MNL A;  3SFI A;  3V6G A;  3QKX A;  2TCT A;  1ZKG A;  3VVZ A;  1JT6 A;  3BR0 A;  2EH3 A;  1NTC A;  5JLX A;  1IV6 A;  1JKQ C;  2O8K A;  2IU5 A;  5FKM A;  1MNM C;  1NK2 P;  2UXH A;  3Q0V A;  2HKU A;  5JLW A;  2VKE A;  5C44 J;  2TRT A;  2XPU A;  1JUS A;  3S2H J;  1RES A;  2NX4 A;  3JRC A;  4UUS A;  5CW8 A;  4D7N A;  3PPB A;  4GFK A;  3RH2 A;  5IOY A;  4HNV A;  2I10 A;  2HYT A;  2DTZ A;  1E3O C;  2O9L A;  1WH5 A;  2RHA A;  5J1Y A;  2HYJ A;  2E2I J;  4BXX J;  3BG5 A;  3CCY A;  5GPC A;  3BTI A;  3BR1 A;  1POG A;  2ZOZ A;  2LR8 A;  2L7M P;  2L0K A;  5IP9 J;  3BJB A;  1GV5 A;  4YZE A;  1FEX A;  2CQQ A;  2R5Z A;  4GFL A;  4KWA A;  1ETY A;  4C2M J;  1IDZ A;  4NEL A;  4CGR A;  1MBF A;  3FKI J;  3HOW J;  1VFC A;  4IHX A;  2M8G X;  1ORK A;  3GZI A;  2W48 A;  3NXC A;  5IPA A;  4MFE A;  3G1M A;  4AYB N;  4W97 A;  5E3M A;  4BBR J;  2W53 A;  5D18 A;  3OSG A;  3NAR A;  3SJM A;  2JWT A;  3JSJ A;  1FJL A;  5E3O A;  3NI7 A;  1UG2 A;  3E7Q A;  3V78 A;  4X1E A;  5IP6 A;  1IGN A;  3WHC A;  2LLK A;  4S0H B;  1TWH J;  3VW2 A;  3G56 A;  3I4N J;  3HEF A;  2DA5 A;  2GM4 A;  3HIM A;  5D19 A;  2Y31 A;  3K7A J;  4RDU A;  2JJ7 A;  3ZQL A;  4UDS A;  1LE8 A;  3Q3S A;  3LSR A;  5IYD J;  5K7Z A;  3E7L A;  3GTL J;  3BR6 A;  1JUM A;  1T33 A;  3IH3 A;  3AQS A;  1ZK8 A;  2CJJ A;  2XPW A;  4W1U A;  4NN1 A;  2DN0 A;  1IG7 A;  1GT0 C;  5F0C A;  1APL C;  3WHB A;  4MLO A;  1U8B A;  3ZOB A;  5FLM J;  2GEN A;  4C3J J;  5GP9 A;  4GCK A;  1P7J A;  2G3B A;  4JX5 A;  2HXO A;  3QBM A;  5FMP A;  3KKD A;  3MVP A;  2QIB A;  3EUP A;  3PM1 A;  1MSE C;  3S16 J;  1MBJ A;  3BR3 A;  1U9N A;  3ZQG A;  2UXU A;  2WUI A;  2AHQ A;  3Q0U A;  3NNR A;  2ME0 A;  2FBQ A;  1HDP A;  3BTC A;  1AKH B;  1JUP A;  2P81 A;  5IP7 J;  2HQ5 A;  4AUX A;  1ZTR A;  3LWJ A;  2DA3 A;  1Y1W J;  2QF7 A;  3FIW A;  2QWT A;  2L9R A;  3TED A;  1GVD A;  3VP5 A;  2OI8 A;  3RZO J;  2FQ4 A;  4Y7N J;  2JN6 A;  3O60 A;  2QKO A;  4C3I J;  3HTJ A;  3JRG A;  3B81 A;  5C4Y A;  3HOY J;  2UXP A;  2N8G A;  1HOM A;  1OJL A;  5EG0 A;  4V2F A;  3GTK J;  2VKV A;  5FKK A;  2EQR A;  4DYC A;  4A69 C;  2DMU A;  3HTA A;  1ETV A;  1AKH A;  3W6V A;  2XSD C;  1RR7 A;  2FD5 A;  3HGY A;  3CMY A;  4JL3 A;  2WV1 A;  2UXI A;  5D1R A;  4A93 J;  2O7T A;  1O4X A;  2QTQ A;  3RD3 A;  1ETO A;  3BR2 A;  2NVX J;  2R5Z B;  4JX6 A;  2JK3 A;  4M3F A;  1Z77 A;  3TP3 A;  1YRN A;  1FIA A;  1UHS A;  4JP0 A;  2Y9Y A;  5HOD A;  2OF7 A;  3LSG A;  2VI6 A;  4DZJ A;  2PBX A;  5EDN A;  4I76 A;  3HGG A;  4C3H J;  1BA5 A;  4GCL A;  2MGQ A;  1B8I B;  2R93 J;  5EZG A;  3ANG A;  3IV5 A;  1ETX A;  3VPR A;  3MKL A;  1JTX A;  1FTT A;  1TWG J;  1WI3 A;  2LVS A;  4D5C A;  4L62 A;  2L7F P;  3K2A A;  1QRY A;  2PMZ N;  2X48 A;  2ZCX A;  1JJ6 C;  4B1R A;  3HOX J;  5IYB J;  5EGO B;  1B72 A;  1LFU P;  3GTM J;  3B6C A;  3VVX A;  2ECC A;  1MBH A;  3FK7 A;  3LSP A;  3ON2 A;  3A02 A;  2HXI A;  4RBO A;  2AO9 A;  2ELK A;  3S17 J;  1PUF B;  2X9D A;  1H8A C;  2CUF A;  2R5Y B;  3C2B A;  5EEA A;  2YVE A;  2WAQ N;  1F36 A;  2DA6 A;  2KT0 A;  2G7S A;  3EGQ A;  3I4M J;  5J1U A;  4Y52 J;  2M0C A;  4JYK A;  1BW6 A;  1WGX A;  4IEJ A;  3HOU J;  3BG3 A;  2CU7 A;  2QCO A;  1JKR C;  2YU9 J;  2KDZ A;  4A3D J;  2NS8 A;  2ID6 A;  3F1B A;  2DMQ A;  5E3N A;  2R92 J;  1EF4 A;  4XK4 A;  1IC8 A;  2VUM J;  2JMW A;  3CQZ J;  2XB0 X;  3GBG A;  1TWF J;  4QIW N;  1JTY A;  1PUF A;  3DEW A;  5C3E J;  2XGE A;  4D7M A;  5FKL A;  1W0T A;  2K9N A;  3G1O A;  1MBK A;  3SDG A;  1I50 J;  2YUS A;  4ABZ A;  3LSJ A;  2K9Q A;  1CQT A;  2YS9 A;  3S1Q J;  9ANT A;  2ZCM A;  2O7O A;  4A3L J;  3C07 A;  3KNW A;  5K58 A;  1SGM A;  1G2H A;  3BG9 A;  2NVQ J;  2F07 A;  3H3V K;  3AQT A;  1T56 A;  1MBE A;  1A6I A;  1RKT A;  2FX0 A;  3BHQ A;  1D5Y A;  1K83 J;  5AQC A;  4A3K J;  3HKZ N;  3GTP J;  2YVH A;  5FKO A;  1RKW A;  4IHW A;  3PO3 J;  1B8I A;  1UMQ A;  1BW5 A;  3JRA A;  2EZH A;  2LK2 A;  3JRH A;  3TW7 A;  4JX4 A;  1HLV A;  1MBG A;  2DMT A;  5E3L A;  5EG0 B;  2GBY A;  4XRM A;  1ETQ A;  5EGO A;  2GFN A;  1QVT A;  2NP5 A;  1JKO C;  5CXG A;  1OCT C;  5FHP A;  1VND A;  1ZQ3 P;  3VW0 A;  5M5X J;  2XRL A;  3G1L A;  4DYQ A;  1ZR2 A;  3G7R A;  1UI5 A;  2DG7 A;  2VPR A;  1JJ8 C;  3ZQH A;  3IH2 A;  3BCG A;  4CYC A;  1F43 A;  4A3M J;  2H8R A;  3NPI A;  3VIB A;  5C4J J;  3KKC A;  3GTJ J;  3ZQC A;  4FTH A;  3M4O J;  1OFC X;  3DPJ A;  4FE4 A;  2WB1 N;  3IH4 A;  3HOZ J;  1SAN A;  5F0H A;  1WPK A;  1Z0X A;  2DA7 A;  3OSF A;  2R5Y A;  1YRN B;  2ECB A;  2E2J J;  3VW1 A;  1FIP A;  3GTQ J;  3LJL A;  5H9T A;  3HTH A;  1A5J A;  2FJ1 A;  2NOG A;  3S5R A;  5M3M J;  5M5W J;  3RKQ A;  3BT9 A;  4XRS A;  2LD5 A;  1RET A;  1X2N A;  1I3Q J;  2R7Z J;  2B63 J;  3HDD A;  3FRQ A;  3B6A A;  4EEF G;  4ME9 A;  3M3Y J;  2DG8 A;  3FIS A;  5J3L A;  5IOZ A;  2M34 A;  3LHQ A;  4I6Z A;  1GDT A;  2HDD A;  1MSF C;  2UXO A;  4FCY A;  5F04 A;  4HKU A;  2HI3 A;  2Y30 A;  2ID3 A;  1TWA J;  4XIC A;  1P7I A;  1GUU A;  3OIO A;  1B72 B;  1AHD P;  2EBI A;  5HSZ A;  3VOK A;  4L5E A;  5F08 A;  1IUF A;  1X58 A;  3COL A;  4FE7 A;  2COB A;  3TP0 A;  3ZQF A;  2REK A;  2G0E A;  2DMN A;  1XG1 A;  1I6H J;  5J1R A;  1MH4 A;  2G7G A;  3QPL A;  2QOP A;  2ZCN A;  3NRG A;  5C4X J;  2MW8 A;  5DAJ A;  3O8G A;  3JRD A;  2LKX A;  3NAU A;  1TC3 C;  5F0F A;  1H88 C;  4J19 A;  1ZGW A;  2NVY J;  1ETK A;  2ME6 A;  2OER A;  1Y1V J;  5EZH A;  2Y2Z A;  3ZQI A;  1IRZ A;  1XC5 A;  1VF9 A;  2MSY A;  3HM5 A;  2ZOY A;  1ITY A;  3KZ9 A;  1SFO J;  1IJW C;  3HOV J;  4ACI A;  4A3B J;  2EZI A;  2K40 A;  5HBU A;  5FLV A;  4G12 A;  3A01 A;  3S1N J;  2DA1 A;  1ETW A;  5FKN A;  4A3C J;  1Q1V A;  4B4C A;  3DCF A;  1U78 A;  3PO2 J;  3FK6 A;  3OOU A;  2V57 A;  3Q0W A;  1IDY A;  2HOT A;  5F1J A;  3CJD A;  4FIS A;  1R9T J;  2EZK A;  2IBD A;  4GFB A;  2GLO A;  2OPT A;  3LOC A;  4QTR A;  5CXI A;  4M3D A;  4JKZ A;  3JRF A;  1WCM J;  4A3J J;  3MN2 A;  3PAS A;  4AC6 A;  2JA7 J;  1BL0 A;  4DYR A;  3F0C A;  3JRE A;  2E2H J;  1QPI A;  1W0U A;  2HOA A;  4MK6 A;  3GTG J;  4X6A J;  4A3E J;  3CWR A;  3D1N I;  2XGD A;  3T6N A;  3QPS A;  3UKG A;  3BTJ A;  5M5Y J;  5EYR A;  4MFD A;  3BQZ A;  1LE8 B;  3QQA A;  4DW6 A; 
#chains in the Genus database with same CATH topology
 3S1R J;  4AIH A;  3VB2 A;  3RKX A;  1XS9 A;  2VJ5 A;  2G7H A;  1R36 A;  5DS9 A;  1WJ5 A;  4DQ2 A;  2GUH A;  3OYA A;  3FM3 A;  2MC3 A;  2MBF A;  4Q48 A;  2H8W A;  5K7H A;  5L3F A;  4FHT A;  2GQQ A;  3BQY A;  5EJC A;  3FKJ A;  5HNF A;  2G7L A;  4UHT A;  1S7E A;  3ZMT A;  1LKX A;  2Z9O A;  3LA2 A;  1JKP C;  5K7F A;  4KFC A;  2LMD A;  3HBL A;  2XIG A;  2YR2 A;  2Q0O A;  2E19 A;  5D6F A;  2DT7 B;  3F8B A;  3VOX A;  4ZJZ A;  3TOA A;  2ZFU A;  1BM9 A;  2Q2E B;  3DKY A;  1OYW A;  4RGU A;  1HF0 A;  3BCA A;  3PJR A;  3S1M J;  1I1S A;  2XUB A;  1GV2 A;  2VB6 A;  4M3B A;  5LBQ A;  1T6S A;  2LY9 A;  4IOC F;  2RAS A;  2JA8 J;  2CUE A;  3AKZ A;  2XDV A;  1NH3 A;  1P4A A;  2ZJ2 A;  2ZNY A;  4A12 A;  2D6Y A;  5DD4 A;  4PFO A;  5BQT A;  3P9C A;  2LTP A;  4JNN A;  3SYT A;  4BJ5 C;  3HL2 A;  1HKQ A;  5DM6 F;  3IRR A;  5EF6 A;  3HRM A;  1W7P A;  5F27 A;  4ICH A;  1VQM I;  4BY1 J;  1KYW A;  2ADU A;  4CCO A;  3WU1 B;  3MAJ A;  1XGS A;  1M1E B;  2DJN A;  3E5U A;  3MCZ A;  2H94 A;  5H2F C;  5IT3 A;  2RV8 A;  2RN7 A;  1GHC A;  4OAZ A;  3VUQ A;  4HST A;  1YX3 A;  3PNT A;  3BLY A;  1HDD C;  2KLO A;  4L9J A;  1AA7 A;  1ZRD A;  1BJZ A;  2EIL H;  1KU2 A;  1X1B A;  2QQA A;  3FXM A;  2IAI A;  2LSO A;  2YPR A;  3PUF A;  2EJR A;  3N4M A;  1ZH5 A;  3MKZ A;  2NS7 A;  1A31 A;  2Q24 A;  4AF5 A;  1X4P A;  1X2M A;  4J00 A;  1B1B A;  4BY7 J;  4UUS B;  4L5J A;  4B09 A;  4II2 A;  5ERI A;  4KYW A;  5IYC J;  2D5V A;  4P9U A;  1F9N A;  3K4J A;  3LQR A;  1FOK A;  3MNL A;  2Y9Z A;  3V6G A;  3SFI A;  5LLQ A;  1PP7 U;  2TCT A;  1ZKG A;  1JT6 A;  2FEZ A;  1MDM B;  2O8K A;  4EJT A;  1O7L A;  1GXQ A;  2HKU A;  5JLW A;  2GAU A;  5F1R A;  1VZ0 A;  2TRT A;  1JUS A;  3H5A A;  4BDZ A;  3I4P A;  3PPB A;  2HVQ A;  2X4H A;  4HNV A;  2KRH A;  2DTZ A;  4R1H A;  4UVA A;  1E3O C;  4OIR F;  2CWE A;  3S2W A;  4BXX J;  3BG5 A;  4NC6 A;  2WAD A;  5GPC A;  1POG A;  4YEL A;  5IT9 K;  3Q5F A;  2PG4 A;  4CCM A;  3ERM A;  2Z1D A;  3DPU A;  5HNH A;  5HS8 A;  4KT5 C;  4KIC A;  3K4N A;  1FEX A;  4MHG A;  4GFL A;  1WRJ A;  1YW8 A;  1VFC A;  4IHX A;  4AIK A;  2LOO A;  4N9I A;  3G4S I;  2M8G X;  3HHG A;  3GZI A;  1JXS A;  4D1Q A;  2ZME A;  4BQN A;  3H3Z A;  3DKX A;  3L2C A;  5E3M A;  1Y0U A;  4BBR J;  2W53 A;  4CHU A;  3OSG A;  4LLL A;  4RLF A;  3JSJ A;  1FJL A;  1SMT A;  3E7Q A;  2CSO A;  5GAH J;  4OD4 A;  1IGN A;  4BE0 A;  3OL3 A;  1TWH J;  3G56 A;  3I5U A;  3HEF A;  3VDX A;  2H1L A;  2GM4 A;  2BVL A;  1F1Z A;  2V1U A;  5D19 A;  1B4A A;  1WQ2 A;  2Y31 A;  3K7A J;  1YYV A;  1NG7 A;  2JJ7 A;  4HPQ A;  4PGG A;  2DDA A;  3ZQL A;  3Q3S A;  2HDW A;  3F8F A;  3LSR A;  2VIX A;  1A04 A;  2F48 A;  1JUM A;  3IH3 A;  4P5O A;  5D4S A;  2HR3 A;  2JT1 A;  3NWT A;  2XPW A;  4C2T A;  2DPU A;  1IG7 A;  1IV8 A;  3CCQ I;  4ETS A;  1X19 A;  3JTH A;  3WHB A;  5AON A;  1SD5 A;  4EM1 A;  3ZOB A;  1YIO A;  5FLM J;  4C3J J;  2P5V A;  2PQ8 A;  5GP9 A;  5IY5 H;  5D8L B;  5KHD A;  4YRV A;  4I98 B;  2UV1 A;  2G3B A;  4JX5 A;  2HYG D;  5ILS A;  5CLS A;  3MVP A;  3C3W A;  4MQV A;  3PIO F;  5B3S H;  3SFZ A;  3EUH C;  3EUP A;  4XON A;  2H6B A;  3BR3 A;  2M1B A;  4WXC A;  3EDP A;  2UXU A;  5E18 F;  1KU7 A;  3Q0U A;  1R4N B;  3H36 A;  4N0B A;  3J80 K;  4AVP A;  3QYB A;  5HVQ C;  5GAG J;  2ME0 A;  3QP6 A;  1HDP A;  2BY0 A;  1YHQ I;  1JUP A;  2P81 A;  2QWW A;  5IP7 J;  4OIO F;  4AUX A;  4V19 K;  2QLZ A;  2K02 A;  1JI8 A;  3O6B B;  3WTT C;  4ON0 A;  2L4M A;  1R1T A;  1V5G A;  3FWE A;  4LG0 A;  1GVD A;  2OI8 A;  4Y7N J;  1TBX A;  2JN6 A;  2QKO A;  1KQ8 A;  2Y48 A;  4BEH A;  3C1D A;  3QYE A;  3HTJ A;  1O57 A;  4KMU X;  1FSH A;  4V2F A;  5FKK A;  2CV1 A;  2WV0 A;  3W6V A;  2MH9 A;  2O8X A;  1RR7 A;  4NBQ A;  4X0G A;  4AIJ A;  1JHH A;  3SWH A;  1S7A A;  1O4X A;  4BQQ A;  1ETO A;  2FBK A;  3E3V A;  2HVR A;  4M3F A;  3ZMV A;  1UG0 A;  1T38 A;  3SZG A;  2JPB A;  2OF7 A;  3TO9 A;  5HOD A;  1W5T A;  2PBX A;  3WTZ A;  2LKS A;  3H92 A;  4C3H J;  4GCL A;  1IRG A;  3K1N A;  3IV5 A;  3T8R A;  1FPQ A;  1ETX A;  1FSE A;  1DQU A;  2AQE A;  2XAU A;  3E97 A;  5ILV A;  3M8E A;  2LVS A;  2VBZ A;  2VQL A;  3FXJ A;  2L7F P;  2VJ4 A;  4D5C A;  3G71 I;  4L62 A;  3KEO A;  2R7W A;  4KIB A;  2A69 F;  1STZ A;  5DCF A;  3OV8 A;  3BC8 A;  3OR1 C;  5EGO B;  1Z67 A;  1WVR A;  1LFU P;  3B6C A;  4PFP A;  3ON2 A;  1R5G A;  3A02 A;  5DCM A;  6PAX A;  1T0F A;  4ZC3 A;  5E1W A;  2ELK A;  2EV6 A;  3KP6 A;  4F7Z A;  3KIO A;  4EJW A;  1EJ9 A;  2YVE A;  3I59 B;  4IVN A;  4I2O A;  1RIO H;  2DA6 A;  2V1N A;  3P7N A;  3I4M J;  5J1U A;  2GWR A;  1FC3 A;  5BPD A;  4JYK A;  2OCE A;  1MMA A;  3FXK A;  2W84 A;  5GTH C;  2JA2 A;  3BZ6 A;  4FX4 A;  4XM3 A;  3FXL A;  2R7F A;  1JKR C;  2YU9 J;  3AG1 H;  1E17 A;  4RMN A;  2L9V A;  1XSD A;  3FBI B;  3DLL F;  1ZRC A;  2JUG A;  3ABL H;  2W00 A;  1Z1D A;  3R61 A;  5C3E J;  4I01 A;  3K4M A;  2XGE A;  3ZMD A;  5FKL A;  4B48 A;  1OIS A;  1W1W E;  4PJM A;  4I99 C;  3KEQ A;  3NQO A;  3KZY A;  5KK1 A;  5KAI C;  4PGH A;  5E8G A;  4XKC A;  1DUX C;  2O7O A;  3HZJ A;  4A2U A;  3OY9 A;  3BDD A;  1D1A A;  1SGM A;  3FDY A;  3BG9 A;  2W24 A;  1GXP A;  1FNN A;  4UV8 A;  2V9P A;  5BMZ A;  1MBE A;  2FX0 A;  4CCN A;  1K83 J;  5AQC A;  4A3K J;  3HKZ N;  3BJ6 A;  1RKW A;  3BOQ A;  4OIP F;  1UMQ A;  4XL9 A;  1R5H A;  1RUO A;  3JRA A;  2VJJ A;  1KQ0 A;  3LWF A;  5J8F A;  4QPO A;  2LK2 A;  3E5Q A;  4P1W A;  1HLV A;  1I5Z A;  3T1B A;  3TL4 X;  4XRM A;  5EGO A;  1A36 A;  3M7G A;  3ZN1 A;  5CXG A;  5FFZ A;  5FHP A;  1ZQ3 P;  1PUE E;  3WG9 A;  3WTS C;  4EJV A;  2F5E A;  2VPR A;  4HLY A;  2L02 A;  2F5D A;  3BCG A;  2H8R A;  3VIB A;  2A07 F;  1WSU A;  1S3J A;  5AIP A;  1LNW A;  3D5L A;  2HTJ A;  5FRM A;  4KIF A;  4WF2 A;  5CVU A;  3M4O J;  1I6X A;  5F0H A;  1NHA A;  2WA0 A;  1Z0X A;  3OSF A;  2R5Y A;  1MMD A;  5E20 A;  4C9Y A;  4GDF A;  2CV2 A;  4HBL A;  2FML A;  2BE5 F;  2FJ1 A;  1ZHF A;  2DOE A;  5M3M J;  3RKQ A;  4XRS A;  1RET A;  5LRR A;  1HW5 A;  2B63 J;  3WE2 A;  2DG8 A;  3FIS A;  3LL7 A;  5IOZ A;  2JRM A;  2GOX B;  4I6Z A;  3ONQ A;  1V55 H;  1GDT A;  3ML6 A;  1J9I A;  4LGW A;  5F04 A;  3ELK A;  3GW2 A;  1P7I A;  2HTS A;  4E7I A;  1B72 B;  3IRQ A;  5HSZ A;  2ELH A;  4IQ4 A;  4PJN A;  4I0A A;  3H5R A;  4G7O F;  3TP0 A;  2REK A;  1XG1 A;  2QOP A;  4DVY P;  1LEB A;  5JVT A;  4F93 B;  3CP2 A;  1ULY A;  3A4C A;  5DAJ A;  5HLH A;  3NAU A;  3GZN B;  3K8P C;  4BL0 B;  2GA1 A;  1H88 C;  4OMZ A;  4LJZ F;  1HW1 A;  3LMM A;  2RKH A;  3AFH A;  4N4N B;  5EZH A;  2Y2Z A;  2ISY A;  5HDN A;  4XOP A;  1FOW A;  2K4B A;  5DV5 A;  3KP5 A;  2J5P A;  2MSY A;  2ZBK A;  1ITY A;  4G6T B;  1Z7U A;  2RQQ A;  4DBR A;  4ZYD A;  3VSL A;  5D5W B;  2EZI A;  5FLV A;  4G12 A;  1Z91 A;  2MAB A;  1YW9 A;  3TMO A;  2XKP A;  3S1N J;  1MJ9 A;  2MH2 A;  4S05 A;  3TDU C;  4IO9 F;  3V8L A;  5DYM A;  2W25 A;  4I09 A;  2F5V A;  3IKV A;  1K6Y A;  1U78 A;  1XX5 A;  1XMX A;  5LGU A;  2L3D A;  3RPU A;  2V57 A;  1E3P A;  3AAF A;  4CCL A;  4FIS A;  2DXI A;  3C7J A;  1LB2 A;  3GLX A;  2KIS A;  2EIJ H;  2XF6 A;  4GFB A;  4FAS D;  2OPT A;  2GLO A;  2E34 A;  4BH9 A;  2XKO A;  1VQP I;  1YG2 A;  5CXI A;  4JKZ A;  4ESJ A;  2R7S A;  1WCM J;  2W4S A;  2XSJ C;  1SFK A;  2GOM A;  4DYR A;  2LDU A;  2V6C A;  3L00 A;  3O2P E;  3JRE A;  2E2H J;  2GZW A;  3KET A;  4EJO A;  4AU7 A;  4LD5 A;  4F52 A;  1W0U A;  2HOA A;  3ABT A;  4MK6 A;  4G7Z F;  1MW7 A;  1XN7 A;  4LIT A;  3VTI A;  2HZT A;  1WJC A;  1NG6 A;  3QPS A;  2DO7 A;  3BTJ A;  4UUV A;  2M4K A;  5EYR A;  1OQY A;  3QQA A;  3RPQ A;  4DW6 A;  1P92 A;  3PNV A;  4L9T A;  5K5O A;  4PSW A;  5LGN A;  4BHC A;  2E71 A;  2VBW A;  3I9V 2;  2R7T A;  3GWZ A;  2IEK A;  4CCJ A;  1IRF A;  2EIN H;  2M30 A;  1A35 A;  4BBS J;  2WGB A;  2UUZ A;  1QVU A;  4H0E A;  3F8N A;  2CQN A;  2TDX A;  3GFM A;  2ESN A;  5E8I A;  3K70 C;  1NK3 P;  1O3R A;  1KYZ A;  2DT5 A;  2EZL A;  2KRF A;  1CF7 A;  2YVX A;  4IF4 A;  2B3W A;  2KPM A;  1I1G A;  2ZME B;  3LNQ A;  3V7S A;  3LAJ A;  2IP2 A;  2BZT A;  3K4K A;  2HOS A;  2IGO A;  2KDO A;  4RB2 C;  2R7U A;  2MLK A;  3QPH A;  4MO7 A;  1U0J A;  2HKO A;  1REP C;  4OIN F;  4IZZ A;  1U3E M;  1QZZ A;  3KP2 A;  2IJL A;  2RDP A;  4NNJ A;  3A01 B;  2H27 A;  1W7P D;  4XLP F;  4HRI A;  3QRF F;  2V9V A;  4Y3O A;  2LYC A;  4MNU A;  2QSG X;  3W2A A;  4KUM A;  1GLN A;  3J81 Z;  3CDH A;  2CW7 A;  2QUF A;  2VKH A;  4XKW A;  1E2X A;  1VQN I;  3S15 J;  3BRU A;  5LEK A;  4CYC B;  2XHK A;  5M3F J;  2MG4 A;  4M71 A;  3U1D A;  1BIB A;  2Y75 A;  3RDI A;  4BKX A;  2OAZ A;  3KP3 A;  1FT9 A;  4WX9 A;  1QQI A;  2Q2E A;  3RYP A;  2XGC A;  4IHV A;  3I0T A;  2R0Q C;  2LFB A;  1TQI A;  1S5L C;  1S6L A;  1K61 A;  1UST A;  1X1A A;  3RCO A;  4Q5S F;  1WHU A;  1Z9C A;  1YJW I;  3QWL A;  4RAZ A;  2XDN A;  2NVT J;  2NP3 A;  3RQI A;  3IWF A;  1JHF A;  2CRG A;  2QVO A;  3DU5 A;  2UXX A;  3RQ4 A;  3BPX A;  4A3I J;  4D9J A;  1D3Y A;  4HDU A;  2LP0 A;  1K79 A;  4U9N A;  3CUQ C;  1FYM A;  2VQC A;  2HEO A;  1OYI A;  5KNL A;  3GTO J;  5GPA A;  4RA2 A;  3L2U A;  3TW6 A;  2MLG A;  1W36 C;  1VQ6 I;  3CDL A;  3IAM 2;  1H89 C;  2RNG A;  1RZ4 A;  4NQW B;  1BBY A;  3QKX A;  3J7Y J;  1U2W A;  3VVZ A;  4YFK F;  3I53 A;  1NTC A;  1IV6 A;  2IU5 A;  2LC2 A;  3HIF A;  3H9J A;  3Q0V A;  4O3M A;  2KIM A;  4LMY A;  3JW4 A;  3IP4 B;  2VXZ A;  2OV7 A;  1T8I A;  4ANJ A;  4KN4 X;  1L3L A;  5TIS C;  4UUS A;  3QOP A;  4D7N A;  5CW8 A;  3RH2 A;  1Z05 A;  5IOY A;  1SVL A;  1R7J A;  3H9G A;  5DUK A;  5JFR A;  2O9L A;  2R7V A;  1IXC A;  3HRU A;  5J1Y A;  2IT0 A;  3D5R C;  3WGG A;  3BTI A;  1N78 A;  2W1O A;  3HJE A;  2ZOZ A;  3PUB A;  2ZFW A;  3FMR A;  1SVM A;  2QSH X;  3CD6 I;  2K3F A;  4K2E A;  1ZRF A;  2R4G A;  2ZXI A;  4ZYH A;  4RB0 A;  5K1Y A;  2R5Z A;  1ZYR F;  2XF5 A;  2WAQ A;  2GXB A;  1IDZ A;  1DPR A;  4CGR A;  4XLC A;  5CVI A;  2W48 A;  1G3T A;  3NXC A;  3OYN A;  5IPA A;  3GFL A;  3PSI A;  3F3X A;  4ZYG A;  4AYB N;  3O3K A;  2HQN A;  1UCR A;  3GF2 A;  4ZYE A;  2VOP A;  2RQP A;  4BU2 A;  2FOK A;  2Y0M A;  3NAR A;  3SJM A;  2JWT A;  3K69 A;  5E3O A;  2PJP A;  2MA3 A;  3FXQ A;  4X1E A;  3WHC A;  5LGT A;  4MQ9 F;  1BI0 A;  3K4C A;  3CLQ A;  1QA6 A;  5JR3 A;  1H9T A;  4UDS A;  2YSR A;  3HTS B;  1MJA A;  1XSX A;  3E7L A;  2M5W A;  3QAH A;  2M0M A;  3AQS A;  4OD5 A;  1ZK8 A;  4U9L A;  3A0B C;  3W2W A;  2LNB A;  2Y0S A;  2WC2 A;  4W1U A;  5D5V B;  3FX3 A;  4J01 A;  5F0C A;  1O3S A;  3CME I;  1SAX A;  3OYH A;  3CCU I;  3DU6 A;  2ZXJ A;  3REO A;  2HZD A;  2V9K A;  4HV5 A;  2GEN A;  3IUO A;  3OIP A;  3CJN A;  5AIQ A;  1P7J A;  1R23 A;  4BAY A;  3QBM A;  5FMP A;  3KKD A;  3PNY A;  3A2K A;  3U1K A;  2E1N A;  1KGS A;  1E3H A;  2V26 A;  1IN4 A;  4BHP A;  2K5C A;  3FHN A;  2QQ8 A;  3LA3 A;  1U9N A;  3OYM A;  3ZQG A;  2NS0 A;  4ENN A;  2WUI A;  2AHQ A;  1HSJ A;  1XD7 A;  4UXN A;  5L3E A;  5FD5 A;  5FO5 A;  2CW8 A;  2NNN A;  1AKH B;  4XKB A;  2ZY9 A;  2KIQ A;  2HQ5 A;  2V7F A;  3V42 A;  3LWJ A;  1MZB A;  1Y1W J;  2JVH A;  2YU3 A;  2QWT A;  1XPX A;  2L9R A;  1OR7 C;  3OWT A;  4KIT B;  1PP8 F;  4C3I J;  1OYY A;  3JRG A;  3B81 A;  4BDY A;  1LVK A;  3RTR A;  2N8G A;  1HOM A;  1OJL A;  4EM0 B;  3GTK J;  2VKV A;  3CCS I;  3COA C;  2EQR A;  2FXA A;  4PDK A;  1ETV A;  1YOV B;  2P6S A;  1AKH A;  2D45 A;  2PI0 A;  3CJR B;  4JL3 A;  1XTA A;  4PUS A;  1BJA A;  5E1X A;  2UXI A;  4Y17 A;  1K6O A;  1IO2 A;  4A93 J;  4JOM A;  3RD3 A;  1FY7 A;  2DI3 A;  3DKW A;  2NVX J;  3R0A A;  4JX6 A;  1YTY A;  3R60 A;  4HZF A;  3F22 A;  1QBJ A;  3K9T A;  4HSR A;  3DPT A;  4RAG A;  3B73 A;  1UHS A;  3GXO A;  2QSF X;  2Y9Y A;  4P55 A;  4RGR A;  3V4G A;  2GXG A;  2ZCW A;  3LSG A;  2VI6 A;  1P4W A;  5EDN A;  4I76 A;  3HGG A;  3CCV I;  1BA5 A;  2MGQ A;  5H6R A;  1XMK A;  3UR3 C;  2RVC A;  3HPH A;  2H09 A;  1FTT A;  2I5U A;  1N75 A;  3ZR8 X;  4XLF A;  1QRY A;  2NYX A;  2PMZ N;  1SFX A;  4JK1 X;  3GYH X;  2VC1 A;  3K0L A;  3MFK A;  4B1R A;  3SZP A;  3HOX J;  1V3F A;  3JAM Z;  1YJ9 I;  2IS4 A;  4HF0 A;  2B0L A;  2DQL A;  3SXY A;  3JSO A;  2DAO A;  2L9N A;  2HXI A;  3HC7 A;  4G7H F;  1D0Y A;  3G73 A;  3L2W A;  1SFE A;  3VYT B;  2HFH A;  2X1E A;  2GA2 A;  2WY8 Q;  2M0C A;  4PJJ A;  4ENK A;  5ILU A;  1WGX A;  4DIQ A;  3OYF A;  4ZH4 F;  2O61 A;  4IEJ A;  3L09 A;  3R4K A;  2CU7 A;  3MQ0 A;  1WZ2 A;  4IL6 C;  3P9K A;  3VYR B;  2NS8 A;  1BOA A;  2ID6 A;  3F1B A;  4A0Z A;  4BE2 A;  3OS2 A;  4BS9 A;  3S32 A;  1TL8 A;  1EKE A;  3CQZ J;  3BZC A;  3GBG A;  1JTY A;  4BXF A;  3DEW A;  5DM7 F;  3H1C A;  3IC7 A;  1D8J A;  1J59 A;  1R5I D;  2XAH A;  1X1P A;  3J7Z I;  1Q1H A;  1I50 J;  3SDG A;  3LFK A;  4ABZ A;  2QKL B;  3CO6 C;  2NXN B;  5ICE A;  1CQT A;  3S1Q J;  3C07 A;  2DFE A;  4DBQ A;  4A3L J;  2ZCM A;  5K58 A;  1G2H A;  2OCC H;  4HEA 2;  2NVQ J;  3J7A Y;  2F07 A;  3H3V K;  4RLQ A;  2ZC2 A;  5LEJ A;  1RKT A;  4A5N A;  2CO5 A;  1G59 A;  3CUO A;  1WJD A;  3PFY A;  4CO8 A;  2ISZ A;  5FKO A;  3PO3 J;  1SVO A;  1BW5 A;  3EUH A;  1H0M A;  2PJR A;  3TW7 A;  1BR2 A;  2M87 A;  2ZJR F;  2DMT A;  4EMS A;  1ETQ A;  2M3A A;  2GFN A;  5BS6 A;  4EGY A;  5FRN A;  1PJR A;  3AL0 B;  2XF7 A;  4Y15 A;  3ASN H;  3BG6 A;  3G1L A;  4UB6 C;  4DYQ A;  3G7R A;  2DG7 A;  1JJ8 C;  2AQF A;  3QP5 A;  4HX8 A;  1Z6R A;  3LSM A;  3L7W A;  4FTH A;  2F6C A;  2IW5 A;  2A5W A;  4FE4 A;  3AG3 H;  3IH4 A;  2DPD A;  1IN7 A;  1SAN A;  1S9H A;  2DA7 A;  2XRO A;  2EV5 A;  3HTU A;  3LFU A;  3BJO A;  3HTH A;  2IVM A;  4FET A;  5CKT A;  1A5J A;  1YIJ I;  2ZJQ F;  5M5W J;  1Y8Q B;  3QOD A;  2R7Q A;  1RUN A;  4M6X A;  3GFI A;  5GAE J;  4CZZ A;  2K27 A;  2JVG A;  3B6A A;  4EEF G;  3CLO A;  1S29 A;  1FX7 A;  1IN6 A;  3BWG A;  3HKZ A;  2V79 A;  2M34 A;  2P6T A;  1T95 A;  4HV6 A;  1X3W B;  4G6Q A;  2FE3 A;  2RNJ A;  4FCY A;  3DP7 A;  2O0Y A;  1W5C C;  2ID3 A;  2COM A;  3JAM K;  4KNY A;  3OIO A;  1X1C A;  5KVR A;  3SZT A;  2PEX A;  1O3T A;  3VOK A;  2JTV A;  1IUF A;  2A3S A;  4FE7 A;  4RM3 A;  2DOF A;  5GAD J;  3CCR I;  4XBF A;  1ZLJ A;  2JQ7 A;  4Q47 A;  3UNG C;  5J1R A;  2A61 A;  3NRG A;  5FLX Z;  1C0W A;  4MEX F;  1U5T C;  4CDG A;  1TW3 A;  1Z3Y A;  2VL8 A;  1VQL I;  4BHB A;  4MEY F;  1ZGW A;  1D0X A;  3I64 A;  2NVY J;  1ETK A;  2BHY A;  2OER A;  5ED4 A;  3F9K A;  1CF7 B;  2FBH A;  3IAS 2;  3VSK A;  3S3O A;  1XC5 A;  1WI9 A;  4BJ6 C;  1BR1 A;  1SD4 A;  4CYD A;  5JVG F;  2DYS H;  1SFO J;  3KZ9 A;  2ETH A;  3K4B A;  1WJE A;  2K86 A;  2HPM A;  4EV0 A;  2ZO4 A;  4IOA F;  1OMI A;  2F2E A;  2DA1 A;  4PJL A;  3KZI C;  2VN2 A;  4ZYA A;  4CH7 A;  1BC8 C;  2CS3 A;  3J7A O;  3DCF A;  3WTY C;  4GO1 A;  2L5Q A;  2HOT A;  1IDY A;  5F1J A;  3NEU A;  1ZGJ A;  2IGK A;  4M6Y A;  3ABK H;  3GO5 A;  1YFH A;  1T98 A;  2HKX A;  4QTR A;  1YI2 I;  4LIV A;  3TGN A;  2K3P A;  3MN2 A;  4IRV A;  3GFJ A;  1HW2 A;  2DBB A;  1Z3X A;  2W57 A;  3Q9V A;  2EPF A;  3WGI A;  3KZZ A;  1YJN I;  3AG2 H;  1TZL A;  2KJB A;  4HW0 A;  2O3F A;  3GTG J;  5HOO A;  4CZC A;  3D1N I;  2F4I A;  5M5Y J;  2QM3 A;  1MIJ A;  2DA4 A;  3JRI A;  2RAE A;  3N05 A;  1ONV A;  4L9V A;  3LAP A;  3OS0 A;  1KON A;  2O03 A;  3OYL A;  5E17 F;  1LFB A;  1BOB A;  3CMA I;  2BGC A;  4A3F J;  2OC6 A;  5K5Q A;  4C2M A;  1TWC J;  2WB1 A;  4QSH A;  1LQ1 A;  2P4W A;  4A6D A;  2X0L A;  3RZD J;  5JHU A;  4S04 A;  3P9T A;  4R8H A;  1MDM A;  3V7R A;  2JA6 J;  1EV7 A;  3CRJ A;  2ZSI B;  3A0H C;  3BR5 A;  4HYE A;  4ASN A;  4PK4 A;  5ICG A;  3V8K A;  2HU9 A;  1BI2 A;  3GCM A;  2IS1 A;  3FZV A;  1OCR H;  3U21 A;  3N97 A;  2Z5U A;  2EB7 A;  3L1P A;  4MIM A;  5LHH A;  3ON4 A;  2M45 A;  4NC7 A;  4PJ0 C;  2DT6 A;  1WH7 A;  2OD5 A;  2IS2 A;  3CC4 I;  3ZP5 A;  2PZ9 A;  2LF7 A;  3OYK A;  3BTL A;  3SEZ A;  2I8D A;  1SD7 A;  4E7L A;  2Y0S N;  3JR9 A;  4XMY A;  4P96 A;  4AD9 A;  4HNU A;  2WTE A;  5FGL A;  1LJ9 A;  1I3A A;  4PXI A;  1VQ8 I;  2OA4 A;  4UUT A;  3GZ6 A;  2R3S A;  4M6V A;  2M8E A;  2PFV A;  4HQE A;  2VQG A;  2X6O A;  3ESW B;  3G2B A;  4LOC A;  3HTI A;  5TRD A;  3S2D J;  3H0G J;  5DCM B;  3K1P A;  4JBA A;  3RKY A;  1D0Z A;  4QLC U;  2GIV A;  4LIU A;  1ZAR A;  5A2Q K;  2VC0 A;  2VT2 A;  1HC8 A;  3E0J B;  3I71 A;  4HOB A;  4XRS G;  3S14 J;  3D0S A;  4E7J A;  1UHW A;  1W36 D;  4IHT A;  4ZDL A;  2DLL A;  2UZK A;  1FP1 D;  2IGM A;  4A3G J;  3OL4 A;  1YLF A;  3BY6 A;  2ZB9 A;  1V5E A;  1JT0 A;  4E7Z A;  4BE1 A;  3ANP A;  3HOT A;  1MH3 A;  2HOE A;  1TT5 B;  1EH8 A;  4ZTJ A;  2ZKZ A;  2KFD A;  3ABU A;  4EGZ A;  1U5T B;  4MTE A;  2FNA A;  1VQ9 I;  1JKQ C;  3MZ8 A;  5FKM A;  2OBP A;  2UXH A;  2DFI A;  3S2H J;  1G3Y A;  5B66 C;  2WWY A;  1Y8R B;  1RES A;  2CQK A;  3HHH A;  3F8M A;  1Y56 A;  4AWX B;  4GFK A;  2I10 A;  4U0V A;  2RHA A;  2E2I J;  5FRO A;  1XDS A;  3TDZ C;  2LR8 A;  2L7M P;  1B9N A;  2HGC A;  2A68 F;  3GME A;  4Z2Y A;  1Z21 A;  5IP9 J;  3BJB A;  2VT3 A;  4D0P A;  4YZE A;  3CF5 F;  1G3S A;  1TT0 A;  2CQQ A;  1J2X A;  4L0Z B;  1ZEL A;  4CIC A;  1OKR A;  5A2Q Z;  1VQ7 I;  3ABM H;  1ETY A;  2OJE D;  4C2M J;  4KWA A;  3LST A;  3TO6 A;  4NEL A;  2BXY A;  3L2R A;  1BI1 A;  1MBF A;  1QZY A;  3C2H A;  3FKI J;  3DEU A;  1U8R A;  1UAA A;  4XQF A;  2BY2 A;  1VTN C;  1XGN A;  4MFE A;  3G1M A;  4YEJ A;  2VOO A;  4EQQ A;  4XKV A;  1G8X A;  2G9W A;  2FA5 A;  5D18 A;  5EEH A;  2KHM A;  4B43 A;  4G94 A;  1WKM A;  1IRX A;  1S7O A;  2BW3 A;  2FJI 1;  3H5N A;  3CC2 I;  1LEA A;  1BIA A;  3G3Z A;  3NI7 A;  1UG2 A;  3V78 A;  2LBF B;  3L9F A;  4LK0 F;  5IP6 A;  2NRA C;  2LLK A;  3KFW X;  4S0H B;  3DTE A;  3DWL E;  3J81 K;  4IPA A;  1ERD A;  4RDU A;  4XN0 A;  1LE8 A;  3DBR B;  2A6E F;  1KZH A;  2F5F A;  3EQL F;  4KN7 X;  5K7Z A;  3GTL J;  2D2W A;  1DGW Y;  3KCC A;  1J09 A;  3WU0 A;  1R71 A;  4IJA A;  2JPC A;  4NN1 A;  1Y6I A;  2CYY A;  2OUM A;  2BEO A;  1S72 I;  1APL C;  2HYF A;  4FX0 A;  5D8K B;  1R22 A;  1U8B A;  2L01 A;  3DBL B;  1D1B A;  4GCK A;  1QNT A;  4Y4R A;  4HDV A;  4A5M A;  2HXO A;  2UWM A;  2E1C A;  2RGV A;  2MD0 A;  5ICC A;  2QIB A;  5HLI A;  1MSE C;  3S16 J;  1MBJ A;  2DTR A;  3DEE A;  1XDU A;  2CW0 F;  4M9S A;  1OLT A;  3FHZ A;  1BR4 A;  1DP3 A;  3PFI A;  4BQA A;  5LRS A;  2E1M C;  1V4R A;  2LKP A;  1TTY A;  4P9F A;  3BTC A;  2EA4 A;  2EWN A;  2M7B A;  2DJI A;  3E1S A;  5ICF A;  4ZDO A;  2BY3 A;  2XAQ A;  2QF7 A;  2E60 A;  1OCC H;  3VOE A;  4CCK A;  2FQ4 A;  1WFX A;  3O60 A;  4WK8 F;  1ON2 A;  2KKO A;  2OTJ I;  5FD6 A;  2LRE A;  5C4Y A;  3BZK A;  2V4J C;  3DTK A;  4U0W A;  3HOY J;  4XN3 A;  2UXP A;  1ZG3 A;  3TOB A;  2L2O A;  4RGX A;  3LSI A;  2DMU A;  3HTA A;  3E6M A;  1ZN2 A;  2MYS A;  3W6J B;  2FD5 A;  3BRO A;  4DNC A;  3CMY A;  1RC9 A;  3ECO A;  1Z7L A;  1PDN C;  1P2F A;  4N9H A;  4LG3 A;  4L9N A;  2VBY A;  2MC4 A;  5D1R A;  2QTQ A;  2K4J A;  4KA4 A;  2CV0 A;  2Z3Y A;  2VKD A;  2R5Z B;  3KP7 A;  2P7V B;  3E5X A;  4CSW A;  3FM5 A;  2EFQ A;  2X85 A;  2JK3 A;  2OZ6 A;  3CP8 A;  1YRN A;  1FIA A;  2CQ7 A;  4JP0 A;  4AVZ A;  2XC7 A;  1S8N A;  3EUA A;  2VBX A;  2PX9 A;  2PLY A;  2FF4 A;  2DOD A;  1A6Q A;  2IA1 A;  2R93 J;  5EZG A;  4F55 A;  3LQQ A;  5FLX K;  2BBY A;  1TLH B;  3SDB A;  5CPR B;  5LHG A;  3WU2 C;  3K2A A;  1HBX G;  1K78 A;  1N77 A;  1J7K A;  2X48 A;  4E70 A;  1BC7 C;  3WE3 A;  2EV0 A;  5IYB J;  3GTM J;  4OOI A;  2XVC A;  2ECC A;  1MBH A;  3FK7 A;  4WXH A;  2P7C B;  1VQO I;  1R4M B;  3OYD A;  1YIT I;  3JCU C;  1PUF B;  1QZE A;  3BG7 A;  2CUF A;  3DXJ F;  1FMV A;  2R5Y B;  1LFP A;  3C2B A;  2WAQ N;  2E7X A;  3V7C A;  2G7S A;  3EGQ A;  3DV8 A;  4Y52 J;  2BYV E;  2JRT A;  2XAF A;  3VFZ A;  3HOU J;  3BG3 A;  2A6H F;  2K9L A;  1MMS A;  3C18 A;  2KDZ A;  3EYY A;  5E3N A;  2R92 J;  1EF4 A;  4XK4 A;  2VUM J;  1R6R A;  3TQN A;  2MD5 A;  3BCB A;  2ZXW H;  4D7M A;  4BUP A;  2VE8 A;  1W0T A;  2QYO A;  3KLN A;  1EA3 A;  3G1O A;  1MBK A;  2HQA A;  1Y39 A;  1F5T A;  2YUS A;  3LSJ A;  2CG4 A;  2DK8 A;  3TBI A;  5JHF A;  2XAJ A;  5L3C A;  4L0Y B;  2YX7 A;  4LK1 F;  3KNW A;  4BNC A;  3FF5 A;  3WG7 H;  2P5L C;  3WTV C;  4B44 A;  1LDD A;  2CFX A;  1T56 A;  2HQR A;  2L7K A;  4B47 A;  1D1C A;  3WTU C;  4U0Y A;  3U2R A;  1D5Y A;  2E5N A;  4XOR A;  4Q4Z F;  4II3 A;  3GTP J;  3ISP A;  2QZ8 A;  3K2Z A;  1RR8 C;  4E7H A;  1LVA A;  2OZU A;  1B8I A;  2EZH A;  1DDN A;  1B59 A;  4JX4 A;  1MBG A;  5E3L A;  2UXN A;  4I7H A;  4QPQ A;  2Q8K A;  1FOX A;  2XV4 S;  2W7N A;  3ZQQ A;  1QVT A;  1G4D A;  3CJT B;  1VND A;  3VW0 A;  5M5X J;  2XRL A;  2EFO A;  4XLN F;  3R0J A;  5CVR A;  3KYD B;  3SHF A;  4LLN A;  1ZR2 A;  1UI5 A;  5CQG A;  4ZDP A;  3AL0 C;  5DD8 A;  5B1A H;  4CYC A;  1R58 A;  1L0O C;  3BP8 A;  1FBQ A;  1F43 A;  2STW A;  1QHH D;  2P5K A;  3FXR A;  5CQE A;  1OR7 A;  2FNP A;  1OFC X;  3DPJ A;  2WB1 N;  5D6E A;  3HOZ J;  3P5J A;  3A1Y A;  4ENJ A;  1YRN B;  1TQM A;  1MJB A;  1TW2 A;  3VW1 A;  1FIP A;  1FBU A;  3M07 A;  5H9T A;  3S5R A;  4RB1 A;  2F4O B;  3BT9 A;  2LD5 A;  2BHZ A;  1X2N A;  3CF2 A;  1I3Q J;  1TQP A;  2LY1 A;  4LB6 B;  2B9S A;  2R7Z J;  3HDD A;  4IRI A;  2KZG A;  1N25 A;  3HSE A;  5J3L A;  4AID A;  3OS1 A;  4HX7 A;  3ZXS A;  2FSW A;  4RAY A;  2HDD A;  1MSF C;  2PBI A;  2UXO A;  3NRV A;  2QQB A;  4OU0 A;  3MKY B;  3M1C A;  4GRI A;  2IXS A;  2A05 A;  2AXL A;  2DCE A;  3PL8 A;  4XIC A;  3PQK A;  1GUU A;  1X3Z B;  4CXF A;  1AHD P;  1QHG A;  4FQG A;  2EBI A;  3ZPL A;  3ASO H;  1T2K A;  3H9Q A;  2DQR A;  4DOZ A;  3K1M A;  4XLA A;  3H0D A;  1E0E A;  2AXT C;  2G0E A;  2DMN A;  3BPV A;  1SC7 A;  4F3Q A;  1I6H J;  4EJU A;  1I39 A;  4YG2 F;  4CA0 A;  4YII A;  5C4X J;  2MW8 A;  2FUG 2;  1Z6T A;  4KDP A;  3CCL I;  3O8G A;  3JRD A;  2A2F X;  3L2Q A;  2LKX A;  2VJI A;  3ZN0 A;  4M74 A;  5F0F A;  4DGW B;  1QGP A;  2ME6 A;  4B3X A;  3WTW C;  5TJJ A;  3ZQI A;  1IRZ A;  1VF9 A;  2K9M A;  4YFN F;  1WJB A;  4ACI A;  4A3B J;  5D5X B;  4CGZ A;  5LFA A;  1KU3 A;  2IA2 A;  1GVJ A;  3A01 A;  2QKM B;  2M7A A;  4RB3 C;  1MMG A;  5FKN A;  1Q1V A;  2BV6 A;  2C6Y A;  1TNS A;  1IF1 A;  1OCO H;  1F4K A;  4E4H A;  3HXL A;  2X1D A;  3CJD A;  1O7F A;  3QU6 A;  3HPG A;  4MTD A;  2EIK H;  2XGX A;  2BOL A;  1SMY F;  3KYC B;  4XOT A;  1QU3 A;  4M3D A;  2RC4 A;  3JRF A;  1MGT A;  4A3J J;  3OYB A;  3PAS A;  3F8C A;  4AC6 A;  3F0C A;  1FLI A;  3RIR A;  1ZLK A;  2A6T A;  5FGM A;  4HLX A;  3W2V A;  2EFN A;  3CWR A;  4NUB A;  1P9Q C;  3HUG A;  4I0B A;  3T6N A;  3UKG A;  2IGN A;  2D1H A;  2H1K A;  1ENH A;  1HXD A;  5DDG A;  1HCR A;  5CVJ A;  4BEH B;  4NDL A;  1OCP A;  2M9H A;  2K9S A;  2FQ3 A;  4V2G A;  3F6V A;  3DPL C;  3MKW B;  3B02 A;  4B3A A;  3IUV A;  2VE9 A;  3CZ6 A;  1YS6 A;  5BNG A;  2JSC A;  2DMP A;  3EPZ A;  5HS9 A;  4G9Y A;  4PSX A;  1XGM A;  3D5S C;  3O8H A;  4M3G A;  5DTD A;  2ACJ A;  2CH0 A;  3EYI A;  1ZRE A;  4MXM A;  2QA4 I;  2VXD A;  2E7W A;  3GZ5 A;  2XRN A;  2JA5 J;  4IHY A;  4XID A;  1VQ4 I;  2QGU A;  4PCQ A;  2X6X A;  3HSF A;  3ZMU A;  2LBF A;  1W7P B;  3OYE A;  4WCG A;  4YIF A;  3MZY A;  2W82 A;  1DU0 A;  1TP4 A;  4DZP A;  4R79 A;  2XAG A;  3CUQ A;  4KT6 A;  4AC0 A;  5J8C A;  5DEQ A;  3KP4 A;  1UI6 A;  1ZR4 A;  1HST A;  2X1C A;  3DLA A;  3GEU A;  3IHU A;  5HAW A;  3JRB A;  1UHM A;  1SAU A;  1KQ9 A;  3HE0 A;  2CQX A;  1RPW A;  3RJP A;  1R1V A;  4D5F A;  4IRH A;  1DU6 A;  3U9G A;  4E7S A;  3S3N A;  5CJ9 A;  3ZMS A;  3KX2 A;  1VI0 A;  3DTI A;  4L5I A;  3KPH A;  5HLG A;  3F6O A;  2E35 A;  1OPC A;  1JE8 A;  4Y13 A;  4F92 B;  1FTZ A;  5EFY A;  1P6R A;  3FMS A;  2XPV A;  2BVM A;  1QPM A;  2K7L A;  3NS4 A;  1EH7 A;  2E1O A;  2H6C A;  5CYV A;  3SQN A;  3HB9 A;  3V8J A;  5L3D A;  2OQR A;  4M3E A;  3VVY A;  3OMY A;  2ZXH A;  3BNI A;  2ICW G;  2M2E A;  3ZMZ A;  3M9A A;  5IT9 Z;  5FJ8 J;  2KL4 A;  2HWV A;  1JGG A;  2DA2 A;  2O6G E;  1P4X A;  1XCB A;  4GCT A;  3A03 A;  4U7B A;  3HRS A;  1AU7 A;  1IXS B;  3K10 A;  5D5U B;  1FZP B;  2QBY B;  1U9O A;  2XB5 A;  3VYS B;  3ROU A;  3WTX C;  2LG4 A;  3M8F A;  4UY8 I;  1HA8 A;  3VEP A;  4ZTF A;  3BR0 A;  1AWC A;  2EH3 A;  5JLX A;  2CFO A;  2X51 A;  4QWQ A;  1MNM C;  2X6W A;  1NK2 P;  5C44 J;  2VKE A;  4ENM A;  1ON1 A;  2XPU A;  1JGS A;  1XGO A;  3DBH B;  1FMW A;  2ESH A;  2NX4 A;  1HKS A;  2L9S A;  3JRC A;  5D4R A;  5L3B A;  3ZCO A;  2VON A;  3CDI A;  4RAF A;  3RPU D;  2HYT A;  5J6X A;  1WH5 A;  2HYJ A;  3IWZ A;  4G8X A;  3CCY A;  3BR1 A;  4H4K C;  2KJC A;  1FYL A;  1I27 A;  2R7D A;  1RRJ A;  2L0K A;  2PMH A;  4OAY A;  2KP6 A;  1GV5 A;  2PN6 A;  3W3C A;  3DF8 A;  2R7R A;  1ZAO A;  3I55 I;  3QYF A;  3H35 A;  4YFX F;  2FRH A;  4UNO A;  3HOW J;  1ORK A;  1RI7 A;  2E5Z A;  4KIG A;  2B1E A;  2OTL I;  3QU3 A;  3QPT A;  4W97 A;  5HLT A;  1VQK I;  2PFB A;  4FT8 A;  1Y0N A;  5KAF C;  3K70 D;  4HQM A;  2DFF A;  1RNL A;  1V5F A;  4GXO A;  4UB8 C;  2VLA A;  3T8T A;  3PIP F;  2D1V A;  3VW2 A;  2DW4 A;  3I4N J;  5EEG A;  2DA5 A;  2RRE A;  1FP2 A;  3HIM A;  1KA8 A;  4BXU A;  5B1B H;  1W4M A;  1FYK A;  4HAM A;  4UV9 A;  1SEU A;  5J4Y A;  4U87 A;  4O5V A;  5IYD J;  3HSR A;  3HG9 A;  2IRF G;  4G6D A;  2STT A;  3BR6 A;  4I02 A;  1T33 A;  2KZV A;  4LLG F;  4NQW A;  1WJF A;  2CJJ A;  3X2Q H;  1FOY A;  3SEQ A;  2DN0 A;  5DUI A;  1GT0 C;  3ZRG A;  4M9X A;  4M72 A;  5H20 A;  2Q1Z B;  3RKW A;  3I56 I;  4MLO A;  3HYI A;  4U7D A;  3E6D A;  4LFU A;  3KEY A;  3RYR A;  1USS A;  2L54 A;  4KJZ A;  1XCV A;  4U88 A;  4IKF A;  4BGD A;  2DDB A;  3CC7 I;  3ULQ B;  2NNY A;  2NVU B;  4A6E A;  3WGH A;  3PM1 A;  1K4S A;  2LRD A;  2G7U A;  4LB5 A;  2HDC A;  2GXA A;  4C2U A;  1YQA A;  1UZC A;  3NNR A;  1K78 B;  4GYI A;  4XRF A;  5J4V A;  3IL2 A;  1ZG1 A;  2ZME C;  2FBQ A;  3I58 A;  5KCM A;  3HOS A;  3FXU A;  2FBI A;  5FB2 A;  3CCJ I;  1ZTR A;  2DA3 A;  2E1M B;  3FIW A;  5J47 A;  3GUD A;  3LSK A;  3TED A;  1HKT A;  3VP5 A;  3RZO J;  4N4O B;  4M9Z A;  2P8T A;  2PMU A;  3E6C C;  3W6K B;  1G6N A;  2WAE A;  3K6G A;  1OCZ H;  4EM2 A;  2EFW A;  1DGR M;  3E6B A;  3OYG A;  1ZGA A;  2WBM A;  5EG0 A;  4DYC A;  4A0Y A;  4A69 C;  2B7E A;  3CES A;  2E36 A;  1R49 A;  1XB4 A;  3HGY A;  2M4G A;  5F64 A;  5TGT A;  2WV1 A;  1LDK B;  3KE2 A;  1YO5 C;  1IAW A;  1UEL B;  2VPL A;  2O7T A;  1MMN A;  2R7O A;  1BN5 A;  2DYR H;  3BR2 A;  3CO7 C;  1CGP A;  5J40 A;  1J5Y A;  3ZQ7 A;  1FWZ A;  4E6K G;  3EET A;  1Z77 A;  3TP3 A;  2ELJ A;  2L4A A;  4PZJ A;  5F6F A;  2DK5 A;  4B8X A;  4WIB A;  1IW7 F;  2QEX I;  4DZJ A;  5LD2 C;  1H9G A;  4GCV A;  4MGR A;  3RSN A;  5CVV A;  3WOD F;  3NWS A;  1B8I B;  1XMA A;  5E79 C;  2QEN A;  3ANG A;  4EVI A;  2JSP A;  3L2V A;  2Y69 H;  2HNH A;  1W5S A;  3VPR A;  3MKL A;  1D5V A;  1V54 H;  1JTX A;  5HDK A;  1TWG J;  1WI3 A;  3I59 A;  2X6Y A;  4AYB A;  3RI4 A;  2ZCX A;  1JJ6 C;  3OYJ A;  1IN5 A;  1LUJ B;  1B72 A;  2BXZ A;  3F21 A;  4M73 A;  4RS8 A;  3VWB A;  1FBS A;  3VVX A;  1U6G A;  3LSP A;  4XLE A;  2KMU A;  4RBO A;  4TV7 A;  2AO9 A;  1QO0 D;  1MD0 A;  3S17 J;  2X9D A;  1XSV A;  3MEX A;  1O3Q A;  1H8A C;  1BI3 A;  3T0Y A;  5EEA A;  4Y33 A;  1F36 A;  3HRT A;  2KT0 A;  4KIS A;  2VAS A;  2FOW A;  3M8J A;  4F91 B;  3G6E I;  4ITV A;  3MMY B;  1BW6 A;  3CMM A;  1WJA A;  4BYY A;  3CCE I;  3MZH A;  2QCO A;  3I3L A;  2LY2 A;  4A3D J;  2JUC A;  2EK5 A;  3Q9S A;  2DMQ A;  2Z2S B;  1ODD A;  5LHI A;  2JZY A;  1IC8 A;  2JMW A;  2YX4 A;  2HVS A;  5K5R A;  2XB0 X;  4NHJ A;  1TWF J;  3OYI A;  4QIW N;  1PUF A;  2EA2 A;  4UVB A;  4OMY A;  4IXA A;  2O5R A;  2Z33 A;  4EAT A;  1IZ1 A;  2K9N A;  3FBN B;  3JSP A;  3KLO A;  1LDJ A;  4HF2 A;  4IQJ A;  2K9Q A;  3PQJ A;  2YS9 A;  2NAZ A;  4BJT A;  9ANT A;  2F4M B;  2CUZ A;  4NC8 A;  2IS6 A;  4IRG A;  3DFG A;  2CMP A;  3S8P A;  4DJA A;  2K85 A;  3AQT A;  3QOE A;  1A6I A;  3BHQ A;  1X3U A;  3OYC A;  4LG0 B;  2KQR A;  2YVH A;  4IHW A;  2CUJ A;  1UFM A;  3ZGK A;  1YX5 A;  1B9M A;  3OOP A;  3F23 A;  3JRH A;  5EG0 B;  2GBY A;  4YIR X;  2EFP A;  4RGS A;  4A0X A;  2KRC A;  1JKO C;  2NP5 A;  3CUQ B;  2DOA A;  2WY7 Q;  1OCT C;  1WWX A;  3LSH A;  1IXR C;  3MD2 A;  4ZZD A;  3ZQH A;  3IH2 A;  5GTI C;  1PVE A;  3OIQ A;  1AOY A;  4KMF A;  5BPI A;  4CUG A;  2ZNZ A;  3HUG B;  3LA7 A;  4HG2 A;  4HX4 A;  4A3M J;  3NPI A;  5C4J J;  4HNT A;  3KKC A;  2BY1 A;  5JI6 A;  3GTJ J;  3ZQC A;  3FMQ A;  2MFZ A;  2AS5 F;  4O6J A;  1UB9 A;  1YE9 A;  3GVA A;  1WPK A;  3JTG A;  5FFX A;  3VYU B;  1DPU A;  2ECB A;  2CGP A;  4ESF A;  2E2J J;  4ZZL A;  4WWC A;  4IX7 A;  3GTQ J;  3LJL A;  1J75 A;  2NOJ B;  2NOG A;  2QQ9 A;  3ERE D;  2KIF A;  2Z99 A;  3GLL A;  2P0W A;  3S93 A;  2VOD A;  2WAF A;  3IKT A;  3FRQ A;  4ME9 A;  3M3Y J;  1MNE A;  4WXD A;  3LHQ A;  2V1D A;  3EUK L;  1UJ8 A;  3M1E A;  4HA8 A;  4HF1 A;  1SFU A;  4HKU A;  2HI3 A;  2Y30 A;  2EIM H;  3GEZ A;  1G3W A;  1TWA J;  1K4T A;  3VOD A;  4GYG A;  4L5E A;  5F08 A;  4C30 A;  1X58 A;  3COL A;  2COB A;  2HS5 A;  3CTA A;  5HS7 A;  4XR6 A;  2PMZ A;  3CJQ B;  3ZQF A;  3K4L A;  1KU9 A;  1LPQ A;  1MH4 A;  3FXO A;  3QPL A;  4IHS A;  4L18 B;  2G7G A;  2ZCN A;  2FMY A;  3DQV C;  3H3U A;  1YS7 A;  2ZJP F;  4E7K A;  3PSF A;  2IA0 A;  4BQO A;  3C2G A;  5L3G A;  2V6E A;  1DP7 P;  3OR2 C;  4XSX F;  1PYV A;  1TC3 C;  2LF8 A;  1YW7 A;  1X4O A;  2PJR B;  2IPQ X;  4JQF A;  4J19 A;  1MKM A;  3T5X A;  1Y1V J;  1R00 A;  2HPI A;  5B5E C;  1TNT A;  2W85 A;  3ECH A;  5E1Z B;  4NB5 A;  3TKY A;  3HM5 A;  2LH9 A;  2ZOY A;  1T0F C;  3TO7 A;  1IJW C;  3HOV J;  2J5O A;  3CCM I;  3BJA A;  1IN8 A;  2K40 A;  5HBU A;  1SD6 A;  1X1D A;  2A5Y B;  3S3M A;  4XSZ F;  4XNF A;  1T39 A;  2OU2 A;  1ETW A;  2Z16 A;  4A3C J;  2DFH A;  1MND A;  3P9I A;  4BAC A;  4B4C A;  3KYL A;  3PO2 J;  3MWM A;  3AG4 H;  3FK6 A;  3OOU A;  3Q0W A;  4ESB A;  1J0R A;  1U5T A;  2EZK A;  2BW3 B;  1R9T J;  2QBY A;  1ZG5 A;  4OIQ F;  1D8K A;  2IBD A;  4Z6Y A;  1B6A A;  2XAS A;  3LOC A;  2V1X A;  2F5C A;  5BOX A;  2R7X A;  3GX4 X;  5H6Q A;  4RM2 A;  2JA7 J;  3I54 A;  1BL0 A;  2DU9 A;  4XLH A;  2ZSH B;  1T08 B;  4UVC A;  2KIU A;  1QPI A;  5HDG A;  1R1U A;  1HQC A;  2OQG A;  3F72 A;  3J80 Z;  4X6A J;  4A3E J;  1VQ5 I;  3R6S A;  2XGD A;  4GGG A;  1ACI A;  1K7A A;  1EH6 A;  4AM3 A;  2FU4 A;  1IUY A;  4MFD A;  2GIZ A;  3BQZ A;  2L7Z A;  2XSD C;  1LE8 B;  4OWR B;  2VQH A; 
#chains in the Genus database with same CATH homology
 2DA4 A;  3S1R J;  2H1K A;  3JRI A;  1ENH A;  2RAE A;  1HCR A;  4NDL A;  1OCP A;  2M9H A;  2IEK A;  1XS9 A;  2K9S A;  4BBS J;  2WGB A;  1LFB A;  5DS9 A;  4V2G A;  1QVU A;  2GUH A;  4A3F J;  4B3A A;  3IUV A;  5K7H A;  2G7L A;  1TWC J;  4QSH A;  3BQY A;  5BNG A;  2EZL A;  1NK3 P;  2DMP A;  1S7E A;  3RZD J;  3P9T A;  5DTD A;  3O8H A;  4M3G A;  2JA6 J;  3LNQ A;  1JKP C;  3CRJ A;  5K7F A;  4MXM A;  3BR5 A;  3HBL A;  2HOS A;  2E19 A;  4MO7 A;  2JA5 J;  4IHY A;  4XID A;  3VOX A;  3L1P A;  4MIM A;  3ON4 A;  1HF0 A;  3S1M J;  1WH7 A;  3A01 B;  1GV2 A;  4M3B A;  1DU0 A;  2LY9 A;  2RAS A;  4DZP A;  2PZ9 A;  4AC0 A;  2JA8 J;  1UI6 A;  2CUE A;  1ZR4 A;  3BTL A;  2Y0S N;  3JR9 A;  2D6Y A;  3GEU A;  5HAW A;  3JRB A;  4JNN A;  2LTP A;  3S15 J;  3BRU A;  3HE0 A;  2CQX A;  5FGL A;  4CYC B;  1RPW A;  5M3F J;  2MG4 A;  4D5F A;  1DU6 A;  4PXI A;  2L7Z A;  4BKX A;  5EF6 A;  4UUT A;  4M6V A;  5F27 A;  1VI0 A;  2XGC A;  4ICH A;  4IHV A;  4BY1 J;  2R0Q C;  2LFB A;  2X6O A;  4LOC A;  1FTZ A;  3HTI A;  1K61 A;  5EFY A;  2XPV A;  2DJN A;  3S2D J;  3H0G J;  2XDN A;  2NVT J;  2NP3 A;  3VUQ A;  2E1O A;  3RQI A;  1HDD C;  3HB9 A;  2CRG A;  4M3E A;  1BJZ A;  3VVY A;  4A3I J;  3BNI A;  2IAI A;  4XRS G;  2LP0 A;  3S14 J;  2M2E A;  2NS7 A;  2Q24 A;  4AF5 A;  5FJ8 J;  1X2M A;  1JGG A;  2DA2 A;  4GCT A;  4BY7 J;  3A03 A;  3GTO J;  4UUS B;  5GPA A;  4A3G J;  2ZB9 A;  1JT0 A;  1AU7 A;  3TW6 A;  5IYC J;  2D5V A;  3ANP A;  1MH3 A;  3CDL A;  1H89 C;  1U9O A;  2XB5 A;  2Y9Z A;  3MNL A;  3SFI A;  3V6G A;  3QKX A;  2TCT A;  1ZKG A;  3VVZ A;  1JT6 A;  3BR0 A;  2EH3 A;  1NTC A;  5JLX A;  1IV6 A;  1JKQ C;  2O8K A;  2IU5 A;  5FKM A;  1MNM C;  1NK2 P;  2UXH A;  3Q0V A;  2HKU A;  5JLW A;  2VKE A;  5C44 J;  2TRT A;  2XPU A;  1JUS A;  3S2H J;  1RES A;  2NX4 A;  3JRC A;  4UUS A;  5CW8 A;  4D7N A;  3PPB A;  4GFK A;  3RH2 A;  5IOY A;  4HNV A;  2I10 A;  2HYT A;  2DTZ A;  1E3O C;  2O9L A;  1WH5 A;  2RHA A;  5J1Y A;  2HYJ A;  2E2I J;  4BXX J;  3BG5 A;  3CCY A;  5GPC A;  3BTI A;  3BR1 A;  1POG A;  2ZOZ A;  2LR8 A;  2L7M P;  2L0K A;  5IP9 J;  3BJB A;  1GV5 A;  4YZE A;  1FEX A;  2CQQ A;  2R5Z A;  4GFL A;  4KWA A;  1ETY A;  4C2M J;  1IDZ A;  4NEL A;  4CGR A;  1MBF A;  3FKI J;  3HOW J;  1VFC A;  4IHX A;  2M8G X;  1ORK A;  3GZI A;  2W48 A;  3NXC A;  5IPA A;  4MFE A;  3G1M A;  4AYB N;  4W97 A;  5E3M A;  4BBR J;  2W53 A;  5D18 A;  3OSG A;  3NAR A;  3SJM A;  2JWT A;  3JSJ A;  1FJL A;  5E3O A;  3NI7 A;  1UG2 A;  3E7Q A;  3V78 A;  4X1E A;  5IP6 A;  1IGN A;  3WHC A;  2LLK A;  4S0H B;  1TWH J;  3VW2 A;  3G56 A;  3I4N J;  3HEF A;  2DA5 A;  2GM4 A;  3HIM A;  5D19 A;  2Y31 A;  3K7A J;  4RDU A;  2JJ7 A;  3ZQL A;  4UDS A;  1LE8 A;  3Q3S A;  3LSR A;  5IYD J;  5K7Z A;  3E7L A;  3GTL J;  3BR6 A;  1JUM A;  1T33 A;  3IH3 A;  3AQS A;  1ZK8 A;  2CJJ A;  2XPW A;  4W1U A;  4NN1 A;  2DN0 A;  1IG7 A;  1GT0 C;  5F0C A;  1APL C;  3WHB A;  4MLO A;  1U8B A;  3ZOB A;  5FLM J;  2GEN A;  4C3J J;  5GP9 A;  4GCK A;  1P7J A;  2G3B A;  4JX5 A;  2HXO A;  3QBM A;  5FMP A;  3KKD A;  3MVP A;  2QIB A;  3EUP A;  3PM1 A;  1MSE C;  3S16 J;  1MBJ A;  3BR3 A;  1U9N A;  3ZQG A;  2UXU A;  2WUI A;  2AHQ A;  3Q0U A;  3NNR A;  2ME0 A;  2FBQ A;  1HDP A;  3BTC A;  1AKH B;  1JUP A;  2P81 A;  5IP7 J;  2HQ5 A;  4AUX A;  1ZTR A;  3LWJ A;  2DA3 A;  1Y1W J;  2QF7 A;  3FIW A;  2QWT A;  2L9R A;  3TED A;  1GVD A;  3VP5 A;  2OI8 A;  3RZO J;  2FQ4 A;  4Y7N J;  2JN6 A;  3O60 A;  2QKO A;  4C3I J;  3HTJ A;  3JRG A;  3B81 A;  5C4Y A;  3HOY J;  2UXP A;  2N8G A;  1HOM A;  1OJL A;  5EG0 A;  4V2F A;  3GTK J;  2VKV A;  5FKK A;  2EQR A;  4DYC A;  4A69 C;  2DMU A;  3HTA A;  1ETV A;  1AKH A;  3W6V A;  2XSD C;  1RR7 A;  2FD5 A;  3HGY A;  3CMY A;  4JL3 A;  2WV1 A;  2UXI A;  5D1R A;  4A93 J;  2O7T A;  1O4X A;  2QTQ A;  3RD3 A;  1ETO A;  3BR2 A;  2NVX J;  2R5Z B;  4JX6 A;  2JK3 A;  4M3F A;  1Z77 A;  3TP3 A;  1YRN A;  1FIA A;  1UHS A;  4JP0 A;  2Y9Y A;  5HOD A;  2OF7 A;  3LSG A;  2VI6 A;  4DZJ A;  2PBX A;  5EDN A;  4I76 A;  3HGG A;  4C3H J;  1BA5 A;  4GCL A;  2MGQ A;  1B8I B;  2R93 J;  5EZG A;  3ANG A;  3IV5 A;  1ETX A;  3VPR A;  3MKL A;  1JTX A;  1FTT A;  1TWG J;  1WI3 A;  2LVS A;  4D5C A;  4L62 A;  2L7F P;  3K2A A;  1QRY A;  2PMZ N;  2X48 A;  2ZCX A;  1JJ6 C;  4B1R A;  3HOX J;  5IYB J;  5EGO B;  1B72 A;  1LFU P;  3GTM J;  3B6C A;  3VVX A;  2ECC A;  1MBH A;  3FK7 A;  3LSP A;  3ON2 A;  3A02 A;  2HXI A;  4RBO A;  2AO9 A;  2ELK A;  3S17 J;  1PUF B;  2X9D A;  1H8A C;  2CUF A;  2R5Y B;  3C2B A;  5EEA A;  2YVE A;  2WAQ N;  1F36 A;  2DA6 A;  2KT0 A;  2G7S A;  3EGQ A;  3I4M J;  5J1U A;  4Y52 J;  2M0C A;  4JYK A;  1BW6 A;  1WGX A;  4IEJ A;  3HOU J;  3BG3 A;  2CU7 A;  2QCO A;  1JKR C;  2YU9 J;  2KDZ A;  4A3D J;  2NS8 A;  2ID6 A;  3F1B A;  2DMQ A;  5E3N A;  2R92 J;  1EF4 A;  4XK4 A;  1IC8 A;  2VUM J;  2JMW A;  3CQZ J;  2XB0 X;  3GBG A;  1TWF J;  4QIW N;  1JTY A;  1PUF A;  3DEW A;  5C3E J;  2XGE A;  4D7M A;  5FKL A;  1W0T A;  2K9N A;  3G1O A;  1MBK A;  3SDG A;  1I50 J;  2YUS A;  4ABZ A;  3LSJ A;  2K9Q A;  1CQT A;  2YS9 A;  3S1Q J;  9ANT A;  2ZCM A;  2O7O A;  4A3L J;  3C07 A;  3KNW A;  5K58 A;  1SGM A;  1G2H A;  3BG9 A;  2NVQ J;  2F07 A;  3H3V K;  3AQT A;  1T56 A;  1MBE A;  1A6I A;  1RKT A;  2FX0 A;  3BHQ A;  1D5Y A;  1K83 J;  5AQC A;  4A3K J;  3HKZ N;  3GTP J;  2YVH A;  5FKO A;  1RKW A;  4IHW A;  3PO3 J;  1B8I A;  1UMQ A;  1BW5 A;  3JRA A;  2EZH A;  2LK2 A;  3JRH A;  3TW7 A;  4JX4 A;  1HLV A;  1MBG A;  2DMT A;  5E3L A;  5EG0 B;  2GBY A;  4XRM A;  1ETQ A;  5EGO A;  2GFN A;  1QVT A;  2NP5 A;  1JKO C;  5CXG A;  1OCT C;  5FHP A;  1VND A;  1ZQ3 P;  3VW0 A;  5M5X J;  2XRL A;  3G1L A;  4DYQ A;  1ZR2 A;  3G7R A;  1UI5 A;  2DG7 A;  2VPR A;  1JJ8 C;  3ZQH A;  3IH2 A;  3BCG A;  4CYC A;  1F43 A;  4A3M J;  2H8R A;  3NPI A;  3VIB A;  5C4J J;  3KKC A;  3GTJ J;  3ZQC A;  4FTH A;  3M4O J;  1OFC X;  3DPJ A;  4FE4 A;  2WB1 N;  3IH4 A;  3HOZ J;  1SAN A;  5F0H A;  1WPK A;  1Z0X A;  2DA7 A;  3OSF A;  2R5Y A;  1YRN B;  2ECB A;  2E2J J;  3VW1 A;  1FIP A;  3GTQ J;  3LJL A;  5H9T A;  3HTH A;  1A5J A;  2FJ1 A;  2NOG A;  3S5R A;  5M3M J;  5M5W J;  3RKQ A;  3BT9 A;  4XRS A;  2LD5 A;  1RET A;  1X2N A;  1I3Q J;  2R7Z J;  2B63 J;  3HDD A;  3FRQ A;  3B6A A;  4EEF G;  4ME9 A;  3M3Y J;  2DG8 A;  3FIS A;  5J3L A;  5IOZ A;  2M34 A;  3LHQ A;  4I6Z A;  1GDT A;  2HDD A;  1MSF C;  2UXO A;  4FCY A;  5F04 A;  4HKU A;  2HI3 A;  2Y30 A;  2ID3 A;  1TWA J;  4XIC A;  1P7I A;  1GUU A;  3OIO A;  1B72 B;  1AHD P;  2EBI A;  5HSZ A;  3VOK A;  4L5E A;  5F08 A;  1IUF A;  1X58 A;  3COL A;  4FE7 A;  2COB A;  3TP0 A;  3ZQF A;  2REK A;  2G0E A;  2DMN A;  1XG1 A;  1I6H J;  5J1R A;  1MH4 A;  2G7G A;  3QPL A;  2QOP A;  2ZCN A;  3NRG A;  5C4X J;  2MW8 A;  5DAJ A;  3O8G A;  3JRD A;  2LKX A;  3NAU A;  1TC3 C;  5F0F A;  1H88 C;  4J19 A;  1ZGW A;  2NVY J;  1ETK A;  2ME6 A;  2OER A;  1Y1V J;  5EZH A;  2Y2Z A;  3ZQI A;  1IRZ A;  1XC5 A;  1VF9 A;  2MSY A;  3HM5 A;  2ZOY A;  1ITY A;  3KZ9 A;  1SFO J;  1IJW C;  3HOV J;  4ACI A;  4A3B J;  2EZI A;  2K40 A;  5HBU A;  5FLV A;  4G12 A;  3A01 A;  3S1N J;  2DA1 A;  1ETW A;  5FKN A;  4A3C J;  1Q1V A;  4B4C A;  3DCF A;  1U78 A;  3PO2 J;  3FK6 A;  3OOU A;  2V57 A;  3Q0W A;  1IDY A;  2HOT A;  5F1J A;  3CJD A;  4FIS A;  1R9T J;  2EZK A;  2IBD A;  4GFB A;  2GLO A;  2OPT A;  3LOC A;  4QTR A;  5CXI A;  4M3D A;  4JKZ A;  3JRF A;  1WCM J;  4A3J J;  3MN2 A;  3PAS A;  4AC6 A;  2JA7 J;  1BL0 A;  4DYR A;  3F0C A;  3JRE A;  2E2H J;  1QPI A;  1W0U A;  2HOA A;  4MK6 A;  3GTG J;  4X6A J;  4A3E J;  3CWR A;  3D1N I;  2XGD A;  3T6N A;  3QPS A;  3UKG A;  3BTJ A;  5M5Y J;  5EYR A;  4MFD A;  3BQZ A;  1LE8 B;  3QQA A;  4DW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...