3BR0A

Crystal structure of the complex of malachite green bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br0A02
1BL0A 3S1NJ 5EZGA 3TEDA 2TCTA 3Q0WA 4I6ZA 4X6AJ 3VOKA 3CQZJ 2HOTA 4CYCA 2Y9ZA 5K7HA 4ICHA 4GCTA 5C4JJ 5F0CA 2XGEA 2ECBA 2JA7J 4M3GA 3M3YJ 5IYBJ 1DU6A 4X1EA 2E19A 1MBGA 3O8HA 4JX4A 3ZQGA 2NVYJ 2QCOA 3BQZA 2JA8J 3NAUA 3GTKJ 3JSJA 2GBYA 2JK3A 4C2MJ 3W6VA 1ZK8A 5IP6A 1K61A 1TC3C 5K7ZA 3ZQCA 2JA6J 4JL3A 2JA5J 2GM4A 3HOXJ 5FLVA 4UUSA 3JRFA 3GTJJ 3HBLA 3I4NJ 4C3HJ 3NARA 3RZDJ 1LE8A 2DN0A 2M2EA 1FTZA 4JNNA 2R92J 1HCRA 2HYJA 1ZR4A 1LFUP 2P81A 2LD5A 1TWHJ 3HGGA 2G3BA 2EZLA 1APLC 2R0QC 1P7JA 2ZCNA 1CQTA 1GV2A 5DAJA 2IAIA 3Q0VA 2EZHA 4DW6A 3B6AA 2X6OA 1R9TJ 1X2MA 2IBDA 3GTOJ 4BBSJ 3NI7A 3GTMJ 3A01A 1OFCX 2HYTA 5AQCA 4FE7A 5FKMA 5CW8A 5GPAA 3AQTA 4M3EA 2XPWA 3GTGJ 2JN6A 3KKDA 5M3MJ 3GBGA 4QIWN 2GLOA 5DTDA 2DMNA 5FGLA 3HE0A 1WH5A 4YZEA 3CDLA 2KDZA 1GUUA 3BG9A 3QPLA 3C2BA 4BBRJ 3HTJA 4JKZA 3BQYA 2HI3A 1GVDA 4B1RA 1YRNB 4JYKA 2XDNA 3SJMA 4A3GJ 3BHQA 5EF6A 2R5ZB 1IUFA 2OERA 1RKTA 3VVYA 5HODA 4MXMA 3OSFA 2I10A 2MG4A 4DZPA 3FISA 4S0HB 3LSJA 2L7FP 2TRTA 5J3LA 3JRCA 2Y31A 2M0CA 4MK6A 2K9QA 5F0HA 2H8RA 4IHXA 3MN2A 1ZR2A 3ON2A 5D19A 3IUVA 2KT0A 2ECCA 5IPAA 1ETWA 3PASA 2DA3A 2HOAA 3S2DJ 5EG0B 2G7GA 3A03A 2ZOZA 1W0UA 1JTYA 5FKOA 5J1UA 5EEAA 4DYCA 2UXPA 1MH4A 2L9RA 3L1PA 4A3BJ 5FKKA 3VP5A 2GFNA 3LWJA 3S1QJ 1RESA 3O8GA 2VUMJ 2WV1A 3RH2A 3FK7A 1EF4A 3JRIA 5HBUA 4A93J 4AF5A 1BW6A 2NOGA 5F04A 3LSPA 1Z0XA 1FTTA 4CYCB 1U9OA 1IJWC 3PM1A 5EFYA 4XICA 4BY7J 1MBEA 2NS7A 3FKIJ 5GPCA 5FHPA 3G1MA 5HAWA 1AKHA 2D5VA 1ETVA 1UG2A 2ME0A 5F27A 4A69C 5FLMJ 3G56A 3BNIA 3HEFA 1HOMA 2ME6A 3P9TA 2G0EA 3TP3A 4GCLA 1GV5A 1UI5A 2XSDC 2RHAA 1MBKA 2O7OA 4J19A 1MBJA 2QWTA 2UXHA 3DCFA 3S17J 1ITYA 1SANA 1BJZA 4BY1J 1H8AC 3QPSA 5JLXA 2YU9J 4UUSB 1HLVA 3JRGA 2YUSA 1ENHA 1F43A 1AU7A 1UI6A 2LP0A 1LE8B 3BTJA 4FISA 2ID6A 1Y1WJ 2OPTA 1T56A 2EBIA 3V6GA 4XK4A 4G12A 5IOZA 2HXIA 4M3FA 2O8KA 3OSGA 4QSHA 2DMUA 3ZQLA 2K9NA 1F36A 3H3VK 5K58A 3UKGA 1JT0A 2DMTA 2LFBA 1JTXA 2R7ZJ 1HF0A 2PBXA 3LSRA 5IP7J 1Y1VJ 4AUXA 1NK2P 2FD5A 1JUPA 3DEWA 3TP0A 9ANTA 1UMQA 2K40A 3A01B 2DG7A 2HXOA 3QBMA 2OF7A 2WAQN 3GEUA 3HM5A 1TWAJ 4NDLA 1U8BA 1HDPA 2M8GX 4A3KJ 4FCYA 3S1MJ 1VI0A 3D1NI 1Q1VA 3BR2A 4MFEA 1B8IA 2QTQA 2YVEA 1MBHA 4D7MA 2Y2ZA 5D18A 2IEKA 1B72A 3HOVJ 2Y9YA 1A6IA 2IU5A 3CJDA 3COLA 2QF7A 5IOYA 2NVXJ 3EGQA 2REKA 3BCGA 1U9NA 3BG3A 5M3FJ 2XPVA 1ETXA 3G1LA 1HDDC 2GUHA 4UDSA 1X2NA 3HDDA 3S16J 2VI6A 2QOPA 3QQAA 3H0GJ 3E7QA 2DA7A 3C07A 4DYQA 3LJLA 2Y30A 3MKLA 3HOZJ 2F07A 3HKZN 5E3OA 3B81A 3KNWA 1OCPA 5IYCJ 3NXCA 3OOUA 4Y7NJ 5C4YA 3T6NA 3VVXA 1ETQA 2CQXA 1FJLA 3PPBA 2XB0X 4NELA 4UUTA 5FMPA 4IHVA 1MBFA 4V2GA 2DG8A 1WCMJ 2YS9A 5JLWA 5GP9A 1QVUA 3FK6A 5EYRA 4A3MJ 4BXXJ 2EZKA 5FKNA 3GTQJ 4GFBA 4AYBN 3HGYA 3HTHA 3SFIA 2H1KA 4D5FA 1AKHB 3FRQA 3IV5A 4A3CJ 5EGOA 2LVSA 3BTLA 3S14J 4A3DJ 3JRBA 5CXIA 1GT0C 2JMWA 2CRGA 3SDGA 2L0KA 4V2FA 4AC6A 4B4CA 4A3EJ 3IH3A 1E3OC 4FTHA 1JUMA 2LK2A 4Y52J 4AC0A 3HOYJ 1QRYA 2G7LA 4D5CA 1GDTA 1ETYA 2AHQA 4L5EA 1JKQC 1P7IA 1JUSA 2ZCXA 2FBQA 4PXIA 1I50J 4KWAA 4D7NA 2L7MP 5C4XJ 4I76A 4RDUA 1IC8A 1QPIA 3BG5A 3K2AA 4A3FJ 4XRSA 2O7TA 4A3JJ 2MW8A 2K9SA 3ZOBA 3F1BA 1VNDA 3WHCA 3BR6A 3ANPA 1H89C 1JT6A 3VW0A 4EEFG 5M5XJ 3JREA 3TW6A 3OIOA 2XRLA 5F1JA 2G7SA 1MH3A 2QIBA 2DMPA 4NN1A 3G1OA 2NVQJ 4ME9A 2RASA 3AQSA 3FIWA 2O9LA 1XS9A 3Q3SA 2WB1N 5E3NA 2DJNA 3RKQA 1NTCA 3HIMA 2HKUA 1FIPA 5EZHA 2HDDA 4HNVA 4A3IJ 1IDYA 3JR9A 1LFBA 4IHWA 3BJBA 2WGBA 4A3LJ 3VVZA 3RZOJ 2ZOYA 1B8IB 1BW5A 4W1UA 4M3BA 5F0FA 1T33A 3VW1A 1TWCJ 4BKXA 4JP0A 4LOCA 1B72B 3CMYA 3ZQFA 3BTCA 3VIBA 1I3QJ 5D1RA 4FE4A 1S7EA 2QKOA 3KKCA 1ZQ3P 3NRGA 2DA1A 3HOUJ 2CU7A 1RR7A 2XB5A 4DZJA 3S5RA 3GTLJ 1ZGWA 2MGQA 3HB9A 1MSFC 1JJ8C 3CRJA 3ON4A 1QVTA 2LKXA 2CUFA 2R5YB 2DA2A 5F08A 2UXIA 2VPRA 5IP9J 2E2IJ 2EQRA 3LOCA 2MSYA 1MSEC 1XC5A 1JKOC 3VUQA 2DTZA 2ZB9A 1W0TA 3E7LA 1X58A 2M9HA 1O4XA 2XGCA 2WUIA 1ORKA 1BA5A 5IYDJ 5M5YJ 4MFDA 1RPWA 1TWFJ 2FX0A 2GENA 2LTPA 2Y0SN 1POGA 5K7FA 2EH3A 2NVTJ 2OI8A 4C3IJ 1DU0A 3IH4A 3RQIA 1A5JA 2W53A 1IV6A 3HOWJ 5E3MA 4ACIA 2E1OA 2ZCMA 2COBA 5EGOB 1PUFB 4JX5A 3ZQHA 3LSGA 5CXGA 3A02A 1Z77A 5J1RA 5HSZA 3K7AJ 4L62A 1IGNA 2NS8A 1VFCA 2R5YA 2VKVA 3PO2J 3BTIA 1IRZA 2V57A 3BR1A 2ID3A 2E2HJ 3TW7A 3IH2A 2CQQA 3ZQIA 4ABZA 1WH7A 1OCTC 2D6YA 3BR5A 2HOSA 4IHYA 5C44J 1K83J 2L7ZA 2R93J 4GFKA 3LNQA 1G2HA 1ETOA 2FQ4A 4XRSG 3QKXA 4GFLA 4MO7A 2LY9A 2VKEA 3BR0A 3S2HJ 3LHQA 4HKUA 1ETKA 1PUFA 2PMZN 1JJ6C 5DS9A 2B63J 3HTAA 1WPKA 2RAEA 3JRHA 3HTIA 4MIMA 1MNMC 5BNGA 3I4MJ 3ANGA 2Q24A 1FEXA 1ZTRA 3B6CA 4XIDA 1IDZA 3O60A 3RD3A 3Q0UA 2E2JJ 2JWTA 1D5YA 2XPUA 4MLOA 4C3JJ 4RBOA 2W48A 5M5WJ 2LR8A 3F0CA 3GZIA 3BR3A 1TWGJ 2PZ9A 2X48A 2LLKA 1JGGA 3WHBA 1FIAA 4XRMA 3G7RA 1UHSA 5H9TA 2UXUA 4JX6A 1SFOJ 5C3EJ 3VOXA 1NK3P 2XGDA 3DPJA 1WGXA 4W97A 5E3LA 3NNRA 3BT9A 1YRNA 3S15J 4M3DA 2ELKA 3VPRA 2HQ5A 2UXOA 2JJ7A 2R5ZA 3PO3J 1IG7A 3M4OJ 2DA6A 1H88C 3JRAA 1U78A 2AO9A 3BRUA 2N8GA 4CGRA 5J1YA 2EZIA 4B3AA 3CWRA 3MVPA 1RKWA 2X9DA 3EUPA 3GTPJ 1JKPC 2NP3A 1XG1A 1VF9A 3V78A 4DYRA 1WI3A 2M34A 2FJ1A 4M6VA 3S1RJ 2NP5A 3CCYA 3NPIA 2DMQA 1I6HJ 2NX4A 1ZKGA 5EG0A 4QTRA 3MNLA 3VW2A 2CUEA 4IEJA 1JKRC 3KZ9A 2DA4A 2YVHA 1AHDP 3JRDA 2CJJA 5EDNA 5FKLA 1RETA 1SGMA 2DA5A 4GCKA 1OJLA 5FJ8J
chains in the Genus database with same CATH superfamily
4PK4A 4QWQA 3WTUC 1G8XA 5CVRA 5HS8A 2XF7A 3BZKA 1OCRH 3E6MA 4LK1F 4EM1A 3KP5A 1FOWA 2FUG2 4E7HA 2HOTA 1QO0D 3PJRA 4XMYA 1G3YA 2XGEA 2P7VB 2VKDA 3BC8A 3NWSA 4XLPF 4HA8A 4M3GA 1LDKB 2E19A 5BS6A 3TO6A 3KEQA 2QCOA 1W36C 2IS4A 2BVMA 4ZZLA 3MQ0A 3KYDB 4O6JA 2DLLA 2E34A 2MABA 3JW4A 1WSUA 1I39A 5F64A 1FP1D 4CICA 4EGYA 3OYFA 3RJPA 1R49A 2EFNA 2F6CA 1MMAA 4WXCA 1RI7A 4OMZA 3J81Z 1J9IA 1LE8A 3HSEA 2BXYA 3L00A 3KX2A 1ZR4A 2FEZA 2LBFA 5TGTA 2CV1A 2FBIA 2LD5A 2R7VA 3DEUA 2G3BA 4QLCU 4I01A 4C9YA 2KIUA 4CGZA 1FYLA 1R7JA 3OYAA 4KJZA 4YEJA 2FA5A 2LY1A 2EZHA 4DW6A 1SVLA 2Z5UA 2F4IA 2X6OA 5FD5A 2KLOA 1N25A 1XGOA 4HEA2 2NAZA 3IKTA 2RC4A 2FSWA 5B66C 3MKYB 4FE7A 5CW8A 5GPAA 4ENMA 3AQTA 2LSOA 2MYSA 1T0FC 1WWXA 4QIWN 1UG0A 4CZCA 4II2A 5LEJA 2MLKA 4BHPA 2B3WA 3K4CA 3RYRA 4BE0A 1LQ1A 3HE0A 3HTJA 1H0MA 1OCZH 1QPMA 4BGDA 1GVDA 2VB6A 4B1RA 1MDMA 2CV2A 2BY3A 3WU1B 3SJMA 2XDNA 1A35A 3FMQA 3S2WA 1NG7A 2LH9A 1VQKI 1LNWA 4MXMA 3QU3A 3OSFA 2KZVA 1S29A 4S0HB 3BJAA 4YELA 4N4OB 1KYZA 1QBJA 3GFJA 3H9JA 3K9TA 3SHFA 5L3EA 2K9QA 5E8IA 1TT0A 4IHXA 5D19A 2QSHX 1S5LC 1O3QA 3U21A 4PFPA 5B1AH 2GXBA 1ZLKA 2WY7Q 3A2KA 2G7GA 2Z1DA 1OMIA 2HKOA 1W0UA 3CTAA 1Z05A 3C2GA 4A0YA 4FASD 3S3NA 2BBYA 1VQ4I 1D8JA 3HTSB 1Z3XA 4I2OA 2OTLI 4HOBA 1LJ9A 2VBXA 3VP5A 4OD5A 3A4CA 2GFNA 3O8GA 3QODA 2WV1A 1RUNA 5KCMA 3JRIA 4TV7A 4RLFA 4XOPA 3QU6A 2M3AA 3CDIA 2G7HA 4U87A 4OOIA 3PM1A 4BY7J 5FHPA 4K2EA 5HOOA 3R60A 2FOWA 2VQCA 2ME0A 4A69C 3P9TA 4HBLA 1XDUA 3FX3A 2LREA 4KICA 3UR3C 3N4MA 1UI5A 4XKCA 2D1VA 1HKTA 4LLNA 2B7EA 1VQPI 3OS1A 4IZZA 4IRVA 3S17J 2RN7A 1ITYA 1SANA 2HNHA 5LHHA 2ZY9A 3ECOA 3QPSA 2YU9J 2OCEA 5CQEA 4UUSB 3JRGA 1TT5B 3LSIA 1OKRA 1OLTA 2LP0A 3QPHA 4ON0A 2ID6A 1Y1WJ 1SD5A 1W7PD 3V6GA 4XK4A 4G12A 2HDWA 5IOZA 4RGSA 2KRHA 2QYOA 4M3FA 4QSHA 1IN7A 4Q48A 3P9CA 2HEOA 2ZXJA 1WJCA 1TQIA 1JTXA 2K4BA 2R7ZJ 1HF0A 2PBXA 1R36A 3LSRA 2OJED 4AUXA 1IXRC 3H1CA 3ASNH 5DUKA 3TO9A 1OPCA 1ZH5A 3RYPA 1YQAA 2HXOA 3QBMA 2WAQN 4HDVA 3HM5A 1U8BA 1O3RA 1V5FA 3MEXA 1HDPA 4M6XA 1YTYA 2WAFA 2CGPA 4A0ZA 2FBKA 4N4NB 4FCYA 1VI0A 2QENA 4ASNA 4FHTA 1K79A 3HRUA 1HQCA 5ERIA 2J5OA 3CUQC 3GFLA 3F8NA 3EUAA 3L09A 1Z67A 4HYEA 3ZQ7A 5KK1A 5LGNA 1A6IA 2BVLA 3DF8A 3CJDA 3COLA 4HX4A 4LLGF 3CUQA 1C0WA 1QU3A 3BG3A 2XPVA 3O3KA 1NHAA 3P5JA 3PFIA 2Z33A 3R0JA 4DQ2A 2ESNA 3S16J 2E71A 3WTYC 3H0GJ 4XBFA 3K4BA 5KVRA 4HLXA 3OYBA 1P92A 5FD6A 1YJWI 2KHMA 5E3OA 3WTSC 3U1DA 3KNWA 3E6BA 5C4YA 3VVXA 4BAYA 5FO5A 3ZQQA 1FJLA 2XB0X 4NELA 2IGNA 5D5VB 4QPQA 2PFVA 2EJRA 3TDUC 4YIFA 4A3MJ 5FLXK 2H1LA 3QOEA 1EH7A 2XF6A 4BYYA 4CCNA 1B59A 4GFBA 4AYBN 3GTQJ 5GADJ 1VQ7I 3SFIA 3HTHA 4FETA 2LG4A 3PQJA 5BPDA 2LF8A 5D5WB 2M7BA 3VDXA 2MD0A 1EKEA 2W00A 2OBPA 1J5YA 1E17A 3JRBA 1GT0C 1PVEA 4O5VA 1Z3YA 4GYIA 4XSXF 2L0KA 4UVBA 3SDGA 3CCRI 4M9SA 2LF7A 4AC0A 3JAMK 2PN6A 5LEKA 1BC7C 1GDTA 2HTJA 4L5EA 2WAEA 1ZG3A 3I71A 3JCUC 5HLGA 4RA2A 2VIXA 1YO5C 4C2TA 2ZCXA 4KWAA 2W85A 4PUSA 5C4XJ 3M8FA 2EILH 4RDUA 3W6JB 1JHFA 1QPIA 2GOMA 3ONQA 4XRSA 3D5SC 4A3JJ 3DTEA 3ZOBA 4LG3A 4PFOA 4CDGA 2GIVA 2HYFA 2HS5A 4M6YA 3ANPA 1H89C 1LVKA 2UV1A 4OIQF 2GA2A 5E1ZB 1R22A 2QIBA 5IY5H 4PJMA 3G1OA 1XPXA 3EPZA 4PGGA 4ME9A 3AQSA 2DJIA 1W5TA 3FIWA 5CJ9A 1MKMA 1XS9A 2DJNA 2R7UA 4L9TA 4HQEA 3VTIA 2HKUA 1FIPA 2HDDA 1BI2A 3U9GA 2M4GA 2DBBA 1R5GA 3GZ6A 3JR9A 1LFBA 2LDUA 3SEZA 1LPQA 2JSCA 4NHJA 2A61A 2JT1A 3ZMVA 3RZOJ 3VVZA 1BW5A 4MEYF 4UUVA 1XD7A 4M3BA 1T33A 1P2FA 4E7SA 4LOCA 1OYIA 3FXRA 3BTCA 3K4MA 2RQPA 2ZFUA 2HPMA 3OY9A 2EIJH 1MJAA 3VIBA 2O0YA 1I3QJ 1NG6A 3I4PA 4L9NA 5L3CA 4KN7X 4AVZA 4BHBA 5L3FA 1RR7A 2UUZA 3WTTC 4C30A 4DZJA 5BOXA 1B4AA 1ZHFA 2C6YA 5DEQA 3QP6A 4AD9A 3CD6I 3DPLC 1QVTA 3JTHA 2P5VA 2V6CA 3WTWC 3H0DA 4CA0A 2UXIA 2DA2A 2HKXA 4UXNA 4EGZA 1CF7A 1XC5A 1JKOC 3VUQA 2VKHA 2Y69H 1W0TA 3C2HA 3E7LA 4RGRA 2M9HA 3H36A 3P7NA 1LKXA 2OU2A 2XGCA 3ABKH 3T0YA 1O4XA 2WUIA 4HX8A 5J4YA 1GLNA 3RPUA 1J7KA 2ZXIA 2GENA 1QZEA 2LTPA 2Q2EA 3BPVA 5K7FA 2JRMA 3L2RA 2W53A 1A5JA 1IV6A 3MWMA 3HOWJ 2ZSHB 3GMEA 1PUFB 2GXAA 3A02A 5J1RA 3GFMA 3IL2A 5HSZA 4F93B 1IGNA 1X3ZB 5CVVA 2DT7B 2D2WA 2V1NA 2CW8A 4EJOA 4GGGA 5F6FA 2Y75A 3BOQA 1W36D 5BQTA 3ZP5A 3ESWB 3ZMZA 2FMYA 4IOAF 4HZFA 1WH7A 4OIPF 2Z9OA 2DOFA 2GOXB 2JPBA 2MFZA 1K83J 4MHGA 3O2PE 2R93J 3LNQA 4XRSG 4GFLA 4XKVA 1WJAA 5D6FA 1ETKA 2P5LC 1PUFA 3DEEA 3SWHA 1GVJA 3IWFA 4ZJZA 5DS9A 4IRIA 2VN2A 2B63J 1W7PB 1K78B 1IO2A 2CFXA 2RAEA 3Q9SA 1V5EA 2DA5A 1YS7A 2BHZA 2WAQA 3EUHA 3W3CA 2P4WA 3WE3A 3M9AA 1MNMC 5GTHC 2KPMA 3PIOF 4ZYGA 3FKJA 3JTGA 1FEXA 2Q24A 1P6RA 3ABMH 1IN6A 4XIDA 2HQNA 2X1EA 5ICFA 2BOLA 2KISA 1BOAA 2ESHA 2HTSA 4KYWA 3BR3A 1TWGJ 3QPTA 3RCOA 4RM2A 1N77A 2LLKA 3WHBA 4EQQA 3L2UA 4Y3OA 1BR2A 1V55H 3FHZA 2UXUA 3PUBA 1SFOJ 3B73A 1Z21A 4F55A 2FNAA 2RQQA 5DUIA 2L7KA 3ABUA 3S15J 4U9NA 2ELKA 5ICEA 2V9VA 2KQRA 2QM3A 2JJ7A 4IPAA 4MQ9F 4U7BA 1W5SA 2E5NA 4KUMA 3EUKL 1JGSA 1USSA 4B3AA 4M73A 3CWRA 4AIDA 3EUPA 3FXJA 4P55A 4XONA 2O5RA 2NP3A 3QYFA 4RGUA 1VTNC 3V78A 2YX7A 4DYRA 2M34A 3S1RJ 1ZAOA 1Y8RB 2IA1A 1FBQA 3K0LA 5DYMA 4LFUA 1YOVB 2BZTA 1R4NB 2Z99A 4AWXB 1RZ4A 2ICWG 2IT0A 3HRMA 3KZ9A 2DA4A 3S3OA 2CJJA 1IF1A 3PSIA 5K5OA 1XGNA 2YU3A 3EQLF 3F8CA 1XMKA 2K9LA 4AYBA 2A5YB 4Y4RA 1DGRM 1OJLA 5FJ8J 1EV7A 3IP4B 1BL0A 3LAJA 3QAHA 3DLLF 3TEDA 3VOKA 4L0ZB 1Z91A 3RDIA 2Y9ZA 2FOKA 3SXYA 3MMYB 2H6BA 1E3HA 2CQNA 1I1SA 5IYBJ 2R7XA 4BQOA 3GVAA 4JX4A 3BDDA 3LQRA 3BQZA 2JA8J 2O8XA 1HKSA 3NAUA 5CVIA 3JSJA 3HPHA 1G3TA 4C2MJ 1ZK8A 1TC3C 3MAJA 3FDYA 3ZQCA 2K7LA 2JA5J 3CCMI 1KYWA 4JK1X 1T2KA 2X6YA 1TTYA 5AIPA 4I99C 3GTJJ 4IRGA 1E2XA 3NRVA 3I4NJ 2F5CA 2Z16A 3CJTB 2F5VA 4GDFA 1R1VA 1B1BA 1UJ8A 2EV5A 2EFPA 4NQWB 2EV0A 2M2EA 1BI1A 1U0JA 2BGCA 2HYJA 1LEBA 1KA8A 3HOSA 2WV0A 4I0BA 3MKWB 1TWHJ 3BY6A 3HGGA 3S93A 2EZLA 3ZMUA 2R0QC 3AFHA 4M71A 4KNYA 1WJEA 2CV0A 4LD5A 3Q0VA 1T6SA 1X4PA 3B6AA 1BM9A 2ZJRF 2W84A 2IBDA 3GTOJ 2QQ8A 3OYLA 3TOAA 1VQNI 3A01A 2ZC2A 1OFCX 2HYTA 2P0WA 3GTGJ 2JN6A 3I59A 2WA0A 4XKBA 2KZGA 2BY2A 2VJJA 3T1BA 5M3MJ 4LB5A 5L3DA 4ESBA 3SFZA 2KDZA 3BG9A 3C2BA 4JKZA 2VODA 3DTKA 4N0BA 2HI3A 3OYDA 2JSPA 4Q47A 2JPCA 4HX7A 3L9FA 3QYEA 2OZUA 1YE9A 3FXKA 3K4JA 2H6CA 3SZTA 2MG4A 4DZPA 1X1CA 2Y31A 1OYYA 1G3WA 2M0CA 3HRTA 4J00A 3OWTA 3W2VA 1X1DA 4JOMA 3PNVA 1Y0UA 3IUVA 1BI3A 2ECCA 5JR3A 1ETWA 1S7OA 3CF2A 3PASA 1MD0A 3LSKA 3CCQI 3ZMSA 3S2DJ 2OAZA 3A03A 2ZOZA 2VXDA 2A6TA 3BLYA 1JTYA 4XLCA 4A6EA 4ZTFA 2BW3A 2L9SA 3ZMDA 4DVYP 1UCRA 1R23A 1RR8C 3COAC 2VC1A 2UXPA 1W1WE 4A3BJ 3FHNA 2DPDA 4FX4A 4B09A 3GLLA 1B9NA 4H0EA 2VUMJ 3LA3A 1TW2A 2KIMA 4I02A 3GLXA 2A05A 3G71I 5HBUA 3NQOA 1BW6A 2NOGA 3G4SI 3LSPA 1Z1DA 1TW3A 3QP5A 4XICA 2OC6A 1D1AA 3FKIJ 1RC9A 2D5VA 4PJLA 4XN3A 1ZREA 4WCGA 5F27A 3BNIA 1HOMA 2HZDA 3VYSB 5JVTA 2RHAA 1IN8A 4J19A 4ZC3A 2UXHA 1SMTA 2DT5A 3DCFA 3F8MA 5K5QA 4WWCA 1ULYA 1BJZA 1IRGA 3WTXC 2B0LA 4XOTA 3A1YA 3VOEA 1HLVA 4KIBA 1WKMA 3KIOA 3LSTA 3MZYA 1R6RA 1T08B 2I8DA 2K4JA 2JQ7A 1UI6A 1D3YA 5DCFA 1LE8B 4CCKA 5JHUA 1OCOH 2CW0F 2OPTA 2CG4A 2JRTA 2LBFB 3HC7A 3RQ4A 2Y48A 3I64A 1TL8A 4B8XA 3K1PA 3OSGA 4DGWB 2DMUA 2K9NA 4G6QA 1JT0A 3VODA 1FWZA 3IUOA 3CC7I 5CQGA 1SFEA 5GAHJ 3HIFA 2F2EA 4UB8C 1R1UA 2TDXA 2K40A 5ICGA 9ANTA 1FLIA 2DPUA 3GEUA 3BCBA 2MA3A 2A69F 2J5PA 2QQBA 1STZA 4IKFA 3CO7C 4A3KJ 3MZHA 3CP8A 3S1MJ 1AWCA 4EJVA 3D1NI 2A6HF 2PQ8A 2FQ3A 1PUEE 2JVGA 4A6DA 3ROUA 3K70D 4Z6YA 3L7WA 2IS6A 4UV8A 1MDMB 2Y2ZA 3NWTA 2DK8A 3B02A 3KETA 3GEZA 5KNLA 3OL3A 3HOVJ 2QF7A 2H8WA 2HR3A 5IOYA 3EGQA 1X19A 1KU9A 3BCGA 2BXZA 1U9NA 3FF5A 3P9KA 4FT8A 4BDZA 3G1LA 1ETXA 1G6NA 2GUHA 1X2NA 2DDAA 2VL8A 3E7QA 2KMUA 2R7DA 2Q1ZB 4DYQA 5CVUA 3S32A 2NS0A 3HOZJ 2F07A 3D5LA 4B47A 3HKZN 2IJLA 3GF2A 3B81A 1OCPA 3OYCA 2XUBA 3NXCA 3FXOA 4Y7NJ 1ETQA 3M1EA 3PPBA 2STTA 4HPQA 1R5ID 4UUTA 1Y8QB 3E5UA 1R71A 2K3PA 1WCMJ 5JLWA 5GP9A 5EYRA 2DYSH 1YYVA 1ZELA 4BXFA 4EV0A 4P1WA 2H1KA 4G6DA 1RNLA 4WXDA 1SVMA 4I0AA 5L3GA 5EGOA 4ESFA 1WVRA 2X1DA 2L54A 5CXIA 2HOEA 3FWEA 2JMWA 2L5QA 2V6EA 1IN5A 2CRGA 1O3SA 4AC6A 2ZMEA 4A3EJ 3IH3A 1JUMA 1MJBA 2LK2A 3I9V2 1RRJA 1LDJA 4HG2A 3DXJF 3RKYA 3VWBA 4D5CA 1XSDA 5F1RA 3DBRB 2AHQA 3S3MA 1JKQC 2BEOA 1JUSA 2ACJA 3WU0A 4I76A 2XF5A 1IC8A 1ZLJA 2NYXA 3K2AA 3CESA 3E1SA 5E1WA 2MW8A 3F1BA 1HBXG 1VNDA 3WG9A 3WHCA 3BR6A 3KP2A 3ZR8X 1F1ZA 3AAFA 3GX4X 4BQAA 4HV6A 4KA4A 3OIOA 2XRLA 5H20A 4KT6A 1OYWA 5F1JA 4MTDA 1MH3A 5HVQC 1XTAA 1ONVA 4KN4X 3PIPF 2DAOA 2M8EA 3HOTA 5D4SA 1JXSA 3J81K 2RASA 1A6QA 5GAGJ 2O9LA 5DCMA 4RMNA 2WB1N 3ERMA 1NTCA 2M7AA 1IRFA 2DFHA 3K2ZA 1IDYA 2HYGD 1RIOH 3PNYA 4XLNF 4A3LJ 2H27A 1XSXA 1D8KA 3TQNA 1TNSA 2PJRA 2HGCA 4E7IA 1K6OA 4BKXA 3E6DA 4JP0A 2F5FA 2CQKA 5EEGA 4BL0B 3CMYA 1TQMA 3OYEA 3F9KA 5D1RA 2HZTA 2XAQA 3O6BB 2JUCA 2QKLB 3EDPA 4RB3C 1PJRA 3HOUJ 2V1UA 3CUQB 2CU7A 2K02A 2XB5A 3S5RA 3GTLJ 3CMAI 1SFUA 1ZGWA 2EIKH 2XAHA 4S05A 1MMSA 2MGQA 2VQGA 3HB9A 1MSFC 3V7RA 4BHCA 2ISYA 2IXSA 4RB0A 4EVIA 2X6WA 4XLEA 1YW9A 2R5YB 2IS2A 3CCSI 2H09A 3ISPA 3CF5F 2E2IJ 2M4KA 1PP7U 1LB2A 4KITB 2MSYA 3HUGA 4IOCF 1U8RA 2ZO4A 2DTZA 4UVAA 1REPC 1HSJA 5FROA 3GW2A 4OIOF 3R61A 1DDNA 3NEUA 1RPWA 2VQLA 1HA8A 2RNJA 3HZJA 1K6YA 5E18F 3KLOA 1A36A 1FBSA 3LSHA 4CZZA 1CGPA 1YIJI 3SZGA 1J0RA 5E3MA 1P4XA 2ZCMA 4ACIA 2COBA 2W1OA 1MJ9A 4JX5A 1Z77A 3FXLA 3K7AJ 3CO6C 2OQGA 2PLYA 2E1CA 4L62A 2NS8A 1AA7A 1OR7C 2QLZA 2R5YA 1VFCA 2VKVA 3LA2A 1HXDA 3F22A 5CKTA 2E5ZA 4L5IA 5HS7A 1XN7A 2QVOA 5LBQA 2NOJB 3BTIA 3I55I 4RB1A 2HDCA 3BR1A 1JE8A 4KMFA 4ZYEA 4OAYA 1K7AA 3TW7A 1WJBA 1USTA 2M0MA 4IVNA 1Z7UA 2CQQA 2W24A 1OR7A 1FX7A 2CMPA 1U5TB 3DPUA 5E8GA 1GXQA 1OCTC 3OYGA 2RNGA 5C44J 2XAJA 2L7ZA 4GFKA 1G2HA 4Y15A 2LY9A 2VKEA 3S2HJ 4I7HA 1FMVA 2PMZN 4CYDA 1JJ6C 2KP6A 3HTAA 3VEPA 2VT2A 1ZGAA 3JRHA 3P9IA 1U5TC 3HTIA 2WADA 4Q4ZF 4MIMA 2G7UA 6PAXA 3ZN0A 1E0EA 2DQRA 2CH0A 3ANGA 2KFDA 1KU2A 2DQLA 1SAUA 3ZXSA 2K5CA 3K4NA 1J2XA 2XVCA 2JWTA 1ERDA 4CHUA 1D5YA 3SYTA 5LRRA 2LR8A 2O03A 5CLSA 2F4OB 1U5TA 4JBAA 2R3SA 4OU0A 1ZG5A 3PUFA 3DV8A 2OTJI 2CW7A 3TBIA 3J80Z 4RGXA 4XRMA 3G7RA 4BACA 3HPGA 2MH9A 5H9TA 1SD7A 4JX6A 2HVSA 2YSRA 1XMAA 3CDHA 3M1CA 2VLAA 1NK3P 2XGDA 2HWVA 3NNRA 4W97A 5E3LA 3SQNA 3RI4A 4X0GA 1YRNA 3GXOA 4RAZA 2VPLA 3VPRA 4KIGA 2UXOA 3AL0C 4I09A 2R5ZA 3E3VA 3FM5A 1H88C 1TZLA 3BRUA 4IO9F 2N8GA 4NBQA 3K8PC 2IPQX 1PYVA 1S6LA 2VBZA 3HKZA 1VF9A 3LFKA 4M6VA 3IAM2 2DMQA 3C18A 3F6VA 2M30A 3K70C 1ZKGA 2D45A 5EG0A 3KLNA 1YLFA 5A2QZ 3LQQA 2V26A 1JKRC 4V19K 4MQVA 4YFNF 4E70A 2YVHA 1CF7B 2CFOA 4MTEA 4B3XA 3E5QA 1DPUA 1RETA 2QGUA 3MD2A 1UELB 1WJ5A 5EZGA 4X6AJ 3Q0WA 2Q2EB 5HDGA 3CQZJ 3FXQA 3DFGA 3MFKA 2OV7A 4CYCA 2ECBA 1DU6A 4X1EA 3N05A 5KHDA 5LHIA 1MBGA 3O8HA 3ZQGA 1IUYA 3GTKJ 2V4JC 3T5XA 3HL2A 3H3ZA 5TJJA 3W6VA 4XLFA 5IP6A 4NC8A 1WJDA 2XROA 1B9MA 2RREA 2JA6J 4JL3A 2VJ5A 3DQVC 2GM4A 3CJNA 4HV5A 1I3AA 3H5RA 3CZ6A 2QKMB 4B44A 1VZ0A 2YPRA 3JRFA 2ZXHA 2Y0MA 2AS5F 1OISA 3HBLA 3G2BA 3H9QA 4C3HJ 1S8NA 2VJIA 3RZDJ 2KRFA 3GUDA 5TISC 3OR2C 4AVPA 4HNUA 4HNTA 3QOPA 3HRSA 2DFFA 2DW4A 5EJCA 2V1XA 2QZ8A 1J09A 4LLLA 4EJWA 1APLC 3WGIA 1U6GA 1CQTA 5DAJA 2IAIA 4XM3A 1JI8A 2WB1A 2M1BA 4CXFA 2QSGX 1P4AA 3W2WA 4BBSJ 1LUJB 5HNHA 1ZYRF 1DPRA 4M3EA 2XPWA 3BPXA 3EUHC 4G7HF 2GLOA 5FGLA 3L2QA 5ICCA 3KCCA 3CDLA 1SMYF 4U88A 1GUUA 4HW0A 5H2FC 4BBRJ 2L9VA 3BQYA 4NNJA 4XORA 4F91B 1EA3A 1FOKA 3CCVI 1BBYA 5DD8A 5JHFA 5TRDA 5JFRA 2OERA 1RKTA 4AIJA 4F7ZA 3WGHA 3WE2A 3FISA 3LSJA 2IRFG 3V42A 2E36A 2TRTA 4BU2A 4PJ0C 3DTIA 3JRCA 2QUFA 3HYIA 1G4DA 4MK6A 5F0HA 2H8RA 4AM3A 3MN2A 1TNTA 4JQFA 1ZR2A 3DU5A 1YI2I 1SD6A 2KT0A 2HOAA 3V4GA 4NC7A 2P5KA 2XHKA 2E60A 5J1UA 1KZHA 5EEAA 2L01A 1T98A 2L9RA 3L1PA 2EV6A 1BOBA 4EJTA 2NXNB 2JTVA 4F3QA 2KL4A 3UNGC 4U0YA 1BR1A 1EF4A 1YIOA 4AF5A 1P4WA 1Z0XA 4Z2YA 5EFYA 1A04A 5J47A 4GRIA 1MBEA 2NS7A 2X6XA 4LITA 1AKHA 2FNPA 2XASA 1QZYA 3LAPA 3G56A 5FLMJ 3RPQA 1UZCA 4DBQA 2G0EA 5DM6F 3OYJA 2XSDC 5LRSA 1FYKA 4MNUA 4Q5SF 2QWTA 1MZBA 2ZBKA 3WG7H 2GIZA 3BJOA 4ZTJA 5B3SH 4BY1J 5JLXA 3C7JA 5LHGA 1QZZA 1X3WB 2YUSA 2PMZA 3ERED 1AU7A 5AONA 3KZYA 5ILSA 4FISA 5K1YA 1N75A 5GTIC 4IRHA 5D6EA 2AXLA 2XRNA 2ELJA 3HTUA 3HJEA 4CSWA 2O8KA 2IS1A 3U2RA 3ZQLA 1ACIA 3UKGA 3VSKA 2DMTA 2LFBA 1MMNA 3X2QH 2FMLA 3F8FA 4CO8A 1ON1A 1H9GA 2IGMA 5IP7J 1YJNI 1KQ0A 1NK2P 1UFMA 2IA0A 2L3DA 3TP0A 4PJNA 3A01B 1FSEA 3M7GA 3K10A 3QWLA 2KJCA 4UVCA 2OF7A 3BG6A 1Q1HA 3BWGA 3K4KA 4IF4A 4NDLA 3WGGA 3ZN1A 3I56I 2M8GX 3I59B 1O7FA 4I98B 2HVRA 2LRDA 3WTZA 5IT9Z 3AG4H 3BR2A 4XN0A 1WFXA 4MFEA 4XR6A 2L4MA 1B8IA 2YVEA 3KYCB 4YG2F 4LG0A 1KQ9A 2F4MB 4D7MA 3IRQA 2IEKA 2R7FA 1B72A 5GAEJ 2W7NA 1R5HA 4ITVA 2Y9YA 1QQIA 1D1CA 1ZN2A 3R4KA 2NVXJ 2K27A 4L9JA 2REKA 3CP2A 1S72I 2FJI1 5K5RA 5E20A 1HDDC 2BY0A 1F4KA 4HLYA 2QOPA 1ON2A 3TOBA 3QQAA 2DA7A 5J8CA 2CO5A 3MKZA 2MC4A 2BW3B 1SD4A 4NC6A 5J6XA 1HW2A 5IYCJ 4L18B 4CCJA 3OOUA 1FYMA 1SVOA 1ZGJA 2CQXA 3K69A 4UY8I 2LYCA 1QNTA 5FMPA 2UXNA 3EYYA 3TKYA 1FOXA 2M87A 2DG8A 1I1GA 4E4HA 3TDZC 1G3SA 1Z6TA 5FKNA 1D1BA 2OA4A 3HGYA 3GO5A 2OUMA 3OYNA 4D5FA 4DOZA 3FRQA 4E7ZA 3IV5A 1FBUA 3W6KB 2LVSA 1MIJA 3BTLA 5J40A 3LSMA 2K3FA 2PI0A 3GCMA 5H6RA 4CH7A 1FC3A 5CVJA 2HQAA 3V7CA 4E6KG 1QA6A 2NNYA 4MGRA 1E3OC 4IL6C 4FTHA 3BJ6A 3E97A 3M8EA 1YHQI 1Y39A 2XAFA 4DNCA 1D5VA 3T8RA 1VQ9I 4LB6B 1ETYA 1FMWA 2PMHA 1P7IA 4OIRF 5DM7F 2DT6A 1FP2A 2CQ7A 4C2UA 3VYUB 4D7NA 1Z6RA 3CCLI 2WBMA 1HW1A 4YIIA 4A3FJ 1VQOI 3DKXA 2DODA 1ZRFA 4LJZF 2V7FA 2K9SA 2VQHA 2CWEA 1FNNA 1VQ8I 5LGTA 3VW0A 4EEFG 3TO7A 4Y13A 1QGPA 3JREA 1BN5A 4BE2A 1VQMI 1YJ9I 2G7SA 5HLIA 4Y33A 2IA2A 1BJAA 2VE8A 4UB6C 2DMPA 2EINH 4L0YB 2DI3A 2ZFWA 2NVQJ 3ULQB 4NUBA 4YFKF 4XKWA 3OMYA 4HRIA 3GWZA 3Q3SA 1KQ8A 3HIMA 3MZ8A 2K9MA 4LMYA 5B1BH 2VE9A 3IAS2 4HNVA 2LOOA 5LGUA 3KFWX 4IHWA 3BJBA 5JI6A 2CUZA 2ZJQF 2WGBA 2ZOYA 2PMUA 4DJAA 4IHTA 2A3SA 1OCCH 3BZ6A 2OCCH 2F48A 1WQ2A 1F5TA 2IGKA 3G73A 1S7EA 2EA4A 2QKOA 4AIKA 3NRGA 4RLQA 3DLAA 1JHHA 5AIQA 4BH9A 1YX3A 5JVGF 4HSTA 4HQMA 1S7AA 2EFWA 1ZRDA 2L9NA 1L3LA 3AG1H 4HAMA 4RM3A 3TL4X 3E6CC 2CUFA 4E7JA 1DP3A 4G8XA 2GAUA 5IP9J 4AU7A 2EQRA 3LOCA 2H94A 1A31A 2ZB9A 1FPQA 1UHWA 3CJRB 2A68F 3DBLB 1EJ9A 3H35A 3CCEI 4G7OF 1BA5A 3BCAA 4MFDA 1TWFJ 2FX0A 2GA1A 2Y0SN 4MEXF 4BQNA 2O6GE 4D0PA 1POGA 2EH3A 2NVTJ 2OI8A 1DU0A 2V79A 3RQIA 3GFIA 3OS0A 2A07F 1L0OC 1V4RA 2E1OA 3MCZA 5EGOB 3LSGA 5CXGA 1SFXA 4LIUA 3ZCOA 3V8LA 3LL7A 4F52A 5D8LB 4ZYAA 4OWRB 2ZMEB 3E0JB 2IW5A 5HDKA 2A6EF 2UZKA 5B5EC 1KGSA 4RAFA 2DU9A 1IRZA 2V57A 2ID3A 3ML6A 3RPUD 2EFQA 2E2HJ 4PCQA 5DD4A 1ZARA 4WX9A 4R79A 1DP7P 4LIVA 1NH3A 2B9SA 2VBWA 4KT5C 4XLHA 2D6YA 3OOPA 2XV4S 3OV8A 2VBYA 3LA7A 2HOSA 4IHYA 1XCVA 2ZMEC 4PSWA 4ZZDA 1RUOA 3QKXA 4MO7A 3BR0A 2ZXWH 3I54A 2FE3A 1IV8A 3KEOA 2ZNZA 1U2WA 5FRMA 2NVUB 3RTRA 4BXUA 5J8FA 4FX0A 2KKOA 1O7LA 3ASOH 1T0FA 3VSLA 3KP7A 5BNGA 3I4MJ 3LFUA 2WWYA 2F5EA 2BYVE 3KZIC 1LVAA 1IAWA 1Y6IA 3U1KA 4IJAA 4OMYA 4DBRA 2XPUA 4MLOA 4C3JJ 2W48A 5M5WJ 4BQQA 5HNFA 5DCMB 2PZ9A 5HS9A 3PQKA 1T95A 1JGGA 2COMA 2HFHA 3HG9A 4CCLA 1UHSA 3OYMA 2A5WA 3CMMA 2PJRB 1YFHA 3Q9VA 3DPJA 3WU2C 3QYBA 3KE2A 3REOA 3BT9A 4M3DA 3DPTA 4XSZF 4WF2A 2HQ5A 3FXMA 3PO3J 1IG7A 1K4TA 1YX5A 1K4SA 4XNFA 4R1HA 5IT3A 5HLHA 2WC2A 1J59A 2PX9A 3OIQA 4QPOA 2X1CA 1MNEA 1IN4A 1RKWA 2JVHA 4FQGA 1JKPC 4U7DA 4N9HA 2NP5A 1WI3A 2FJ1A 1QHHD 5FLXZ 4YFXF 3NPIA 3D0SA 1X3UA 1I6HJ 2FF4A 3I5UA 2M45A 3VW2A 2CUEA 4IEJA 1AHDP 5HLTA 3JRDA 1XB4A 3OYKA 1SGMA 1IZ1A 2KJBA 3HUGB 3BP8A 4BJ6C 5EDNA 4U0WA 4ZDPA 1I50J 4JNNA 2DFIA 3S1NJ 2ETHA 2TCTA 3JAMZ 4I6ZA 2RVCA 2R7SA 4XQFA 5ILUA 3JSOA 2RKHA 4GXOA 3CCJI 5K7HA 4ICHA 4GCTA 5C4JJ 5F0CA 3CC2I 2JA7J 3M3YJ 1IRXA 2V1DA 3A0BC 4C2MA 1HSTA 1X1AA 3TGNA 2V9KA 3C1DA 1GXPA 2GXGA 1O57A 2NVYJ 2ZNYA 4KFCA 3E5XA 3OL4A 4HDUA 4OINF 2GBYA 2JK3A 5FFXA 1K61A 4BNCA 5K7ZA 4IXAA 2Z3YA 3HHHA 1PP8F 2P7CB 2LC2A 4II3A 2A2FX 2RDPA 2W25A 3HOXJ 4R8HA 5FLVA 3C3WA 4UUSA 4CCMA 3FBIB 1MGTA 3ABTA 3W2AA 2XDVA 1TLHB 2PBIA 3NARA 3F3XA 3IWZA 2DN0A 3PL8A 4A0XA 3H5NA 4UNOA 1FTZA 2B1EA 2AQFA 2R92J 4GCVA 1HCRA 3L2WA 1KONA 1LFUP 2BHYA 5E17F 4WIBA 3GZNB 2P81A 3FXUA 2NRAC 4ENKA 2R7RA 2MBFA 1FY7A 1P7JA 3I58A 4BJ5C 4A12A 4BE1A 2X0LA 4KIFA 2ZCNA 4P9UA 1GV2A 2ADUA 3J7YJ 1FSHA 2HU9A 2XAGA 1R9TJ 1X2MA 4UHTA 2DO7A 1KU7A 3NI7A 2ZKZA 2QA4I 3GTMJ 4ENJA 3FBNB 2NNNA 5AQCA 5FKMA 3AG2H 3OS2A 1SFKA 3H9GA 3KKDA 3GBGA 1S3JA 5DTDA 2DMNA 4RAYA 1I27A 2FXAA 1WH5A 4YZEA 1XMXA 4EATA 4Y17A 3QPLA 2ZCWA 1FOYA 5CPRB 4S04A 4PDKA 3CC4I 1IXSB 2LNBA 1YRNB 4JYKA 3M8JA 4A3GJ 3BHQA 5EF6A 3JSPA 3LMMA 3K4LA 5BPIA 2R5ZB 1IUFA 2CS3A 3F6OA 3H92A 4CUGA 5D4RA 3VVYA 4ZYHA 5HODA 1GHCA 2EPFA 2I10A 3ELKA 4WXHA 1V5GA 3ABLH 1J75A 2L7FP 5J3LA 5CYVA 3PFYA 3FZVA 3GYHX 3ON2A 2ZJPF 2P6TA 3AL0B 4XLAA 5IPAA 1V3FA 1SAXA 2DA3A 5BMZA 4G9YA 5EG0B 2IGOA 5HDNA 5FKOA 2HPIA 2W82A 2BY1A 4DYCA 2EIMH 2Y0SA 3CUOA 1MH4A 2KRCA 1I5ZA 1MNDA 2X51A 1Y56A 5FKKA 3AKZA 3LWJA 2FRHA 4PZJA 3S1QJ 1RESA 4HF1A 3RH2A 3FK7A 1LFPA 2FBHA 1YITI 1ZG1A 4A93J 3ZPLA 3DWLE 2M5WA 2OQRA 3ECHA 3HSFA 5F04A 1U3EM 1FTTA 4CYCB 1U9OA 1IJWC 3A0HC 2AQEA 1W5CC 2E7XA 5GPCA 4G94A 2MH2A 3G1MA 3ZGKA 5HAWA 1ETVA 5LD2C 2O3FA 4XRFA 1UG2A 5D8KB 2UWMA 2DCEA 3HEFA 4RB2C 2ME6A 4ETSA 3TP3A 4B48A 4GCLA 1GV5A 3R0AA 1SEUA 1MBKA 1WRJA 2O7OA 3WTVC 2IVMA 1MBJA 1UB9A 1WJFA 2DOAA 3K1NA 2D1HA 3IC7A 4HSRA 2JZYA 3CCUI 1H8AC 2EA2A 3EETA 3V7SA 3HXLA 3VB2A 4D9JA 2VJ4A 4NB5A 1ENHA 1F43A 3N97A 5FRNA 2R4GA 3BTJA 2P6SA 2YR2A 1TP4A 2KIQA 1IXCA 1T56A 2EBIA 2L2OA 2HXIA 1YG2A 3I53A 4KDPA 2VOPA 1F36A 2CYYA 3HSRA 5KAFC 1DQUA 5ILVA 3H3VK 3J7AO 5KAIC 5K58A 1V54H 3KPHA 4O3MA 1M1EB 1WI9A 3CLOA 1Y1VJ 3VYRB 2E7WA 2UXXA 2FD5A 1T8IA 1JUPA 3DEWA 4EJUA 1UMQA 2RV8A 2WY8Q 2DG7A 3SEQA 4BS9A 2QQAA 1TWAJ 3G3ZA 1YW8A 3RKXA 2YX4A 4HF0A 2V9PA 2EFOA 1SC7A 4N9IA 2CUJA 4BEHB 1Q1VA 3D5RC 3SDBA 2QTQA 1MBHA 3AG3H 3V8KA 2F5DA 3KP4A 1FZPB 5D18A 1LEAA 1BC8C 2BE5F 4KISA 1XX5A 2IU5A 3T8TA 1XGSA 3BROA 2Q8KA 3DBHB 5M3FJ 3J80K 4ENNA 1I6XA 3SZPA 4UDSA 3F21A 4IQJA 3HDDA 2VI6A 1DUXC 1AOYA 1TBXA 4RS8A 3C07A 2W4SA 2PFBA 3LJLA 5J4VA 4BEHA 2Y30A 3MKLA 2O61A 2LY2A 1PDNC 3K6GA 2XKOA 4IQ4A 3T6NA 1LDDA 4M74A 4P96A 4IHVA 3VYTB 1MBFA 2DTRA 3LWFA 4U0VA 4V2GA 4YRVA 2YS9A 4LGWA 3FM3A 3ZRGA 4IHSA 1QVUA 3FK6A 3H5AA 2QEXI 4BXXJ 5DDGA 2EZKA 3DKYA 5H6QA 4ANJA 1BIAA 2CSOA 2VXZA 3K1MA 2XSJC 3IKVA 5A2QK 4PSXA 1AKHB 1F9NA 4A3CJ 4D1QA 3BZCA 3Q5FA 3S14J 1MW7A 2VT3A 2GQQA 4A3DJ 1MMGA 4L9VA 1X1PA 1X1BA 4V2FA 4H4KC 4B4CA 1VQ5I 4E7KA 2XAUA 2ISZA 2Z2SB 5D5XB 2DOEA 2PEXA 4A2UA 5ED4A 4Y52J 1D0ZA 3HOYJ 2JUGA 1QRYA 2G7LA 3RIRA 4M9XA 2FBQA 4KMUX 4PXIA 2XGXA 2L02A 2L7MP 1HW5A 2EB7A 3KZZA 5D5UB 1R00A 4OD4A 3BG5A 1QHGA 3QRFF 2KIFA 2O7TA 1EH8A 1XCBA 4G7ZF 1UHMA 2LKSA 2DFEA 1W7PA 4G6TB 1Z9CA 2VONA 2L4AA 4AIHA 3HHGA 4PJJA 1K78A 3RKWA 3TMOA 1JT6A 1BI0A 1W4MA 5M5XJ 4IX7A 1H9TA 3DU6A 3TW6A 4LK0F 2LMDA 4L5JA 2WTEA 1B6AA 1E3PA 1G59A 4NN1A 2W57A 1IW7F 2OD5A 1O3TA 2HVQA 2R7OA 5E3NA 3OYHA 3RKQA 2I5UA 5EZHA 2DK5A 4A3IJ 2FU4A 1XGMA 3PNTA 1B8IB 2QSFX 4P9FA 4W1UA 3WODF 4EM2A 1T39A 1Y0NA 4LG0B 3I0TA 5F0FA 3S8PA 3VW1A 1TWCJ 1ODDA 1B72B 1R1TA 3ZQFA 1TQPA 5LFAA 4FE4A 4EMSA 2MC3A 3KKCA 1ZQ3P 2DA1A 3DP7A 2MD5A 4A5MA 4GO1A 4P5OA 4BJTA 4M9ZA 4CCOA 2EK5A 2E1NA 1JJ8C 3CRJA 3ON4A 2PJPA 1XSVA 2KDOA 4ESJA 2LKXA 3V8JA 5F08A 1FT9A 2VPRA 1KU3A 5FFZA 2QBYB 1MSEC 2X85A 1X58A 3CMEI 4YIRX 3KEYA 1ORKA 4ZDLA 3NS4A 1HC8A 5IYDJ 5M5YJ 1DGWY 3M07A 3FMSA 3PSFA 2VOOA 4GYGA 4BDYA 2JA2A 1VQ6I 2BV6A 3GZ5A 4C3IJ 4ZH4F 3IH4A 3DKWA 4U9LA 1HKQA 3ZQHA 3OR1C 5DV5A 2ZJ2A 2X4HA 3L2CA 2STWA 2QBYA 4BUPA 1X4OA 3PO2J 3J7AY 4EM0B 2XC7A 2QQ9A 3VFZA 2R7TA 3IH2A 2ZSIB 3ZQIA 5LLQA 2GWRA 4A5NA 1S9HA 5E79C 4ABZA 3CJQB 3BR5A 2Q0OA 2E35A 4ZDOA 3ZMTA 1P9QC 4NQWA 1ETOA 2FQ4A 4J01A 2LKPA 2VASA 1YS6A 3LHQA 4HKUA 3L2VA 1BIBA 3I3LA 2R7WA 1D0XA 4E7LA 4DIQA 1WPKA 2K86A 3RSNA 3CLQA 2G9WA 2QWWA 2VC0A 1BR4A 4M72A 5L3BA 1ZTRA 3B6CA 1MMDA 1ZRCA 1UAAA 2RGVA 1IDZA 3O60A 3Q0UA 2E2JJ 3RD3A 1WHUA 4RBOA 4RAGA 5EEHA 3F0CA 3GZIA 1D0YA 4HF2A 3KP6A 2X48A 4B43A 1R4MB 4F92B 4OAZA 2MLGA 1FIAA 2DXIA 4PGHA 1XDSA 2EWNA 3FMRA 5C3EJ 3R6SA 3VOXA 2AXTC 2E1MB 1WGXA 2YVXA 1Z7LA 3H3UA 1N78A 3J7ZI 1WZ2A 2GZWA 1OQYA 3M4OJ 2DA6A 3F8BA 1EH6A 3G6EI 1YW7A 3JRAA 2AO9A 1U78A 4CGRA 5J1YA 2EZIA 3F72A 2XIGA 2P8TA 4XL9A 2DDBA 3OYIA 3MVPA 2X9DA 3GTPJ 2E1MC 1XG1A 5IT9K 5FGMA 2PG4A 2IP2A 2OZ6A 2R7QA 3CCYA 3F23A 5E1XA 2NX4A 2XKPA 3EYIA 3MNLA 4QTRA 3OIPA 4WK8F 5FB2A 3IRRA 2HQRA 3BG7A 3KP3A 4UV9A 3KYLA 1VQLI 1R58A 4ZYDA 2DYRH 2ELHA 5FKLA 1T38A 3IHUA 2K85A 4GCKA
chains in the Genus database with same CATH topology
1BL0A 3S1NJ 5EZGA 3TEDA 2TCTA 3Q0WA 4I6ZA 4X6AJ 3VOKA 3CQZJ 2HOTA 4CYCA 2Y9ZA 5K7HA 4ICHA 4GCTA 5C4JJ 5F0CA 2XGEA 2ECBA 2JA7J 4M3GA 3M3YJ 5IYBJ 1DU6A 4X1EA 2E19A 1MBGA 3O8HA 4JX4A 3ZQGA 2NVYJ 2QCOA 3BQZA 2JA8J 3NAUA 3GTKJ 3JSJA 2GBYA 2JK3A 4C2MJ 3W6VA 1ZK8A 5IP6A 1K61A 1TC3C 5K7ZA 3ZQCA 2JA6J 4JL3A 2JA5J 2GM4A 3HOXJ 5FLVA 4UUSA 3JRFA 3GTJJ 3HBLA 3I4NJ 4C3HJ 3NARA 3RZDJ 1LE8A 2DN0A 2M2EA 1FTZA 4JNNA 2R92J 1HCRA 2HYJA 1ZR4A 1LFUP 2P81A 2LD5A 1TWHJ 3HGGA 2G3BA 2EZLA 1APLC 2R0QC 1P7JA 2ZCNA 1CQTA 1GV2A 5DAJA 2IAIA 3Q0VA 2EZHA 4DW6A 3B6AA 2X6OA 1R9TJ 1X2MA 2IBDA 3GTOJ 4BBSJ 3NI7A 3GTMJ 3A01A 1OFCX 2HYTA 5AQCA 4FE7A 5FKMA 5CW8A 5GPAA 3AQTA 4M3EA 2XPWA 3GTGJ 2JN6A 3KKDA 5M3MJ 3GBGA 4QIWN 2GLOA 5DTDA 2DMNA 5FGLA 3HE0A 1WH5A 4YZEA 3CDLA 2KDZA 1GUUA 3BG9A 3QPLA 3C2BA 4BBRJ 3HTJA 4JKZA 3BQYA 2HI3A 1GVDA 4B1RA 1YRNB 4JYKA 2XDNA 3SJMA 4A3GJ 3BHQA 5EF6A 2R5ZB 1IUFA 2OERA 1RKTA 3VVYA 5HODA 4MXMA 3OSFA 2I10A 2MG4A 4DZPA 3FISA 4S0HB 3LSJA 2L7FP 2TRTA 5J3LA 3JRCA 2Y31A 2M0CA 4MK6A 2K9QA 5F0HA 2H8RA 4IHXA 3MN2A 1ZR2A 3ON2A 5D19A 3IUVA 2KT0A 2ECCA 5IPAA 1ETWA 3PASA 2DA3A 2HOAA 3S2DJ 5EG0B 2G7GA 3A03A 2ZOZA 1W0UA 1JTYA 5FKOA 5J1UA 5EEAA 4DYCA 2UXPA 1MH4A 2L9RA 3L1PA 4A3BJ 5FKKA 3VP5A 2GFNA 3LWJA 3S1QJ 1RESA 3O8GA 2VUMJ 2WV1A 3RH2A 3FK7A 1EF4A 3JRIA 5HBUA 4A93J 4AF5A 1BW6A 2NOGA 5F04A 3LSPA 1Z0XA 1FTTA 4CYCB 1U9OA 1IJWC 3PM1A 5EFYA 4XICA 4BY7J 1MBEA 2NS7A 3FKIJ 5GPCA 5FHPA 3G1MA 5HAWA 1AKHA 2D5VA 1ETVA 1UG2A 2ME0A 5F27A 4A69C 5FLMJ 3G56A 3BNIA 3HEFA 1HOMA 2ME6A 3P9TA 2G0EA 3TP3A 4GCLA 1GV5A 1UI5A 2XSDC 2RHAA 1MBKA 2O7OA 4J19A 1MBJA 2QWTA 2UXHA 3DCFA 3S17J 1ITYA 1SANA 1BJZA 4BY1J 1H8AC 3QPSA 5JLXA 2YU9J 4UUSB 1HLVA 3JRGA 2YUSA 1ENHA 1F43A 1AU7A 1UI6A 2LP0A 1LE8B 3BTJA 4FISA 2ID6A 1Y1WJ 2OPTA 1T56A 2EBIA 3V6GA 4XK4A 4G12A 5IOZA 2HXIA 4M3FA 2O8KA 3OSGA 4QSHA 2DMUA 3ZQLA 2K9NA 1F36A 3H3VK 5K58A 3UKGA 1JT0A 2DMTA 2LFBA 1JTXA 2R7ZJ 1HF0A 2PBXA 3LSRA 5IP7J 1Y1VJ 4AUXA 1NK2P 2FD5A 1JUPA 3DEWA 3TP0A 9ANTA 1UMQA 2K40A 3A01B 2DG7A 2HXOA 3QBMA 2OF7A 2WAQN 3GEUA 3HM5A 1TWAJ 4NDLA 1U8BA 1HDPA 2M8GX 4A3KJ 4FCYA 3S1MJ 1VI0A 3D1NI 1Q1VA 3BR2A 4MFEA 1B8IA 2QTQA 2YVEA 1MBHA 4D7MA 2Y2ZA 5D18A 2IEKA 1B72A 3HOVJ 2Y9YA 1A6IA 2IU5A 3CJDA 3COLA 2QF7A 5IOYA 2NVXJ 3EGQA 2REKA 3BCGA 1U9NA 3BG3A 5M3FJ 2XPVA 1ETXA 3G1LA 1HDDC 2GUHA 4UDSA 1X2NA 3HDDA 3S16J 2VI6A 2QOPA 3QQAA 3H0GJ 3E7QA 2DA7A 3C07A 4DYQA 3LJLA 2Y30A 3MKLA 3HOZJ 2F07A 3HKZN 5E3OA 3B81A 3KNWA 1OCPA 5IYCJ 3NXCA 3OOUA 4Y7NJ 5C4YA 3T6NA 3VVXA 1ETQA 2CQXA 1FJLA 3PPBA 2XB0X 4NELA 4UUTA 5FMPA 4IHVA 1MBFA 4V2GA 2DG8A 1WCMJ 2YS9A 5JLWA 5GP9A 1QVUA 3FK6A 5EYRA 4A3MJ 4BXXJ 2EZKA 5FKNA 3GTQJ 4GFBA 4AYBN 3HGYA 3HTHA 3SFIA 2H1KA 4D5FA 1AKHB 3FRQA 3IV5A 4A3CJ 5EGOA 2LVSA 3BTLA 3S14J 4A3DJ 3JRBA 5CXIA 1GT0C 2JMWA 2CRGA 3SDGA 2L0KA 4V2FA 4AC6A 4B4CA 4A3EJ 3IH3A 1E3OC 4FTHA 1JUMA 2LK2A 4Y52J 4AC0A 3HOYJ 1QRYA 2G7LA 4D5CA 1GDTA 1ETYA 2AHQA 4L5EA 1JKQC 1P7IA 1JUSA 2ZCXA 2FBQA 4PXIA 1I50J 4KWAA 4D7NA 2L7MP 5C4XJ 4I76A 4RDUA 1IC8A 1QPIA 3BG5A 3K2AA 4A3FJ 4XRSA 2O7TA 4A3JJ 2MW8A 2K9SA 3ZOBA 3F1BA 1VNDA 3WHCA 3BR6A 3ANPA 1H89C 1JT6A 3VW0A 4EEFG 5M5XJ 3JREA 3TW6A 3OIOA 2XRLA 5F1JA 2G7SA 1MH3A 2QIBA 2DMPA 4NN1A 3G1OA 2NVQJ 4ME9A 2RASA 3AQSA 3FIWA 2O9LA 1XS9A 3Q3SA 2WB1N 5E3NA 2DJNA 3RKQA 1NTCA 3HIMA 2HKUA 1FIPA 5EZHA 2HDDA 4HNVA 4A3IJ 1IDYA 3JR9A 1LFBA 4IHWA 3BJBA 2WGBA 4A3LJ 3VVZA 3RZOJ 2ZOYA 1B8IB 1BW5A 4W1UA 4M3BA 5F0FA 1T33A 3VW1A 1TWCJ 4BKXA 4JP0A 4LOCA 1B72B 3CMYA 3ZQFA 3BTCA 3VIBA 1I3QJ 5D1RA 4FE4A 1S7EA 2QKOA 3KKCA 1ZQ3P 3NRGA 2DA1A 3HOUJ 2CU7A 1RR7A 2XB5A 4DZJA 3S5RA 3GTLJ 1ZGWA 2MGQA 3HB9A 1MSFC 1JJ8C 3CRJA 3ON4A 1QVTA 2LKXA 2CUFA 2R5YB 2DA2A 5F08A 2UXIA 2VPRA 5IP9J 2E2IJ 2EQRA 3LOCA 2MSYA 1MSEC 1XC5A 1JKOC 3VUQA 2DTZA 2ZB9A 1W0TA 3E7LA 1X58A 2M9HA 1O4XA 2XGCA 2WUIA 1ORKA 1BA5A 5IYDJ 5M5YJ 4MFDA 1RPWA 1TWFJ 2FX0A 2GENA 2LTPA 2Y0SN 1POGA 5K7FA 2EH3A 2NVTJ 2OI8A 4C3IJ 1DU0A 3IH4A 3RQIA 1A5JA 2W53A 1IV6A 3HOWJ 5E3MA 4ACIA 2E1OA 2ZCMA 2COBA 5EGOB 1PUFB 4JX5A 3ZQHA 3LSGA 5CXGA 3A02A 1Z77A 5J1RA 5HSZA 3K7AJ 4L62A 1IGNA 2NS8A 1VFCA 2R5YA 2VKVA 3PO2J 3BTIA 1IRZA 2V57A 3BR1A 2ID3A 2E2HJ 3TW7A 3IH2A 2CQQA 3ZQIA 4ABZA 1WH7A 1OCTC 2D6YA 3BR5A 2HOSA 4IHYA 5C44J 1K83J 2L7ZA 2R93J 4GFKA 3LNQA 1G2HA 1ETOA 2FQ4A 4XRSG 3QKXA 4GFLA 4MO7A 2LY9A 2VKEA 3BR0A 3S2HJ 3LHQA 4HKUA 1ETKA 1PUFA 2PMZN 1JJ6C 5DS9A 2B63J 3HTAA 1WPKA 2RAEA 3JRHA 3HTIA 4MIMA 1MNMC 5BNGA 3I4MJ 3ANGA 2Q24A 1FEXA 1ZTRA 3B6CA 4XIDA 1IDZA 3O60A 3RD3A 3Q0UA 2E2JJ 2JWTA 1D5YA 2XPUA 4MLOA 4C3JJ 4RBOA 2W48A 5M5WJ 2LR8A 3F0CA 3GZIA 3BR3A 1TWGJ 2PZ9A 2X48A 2LLKA 1JGGA 3WHBA 1FIAA 4XRMA 3G7RA 1UHSA 5H9TA 2UXUA 4JX6A 1SFOJ 5C3EJ 3VOXA 1NK3P 2XGDA 3DPJA 1WGXA 4W97A 5E3LA 3NNRA 3BT9A 1YRNA 3S15J 4M3DA 2ELKA 3VPRA 2HQ5A 2UXOA 2JJ7A 2R5ZA 3PO3J 1IG7A 3M4OJ 2DA6A 1H88C 3JRAA 1U78A 2AO9A 3BRUA 2N8GA 4CGRA 5J1YA 2EZIA 4B3AA 3CWRA 3MVPA 1RKWA 2X9DA 3EUPA 3GTPJ 1JKPC 2NP3A 1XG1A 1VF9A 3V78A 4DYRA 1WI3A 2M34A 2FJ1A 4M6VA 3S1RJ 2NP5A 3CCYA 3NPIA 2DMQA 1I6HJ 2NX4A 1ZKGA 5EG0A 4QTRA 3MNLA 3VW2A 2CUEA 4IEJA 1JKRC 3KZ9A 2DA4A 2YVHA 1AHDP 3JRDA 2CJJA 5EDNA 5FKLA 1RETA 1SGMA 2DA5A 4GCKA 1OJLA 5FJ8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL0 A;  3S1N J;  5EZG A;  3TED A;  2TCT A;  3Q0W A;  4I6Z A;  4X6A J;  3VOK A;  3CQZ J;  2HOT A;  4CYC A;  2Y9Z A;  5K7H A;  4ICH A;  4GCT A;  5C4J J;  5F0C A;  2XGE A;  2ECB A;  2JA7 J;  4M3G A;  3M3Y J;  5IYB J;  1DU6 A;  4X1E A;  2E19 A;  1MBG A;  3O8H A;  4JX4 A;  3ZQG A;  2NVY J;  2QCO A;  3BQZ A;  2JA8 J;  3NAU A;  3GTK J;  3JSJ A;  2GBY A;  2JK3 A;  4C2M J;  3W6V A;  1ZK8 A;  5IP6 A;  1K61 A;  1TC3 C;  5K7Z A;  3ZQC A;  2JA6 J;  4JL3 A;  2JA5 J;  2GM4 A;  3HOX J;  5FLV A;  4UUS A;  3JRF A;  3GTJ J;  3HBL A;  3I4N J;  4C3H J;  3NAR A;  3RZD J;  1LE8 A;  2DN0 A;  2M2E A;  1FTZ A;  4JNN A;  2R92 J;  1HCR A;  2HYJ A;  1ZR4 A;  1LFU P;  2P81 A;  2LD5 A;  1TWH J;  3HGG A;  2G3B A;  2EZL A;  1APL C;  2R0Q C;  1P7J A;  2ZCN A;  1CQT A;  1GV2 A;  5DAJ A;  2IAI A;  3Q0V A;  2EZH A;  4DW6 A;  3B6A A;  2X6O A;  1R9T J;  1X2M A;  2IBD A;  3GTO J;  4BBS J;  3NI7 A;  3GTM J;  3A01 A;  1OFC X;  2HYT A;  5AQC A;  4FE7 A;  5FKM A;  5CW8 A;  5GPA A;  3AQT A;  4M3E A;  2XPW A;  3GTG J;  2JN6 A;  3KKD A;  5M3M J;  3GBG A;  4QIW N;  2GLO A;  5DTD A;  2DMN A;  5FGL A;  3HE0 A;  1WH5 A;  4YZE A;  3CDL A;  2KDZ A;  1GUU A;  3BG9 A;  3QPL A;  3C2B A;  4BBR J;  3HTJ A;  4JKZ A;  3BQY A;  2HI3 A;  1GVD A;  4B1R A;  1YRN B;  4JYK A;  2XDN A;  3SJM A;  4A3G J;  3BHQ A;  5EF6 A;  2R5Z B;  1IUF A;  2OER A;  1RKT A;  3VVY A;  5HOD A;  4MXM A;  3OSF A;  2I10 A;  2MG4 A;  4DZP A;  3FIS A;  4S0H B;  3LSJ A;  2L7F P;  2TRT A;  5J3L A;  3JRC A;  2Y31 A;  2M0C A;  4MK6 A;  2K9Q A;  5F0H A;  2H8R A;  4IHX A;  3MN2 A;  1ZR2 A;  3ON2 A;  5D19 A;  3IUV A;  2KT0 A;  2ECC A;  5IPA A;  1ETW A;  3PAS A;  2DA3 A;  2HOA A;  3S2D J;  5EG0 B;  2G7G A;  3A03 A;  2ZOZ A;  1W0U A;  1JTY A;  5FKO A;  5J1U A;  5EEA A;  4DYC A;  2UXP A;  1MH4 A;  2L9R A;  3L1P A;  4A3B J;  5FKK A;  3VP5 A;  2GFN A;  3LWJ A;  3S1Q J;  1RES A;  3O8G A;  2VUM J;  2WV1 A;  3RH2 A;  3FK7 A;  1EF4 A;  3JRI A;  5HBU A;  4A93 J;  4AF5 A;  1BW6 A;  2NOG A;  5F04 A;  3LSP A;  1Z0X A;  1FTT A;  4CYC B;  1U9O A;  1IJW C;  3PM1 A;  5EFY A;  4XIC A;  4BY7 J;  1MBE A;  2NS7 A;  3FKI J;  5GPC A;  5FHP A;  3G1M A;  5HAW A;  1AKH A;  2D5V A;  1ETV A;  1UG2 A;  2ME0 A;  5F27 A;  4A69 C;  5FLM J;  3G56 A;  3BNI A;  3HEF A;  1HOM A;  2ME6 A;  3P9T A;  2G0E A;  3TP3 A;  4GCL A;  1GV5 A;  1UI5 A;  2XSD C;  2RHA A;  1MBK A;  2O7O A;  4J19 A;  1MBJ A;  2QWT A;  2UXH A;  3DCF A;  3S17 J;  1ITY A;  1SAN A;  1BJZ A;  4BY1 J;  1H8A C;  3QPS A;  5JLX A;  2YU9 J;  4UUS B;  1HLV A;  3JRG A;  2YUS A;  1ENH A;  1F43 A;  1AU7 A;  1UI6 A;  2LP0 A;  1LE8 B;  3BTJ A;  4FIS A;  2ID6 A;  1Y1W J;  2OPT A;  1T56 A;  2EBI A;  3V6G A;  4XK4 A;  4G12 A;  5IOZ A;  2HXI A;  4M3F A;  2O8K A;  3OSG A;  4QSH A;  2DMU A;  3ZQL A;  2K9N A;  1F36 A;  3H3V K;  5K58 A;  3UKG A;  1JT0 A;  2DMT A;  2LFB A;  1JTX A;  2R7Z J;  1HF0 A;  2PBX A;  3LSR A;  5IP7 J;  1Y1V J;  4AUX A;  1NK2 P;  2FD5 A;  1JUP A;  3DEW A;  3TP0 A;  9ANT A;  1UMQ A;  2K40 A;  3A01 B;  2DG7 A;  2HXO A;  3QBM A;  2OF7 A;  2WAQ N;  3GEU A;  3HM5 A;  1TWA J;  4NDL A;  1U8B A;  1HDP A;  2M8G X;  4A3K J;  4FCY A;  3S1M J;  1VI0 A;  3D1N I;  1Q1V A;  3BR2 A;  4MFE A;  1B8I A;  2QTQ A;  2YVE A;  1MBH A;  4D7M A;  2Y2Z A;  5D18 A;  2IEK A;  1B72 A;  3HOV J;  2Y9Y A;  1A6I A;  2IU5 A;  3CJD A;  3COL A;  2QF7 A;  5IOY A;  2NVX J;  3EGQ A;  2REK A;  3BCG A;  1U9N A;  3BG3 A;  5M3F J;  2XPV A;  1ETX A;  3G1L A;  1HDD C;  2GUH A;  4UDS A;  1X2N A;  3HDD A;  3S16 J;  2VI6 A;  2QOP A;  3QQA A;  3H0G J;  3E7Q A;  2DA7 A;  3C07 A;  4DYQ A;  3LJL A;  2Y30 A;  3MKL A;  3HOZ J;  2F07 A;  3HKZ N;  5E3O A;  3B81 A;  3KNW A;  1OCP A;  5IYC J;  3NXC A;  3OOU A;  4Y7N J;  5C4Y A;  3T6N A;  3VVX A;  1ETQ A;  2CQX A;  1FJL A;  3PPB A;  2XB0 X;  4NEL A;  4UUT A;  5FMP A;  4IHV A;  1MBF A;  4V2G A;  2DG8 A;  1WCM J;  2YS9 A;  5JLW A;  5GP9 A;  1QVU A;  3FK6 A;  5EYR A;  4A3M J;  4BXX J;  2EZK A;  5FKN A;  3GTQ J;  4GFB A;  4AYB N;  3HGY A;  3HTH A;  3SFI A;  2H1K A;  4D5F A;  1AKH B;  3FRQ A;  3IV5 A;  4A3C J;  5EGO A;  2LVS A;  3BTL A;  3S14 J;  4A3D J;  3JRB A;  5CXI A;  1GT0 C;  2JMW A;  2CRG A;  3SDG A;  2L0K A;  4V2F A;  4AC6 A;  4B4C A;  4A3E J;  3IH3 A;  1E3O C;  4FTH A;  1JUM A;  2LK2 A;  4Y52 J;  4AC0 A;  3HOY J;  1QRY A;  2G7L A;  4D5C A;  1GDT A;  1ETY A;  2AHQ A;  4L5E A;  1JKQ C;  1P7I A;  1JUS A;  2ZCX A;  2FBQ A;  4PXI A;  1I50 J;  4KWA A;  4D7N A;  2L7M P;  5C4X J;  4I76 A;  4RDU A;  1IC8 A;  1QPI A;  3BG5 A;  3K2A A;  4A3F J;  4XRS A;  2O7T A;  4A3J J;  2MW8 A;  2K9S A;  3ZOB A;  3F1B A;  1VND A;  3WHC A;  3BR6 A;  3ANP A;  1H89 C;  1JT6 A;  3VW0 A;  4EEF G;  5M5X J;  3JRE A;  3TW6 A;  3OIO A;  2XRL A;  5F1J A;  2G7S A;  1MH3 A;  2QIB A;  2DMP A;  4NN1 A;  3G1O A;  2NVQ J;  4ME9 A;  2RAS A;  3AQS A;  3FIW A;  2O9L A;  1XS9 A;  3Q3S A;  2WB1 N;  5E3N A;  2DJN A;  3RKQ A;  1NTC A;  3HIM A;  2HKU A;  1FIP A;  5EZH A;  2HDD A;  4HNV A;  4A3I J;  1IDY A;  3JR9 A;  1LFB A;  4IHW A;  3BJB A;  2WGB A;  4A3L J;  3VVZ A;  3RZO J;  2ZOY A;  1B8I B;  1BW5 A;  4W1U A;  4M3B A;  5F0F A;  1T33 A;  3VW1 A;  1TWC J;  4BKX A;  4JP0 A;  4LOC A;  1B72 B;  3CMY A;  3ZQF A;  3BTC A;  3VIB A;  1I3Q J;  5D1R A;  4FE4 A;  1S7E A;  2QKO A;  3KKC A;  1ZQ3 P;  3NRG A;  2DA1 A;  3HOU J;  2CU7 A;  1RR7 A;  2XB5 A;  4DZJ A;  3S5R A;  3GTL J;  1ZGW A;  2MGQ A;  3HB9 A;  1MSF C;  1JJ8 C;  3CRJ A;  3ON4 A;  1QVT A;  2LKX A;  2CUF A;  2R5Y B;  2DA2 A;  5F08 A;  2UXI A;  2VPR A;  5IP9 J;  2E2I J;  2EQR A;  3LOC A;  2MSY A;  1MSE C;  1XC5 A;  1JKO C;  3VUQ A;  2DTZ A;  2ZB9 A;  1W0T A;  3E7L A;  1X58 A;  2M9H A;  1O4X A;  2XGC A;  2WUI A;  1ORK A;  1BA5 A;  5IYD J;  5M5Y J;  4MFD A;  1RPW A;  1TWF J;  2FX0 A;  2GEN A;  2LTP A;  2Y0S N;  1POG A;  5K7F A;  2EH3 A;  2NVT J;  2OI8 A;  4C3I J;  1DU0 A;  3IH4 A;  3RQI A;  1A5J A;  2W53 A;  1IV6 A;  3HOW J;  5E3M A;  4ACI A;  2E1O A;  2ZCM A;  2COB A;  5EGO B;  1PUF B;  4JX5 A;  3ZQH A;  3LSG A;  5CXG A;  3A02 A;  1Z77 A;  5J1R A;  5HSZ A;  3K7A J;  4L62 A;  1IGN A;  2NS8 A;  1VFC A;  2R5Y A;  2VKV A;  3PO2 J;  3BTI A;  1IRZ A;  2V57 A;  3BR1 A;  2ID3 A;  2E2H J;  3TW7 A;  3IH2 A;  2CQQ A;  3ZQI A;  4ABZ A;  1WH7 A;  1OCT C;  2D6Y A;  3BR5 A;  2HOS A;  4IHY A;  5C44 J;  1K83 J;  2L7Z A;  2R93 J;  4GFK A;  3LNQ A;  1G2H A;  1ETO A;  2FQ4 A;  4XRS G;  3QKX A;  4GFL A;  4MO7 A;  2LY9 A;  2VKE A;  3BR0 A;  3S2H J;  3LHQ A;  4HKU A;  1ETK A;  1PUF A;  2PMZ N;  1JJ6 C;  5DS9 A;  2B63 J;  3HTA A;  1WPK A;  2RAE A;  3JRH A;  3HTI A;  4MIM A;  1MNM C;  5BNG A;  3I4M J;  3ANG A;  2Q24 A;  1FEX A;  1ZTR A;  3B6C A;  4XID A;  1IDZ A;  3O60 A;  3RD3 A;  3Q0U A;  2E2J J;  2JWT A;  1D5Y A;  2XPU A;  4MLO A;  4C3J J;  4RBO A;  2W48 A;  5M5W J;  2LR8 A;  3F0C A;  3GZI A;  3BR3 A;  1TWG J;  2PZ9 A;  2X48 A;  2LLK A;  1JGG A;  3WHB A;  1FIA A;  4XRM A;  3G7R A;  1UHS A;  5H9T A;  2UXU A;  4JX6 A;  1SFO J;  5C3E J;  3VOX A;  1NK3 P;  2XGD A;  3DPJ A;  1WGX A;  4W97 A;  5E3L A;  3NNR A;  3BT9 A;  1YRN A;  3S15 J;  4M3D A;  2ELK A;  3VPR A;  2HQ5 A;  2UXO A;  2JJ7 A;  2R5Z A;  3PO3 J;  1IG7 A;  3M4O J;  2DA6 A;  1H88 C;  3JRA A;  1U78 A;  2AO9 A;  3BRU A;  2N8G A;  4CGR A;  5J1Y A;  2EZI A;  4B3A A;  3CWR A;  3MVP A;  1RKW A;  2X9D A;  3EUP A;  3GTP J;  1JKP C;  2NP3 A;  1XG1 A;  1VF9 A;  3V78 A;  4DYR A;  1WI3 A;  2M34 A;  2FJ1 A;  4M6V A;  3S1R J;  2NP5 A;  3CCY A;  3NPI A;  2DMQ A;  1I6H J;  2NX4 A;  1ZKG A;  5EG0 A;  4QTR A;  3MNL A;  3VW2 A;  2CUE A;  4IEJ A;  1JKR C;  3KZ9 A;  2DA4 A;  2YVH A;  1AHD P;  3JRD A;  2CJJ A;  5EDN A;  5FKL A;  1RET A;  1SGM A;  2DA5 A;  4GCK A;  1OJL A;  5FJ8 J; 
#chains in the Genus database with same CATH topology
 4PK4 A;  4QWQ A;  3WTU C;  1G8X A;  5CVR A;  5HS8 A;  2XF7 A;  3BZK A;  1OCR H;  3E6M A;  4LK1 F;  4EM1 A;  3KP5 A;  1FOW A;  2FUG 2;  4E7H A;  2HOT A;  1QO0 D;  3PJR A;  4XMY A;  1G3Y A;  2XGE A;  2P7V B;  2VKD A;  3BC8 A;  3NWS A;  4XLP F;  4HA8 A;  4M3G A;  1LDK B;  2E19 A;  5BS6 A;  3TO6 A;  3KEQ A;  2QCO A;  1W36 C;  2IS4 A;  2BVM A;  4ZZL A;  3MQ0 A;  3KYD B;  4O6J A;  2DLL A;  2E34 A;  2MAB A;  3JW4 A;  1WSU A;  1I39 A;  5F64 A;  1FP1 D;  4CIC A;  4EGY A;  3OYF A;  3RJP A;  1R49 A;  2EFN A;  2F6C A;  1MMA A;  4WXC A;  1RI7 A;  4OMZ A;  3J81 Z;  1J9I A;  1LE8 A;  3HSE A;  2BXY A;  3L00 A;  3KX2 A;  1ZR4 A;  2FEZ A;  2LBF A;  5TGT A;  2CV1 A;  2FBI A;  2LD5 A;  2R7V A;  3DEU A;  2G3B A;  4QLC U;  4I01 A;  4C9Y A;  2KIU A;  4CGZ A;  1FYL A;  1R7J A;  3OYA A;  4KJZ A;  4YEJ A;  2FA5 A;  2LY1 A;  2EZH A;  4DW6 A;  1SVL A;  2Z5U A;  2F4I A;  2X6O A;  5FD5 A;  2KLO A;  1N25 A;  1XGO A;  4HEA 2;  2NAZ A;  3IKT A;  2RC4 A;  2FSW A;  5B66 C;  3MKY B;  4FE7 A;  5CW8 A;  5GPA A;  4ENM A;  3AQT A;  2LSO A;  2MYS A;  1T0F C;  1WWX A;  4QIW N;  1UG0 A;  4CZC A;  4II2 A;  5LEJ A;  2MLK A;  4BHP A;  2B3W A;  3K4C A;  3RYR A;  4BE0 A;  1LQ1 A;  3HE0 A;  3HTJ A;  1H0M A;  1OCZ H;  1QPM A;  4BGD A;  1GVD A;  2VB6 A;  4B1R A;  1MDM A;  2CV2 A;  2BY3 A;  3WU1 B;  3SJM A;  2XDN A;  1A35 A;  3FMQ A;  3S2W A;  1NG7 A;  2LH9 A;  1VQK I;  1LNW A;  4MXM A;  3QU3 A;  3OSF A;  2KZV A;  1S29 A;  4S0H B;  3BJA A;  4YEL A;  4N4O B;  1KYZ A;  1QBJ A;  3GFJ A;  3H9J A;  3K9T A;  3SHF A;  5L3E A;  2K9Q A;  5E8I A;  1TT0 A;  4IHX A;  5D19 A;  2QSH X;  1S5L C;  1O3Q A;  3U21 A;  4PFP A;  5B1A H;  2GXB A;  1ZLK A;  2WY7 Q;  3A2K A;  2G7G A;  2Z1D A;  1OMI A;  2HKO A;  1W0U A;  3CTA A;  1Z05 A;  3C2G A;  4A0Y A;  4FAS D;  3S3N A;  2BBY A;  1VQ4 I;  1D8J A;  3HTS B;  1Z3X A;  4I2O A;  2OTL I;  4HOB A;  1LJ9 A;  2VBX A;  3VP5 A;  4OD5 A;  3A4C A;  2GFN A;  3O8G A;  3QOD A;  2WV1 A;  1RUN A;  5KCM A;  3JRI A;  4TV7 A;  4RLF A;  4XOP A;  3QU6 A;  2M3A A;  3CDI A;  2G7H A;  4U87 A;  4OOI A;  3PM1 A;  4BY7 J;  5FHP A;  4K2E A;  5HOO A;  3R60 A;  2FOW A;  2VQC A;  2ME0 A;  4A69 C;  3P9T A;  4HBL A;  1XDU A;  3FX3 A;  2LRE A;  4KIC A;  3UR3 C;  3N4M A;  1UI5 A;  4XKC A;  2D1V A;  1HKT A;  4LLN A;  2B7E A;  1VQP I;  3OS1 A;  4IZZ A;  4IRV A;  3S17 J;  2RN7 A;  1ITY A;  1SAN A;  2HNH A;  5LHH A;  2ZY9 A;  3ECO A;  3QPS A;  2YU9 J;  2OCE A;  5CQE A;  4UUS B;  3JRG A;  1TT5 B;  3LSI A;  1OKR A;  1OLT A;  2LP0 A;  3QPH A;  4ON0 A;  2ID6 A;  1Y1W J;  1SD5 A;  1W7P D;  3V6G A;  4XK4 A;  4G12 A;  2HDW A;  5IOZ A;  4RGS A;  2KRH A;  2QYO A;  4M3F A;  4QSH A;  1IN7 A;  4Q48 A;  3P9C A;  2HEO A;  2ZXJ A;  1WJC A;  1TQI A;  1JTX A;  2K4B A;  2R7Z J;  1HF0 A;  2PBX A;  1R36 A;  3LSR A;  2OJE D;  4AUX A;  1IXR C;  3H1C A;  3ASN H;  5DUK A;  3TO9 A;  1OPC A;  1ZH5 A;  3RYP A;  1YQA A;  2HXO A;  3QBM A;  2WAQ N;  4HDV A;  3HM5 A;  1U8B A;  1O3R A;  1V5F A;  3MEX A;  1HDP A;  4M6X A;  1YTY A;  2WAF A;  2CGP A;  4A0Z A;  2FBK A;  4N4N B;  4FCY A;  1VI0 A;  2QEN A;  4ASN A;  4FHT A;  1K79 A;  3HRU A;  1HQC A;  5ERI A;  2J5O A;  3CUQ C;  3GFL A;  3F8N A;  3EUA A;  3L09 A;  1Z67 A;  4HYE A;  3ZQ7 A;  5KK1 A;  5LGN A;  1A6I A;  2BVL A;  3DF8 A;  3CJD A;  3COL A;  4HX4 A;  4LLG F;  3CUQ A;  1C0W A;  1QU3 A;  3BG3 A;  2XPV A;  3O3K A;  1NHA A;  3P5J A;  3PFI A;  2Z33 A;  3R0J A;  4DQ2 A;  2ESN A;  3S16 J;  2E71 A;  3WTY C;  3H0G J;  4XBF A;  3K4B A;  5KVR A;  4HLX A;  3OYB A;  1P92 A;  5FD6 A;  1YJW I;  2KHM A;  5E3O A;  3WTS C;  3U1D A;  3KNW A;  3E6B A;  5C4Y A;  3VVX A;  4BAY A;  5FO5 A;  3ZQQ A;  1FJL A;  2XB0 X;  4NEL A;  2IGN A;  5D5V B;  4QPQ A;  2PFV A;  2EJR A;  3TDU C;  4YIF A;  4A3M J;  5FLX K;  2H1L A;  3QOE A;  1EH7 A;  2XF6 A;  4BYY A;  4CCN A;  1B59 A;  4GFB A;  4AYB N;  3GTQ J;  5GAD J;  1VQ7 I;  3SFI A;  3HTH A;  4FET A;  2LG4 A;  3PQJ A;  5BPD A;  2LF8 A;  5D5W B;  2M7B A;  3VDX A;  2MD0 A;  1EKE A;  2W00 A;  2OBP A;  1J5Y A;  1E17 A;  3JRB A;  1GT0 C;  1PVE A;  4O5V A;  1Z3Y A;  4GYI A;  4XSX F;  2L0K A;  4UVB A;  3SDG A;  3CCR I;  4M9S A;  2LF7 A;  4AC0 A;  3JAM K;  2PN6 A;  5LEK A;  1BC7 C;  1GDT A;  2HTJ A;  4L5E A;  2WAE A;  1ZG3 A;  3I71 A;  3JCU C;  5HLG A;  4RA2 A;  2VIX A;  1YO5 C;  4C2T A;  2ZCX A;  4KWA A;  2W85 A;  4PUS A;  5C4X J;  3M8F A;  2EIL H;  4RDU A;  3W6J B;  1JHF A;  1QPI A;  2GOM A;  3ONQ A;  4XRS A;  3D5S C;  4A3J J;  3DTE A;  3ZOB A;  4LG3 A;  4PFO A;  4CDG A;  2GIV A;  2HYF A;  2HS5 A;  4M6Y A;  3ANP A;  1H89 C;  1LVK A;  2UV1 A;  4OIQ F;  2GA2 A;  5E1Z B;  1R22 A;  2QIB A;  5IY5 H;  4PJM A;  3G1O A;  1XPX A;  3EPZ A;  4PGG A;  4ME9 A;  3AQS A;  2DJI A;  1W5T A;  3FIW A;  5CJ9 A;  1MKM A;  1XS9 A;  2DJN A;  2R7U A;  4L9T A;  4HQE A;  3VTI A;  2HKU A;  1FIP A;  2HDD A;  1BI2 A;  3U9G A;  2M4G A;  2DBB A;  1R5G A;  3GZ6 A;  3JR9 A;  1LFB A;  2LDU A;  3SEZ A;  1LPQ A;  2JSC A;  4NHJ A;  2A61 A;  2JT1 A;  3ZMV A;  3RZO J;  3VVZ A;  1BW5 A;  4MEY F;  4UUV A;  1XD7 A;  4M3B A;  1T33 A;  1P2F A;  4E7S A;  4LOC A;  1OYI A;  3FXR A;  3BTC A;  3K4M A;  2RQP A;  2ZFU A;  2HPM A;  3OY9 A;  2EIJ H;  1MJA A;  3VIB A;  2O0Y A;  1I3Q J;  1NG6 A;  3I4P A;  4L9N A;  5L3C A;  4KN7 X;  4AVZ A;  4BHB A;  5L3F A;  1RR7 A;  2UUZ A;  3WTT C;  4C30 A;  4DZJ A;  5BOX A;  1B4A A;  1ZHF A;  2C6Y A;  5DEQ A;  3QP6 A;  4AD9 A;  3CD6 I;  3DPL C;  1QVT A;  3JTH A;  2P5V A;  2V6C A;  3WTW C;  3H0D A;  4CA0 A;  2UXI A;  2DA2 A;  2HKX A;  4UXN A;  4EGZ A;  1CF7 A;  1XC5 A;  1JKO C;  3VUQ A;  2VKH A;  2Y69 H;  1W0T A;  3C2H A;  3E7L A;  4RGR A;  2M9H A;  3H36 A;  3P7N A;  1LKX A;  2OU2 A;  2XGC A;  3ABK H;  3T0Y A;  1O4X A;  2WUI A;  4HX8 A;  5J4Y A;  1GLN A;  3RPU A;  1J7K A;  2ZXI A;  2GEN A;  1QZE A;  2LTP A;  2Q2E A;  3BPV A;  5K7F A;  2JRM A;  3L2R A;  2W53 A;  1A5J A;  1IV6 A;  3MWM A;  3HOW J;  2ZSH B;  3GME A;  1PUF B;  2GXA A;  3A02 A;  5J1R A;  3GFM A;  3IL2 A;  5HSZ A;  4F93 B;  1IGN A;  1X3Z B;  5CVV A;  2DT7 B;  2D2W A;  2V1N A;  2CW8 A;  4EJO A;  4GGG A;  5F6F A;  2Y75 A;  3BOQ A;  1W36 D;  5BQT A;  3ZP5 A;  3ESW B;  3ZMZ A;  2FMY A;  4IOA F;  4HZF A;  1WH7 A;  4OIP F;  2Z9O A;  2DOF A;  2GOX B;  2JPB A;  2MFZ A;  1K83 J;  4MHG A;  3O2P E;  2R93 J;  3LNQ A;  4XRS G;  4GFL A;  4XKV A;  1WJA A;  5D6F A;  1ETK A;  2P5L C;  1PUF A;  3DEE A;  3SWH A;  1GVJ A;  3IWF A;  4ZJZ A;  5DS9 A;  4IRI A;  2VN2 A;  2B63 J;  1W7P B;  1K78 B;  1IO2 A;  2CFX A;  2RAE A;  3Q9S A;  1V5E A;  2DA5 A;  1YS7 A;  2BHZ A;  2WAQ A;  3EUH A;  3W3C A;  2P4W A;  3WE3 A;  3M9A A;  1MNM C;  5GTH C;  2KPM A;  3PIO F;  4ZYG A;  3FKJ A;  3JTG A;  1FEX A;  2Q24 A;  1P6R A;  3ABM H;  1IN6 A;  4XID A;  2HQN A;  2X1E A;  5ICF A;  2BOL A;  2KIS A;  1BOA A;  2ESH A;  2HTS A;  4KYW A;  3BR3 A;  1TWG J;  3QPT A;  3RCO A;  4RM2 A;  1N77 A;  2LLK A;  3WHB A;  4EQQ A;  3L2U A;  4Y3O A;  1BR2 A;  1V55 H;  3FHZ A;  2UXU A;  3PUB A;  1SFO J;  3B73 A;  1Z21 A;  4F55 A;  2FNA A;  2RQQ A;  5DUI A;  2L7K A;  3ABU A;  3S15 J;  4U9N A;  2ELK A;  5ICE A;  2V9V A;  2KQR A;  2QM3 A;  2JJ7 A;  4IPA A;  4MQ9 F;  4U7B A;  1W5S A;  2E5N A;  4KUM A;  3EUK L;  1JGS A;  1USS A;  4B3A A;  4M73 A;  3CWR A;  4AID A;  3EUP A;  3FXJ A;  4P55 A;  4XON A;  2O5R A;  2NP3 A;  3QYF A;  4RGU A;  1VTN C;  3V78 A;  2YX7 A;  4DYR A;  2M34 A;  3S1R J;  1ZAO A;  1Y8R B;  2IA1 A;  1FBQ A;  3K0L A;  5DYM A;  4LFU A;  1YOV B;  2BZT A;  1R4N B;  2Z99 A;  4AWX B;  1RZ4 A;  2ICW G;  2IT0 A;  3HRM A;  3KZ9 A;  2DA4 A;  3S3O A;  2CJJ A;  1IF1 A;  3PSI A;  5K5O A;  1XGN A;  2YU3 A;  3EQL F;  3F8C A;  1XMK A;  2K9L A;  4AYB A;  2A5Y B;  4Y4R A;  1DGR M;  1OJL A;  5FJ8 J;  1EV7 A;  3IP4 B;  1BL0 A;  3LAJ A;  3QAH A;  3DLL F;  3TED A;  3VOK A;  4L0Z B;  1Z91 A;  3RDI A;  2Y9Z A;  2FOK A;  3SXY A;  3MMY B;  2H6B A;  1E3H A;  2CQN A;  1I1S A;  5IYB J;  2R7X A;  4BQO A;  3GVA A;  4JX4 A;  3BDD A;  3LQR A;  3BQZ A;  2JA8 J;  2O8X A;  1HKS A;  3NAU A;  5CVI A;  3JSJ A;  3HPH A;  1G3T A;  4C2M J;  1ZK8 A;  1TC3 C;  3MAJ A;  3FDY A;  3ZQC A;  2K7L A;  2JA5 J;  3CCM I;  1KYW A;  4JK1 X;  1T2K A;  2X6Y A;  1TTY A;  5AIP A;  4I99 C;  3GTJ J;  4IRG A;  1E2X A;  3NRV A;  3I4N J;  2F5C A;  2Z16 A;  3CJT B;  2F5V A;  4GDF A;  1R1V A;  1B1B A;  1UJ8 A;  2EV5 A;  2EFP A;  4NQW B;  2EV0 A;  2M2E A;  1BI1 A;  1U0J A;  2BGC A;  2HYJ A;  1LEB A;  1KA8 A;  3HOS A;  2WV0 A;  4I0B A;  3MKW B;  1TWH J;  3BY6 A;  3HGG A;  3S93 A;  2EZL A;  3ZMU A;  2R0Q C;  3AFH A;  4M71 A;  4KNY A;  1WJE A;  2CV0 A;  4LD5 A;  3Q0V A;  1T6S A;  1X4P A;  3B6A A;  1BM9 A;  2ZJR F;  2W84 A;  2IBD A;  3GTO J;  2QQ8 A;  3OYL A;  3TOA A;  1VQN I;  3A01 A;  2ZC2 A;  1OFC X;  2HYT A;  2P0W A;  3GTG J;  2JN6 A;  3I59 A;  2WA0 A;  4XKB A;  2KZG A;  2BY2 A;  2VJJ A;  3T1B A;  5M3M J;  4LB5 A;  5L3D A;  4ESB A;  3SFZ A;  2KDZ A;  3BG9 A;  3C2B A;  4JKZ A;  2VOD A;  3DTK A;  4N0B A;  2HI3 A;  3OYD A;  2JSP A;  4Q47 A;  2JPC A;  4HX7 A;  3L9F A;  3QYE A;  2OZU A;  1YE9 A;  3FXK A;  3K4J A;  2H6C A;  3SZT A;  2MG4 A;  4DZP A;  1X1C A;  2Y31 A;  1OYY A;  1G3W A;  2M0C A;  3HRT A;  4J00 A;  3OWT A;  3W2V A;  1X1D A;  4JOM A;  3PNV A;  1Y0U A;  3IUV A;  1BI3 A;  2ECC A;  5JR3 A;  1ETW A;  1S7O A;  3CF2 A;  3PAS A;  1MD0 A;  3LSK A;  3CCQ I;  3ZMS A;  3S2D J;  2OAZ A;  3A03 A;  2ZOZ A;  2VXD A;  2A6T A;  3BLY A;  1JTY A;  4XLC A;  4A6E A;  4ZTF A;  2BW3 A;  2L9S A;  3ZMD A;  4DVY P;  1UCR A;  1R23 A;  1RR8 C;  3COA C;  2VC1 A;  2UXP A;  1W1W E;  4A3B J;  3FHN A;  2DPD A;  4FX4 A;  4B09 A;  3GLL A;  1B9N A;  4H0E A;  2VUM J;  3LA3 A;  1TW2 A;  2KIM A;  4I02 A;  3GLX A;  2A05 A;  3G71 I;  5HBU A;  3NQO A;  1BW6 A;  2NOG A;  3G4S I;  3LSP A;  1Z1D A;  1TW3 A;  3QP5 A;  4XIC A;  2OC6 A;  1D1A A;  3FKI J;  1RC9 A;  2D5V A;  4PJL A;  4XN3 A;  1ZRE A;  4WCG A;  5F27 A;  3BNI A;  1HOM A;  2HZD A;  3VYS B;  5JVT A;  2RHA A;  1IN8 A;  4J19 A;  4ZC3 A;  2UXH A;  1SMT A;  2DT5 A;  3DCF A;  3F8M A;  5K5Q A;  4WWC A;  1ULY A;  1BJZ A;  1IRG A;  3WTX C;  2B0L A;  4XOT A;  3A1Y A;  3VOE A;  1HLV A;  4KIB A;  1WKM A;  3KIO A;  3LST A;  3MZY A;  1R6R A;  1T08 B;  2I8D A;  2K4J A;  2JQ7 A;  1UI6 A;  1D3Y A;  5DCF A;  1LE8 B;  4CCK A;  5JHU A;  1OCO H;  2CW0 F;  2OPT A;  2CG4 A;  2JRT A;  2LBF B;  3HC7 A;  3RQ4 A;  2Y48 A;  3I64 A;  1TL8 A;  4B8X A;  3K1P A;  3OSG A;  4DGW B;  2DMU A;  2K9N A;  4G6Q A;  1JT0 A;  3VOD A;  1FWZ A;  3IUO A;  3CC7 I;  5CQG A;  1SFE A;  5GAH J;  3HIF A;  2F2E A;  4UB8 C;  1R1U A;  2TDX A;  2K40 A;  5ICG A;  9ANT A;  1FLI A;  2DPU A;  3GEU A;  3BCB A;  2MA3 A;  2A69 F;  2J5P A;  2QQB A;  1STZ A;  4IKF A;  3CO7 C;  4A3K J;  3MZH A;  3CP8 A;  3S1M J;  1AWC A;  4EJV A;  3D1N I;  2A6H F;  2PQ8 A;  2FQ3 A;  1PUE E;  2JVG A;  4A6D A;  3ROU A;  3K70 D;  4Z6Y A;  3L7W A;  2IS6 A;  4UV8 A;  1MDM B;  2Y2Z A;  3NWT A;  2DK8 A;  3B02 A;  3KET A;  3GEZ A;  5KNL A;  3OL3 A;  3HOV J;  2QF7 A;  2H8W A;  2HR3 A;  5IOY A;  3EGQ A;  1X19 A;  1KU9 A;  3BCG A;  2BXZ A;  1U9N A;  3FF5 A;  3P9K A;  4FT8 A;  4BDZ A;  3G1L A;  1ETX A;  1G6N A;  2GUH A;  1X2N A;  2DDA A;  2VL8 A;  3E7Q A;  2KMU A;  2R7D A;  2Q1Z B;  4DYQ A;  5CVU A;  3S32 A;  2NS0 A;  3HOZ J;  2F07 A;  3D5L A;  4B47 A;  3HKZ N;  2IJL A;  3GF2 A;  3B81 A;  1OCP A;  3OYC A;  2XUB A;  3NXC A;  3FXO A;  4Y7N J;  1ETQ A;  3M1E A;  3PPB A;  2STT A;  4HPQ A;  1R5I D;  4UUT A;  1Y8Q B;  3E5U A;  1R71 A;  2K3P A;  1WCM J;  5JLW A;  5GP9 A;  5EYR A;  2DYS H;  1YYV A;  1ZEL A;  4BXF A;  4EV0 A;  4P1W A;  2H1K A;  4G6D A;  1RNL A;  4WXD A;  1SVM A;  4I0A A;  5L3G A;  5EGO A;  4ESF A;  1WVR A;  2X1D A;  2L54 A;  5CXI A;  2HOE A;  3FWE A;  2JMW A;  2L5Q A;  2V6E A;  1IN5 A;  2CRG A;  1O3S A;  4AC6 A;  2ZME A;  4A3E J;  3IH3 A;  1JUM A;  1MJB A;  2LK2 A;  3I9V 2;  1RRJ A;  1LDJ A;  4HG2 A;  3DXJ F;  3RKY A;  3VWB A;  4D5C A;  1XSD A;  5F1R A;  3DBR B;  2AHQ A;  3S3M A;  1JKQ C;  2BEO A;  1JUS A;  2ACJ A;  3WU0 A;  4I76 A;  2XF5 A;  1IC8 A;  1ZLJ A;  2NYX A;  3K2A A;  3CES A;  3E1S A;  5E1W A;  2MW8 A;  3F1B A;  1HBX G;  1VND A;  3WG9 A;  3WHC A;  3BR6 A;  3KP2 A;  3ZR8 X;  1F1Z A;  3AAF A;  3GX4 X;  4BQA A;  4HV6 A;  4KA4 A;  3OIO A;  2XRL A;  5H20 A;  4KT6 A;  1OYW A;  5F1J A;  4MTD A;  1MH3 A;  5HVQ C;  1XTA A;  1ONV A;  4KN4 X;  3PIP F;  2DAO A;  2M8E A;  3HOT A;  5D4S A;  1JXS A;  3J81 K;  2RAS A;  1A6Q A;  5GAG J;  2O9L A;  5DCM A;  4RMN A;  2WB1 N;  3ERM A;  1NTC A;  2M7A A;  1IRF A;  2DFH A;  3K2Z A;  1IDY A;  2HYG D;  1RIO H;  3PNY A;  4XLN F;  4A3L J;  2H27 A;  1XSX A;  1D8K A;  3TQN A;  1TNS A;  2PJR A;  2HGC A;  4E7I A;  1K6O A;  4BKX A;  3E6D A;  4JP0 A;  2F5F A;  2CQK A;  5EEG A;  4BL0 B;  3CMY A;  1TQM A;  3OYE A;  3F9K A;  5D1R A;  2HZT A;  2XAQ A;  3O6B B;  2JUC A;  2QKL B;  3EDP A;  4RB3 C;  1PJR A;  3HOU J;  2V1U A;  3CUQ B;  2CU7 A;  2K02 A;  2XB5 A;  3S5R A;  3GTL J;  3CMA I;  1SFU A;  1ZGW A;  2EIK H;  2XAH A;  4S05 A;  1MMS A;  2MGQ A;  2VQG A;  3HB9 A;  1MSF C;  3V7R A;  4BHC A;  2ISY A;  2IXS A;  4RB0 A;  4EVI A;  2X6W A;  4XLE A;  1YW9 A;  2R5Y B;  2IS2 A;  3CCS I;  2H09 A;  3ISP A;  3CF5 F;  2E2I J;  2M4K A;  1PP7 U;  1LB2 A;  4KIT B;  2MSY A;  3HUG A;  4IOC F;  1U8R A;  2ZO4 A;  2DTZ A;  4UVA A;  1REP C;  1HSJ A;  5FRO A;  3GW2 A;  4OIO F;  3R61 A;  1DDN A;  3NEU A;  1RPW A;  2VQL A;  1HA8 A;  2RNJ A;  3HZJ A;  1K6Y A;  5E18 F;  3KLO A;  1A36 A;  1FBS A;  3LSH A;  4CZZ A;  1CGP A;  1YIJ I;  3SZG A;  1J0R A;  5E3M A;  1P4X A;  2ZCM A;  4ACI A;  2COB A;  2W1O A;  1MJ9 A;  4JX5 A;  1Z77 A;  3FXL A;  3K7A J;  3CO6 C;  2OQG A;  2PLY A;  2E1C A;  4L62 A;  2NS8 A;  1AA7 A;  1OR7 C;  2QLZ A;  2R5Y A;  1VFC A;  2VKV A;  3LA2 A;  1HXD A;  3F22 A;  5CKT A;  2E5Z A;  4L5I A;  5HS7 A;  1XN7 A;  2QVO A;  5LBQ A;  2NOJ B;  3BTI A;  3I55 I;  4RB1 A;  2HDC A;  3BR1 A;  1JE8 A;  4KMF A;  4ZYE A;  4OAY A;  1K7A A;  3TW7 A;  1WJB A;  1UST A;  2M0M A;  4IVN A;  1Z7U A;  2CQQ A;  2W24 A;  1OR7 A;  1FX7 A;  2CMP A;  1U5T B;  3DPU A;  5E8G A;  1GXQ A;  1OCT C;  3OYG A;  2RNG A;  5C44 J;  2XAJ A;  2L7Z A;  4GFK A;  1G2H A;  4Y15 A;  2LY9 A;  2VKE A;  3S2H J;  4I7H A;  1FMV A;  2PMZ N;  4CYD A;  1JJ6 C;  2KP6 A;  3HTA A;  3VEP A;  2VT2 A;  1ZGA A;  3JRH A;  3P9I A;  1U5T C;  3HTI A;  2WAD A;  4Q4Z F;  4MIM A;  2G7U A;  6PAX A;  3ZN0 A;  1E0E A;  2DQR A;  2CH0 A;  3ANG A;  2KFD A;  1KU2 A;  2DQL A;  1SAU A;  3ZXS A;  2K5C A;  3K4N A;  1J2X A;  2XVC A;  2JWT A;  1ERD A;  4CHU A;  1D5Y A;  3SYT A;  5LRR A;  2LR8 A;  2O03 A;  5CLS A;  2F4O B;  1U5T A;  4JBA A;  2R3S A;  4OU0 A;  1ZG5 A;  3PUF A;  3DV8 A;  2OTJ I;  2CW7 A;  3TBI A;  3J80 Z;  4RGX A;  4XRM A;  3G7R A;  4BAC A;  3HPG A;  2MH9 A;  5H9T A;  1SD7 A;  4JX6 A;  2HVS A;  2YSR A;  1XMA A;  3CDH A;  3M1C A;  2VLA A;  1NK3 P;  2XGD A;  2HWV A;  3NNR A;  4W97 A;  5E3L A;  3SQN A;  3RI4 A;  4X0G A;  1YRN A;  3GXO A;  4RAZ A;  2VPL A;  3VPR A;  4KIG A;  2UXO A;  3AL0 C;  4I09 A;  2R5Z A;  3E3V A;  3FM5 A;  1H88 C;  1TZL A;  3BRU A;  4IO9 F;  2N8G A;  4NBQ A;  3K8P C;  2IPQ X;  1PYV A;  1S6L A;  2VBZ A;  3HKZ A;  1VF9 A;  3LFK A;  4M6V A;  3IAM 2;  2DMQ A;  3C18 A;  3F6V A;  2M30 A;  3K70 C;  1ZKG A;  2D45 A;  5EG0 A;  3KLN A;  1YLF A;  5A2Q Z;  3LQQ A;  2V26 A;  1JKR C;  4V19 K;  4MQV A;  4YFN F;  4E70 A;  2YVH A;  1CF7 B;  2CFO A;  4MTE A;  4B3X A;  3E5Q A;  1DPU A;  1RET A;  2QGU A;  3MD2 A;  1UEL B;  1WJ5 A;  5EZG A;  4X6A J;  3Q0W A;  2Q2E B;  5HDG A;  3CQZ J;  3FXQ A;  3DFG A;  3MFK A;  2OV7 A;  4CYC A;  2ECB A;  1DU6 A;  4X1E A;  3N05 A;  5KHD A;  5LHI A;  1MBG A;  3O8H A;  3ZQG A;  1IUY A;  3GTK J;  2V4J C;  3T5X A;  3HL2 A;  3H3Z A;  5TJJ A;  3W6V A;  4XLF A;  5IP6 A;  4NC8 A;  1WJD A;  2XRO A;  1B9M A;  2RRE A;  2JA6 J;  4JL3 A;  2VJ5 A;  3DQV C;  2GM4 A;  3CJN A;  4HV5 A;  1I3A A;  3H5R A;  3CZ6 A;  2QKM B;  4B44 A;  1VZ0 A;  2YPR A;  3JRF A;  2ZXH A;  2Y0M A;  2AS5 F;  1OIS A;  3HBL A;  3G2B A;  3H9Q A;  4C3H J;  1S8N A;  2VJI A;  3RZD J;  2KRF A;  3GUD A;  5TIS C;  3OR2 C;  4AVP A;  4HNU A;  4HNT A;  3QOP A;  3HRS A;  2DFF A;  2DW4 A;  5EJC A;  2V1X A;  2QZ8 A;  1J09 A;  4LLL A;  4EJW A;  1APL C;  3WGI A;  1U6G A;  1CQT A;  5DAJ A;  2IAI A;  4XM3 A;  1JI8 A;  2WB1 A;  2M1B A;  4CXF A;  2QSG X;  1P4A A;  3W2W A;  4BBS J;  1LUJ B;  5HNH A;  1ZYR F;  1DPR A;  4M3E A;  2XPW A;  3BPX A;  3EUH C;  4G7H F;  2GLO A;  5FGL A;  3L2Q A;  5ICC A;  3KCC A;  3CDL A;  1SMY F;  4U88 A;  1GUU A;  4HW0 A;  5H2F C;  4BBR J;  2L9V A;  3BQY A;  4NNJ A;  4XOR A;  4F91 B;  1EA3 A;  1FOK A;  3CCV I;  1BBY A;  5DD8 A;  5JHF A;  5TRD A;  5JFR A;  2OER A;  1RKT A;  4AIJ A;  4F7Z A;  3WGH A;  3WE2 A;  3FIS A;  3LSJ A;  2IRF G;  3V42 A;  2E36 A;  2TRT A;  4BU2 A;  4PJ0 C;  3DTI A;  3JRC A;  2QUF A;  3HYI A;  1G4D A;  4MK6 A;  5F0H A;  2H8R A;  4AM3 A;  3MN2 A;  1TNT A;  4JQF A;  1ZR2 A;  3DU5 A;  1YI2 I;  1SD6 A;  2KT0 A;  2HOA A;  3V4G A;  4NC7 A;  2P5K A;  2XHK A;  2E60 A;  5J1U A;  1KZH A;  5EEA A;  2L01 A;  1T98 A;  2L9R A;  3L1P A;  2EV6 A;  1BOB A;  4EJT A;  2NXN B;  2JTV A;  4F3Q A;  2KL4 A;  3UNG C;  4U0Y A;  1BR1 A;  1EF4 A;  1YIO A;  4AF5 A;  1P4W A;  1Z0X A;  4Z2Y A;  5EFY A;  1A04 A;  5J47 A;  4GRI A;  1MBE A;  2NS7 A;  2X6X A;  4LIT A;  1AKH A;  2FNP A;  2XAS A;  1QZY A;  3LAP A;  3G56 A;  5FLM J;  3RPQ A;  1UZC A;  4DBQ A;  2G0E A;  5DM6 F;  3OYJ A;  2XSD C;  5LRS A;  1FYK A;  4MNU A;  4Q5S F;  2QWT A;  1MZB A;  2ZBK A;  3WG7 H;  2GIZ A;  3BJO A;  4ZTJ A;  5B3S H;  4BY1 J;  5JLX A;  3C7J A;  5LHG A;  1QZZ A;  1X3W B;  2YUS A;  2PMZ A;  3ERE D;  1AU7 A;  5AON A;  3KZY A;  5ILS A;  4FIS A;  5K1Y A;  1N75 A;  5GTI C;  4IRH A;  5D6E A;  2AXL A;  2XRN A;  2ELJ A;  3HTU A;  3HJE A;  4CSW A;  2O8K A;  2IS1 A;  3U2R A;  3ZQL A;  1ACI A;  3UKG A;  3VSK A;  2DMT A;  2LFB A;  1MMN A;  3X2Q H;  2FML A;  3F8F A;  4CO8 A;  1ON1 A;  1H9G A;  2IGM A;  5IP7 J;  1YJN I;  1KQ0 A;  1NK2 P;  1UFM A;  2IA0 A;  2L3D A;  3TP0 A;  4PJN A;  3A01 B;  1FSE A;  3M7G A;  3K10 A;  3QWL A;  2KJC A;  4UVC A;  2OF7 A;  3BG6 A;  1Q1H A;  3BWG A;  3K4K A;  4IF4 A;  4NDL A;  3WGG A;  3ZN1 A;  3I56 I;  2M8G X;  3I59 B;  1O7F A;  4I98 B;  2HVR A;  2LRD A;  3WTZ A;  5IT9 Z;  3AG4 H;  3BR2 A;  4XN0 A;  1WFX A;  4MFE A;  4XR6 A;  2L4M A;  1B8I A;  2YVE A;  3KYC B;  4YG2 F;  4LG0 A;  1KQ9 A;  2F4M B;  4D7M A;  3IRQ A;  2IEK A;  2R7F A;  1B72 A;  5GAE J;  2W7N A;  1R5H A;  4ITV A;  2Y9Y A;  1QQI A;  1D1C A;  1ZN2 A;  3R4K A;  2NVX J;  2K27 A;  4L9J A;  2REK A;  3CP2 A;  1S72 I;  2FJI 1;  5K5R A;  5E20 A;  1HDD C;  2BY0 A;  1F4K A;  4HLY A;  2QOP A;  1ON2 A;  3TOB A;  3QQA A;  2DA7 A;  5J8C A;  2CO5 A;  3MKZ A;  2MC4 A;  2BW3 B;  1SD4 A;  4NC6 A;  5J6X A;  1HW2 A;  5IYC J;  4L18 B;  4CCJ A;  3OOU A;  1FYM A;  1SVO A;  1ZGJ A;  2CQX A;  3K69 A;  4UY8 I;  2LYC A;  1QNT A;  5FMP A;  2UXN A;  3EYY A;  3TKY A;  1FOX A;  2M87 A;  2DG8 A;  1I1G A;  4E4H A;  3TDZ C;  1G3S A;  1Z6T A;  5FKN A;  1D1B A;  2OA4 A;  3HGY A;  3GO5 A;  2OUM A;  3OYN A;  4D5F A;  4DOZ A;  3FRQ A;  4E7Z A;  3IV5 A;  1FBU A;  3W6K B;  2LVS A;  1MIJ A;  3BTL A;  5J40 A;  3LSM A;  2K3F A;  2PI0 A;  3GCM A;  5H6R A;  4CH7 A;  1FC3 A;  5CVJ A;  2HQA A;  3V7C A;  4E6K G;  1QA6 A;  2NNY A;  4MGR A;  1E3O C;  4IL6 C;  4FTH A;  3BJ6 A;  3E97 A;  3M8E A;  1YHQ I;  1Y39 A;  2XAF A;  4DNC A;  1D5V A;  3T8R A;  1VQ9 I;  4LB6 B;  1ETY A;  1FMW A;  2PMH A;  1P7I A;  4OIR F;  5DM7 F;  2DT6 A;  1FP2 A;  2CQ7 A;  4C2U A;  3VYU B;  4D7N A;  1Z6R A;  3CCL I;  2WBM A;  1HW1 A;  4YII A;  4A3F J;  1VQO I;  3DKX A;  2DOD A;  1ZRF A;  4LJZ F;  2V7F A;  2K9S A;  2VQH A;  2CWE A;  1FNN A;  1VQ8 I;  5LGT A;  3VW0 A;  4EEF G;  3TO7 A;  4Y13 A;  1QGP A;  3JRE A;  1BN5 A;  4BE2 A;  1VQM I;  1YJ9 I;  2G7S A;  5HLI A;  4Y33 A;  2IA2 A;  1BJA A;  2VE8 A;  4UB6 C;  2DMP A;  2EIN H;  4L0Y B;  2DI3 A;  2ZFW A;  2NVQ J;  3ULQ B;  4NUB A;  4YFK F;  4XKW A;  3OMY A;  4HRI A;  3GWZ A;  3Q3S A;  1KQ8 A;  3HIM A;  3MZ8 A;  2K9M A;  4LMY A;  5B1B H;  2VE9 A;  3IAS 2;  4HNV A;  2LOO A;  5LGU A;  3KFW X;  4IHW A;  3BJB A;  5JI6 A;  2CUZ A;  2ZJQ F;  2WGB A;  2ZOY A;  2PMU A;  4DJA A;  4IHT A;  2A3S A;  1OCC H;  3BZ6 A;  2OCC H;  2F48 A;  1WQ2 A;  1F5T A;  2IGK A;  3G73 A;  1S7E A;  2EA4 A;  2QKO A;  4AIK A;  3NRG A;  4RLQ A;  3DLA A;  1JHH A;  5AIQ A;  4BH9 A;  1YX3 A;  5JVG F;  4HST A;  4HQM A;  1S7A A;  2EFW A;  1ZRD A;  2L9N A;  1L3L A;  3AG1 H;  4HAM A;  4RM3 A;  3TL4 X;  3E6C C;  2CUF A;  4E7J A;  1DP3 A;  4G8X A;  2GAU A;  5IP9 J;  4AU7 A;  2EQR A;  3LOC A;  2H94 A;  1A31 A;  2ZB9 A;  1FPQ A;  1UHW A;  3CJR B;  2A68 F;  3DBL B;  1EJ9 A;  3H35 A;  3CCE I;  4G7O F;  1BA5 A;  3BCA A;  4MFD A;  1TWF J;  2FX0 A;  2GA1 A;  2Y0S N;  4MEX F;  4BQN A;  2O6G E;  4D0P A;  1POG A;  2EH3 A;  2NVT J;  2OI8 A;  1DU0 A;  2V79 A;  3RQI A;  3GFI A;  3OS0 A;  2A07 F;  1L0O C;  1V4R A;  2E1O A;  3MCZ A;  5EGO B;  3LSG A;  5CXG A;  1SFX A;  4LIU A;  3ZCO A;  3V8L A;  3LL7 A;  4F52 A;  5D8L B;  4ZYA A;  4OWR B;  2ZME B;  3E0J B;  2IW5 A;  5HDK A;  2A6E F;  2UZK A;  5B5E C;  1KGS A;  4RAF A;  2DU9 A;  1IRZ A;  2V57 A;  2ID3 A;  3ML6 A;  3RPU D;  2EFQ A;  2E2H J;  4PCQ A;  5DD4 A;  1ZAR A;  4WX9 A;  4R79 A;  1DP7 P;  4LIV A;  1NH3 A;  2B9S A;  2VBW A;  4KT5 C;  4XLH A;  2D6Y A;  3OOP A;  2XV4 S;  3OV8 A;  2VBY A;  3LA7 A;  2HOS A;  4IHY A;  1XCV A;  2ZME C;  4PSW A;  4ZZD A;  1RUO A;  3QKX A;  4MO7 A;  3BR0 A;  2ZXW H;  3I54 A;  2FE3 A;  1IV8 A;  3KEO A;  2ZNZ A;  1U2W A;  5FRM A;  2NVU B;  3RTR A;  4BXU A;  5J8F A;  4FX0 A;  2KKO A;  1O7L A;  3ASO H;  1T0F A;  3VSL A;  3KP7 A;  5BNG A;  3I4M J;  3LFU A;  2WWY A;  2F5E A;  2BYV E;  3KZI C;  1LVA A;  1IAW A;  1Y6I A;  3U1K A;  4IJA A;  4OMY A;  4DBR A;  2XPU A;  4MLO A;  4C3J J;  2W48 A;  5M5W J;  4BQQ A;  5HNF A;  5DCM B;  2PZ9 A;  5HS9 A;  3PQK A;  1T95 A;  1JGG A;  2COM A;  2HFH A;  3HG9 A;  4CCL A;  1UHS A;  3OYM A;  2A5W A;  3CMM A;  2PJR B;  1YFH A;  3Q9V A;  3DPJ A;  3WU2 C;  3QYB A;  3KE2 A;  3REO A;  3BT9 A;  4M3D A;  3DPT A;  4XSZ F;  4WF2 A;  2HQ5 A;  3FXM A;  3PO3 J;  1IG7 A;  1K4T A;  1YX5 A;  1K4S A;  4XNF A;  4R1H A;  5IT3 A;  5HLH A;  2WC2 A;  1J59 A;  2PX9 A;  3OIQ A;  4QPO A;  2X1C A;  1MNE A;  1IN4 A;  1RKW A;  2JVH A;  4FQG A;  1JKP C;  4U7D A;  4N9H A;  2NP5 A;  1WI3 A;  2FJ1 A;  1QHH D;  5FLX Z;  4YFX F;  3NPI A;  3D0S A;  1X3U A;  1I6H J;  2FF4 A;  3I5U A;  2M45 A;  3VW2 A;  2CUE A;  4IEJ A;  1AHD P;  5HLT A;  3JRD A;  1XB4 A;  3OYK A;  1SGM A;  1IZ1 A;  2KJB A;  3HUG B;  3BP8 A;  4BJ6 C;  5EDN A;  4U0W A;  4ZDP A;  1I50 J;  4JNN A;  2DFI A;  3S1N J;  2ETH A;  2TCT A;  3JAM Z;  4I6Z A;  2RVC A;  2R7S A;  4XQF A;  5ILU A;  3JSO A;  2RKH A;  4GXO A;  3CCJ I;  5K7H A;  4ICH A;  4GCT A;  5C4J J;  5F0C A;  3CC2 I;  2JA7 J;  3M3Y J;  1IRX A;  2V1D A;  3A0B C;  4C2M A;  1HST A;  1X1A A;  3TGN A;  2V9K A;  3C1D A;  1GXP A;  2GXG A;  1O57 A;  2NVY J;  2ZNY A;  4KFC A;  3E5X A;  3OL4 A;  4HDU A;  4OIN F;  2GBY A;  2JK3 A;  5FFX A;  1K61 A;  4BNC A;  5K7Z A;  4IXA A;  2Z3Y A;  3HHH A;  1PP8 F;  2P7C B;  2LC2 A;  4II3 A;  2A2F X;  2RDP A;  2W25 A;  3HOX J;  4R8H A;  5FLV A;  3C3W A;  4UUS A;  4CCM A;  3FBI B;  1MGT A;  3ABT A;  3W2A A;  2XDV A;  1TLH B;  2PBI A;  3NAR A;  3F3X A;  3IWZ A;  2DN0 A;  3PL8 A;  4A0X A;  3H5N A;  4UNO A;  1FTZ A;  2B1E A;  2AQF A;  2R92 J;  4GCV A;  1HCR A;  3L2W A;  1KON A;  1LFU P;  2BHY A;  5E17 F;  4WIB A;  3GZN B;  2P81 A;  3FXU A;  2NRA C;  4ENK A;  2R7R A;  2MBF A;  1FY7 A;  1P7J A;  3I58 A;  4BJ5 C;  4A12 A;  4BE1 A;  2X0L A;  4KIF A;  2ZCN A;  4P9U A;  1GV2 A;  2ADU A;  3J7Y J;  1FSH A;  2HU9 A;  2XAG A;  1R9T J;  1X2M A;  4UHT A;  2DO7 A;  1KU7 A;  3NI7 A;  2ZKZ A;  2QA4 I;  3GTM J;  4ENJ A;  3FBN B;  2NNN A;  5AQC A;  5FKM A;  3AG2 H;  3OS2 A;  1SFK A;  3H9G A;  3KKD A;  3GBG A;  1S3J A;  5DTD A;  2DMN A;  4RAY A;  1I27 A;  2FXA A;  1WH5 A;  4YZE A;  1XMX A;  4EAT A;  4Y17 A;  3QPL A;  2ZCW A;  1FOY A;  5CPR B;  4S04 A;  4PDK A;  3CC4 I;  1IXS B;  2LNB A;  1YRN B;  4JYK A;  3M8J A;  4A3G J;  3BHQ A;  5EF6 A;  3JSP A;  3LMM A;  3K4L A;  5BPI A;  2R5Z B;  1IUF A;  2CS3 A;  3F6O A;  3H92 A;  4CUG A;  5D4R A;  3VVY A;  4ZYH A;  5HOD A;  1GHC A;  2EPF A;  2I10 A;  3ELK A;  4WXH A;  1V5G A;  3ABL H;  1J75 A;  2L7F P;  5J3L A;  5CYV A;  3PFY A;  3FZV A;  3GYH X;  3ON2 A;  2ZJP F;  2P6T A;  3AL0 B;  4XLA A;  5IPA A;  1V3F A;  1SAX A;  2DA3 A;  5BMZ A;  4G9Y A;  5EG0 B;  2IGO A;  5HDN A;  5FKO A;  2HPI A;  2W82 A;  2BY1 A;  4DYC A;  2EIM H;  2Y0S A;  3CUO A;  1MH4 A;  2KRC A;  1I5Z A;  1MND A;  2X51 A;  1Y56 A;  5FKK A;  3AKZ A;  3LWJ A;  2FRH A;  4PZJ A;  3S1Q J;  1RES A;  4HF1 A;  3RH2 A;  3FK7 A;  1LFP A;  2FBH A;  1YIT I;  1ZG1 A;  4A93 J;  3ZPL A;  3DWL E;  2M5W A;  2OQR A;  3ECH A;  3HSF A;  5F04 A;  1U3E M;  1FTT A;  4CYC B;  1U9O A;  1IJW C;  3A0H C;  2AQE A;  1W5C C;  2E7X A;  5GPC A;  4G94 A;  2MH2 A;  3G1M A;  3ZGK A;  5HAW A;  1ETV A;  5LD2 C;  2O3F A;  4XRF A;  1UG2 A;  5D8K B;  2UWM A;  2DCE A;  3HEF A;  4RB2 C;  2ME6 A;  4ETS A;  3TP3 A;  4B48 A;  4GCL A;  1GV5 A;  3R0A A;  1SEU A;  1MBK A;  1WRJ A;  2O7O A;  3WTV C;  2IVM A;  1MBJ A;  1UB9 A;  1WJF A;  2DOA A;  3K1N A;  2D1H A;  3IC7 A;  4HSR A;  2JZY A;  3CCU I;  1H8A C;  2EA2 A;  3EET A;  3V7S A;  3HXL A;  3VB2 A;  4D9J A;  2VJ4 A;  4NB5 A;  1ENH A;  1F43 A;  3N97 A;  5FRN A;  2R4G A;  3BTJ A;  2P6S A;  2YR2 A;  1TP4 A;  2KIQ A;  1IXC A;  1T56 A;  2EBI A;  2L2O A;  2HXI A;  1YG2 A;  3I53 A;  4KDP A;  2VOP A;  1F36 A;  2CYY A;  3HSR A;  5KAF C;  1DQU A;  5ILV A;  3H3V K;  3J7A O;  5KAI C;  5K58 A;  1V54 H;  3KPH A;  4O3M A;  1M1E B;  1WI9 A;  3CLO A;  1Y1V J;  3VYR B;  2E7W A;  2UXX A;  2FD5 A;  1T8I A;  1JUP A;  3DEW A;  4EJU A;  1UMQ A;  2RV8 A;  2WY8 Q;  2DG7 A;  3SEQ A;  4BS9 A;  2QQA A;  1TWA J;  3G3Z A;  1YW8 A;  3RKX A;  2YX4 A;  4HF0 A;  2V9P A;  2EFO A;  1SC7 A;  4N9I A;  2CUJ A;  4BEH B;  1Q1V A;  3D5R C;  3SDB A;  2QTQ A;  1MBH A;  3AG3 H;  3V8K A;  2F5D A;  3KP4 A;  1FZP B;  5D18 A;  1LEA A;  1BC8 C;  2BE5 F;  4KIS A;  1XX5 A;  2IU5 A;  3T8T A;  1XGS A;  3BRO A;  2Q8K A;  3DBH B;  5M3F J;  3J80 K;  4ENN A;  1I6X A;  3SZP A;  4UDS A;  3F21 A;  4IQJ A;  3HDD A;  2VI6 A;  1DUX C;  1AOY A;  1TBX A;  4RS8 A;  3C07 A;  2W4S A;  2PFB A;  3LJL A;  5J4V A;  4BEH A;  2Y30 A;  3MKL A;  2O61 A;  2LY2 A;  1PDN C;  3K6G A;  2XKO A;  4IQ4 A;  3T6N A;  1LDD A;  4M74 A;  4P96 A;  4IHV A;  3VYT B;  1MBF A;  2DTR A;  3LWF A;  4U0V A;  4V2G A;  4YRV A;  2YS9 A;  4LGW A;  3FM3 A;  3ZRG A;  4IHS A;  1QVU A;  3FK6 A;  3H5A A;  2QEX I;  4BXX J;  5DDG A;  2EZK A;  3DKY A;  5H6Q A;  4ANJ A;  1BIA A;  2CSO A;  2VXZ A;  3K1M A;  2XSJ C;  3IKV A;  5A2Q K;  4PSX A;  1AKH B;  1F9N A;  4A3C J;  4D1Q A;  3BZC A;  3Q5F A;  3S14 J;  1MW7 A;  2VT3 A;  2GQQ A;  4A3D J;  1MMG A;  4L9V A;  1X1P A;  1X1B A;  4V2F A;  4H4K C;  4B4C A;  1VQ5 I;  4E7K A;  2XAU A;  2ISZ A;  2Z2S B;  5D5X B;  2DOE A;  2PEX A;  4A2U A;  5ED4 A;  4Y52 J;  1D0Z A;  3HOY J;  2JUG A;  1QRY A;  2G7L A;  3RIR A;  4M9X A;  2FBQ A;  4KMU X;  4PXI A;  2XGX A;  2L02 A;  2L7M P;  1HW5 A;  2EB7 A;  3KZZ A;  5D5U B;  1R00 A;  4OD4 A;  3BG5 A;  1QHG A;  3QRF F;  2KIF A;  2O7T A;  1EH8 A;  1XCB A;  4G7Z F;  1UHM A;  2LKS A;  2DFE A;  1W7P A;  4G6T B;  1Z9C A;  2VON A;  2L4A A;  4AIH A;  3HHG A;  4PJJ A;  1K78 A;  3RKW A;  3TMO A;  1JT6 A;  1BI0 A;  1W4M A;  5M5X J;  4IX7 A;  1H9T A;  3DU6 A;  3TW6 A;  4LK0 F;  2LMD A;  4L5J A;  2WTE A;  1B6A A;  1E3P A;  1G59 A;  4NN1 A;  2W57 A;  1IW7 F;  2OD5 A;  1O3T A;  2HVQ A;  2R7O A;  5E3N A;  3OYH A;  3RKQ A;  2I5U A;  5EZH A;  2DK5 A;  4A3I J;  2FU4 A;  1XGM A;  3PNT A;  1B8I B;  2QSF X;  4P9F A;  4W1U A;  3WOD F;  4EM2 A;  1T39 A;  1Y0N A;  4LG0 B;  3I0T A;  5F0F A;  3S8P A;  3VW1 A;  1TWC J;  1ODD A;  1B72 B;  1R1T A;  3ZQF A;  1TQP A;  5LFA A;  4FE4 A;  4EMS A;  2MC3 A;  3KKC A;  1ZQ3 P;  2DA1 A;  3DP7 A;  2MD5 A;  4A5M A;  4GO1 A;  4P5O A;  4BJT A;  4M9Z A;  4CCO A;  2EK5 A;  2E1N A;  1JJ8 C;  3CRJ A;  3ON4 A;  2PJP A;  1XSV A;  2KDO A;  4ESJ A;  2LKX A;  3V8J A;  5F08 A;  1FT9 A;  2VPR A;  1KU3 A;  5FFZ A;  2QBY B;  1MSE C;  2X85 A;  1X58 A;  3CME I;  4YIR X;  3KEY A;  1ORK A;  4ZDL A;  3NS4 A;  1HC8 A;  5IYD J;  5M5Y J;  1DGW Y;  3M07 A;  3FMS A;  3PSF A;  2VOO A;  4GYG A;  4BDY A;  2JA2 A;  1VQ6 I;  2BV6 A;  3GZ5 A;  4C3I J;  4ZH4 F;  3IH4 A;  3DKW A;  4U9L A;  1HKQ A;  3ZQH A;  3OR1 C;  5DV5 A;  2ZJ2 A;  2X4H A;  3L2C A;  2STW A;  2QBY A;  4BUP A;  1X4O A;  3PO2 J;  3J7A Y;  4EM0 B;  2XC7 A;  2QQ9 A;  3VFZ A;  2R7T A;  3IH2 A;  2ZSI B;  3ZQI A;  5LLQ A;  2GWR A;  4A5N A;  1S9H A;  5E79 C;  4ABZ A;  3CJQ B;  3BR5 A;  2Q0O A;  2E35 A;  4ZDO A;  3ZMT A;  1P9Q C;  4NQW A;  1ETO A;  2FQ4 A;  4J01 A;  2LKP A;  2VAS A;  1YS6 A;  3LHQ A;  4HKU A;  3L2V A;  1BIB A;  3I3L A;  2R7W A;  1D0X A;  4E7L A;  4DIQ A;  1WPK A;  2K86 A;  3RSN A;  3CLQ A;  2G9W A;  2QWW A;  2VC0 A;  1BR4 A;  4M72 A;  5L3B A;  1ZTR A;  3B6C A;  1MMD A;  1ZRC A;  1UAA A;  2RGV A;  1IDZ A;  3O60 A;  3Q0U A;  2E2J J;  3RD3 A;  1WHU A;  4RBO A;  4RAG A;  5EEH A;  3F0C A;  3GZI A;  1D0Y A;  4HF2 A;  3KP6 A;  2X48 A;  4B43 A;  1R4M B;  4F92 B;  4OAZ A;  2MLG A;  1FIA A;  2DXI A;  4PGH A;  1XDS A;  2EWN A;  3FMR A;  5C3E J;  3R6S A;  3VOX A;  2AXT C;  2E1M B;  1WGX A;  2YVX A;  1Z7L A;  3H3U A;  1N78 A;  3J7Z I;  1WZ2 A;  2GZW A;  1OQY A;  3M4O J;  2DA6 A;  3F8B A;  1EH6 A;  3G6E I;  1YW7 A;  3JRA A;  2AO9 A;  1U78 A;  4CGR A;  5J1Y A;  2EZI A;  3F72 A;  2XIG A;  2P8T A;  4XL9 A;  2DDB A;  3OYI A;  3MVP A;  2X9D A;  3GTP J;  2E1M C;  1XG1 A;  5IT9 K;  5FGM A;  2PG4 A;  2IP2 A;  2OZ6 A;  2R7Q A;  3CCY A;  3F23 A;  5E1X A;  2NX4 A;  2XKP A;  3EYI A;  3MNL A;  4QTR A;  3OIP A;  4WK8 F;  5FB2 A;  3IRR A;  2HQR A;  3BG7 A;  3KP3 A;  4UV9 A;  3KYL A;  1VQL I;  1R58 A;  4ZYD A;  2DYR H;  2ELH A;  5FKL A;  1T38 A;  3IHU A;  2K85 A;  4GCK A; 
#chains in the Genus database with same CATH homology
 1BL0 A;  3S1N J;  5EZG A;  3TED A;  2TCT A;  3Q0W A;  4I6Z A;  4X6A J;  3VOK A;  3CQZ J;  2HOT A;  4CYC A;  2Y9Z A;  5K7H A;  4ICH A;  4GCT A;  5C4J J;  5F0C A;  2XGE A;  2ECB A;  2JA7 J;  4M3G A;  3M3Y J;  5IYB J;  1DU6 A;  4X1E A;  2E19 A;  1MBG A;  3O8H A;  4JX4 A;  3ZQG A;  2NVY J;  2QCO A;  3BQZ A;  2JA8 J;  3NAU A;  3GTK J;  3JSJ A;  2GBY A;  2JK3 A;  4C2M J;  3W6V A;  1ZK8 A;  5IP6 A;  1K61 A;  1TC3 C;  5K7Z A;  3ZQC A;  2JA6 J;  4JL3 A;  2JA5 J;  2GM4 A;  3HOX J;  5FLV A;  4UUS A;  3JRF A;  3GTJ J;  3HBL A;  3I4N J;  4C3H J;  3NAR A;  3RZD J;  1LE8 A;  2DN0 A;  2M2E A;  1FTZ A;  4JNN A;  2R92 J;  1HCR A;  2HYJ A;  1ZR4 A;  1LFU P;  2P81 A;  2LD5 A;  1TWH J;  3HGG A;  2G3B A;  2EZL A;  1APL C;  2R0Q C;  1P7J A;  2ZCN A;  1CQT A;  1GV2 A;  5DAJ A;  2IAI A;  3Q0V A;  2EZH A;  4DW6 A;  3B6A A;  2X6O A;  1R9T J;  1X2M A;  2IBD A;  3GTO J;  4BBS J;  3NI7 A;  3GTM J;  3A01 A;  1OFC X;  2HYT A;  5AQC A;  4FE7 A;  5FKM A;  5CW8 A;  5GPA A;  3AQT A;  4M3E A;  2XPW A;  3GTG J;  2JN6 A;  3KKD A;  5M3M J;  3GBG A;  4QIW N;  2GLO A;  5DTD A;  2DMN A;  5FGL A;  3HE0 A;  1WH5 A;  4YZE A;  3CDL A;  2KDZ A;  1GUU A;  3BG9 A;  3QPL A;  3C2B A;  4BBR J;  3HTJ A;  4JKZ A;  3BQY A;  2HI3 A;  1GVD A;  4B1R A;  1YRN B;  4JYK A;  2XDN A;  3SJM A;  4A3G J;  3BHQ A;  5EF6 A;  2R5Z B;  1IUF A;  2OER A;  1RKT A;  3VVY A;  5HOD A;  4MXM A;  3OSF A;  2I10 A;  2MG4 A;  4DZP A;  3FIS A;  4S0H B;  3LSJ A;  2L7F P;  2TRT A;  5J3L A;  3JRC A;  2Y31 A;  2M0C A;  4MK6 A;  2K9Q A;  5F0H A;  2H8R A;  4IHX A;  3MN2 A;  1ZR2 A;  3ON2 A;  5D19 A;  3IUV A;  2KT0 A;  2ECC A;  5IPA A;  1ETW A;  3PAS A;  2DA3 A;  2HOA A;  3S2D J;  5EG0 B;  2G7G A;  3A03 A;  2ZOZ A;  1W0U A;  1JTY A;  5FKO A;  5J1U A;  5EEA A;  4DYC A;  2UXP A;  1MH4 A;  2L9R A;  3L1P A;  4A3B J;  5FKK A;  3VP5 A;  2GFN A;  3LWJ A;  3S1Q J;  1RES A;  3O8G A;  2VUM J;  2WV1 A;  3RH2 A;  3FK7 A;  1EF4 A;  3JRI A;  5HBU A;  4A93 J;  4AF5 A;  1BW6 A;  2NOG A;  5F04 A;  3LSP A;  1Z0X A;  1FTT A;  4CYC B;  1U9O A;  1IJW C;  3PM1 A;  5EFY A;  4XIC A;  4BY7 J;  1MBE A;  2NS7 A;  3FKI J;  5GPC A;  5FHP A;  3G1M A;  5HAW A;  1AKH A;  2D5V A;  1ETV A;  1UG2 A;  2ME0 A;  5F27 A;  4A69 C;  5FLM J;  3G56 A;  3BNI A;  3HEF A;  1HOM A;  2ME6 A;  3P9T A;  2G0E A;  3TP3 A;  4GCL A;  1GV5 A;  1UI5 A;  2XSD C;  2RHA A;  1MBK A;  2O7O A;  4J19 A;  1MBJ A;  2QWT A;  2UXH A;  3DCF A;  3S17 J;  1ITY A;  1SAN A;  1BJZ A;  4BY1 J;  1H8A C;  3QPS A;  5JLX A;  2YU9 J;  4UUS B;  1HLV A;  3JRG A;  2YUS A;  1ENH A;  1F43 A;  1AU7 A;  1UI6 A;  2LP0 A;  1LE8 B;  3BTJ A;  4FIS A;  2ID6 A;  1Y1W J;  2OPT A;  1T56 A;  2EBI A;  3V6G A;  4XK4 A;  4G12 A;  5IOZ A;  2HXI A;  4M3F A;  2O8K A;  3OSG A;  4QSH A;  2DMU A;  3ZQL A;  2K9N A;  1F36 A;  3H3V K;  5K58 A;  3UKG A;  1JT0 A;  2DMT A;  2LFB A;  1JTX A;  2R7Z J;  1HF0 A;  2PBX A;  3LSR A;  5IP7 J;  1Y1V J;  4AUX A;  1NK2 P;  2FD5 A;  1JUP A;  3DEW A;  3TP0 A;  9ANT A;  1UMQ A;  2K40 A;  3A01 B;  2DG7 A;  2HXO A;  3QBM A;  2OF7 A;  2WAQ N;  3GEU A;  3HM5 A;  1TWA J;  4NDL A;  1U8B A;  1HDP A;  2M8G X;  4A3K J;  4FCY A;  3S1M J;  1VI0 A;  3D1N I;  1Q1V A;  3BR2 A;  4MFE A;  1B8I A;  2QTQ A;  2YVE A;  1MBH A;  4D7M A;  2Y2Z A;  5D18 A;  2IEK A;  1B72 A;  3HOV J;  2Y9Y A;  1A6I A;  2IU5 A;  3CJD A;  3COL A;  2QF7 A;  5IOY A;  2NVX J;  3EGQ A;  2REK A;  3BCG A;  1U9N A;  3BG3 A;  5M3F J;  2XPV A;  1ETX A;  3G1L A;  1HDD C;  2GUH A;  4UDS A;  1X2N A;  3HDD A;  3S16 J;  2VI6 A;  2QOP A;  3QQA A;  3H0G J;  3E7Q A;  2DA7 A;  3C07 A;  4DYQ A;  3LJL A;  2Y30 A;  3MKL A;  3HOZ J;  2F07 A;  3HKZ N;  5E3O A;  3B81 A;  3KNW A;  1OCP A;  5IYC J;  3NXC A;  3OOU A;  4Y7N J;  5C4Y A;  3T6N A;  3VVX A;  1ETQ A;  2CQX A;  1FJL A;  3PPB A;  2XB0 X;  4NEL A;  4UUT A;  5FMP A;  4IHV A;  1MBF A;  4V2G A;  2DG8 A;  1WCM J;  2YS9 A;  5JLW A;  5GP9 A;  1QVU A;  3FK6 A;  5EYR A;  4A3M J;  4BXX J;  2EZK A;  5FKN A;  3GTQ J;  4GFB A;  4AYB N;  3HGY A;  3HTH A;  3SFI A;  2H1K A;  4D5F A;  1AKH B;  3FRQ A;  3IV5 A;  4A3C J;  5EGO A;  2LVS A;  3BTL A;  3S14 J;  4A3D J;  3JRB A;  5CXI A;  1GT0 C;  2JMW A;  2CRG A;  3SDG A;  2L0K A;  4V2F A;  4AC6 A;  4B4C A;  4A3E J;  3IH3 A;  1E3O C;  4FTH A;  1JUM A;  2LK2 A;  4Y52 J;  4AC0 A;  3HOY J;  1QRY A;  2G7L A;  4D5C A;  1GDT A;  1ETY A;  2AHQ A;  4L5E A;  1JKQ C;  1P7I A;  1JUS A;  2ZCX A;  2FBQ A;  4PXI A;  1I50 J;  4KWA A;  4D7N A;  2L7M P;  5C4X J;  4I76 A;  4RDU A;  1IC8 A;  1QPI A;  3BG5 A;  3K2A A;  4A3F J;  4XRS A;  2O7T A;  4A3J J;  2MW8 A;  2K9S A;  3ZOB A;  3F1B A;  1VND A;  3WHC A;  3BR6 A;  3ANP A;  1H89 C;  1JT6 A;  3VW0 A;  4EEF G;  5M5X J;  3JRE A;  3TW6 A;  3OIO A;  2XRL A;  5F1J A;  2G7S A;  1MH3 A;  2QIB A;  2DMP A;  4NN1 A;  3G1O A;  2NVQ J;  4ME9 A;  2RAS A;  3AQS A;  3FIW A;  2O9L A;  1XS9 A;  3Q3S A;  2WB1 N;  5E3N A;  2DJN A;  3RKQ A;  1NTC A;  3HIM A;  2HKU A;  1FIP A;  5EZH A;  2HDD A;  4HNV A;  4A3I J;  1IDY A;  3JR9 A;  1LFB A;  4IHW A;  3BJB A;  2WGB A;  4A3L J;  3VVZ A;  3RZO J;  2ZOY A;  1B8I B;  1BW5 A;  4W1U A;  4M3B A;  5F0F A;  1T33 A;  3VW1 A;  1TWC J;  4BKX A;  4JP0 A;  4LOC A;  1B72 B;  3CMY A;  3ZQF A;  3BTC A;  3VIB A;  1I3Q J;  5D1R A;  4FE4 A;  1S7E A;  2QKO A;  3KKC A;  1ZQ3 P;  3NRG A;  2DA1 A;  3HOU J;  2CU7 A;  1RR7 A;  2XB5 A;  4DZJ A;  3S5R A;  3GTL J;  1ZGW A;  2MGQ A;  3HB9 A;  1MSF C;  1JJ8 C;  3CRJ A;  3ON4 A;  1QVT A;  2LKX A;  2CUF A;  2R5Y B;  2DA2 A;  5F08 A;  2UXI A;  2VPR A;  5IP9 J;  2E2I J;  2EQR A;  3LOC A;  2MSY A;  1MSE C;  1XC5 A;  1JKO C;  3VUQ A;  2DTZ A;  2ZB9 A;  1W0T A;  3E7L A;  1X58 A;  2M9H A;  1O4X A;  2XGC A;  2WUI A;  1ORK A;  1BA5 A;  5IYD J;  5M5Y J;  4MFD A;  1RPW A;  1TWF J;  2FX0 A;  2GEN A;  2LTP A;  2Y0S N;  1POG A;  5K7F A;  2EH3 A;  2NVT J;  2OI8 A;  4C3I J;  1DU0 A;  3IH4 A;  3RQI A;  1A5J A;  2W53 A;  1IV6 A;  3HOW J;  5E3M A;  4ACI A;  2E1O A;  2ZCM A;  2COB A;  5EGO B;  1PUF B;  4JX5 A;  3ZQH A;  3LSG A;  5CXG A;  3A02 A;  1Z77 A;  5J1R A;  5HSZ A;  3K7A J;  4L62 A;  1IGN A;  2NS8 A;  1VFC A;  2R5Y A;  2VKV A;  3PO2 J;  3BTI A;  1IRZ A;  2V57 A;  3BR1 A;  2ID3 A;  2E2H J;  3TW7 A;  3IH2 A;  2CQQ A;  3ZQI A;  4ABZ A;  1WH7 A;  1OCT C;  2D6Y A;  3BR5 A;  2HOS A;  4IHY A;  5C44 J;  1K83 J;  2L7Z A;  2R93 J;  4GFK A;  3LNQ A;  1G2H A;  1ETO A;  2FQ4 A;  4XRS G;  3QKX A;  4GFL A;  4MO7 A;  2LY9 A;  2VKE A;  3BR0 A;  3S2H J;  3LHQ A;  4HKU A;  1ETK A;  1PUF A;  2PMZ N;  1JJ6 C;  5DS9 A;  2B63 J;  3HTA A;  1WPK A;  2RAE A;  3JRH A;  3HTI A;  4MIM A;  1MNM C;  5BNG A;  3I4M J;  3ANG A;  2Q24 A;  1FEX A;  1ZTR A;  3B6C A;  4XID A;  1IDZ A;  3O60 A;  3RD3 A;  3Q0U A;  2E2J J;  2JWT A;  1D5Y A;  2XPU A;  4MLO A;  4C3J J;  4RBO A;  2W48 A;  5M5W J;  2LR8 A;  3F0C A;  3GZI A;  3BR3 A;  1TWG J;  2PZ9 A;  2X48 A;  2LLK A;  1JGG A;  3WHB A;  1FIA A;  4XRM A;  3G7R A;  1UHS A;  5H9T A;  2UXU A;  4JX6 A;  1SFO J;  5C3E J;  3VOX A;  1NK3 P;  2XGD A;  3DPJ A;  1WGX A;  4W97 A;  5E3L A;  3NNR A;  3BT9 A;  1YRN A;  3S15 J;  4M3D A;  2ELK A;  3VPR A;  2HQ5 A;  2UXO A;  2JJ7 A;  2R5Z A;  3PO3 J;  1IG7 A;  3M4O J;  2DA6 A;  1H88 C;  3JRA A;  1U78 A;  2AO9 A;  3BRU A;  2N8G A;  4CGR A;  5J1Y A;  2EZI A;  4B3A A;  3CWR A;  3MVP A;  1RKW A;  2X9D A;  3EUP A;  3GTP J;  1JKP C;  2NP3 A;  1XG1 A;  1VF9 A;  3V78 A;  4DYR A;  1WI3 A;  2M34 A;  2FJ1 A;  4M6V A;  3S1R J;  2NP5 A;  3CCY A;  3NPI A;  2DMQ A;  1I6H J;  2NX4 A;  1ZKG A;  5EG0 A;  4QTR A;  3MNL A;  3VW2 A;  2CUE A;  4IEJ A;  1JKR C;  3KZ9 A;  2DA4 A;  2YVH A;  1AHD P;  3JRD A;  2CJJ A;  5EDN A;  5FKL A;  1RET A;  1SGM A;  2DA5 A;  4GCK A;  1OJL A;  5FJ8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...