3BR0A

Crystal structure of the complex of malachite green bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br0A02
3QQAA 3VP5A 1U9NA 3BTCA 1I50J 2XGDA 2NVTJ 2VKEA 3KZ9A 1UHSA 2ZCNA 4RBOA 3CRJA 2UXUA 3LJLA 1MBGA 1VI0A 3BR1A 1JGGA 3HOYJ 4D5CA 3OOUA 3IH2A 3BRUA 2HQ5A 5C3EJ 4AC6A 1FJLA 1YRNA 2K40A 2X6OA 3H0GJ 1IGNA 3HEFA 5EGOA 1GV5A 2H8RA 2YS9A 4GFKA 2REKA 3EGQA 3HKZN 3COLA 3FKIJ 3S1RJ 1BW5A 5HSZA 3BTJA 1RESA 2N8GA 1WI3A 2XRLA 4IHWA 2XB5A 2JA6J 3HOWJ 3S1QJ 4A3CJ 1ETXA 3SDGA 1NK3P 4A93J 1RR7A 3JRIA 4FCYA 3JSJA 5J3LA 1UG2A 2MW8A 3JRBA 3H3VK 4NELA 3GTKJ 1BA5A 3HB9A 3K7AJ 4A3DJ 1GVDA 2HOSA 1OCPA 4JX4A 2ME6A 1SGMA 2UXIA 4M3GA 2JN6A 2G7SA 1Y1VJ 2EQRA 2O9LA 3JRGA 2JK3A 4DYCA 2EBIA 2EZIA 1BJZA 2P81A 3BR0A 4BY1J 3VVYA 2R92J 4ICHA 4XRSG 3MNLA 2DJNA 4AUXA 1B72A 2AHQA 4BXXJ 4JL3A 2R0QC 4CGRA 1D5YA 5F1JA 4D7MA 1MSEC 3JRFA 4NDLA 5E3MA 3Q0WA 1I3QJ 2OF7A 5CXIA 1FTTA 1HOMA 4IHXA 4KWAA 3I4NJ 2DA5A 3RKQA 5E3LA 1LFUP 2DA4A 1GUUA 5FKOA 2L0KA 2V57A 2ECBA 1ZQ3P 2PZ9A 2GUHA 4MFEA 3PPBA 4A3GJ 3VUQA 1HDPA 1S7EA 2WAQN 2G3BA 4C3IJ 3QPLA 5J1YA 2YU9J 1WPKA 3HBLA 5EZGA 1MBKA 2EH3A 1U78A 1K83J 1X58A 3QPSA 2Y2ZA 4M3BA 4MO7A 4Y7NJ 2YVEA 3LNQA 3EUPA 2DTZA 5FGLA 2CRGA 1RPWA 1P7JA 5C4YA 5EYRA 1ENHA 2R5YB 5EF6A 1PUFB 3B6AA 1EF4A 2ID6A 2HXOA 5M5YJ 9ANTA 2DA7A 5FHPA 1AKHA 2E19A 2IEKA 3JRAA 5CXGA 2LVSA 3WHCA 3VIBA 3KKDA 2EZKA 1IDZA 2CU7A 1A5JA 1JUPA 2M2EA 3ON4A 2UXHA 4XICA 4AYBN 1VF9A 1APLC 1ORKA 3BTLA 5K58A 5IOZA 4HNVA 1SANA 2DG7A 2XGEA 1GT0C 3S2DJ 5DTDA 2HKUA 3DPJA 3OSGA 3BTIA 3VVZA 3A01A 3HOXJ 2WB1N 2G7LA 1ZK8A 1JKPC 1LE8A 1OCTC 1E3OC 5DAJA 1DU6A 4A3IJ 1IUFA 3ZQGA 3PASA 3QBMA 3HDDA 1MNMC 1F43A 4A3LJ 1ETQA 3PO2J 4A69C 4S0HB 3BR3A 5IYBJ 2ME0A 5F0CA 2NS7A 3Q3SA 3ANGA 3BR5A 1HF0A 2OERA 3RD3A 1ETWA 1HDDC 1NK2P 3S15J 5K7FA 3TP3A 2W53A 2CQQA 2WGBA 4UUSA 3KNWA 2QCOA 4M3FA 1CQTA 5EGOB 1QPIA 1FIAA 2TCTA 4MFDA 4CYCB 1XS9A 1SFOJ 3NAUA 5HAWA 2NP3A 3O60A 1F36A 4BBSJ 3HM5A 2X48A 3QKXA 2RHAA 3M4OJ 3Q0VA 2VUMJ 4V2GA 1K61A 3BJBA 4X1EA 3IH4A 2DMTA 2FD5A 3AQTA 1FEXA 2R5ZB 1UI5A 5EDNA 4BBRJ 3E7QA 3VW2A 2M0CA 4MXMA 1TWCJ 2RASA 1O4XA 2Y30A 1OJLA 1TWFJ 2K9QA 2QF7A 1JJ6C 3DCFA 4A3MJ 1UMQA 5F08A 4FTHA 5EFYA 2LR8A 2NVQJ 4GCTA 2CUFA 2EZHA 2FBQA 2NOGA 1MBHA 2CUEA 2R7ZJ 3S1NJ 1H8AC 3VPRA 4JP0A 2ECCA 2G7GA 2HYTA 3GEUA 4YZEA 4J19A 2HDDA 2ZCMA 2RAEA 1I6HJ 4D7NA 3ZOBA 1W0TA 5F0FA 1AHDP 2R93J 3B81A 3PO3J 2VPRA 5HODA 1X2NA 4DYRA 1ETYA 2E2HJ 2JMWA 4NN1A 4B4CA 1AU7A 4JX5A 4X6AJ 3GBGA 5JLWA 4RDUA 3NNRA 3WHBA 1WGXA 2DMNA 3BG9A 3GTOJ 3CDLA 2HOTA 5C44J 5FLMJ 2IAIA 2GBYA 2NP5A 1FIPA 4XIDA 3K2AA 3GTMJ 2O8KA 3GTQJ 2VKVA 3VW0A 2IBDA 2FJ1A 5M3MJ 2KDZA 1JTYA 2QOPA 1GDTA 1UI6A 2LKXA 1U8BA 3BQZA 3JRDA 5J1UA 3VOXA 3V6GA 4A3KJ 3CMYA 4IEJA 3I4MJ 1TWGJ 2Y0SN 5M5WJ 1IDYA 3VOKA 4A3JJ 2DMQA 1JTXA 2DA3A 2DA2A 2I10A 1VFCA 1G2HA 4C3JJ 3O8GA 3NRGA 3JR9A 4QIWN 2O7TA 3TW6A 1FTZA 1JKQC 3GTPJ 1JJ8C 2XSDC 1ZGWA 1JKRC 4JYKA 4FE4A 3FISA 3M3YJ 3S1MJ 5IPAA 3IV5A 3FRQA 2UXPA 2XPVA 3S17J 3HOUJ 2ZOYA 4JKZA 1POGA 3RQIA 1B8IA 3VW1A 2NS8A 5DS9A 1JKOC 1MBFA 2AO9A 2R5YA 4XRMA 3NPIA 3JREA 2Y9ZA 1PUFA 2DG8A 2W48A 4D5FA 3HOZJ 2PMZN 2XPWA 2D6YA 5HBUA 1JUMA 4V2FA 3LWJA 3HE0A 3BHQA 1H88C 3LHQA 5BNGA 5D1RA 4A3EJ 4ABZA 3AQSA 4GFLA 1XC5A 5F04A 4G12A 1JUSA 1U9OA 2MSYA 3CCYA 5J1RA 5IOYA 3G1MA 4GCLA 2LD5A 3NARA 4QSHA 3FIWA 4UUSB 3S16J 2FX0A 2K9SA 2ZB9A 5M5XJ 5EG0A 3BCGA 4XRSA 4HKUA 3L1PA 3A02A 3G7RA 3BG5A 5FJ8J 5D18A 2PBXA 3BR6A 4AC0A 1YRNB 3HGYA 2HYJA 2HXIA 1JT0A 4GFBA 5EEAA 2NX4A 2D5VA 4DYQA 2XDNA 3HIMA 4M6VA 1H89C 4ACIA 3HGGA 2FQ4A 2XGCA 3MKLA 2NVXJ 5FKMA 4DW6A 3OIOA 3LSJA 2LK2A 4BKXA 3Q0UA 4I76A 4W1UA 2ZCXA 4M3DA 3RZDJ 1IG7A 3NI7A 3LSRA 3OSFA 3IUVA 3JRHA 2GLOA 3LOCA 2GENA 2DA1A 3BR2A 5GP9A 1A6IA 2GM4A 5F27A 3S5RA 4B3AA 4CYCA 5FKKA 2EZLA 1T56A 2LTPA 4BY7J 2ID3A 2L7ZA 4IHVA 4ME9A 3DEWA 1B72B 1TWHJ 4MLOA 4A3BJ 2M8GX 3ZQLA 1R9TJ 2M9HA 3MVPA 3IH3A 3HTHA 1ZKGA 3TEDA 1HCRA 2DMPA 1QRYA 4L62A 5E3NA 3G1LA 1VNDA 2R5ZA 5FLVA 3TW7A 3G56A 1Q1VA 1T33A 2DA6A 1TC3C 5FKLA 2OI8A 3FK6A 3BG3A 5K7HA 5C4XJ 2YVHA 4JX6A 3S2HJ 1JT6A 2HOAA 2OPTA 2GFNA 2WV1A 2O7OA 2JA5J 3E7LA 4DZPA 2DN0A 1DU0A 3HTAA 5D19A 4I6ZA 3BT9A 3MN2A 5EZHA 3O8HA 4EEFG 1WCMJ 1XG1A 2HI3A 4L5EA 2ELKA 3ANPA 5AQCA 2JJ7A 5IP9J 3BNIA 2JA8J 2QIBA 3RH2A 3D1NI 2L7MP 4A3FJ 4JNNA 1ZR4A 2KT0A 3GZIA 1WH5A 3F0CA 1MSFC 4Y52J 4AF5A 2NVYJ 2F07A 3ON2A 3VVXA 1WH7A 2E2JJ 5E3OA 2K9NA 1QVTA 3RZOJ 1ITYA 5JLXA 5K7ZA 2UXOA 3BQYA 2Y9YA 1ETKA 5F0HA 2E2IJ 1AKHB 2JA7J 2G0EA 1HLVA 2YUSA 5IP7J 1ZTRA 1QVUA 3C2BA 4IHYA 5IYDJ 1Y1WJ 1LFBA 4MK6A 1RKTA 1NTCA 3HOVJ 1IRZA 3NXCA 2Y31A 3ZQCA 1IJWC 4XK4A 3ZQIA 3SJMA 4MIMA 5GPAA 3GTJJ 2MGQA 3G1OA 1BL0A 3CJDA 3ZQHA 5H9TA 5IP6A 4PXIA 1B8IB 3PM1A 3T6NA 1MBEA 3V78A 2MG4A 3TP0A 2JWTA 3ZQFA 4UUTA 1Z0XA 2LY9A 4GCKA 4LOCA 2LP0A 4W97A 1OFCX 3A01B 2H1KA 1LE8B 3GTGJ 4C2MJ 1ETVA 5GPCA 3LSPA 1MH4A 3S14J 3P9TA 1RETA 1P7IA 1ETOA 5IYCJ 2B63J 3KKCA 3SFIA 3GTLJ 1IC8A 5CW8A 1W0UA 1MH3A 3CWRA 2CJJA 3F1BA 2LLKA 3A03A 2XPUA 1IV6A 3W6VA 2WUIA 2TRTA 3HTIA 2QKOA 2XB0X 1Z77A 5M3FJ 2X9DA 4QTRA 5EG0B 2ZOZA 2Q24A 2QWTA 2M34A 3C07A 3HTJA 2LFBA 4UDSA 1TWAJ 2DMUA 2L7FP 3JRCA 4M3EA 4C3HJ 2QTQA 1BW6A 4B1RA 1X2MA 1ZR2A 2E1OA 3FK7A 1MBJA 3LSGA 5FMPA 2CQXA 1RKWA 4FE7A 2COBA 4DZJA 2L9RA 5FKNA 4FISA 2IU5A 1GV2A 3B6CA 3CQZJ 2VI6A 3UKGA 5C4JJ
chains in the Genus database with same CATH superfamily
2E1NA 4CZZA 5FFXA 2E35A 2VT3A 1DUXC 3ELKA 3K70C 4HLXA 3KZ9A 4NQWB 2UXUA 1QPMA 5L3FA 1E3HA 1MBGA 1MDMA 4G7ZF 1O7LA 2D1VA 2PJRA 1W7PB 1R1UA 1E2XA 1D8KA 3SZGA 3OOUA 3IH2A 5ILSA 4AC6A 2CFXA 1IGNA 3E5QA 2ZCWA 3A2KA 2K9MA 4XQFA 4U9LA 3FXOA 4IZZA 3EGQA 2HTSA 3C2HA 2LG4A 5J4VA 3WGIA 1WZ2A 1FBUA 2XRLA 3IKTA 4A3CJ 4IHWA 2VBZA 3S1QJ 1ETXA 2RNJA 1NK3P 5CVJA 3U1KA 1RR7A 1TQIA 3EYIA 3G71I 3JSJA 2DT5A 2EFNA 1UG2A 5JR3A 3GTKJ 2VJ5A 1KYZA 1UELB 1BA5A 4EV0A 4A3DJ 3J7AY 3R0JA 5LLQA 1DDNA 1SGMA 2KHMA 2BY2A 1R5GA 2JN6A 3RKWA 2NRAC 2EQRA 1GLNA 1G3YA 2JVGA 4JOMA 1PVEA 5L3DA 2JK3A 3JRGA 2P81A 4C2UA 2R92J 4Q4ZF 1XSXA 1SFUA 3MNLA 3OL3A 4IQJA 3S3MA 4NC8A 2DXIA 1D1BA 4BYYA 5CQGA 4BXXJ 3SZPA 4BQOA 5F1JA 3OYDA 5J4YA 2Z99A 3JRFA 5E3MA 3Q0WA 5L3CA 3IAM2 3RIRA 3MQ0A 1IRFA 1Z9CA 4DGWB 1LDDA 1C0WA 2D45A 3F6VA 3FDYA 1YI2I 1YJWI 1HOMA 2MABA 4XKVA 3FBIB 3V8JA 4LG3A 1XPXA 2QGUA 3M07A 2L0KA 5F6FA 2GUHA 4MFEA 3U21A 2ZMEA 3V7SA 1HDPA 2W4SA 3PPBA 2MFZA 3QPLA 3N97A 4U7DA 5E1XA 3I3LA 2L4AA 5EZGA 4H4KC 2FJI1 1K83J 5B66C 2XAQA 1XGMA 4C2MA 2X0LA 1S3JA 4MO7A 2YVEA 3LNQA 1L0OC 4IRGA 2DTZA 4GGGA 1RPWA 1P7JA 2TDXA 2KRCA 5C4YA 3BLYA 2JVHA 3LQRA 2A68F 2FMLA 2DYSH 1KONA 2IGNA 1PJRA 5J8FA 4GRIA 3WHCA 4F91B 3VIBA 2QVOA 4L9TA 3TO9A 5DCFA 3KKDA 1IDZA 1JUPA 4UVAA 1U3EM 3ON4A 2UXHA 4XOPA 2XAUA 4CH7A 3WTWC 3HSEA 1VF9A 5LHIA 1LVKA 3BTLA 5K58A 1W36D 5CYVA 1IN4A 2ZNZA 2JUCA 2FSWA 4I7HA 3FBNB 2XUBA 3OSGA 1G4DA 5ED4A 1LQ1A 2G7LA 1LE8A 3OS0A 3D5RC 3P7NA 1DP7P 2L3DA 4OIPF 1L3LA 2VODA 3N05A 1IXRC 2QLZA 2CFOA 3ZQGA 3H3ZA 3ML6A 1G8XA 4MGRA 3CF2A 3KE2A 1XB4A 4A3LJ 3WTUC 5HNFA 4A69C 4II2A 2M87A 2WBMA 3IHUA 4Y3OA 4RLQA 2FOWA 2NS7A 3Q3SA 2E7XA 2GA2A 1Z67A 2ZSHB 2W53A 2FF4A 5J40A 2WGBA 5LFAA 2Z2SB 3F9KA 1CQTA 2Z1DA 1O3SA 5EGOB 4CYCB 1R23A 3JSPA 4MTDA 3OYGA 5HAWA 3WTSC 1PP7U 1PP8F 1F36A 4BBSJ 1R7JA 2EIJH 5D5VB 4IVNA 3OOPA 2CV0A 2ZXIA 3PUBA 4M72A 1SD6A 2L54A 4XM3A 1K61A 1PUEE 3IH4A 3M8JA 3E6CC 4BGDA 1ON2A 3AQTA 1SD4A 1FEXA 2R5ZB 2ZY9A 4NQWA 4BEHB 3MZ8A 3A0BC 5DD8A 4ENNA 1OJLA 1TWFJ 2CW7A 2JSPA 5FROA 2HEOA 1DP3A 1EH8A 3GF2A 5F08A 1DQUA 2HPMA 5EFYA 1X3UA 2LR8A 2CUFA 5IY5H 2X51A 4XLEA 1MBHA 2HYTA 4RGSA 3HRSA 3OIQA 4M6YA 1MJBA 1X1AA 3GEZA 3ASOH 3GFJA 2E1CA 1VQ8I 2HDDA 1I6HJ 4KMUX 1TW2A 5F0FA 1AHDP 4B43A 5HS7A 1FP2A 3BJAA 1R4NB 3RKYA 1ERDA 4RAFA 4EJWA 4DYRA 2GIVA 4BHCA 2JMWA 2L9VA 3DEEA 1V55H 1UJ8A 4Z6YA 2X6WA 4RDUA 3WHBA 3KPHA 4A0XA 3GTOJ 1P2FA 5C44J 5FLMJ 4HG2A 2NP5A 3I0TA 1XGOA 1Z6TA 2RREA 3KP2A 2BV6A 2M5WA 2PG4A 3C7JA 3K2AA 3GTQJ 2O8KA 4FX0A 4B8XA 3BJOA 2IBDA 4UB8C 1Y39A 1JTYA 1P9QC 1UI6A 2K4JA 3MEXA 5ICGA 3J80K 4XN0A 4MTEA 2ZJQF 1YQAA 3V6GA 3L2UA 1ZYRF 1SD7A 4HNTA 3LAPA 2BHZA 2Y0SN 1SFEA 3CCQI 4LG0B 1SAXA 4LMYA 3MZHA 5ICFA 5D5UB 2HWVA 2DO7A 2LY1A 3K6GA 3HSRA 1JTXA 5GAHJ 1TT0A 3DTKA 2E34A 3E97A 4OOIA 4BQAA 5DDGA 4BS9A 2WWYA 4M73A 2O7TA 3HJEA 1AOYA 2VC0A 3FXJA 2R7QA 5DM6F 2Z3YA 3KLOA 4LIUA 3KEYA 3FISA 4CGZA 3S1MJ 1Z6RA 2QSGX 3I5UA 3QYBA 4KITB 2UWMA 5JVGF 1BR1A 4JKZA 1D1AA 3RQIA 3DWLE 3W2WA 5DCMB 4PJMA 1X3WB 3I56I 3OYJA 1OR7A 3OYIA 2XPWA 1Z91A 4KNYA 3B73A 2D6YA 4V2FA 3LWJA 3CF5F 2VIXA 4ENMA 4PGGA 2ZJPF 4ABZA 2HVSA 1I27A 4U87A 4UV8A 1ZN2A 4WWCA 1JUSA 1U9OA 2MSYA 4LLLA 4OU0A 4ZH4F 2EB7A 1WRJA 2M0MA 2FOKA 1WJEA 2LD5A 1LPQA 2NVUB 4QSHA 2ZXHA 2A07F 4HKUA 5M5XJ 2ZXJA 1YITI 5FJ8J 1LEAA 2PJPA 3HRMA 1YRNB 2R7XA 4XN3A 4EGZA 2V1XA 4JQFA 2HXIA 1FC3A 3HRUA 3OYKA 2XSJC 2NX4A 3ZMSA 3WTXC 2RKHA 1HXDA 1S8NA 1YYVA 4CHUA 2DAOA 2YX7A 4BHBA 3Q9VA 2R3SA 1W5CC 2FQ4A 2M45A 3MKLA 5BMZA 2NVXJ 1GXPA 2LKSA 5FKMA 2VXZA 3H0DA 2HDCA 4YIRX 4I76A 4BACA 1I6XA 1Y0UA 1VQ5I 1RUOA 2NNYA 1VTNC 1VQKI 4IXAA 2CV2A 3OMYA 3JRHA 3LOCA 2GENA 1LDKB 1MJAA 2DA1A 2OU2A 2Y0SA 3K4CA 1S6LA 2DFHA 4B3AA 4CYCA 1T56A 2LTPA 4BY7J 3HHHA 4J00A 1XGSA 4IHVA 4A12A 4HEA2 3M1CA 4C9YA 4ZDLA 3K70D 2ZNYA 3JTGA 5AONA 2M8GX 1OLTA 3MVPA 1UB9A 1ZKGA 3H5AA 1QRYA 2VJ4A 3U2RA 5E3NA 3G1LA 1QZEA 3CCEI 2R5ZA 3VFZA 5FLVA 4BEHA 1ZGAA 3LL7A 1R6RA 5FKLA 2OI8A 2HYGD 3BG3A 1U0JA 1FLIA 4JX6A 1R71A 1JT6A 4IO9F 1NHAA 1J0RA 2OPTA 1LVAA 3IP4B 3V42A 2P5VA 4QLCU 2WV1A 2NS0A 4KIGA 4M6XA 2P0WA 4HX7A 1DU0A 2L5QA 2GWRA 3O8HA 1WCMJ 1DGRM 1OCZH 5IP9J 5HS8A 3DEUA 2JA8J 4YELA 2CQNA 1WH5A 1FPQA 3F0CA 3GZIA 1T39A 4PDKA 1WI9A 3VVXA 1WH7A 2E2JJ 2K9NA 1ITYA 4C30A 3WODF 2UXOA 4OMZA 2Y9YA 1ETKA 4G6DA 4CCKA 2X1DA 2E2IJ 5CJ9A 2V6CA 2PMHA 1O3TA 5IP7J 4MK6A 3NXCA 3ZQCA 3WTZA 5KK1A 3AKZA 4XK4A 1JXSA 4MIMA 5FD6A 3TDUC 1T8IA 3DFGA 1FT9A 3G1OA 1YIJI 1BL0A 1ZRFA 2R7VA 4RGRA 2V1DA 2M4KA 3V78A 2EFQA 3RCOA 3TP0A 3EDPA 4OD5A 1Z0XA 4RS8A 2FRHA 2LY9A 4LG0A 2OCEA 3T0YA 4LOCA 1WJBA 4W97A 3A01B 1N75A 3VSLA 4C2MJ 2FE3A 2ZXWH 3S14J 3P9TA 1RETA 1P7IA 2F5CA 3KKCA 2JPBA 1FNNA 1CF7B 1G59A 2L02A 2ZFWA 3ECOA 3SWHA 3I71A 3E3VA 2FBHA 4GYIA 2VXDA 1ACIA 1BIAA 2WUIA 2PBIA 3ESWB 4WXDA 3J7ZI 3WGGA 5HLTA 4L9VA 3WTVC 5DCMA 2ZOZA 2QWTA 3C07A 3HTJA 2EV6A 4CDGA 1TL8A 2O61A 4M3EA 4C3HJ 1KQ8A 1BW6A 4B1RA 4E7JA 1MW7A 4GXOA 3MKZA 4XNFA 2EIMH 1ZG5A 1G3TA 1OYYA 1Z21A 2XDVA 3GWZA 4FISA 1YS7A 2W57A 3W6KB 3CQZJ 1SVOA 2DPUA 2JT1A 3QQAA 3BTCA 1I50J 3H5NA 4G6QA 4P1WA 3WE2A 2VKEA 1JI8A 3FKJA 2HTJA 4KISA 1UHSA 3DF8A 3KLNA 4KT6A 4I2OA 3CRJA 2VBWA 4Y15A 1IV8A 5ILVA 3W2VA 4IF4A 1WQ2A 1YG2A 3PNTA 1FJLA 1YRNA 2IPQX 2X6OA 1FY7A 2IS6A 1Z7UA 2YS9A 1J7KA 2W1OA 3TGNA 3DP7A 2LY2A 2O8XA 4U9NA 3COLA 3E6BA 3LFUA 1FMWA 4MEYF 3V7CA 4LD5A 5HSZA 3KYDB 5DD4A 3GZNB 2IS4A 1K6YA 1U8RA 5HDGA 1ZRDA 3CJTB 3O3KA 5J3LA 1GHCA 2JPCA 1FYMA 3OY9A 1QU3A 4NELA 3BC8A 1BJAA 3GLXA 3K7AJ 1TNTA 3V8KA 1UHWA 2HOSA 4L0YB 4JX4A 1AWCA 1LFPA 1QHHD 4QPOA 3D0SA 1Y1VJ 4A0YA 4RB0A 1LB2A 5BPDA 2O9LA 2IS2A 2EBIA 3NRVA 1BJZA 3BR0A 3VVYA 3E6MA 4XRSG 1QGPA 2QKMB 4U7BA 2KJCA 2W82A 1WJCA 4KJZA 2KPMA 4XORA 4X0GA 1K6OA 1KU7A 2K9LA 4Q5SF 5LGNA 3UNGC 2X6YA 4A5NA 4IX7A 2NYXA 3VDXA 4BJTA 5CXIA 1FTTA 2Y75A 1SMYF 1BI2A 1S5LC 2X4HA 4KWAA 3WE3A 1RC9A 3RKQA 1B6AA 5E3LA 1LFUP 2ISZA 2LF8A 2GOMA 5FKOA 4KA4A 1ZQ3P 1EKEA 2PZ9A 4A3GJ 3DKYA 4XLHA 4XLCA 4CZCA 5J1YA 3QWLA 2YU9J 3J80Z 2ZC2A 4AVZA 2VASA 1R49A 4AM3A 3C3WA 2VJIA 3EUPA 2HQNA 4PSWA 4KMFA 2CRGA 3JCUC 3F8BA 4D9JA 2VE9A 1F4KA 5KCMA 2MA3A 5E8GA 1W5SA 3QPTA 2W85A 3B6AA 2PX9A 1MJ9A 2PEXA 3ZCOA 5CVRA 3PFYA 5B1BH 5FHPA 2IEKA 4AIDA 3I4PA 3QAHA 1HKSA 2W7NA 2PLYA 4HNUA 5GTIC 3ZQ7A 2H94A 3KFWX 3HG9A 3TOAA 4XICA 4J01A 4CXFA 1J9IA 2J5OA 2VE8A 2OTJI 3S3OA 5IOZA 1WJDA 4IJAA 5B5EC 3S2DJ 5TGTA 1LJ9A 3CCRI 2HKUA 1XCVA 4O5VA 3A0HC 3VVZA 2R7FA 3G6EI 3J7YJ 3A01A 1ZLKA 1JKPC 1DU6A 3VODA 5ICEA 3H1CA 4FT8A 1IUFA 1YW7A 3K4BA 1WVRA 3PASA 3QYEA 1CF7A 1MNMC 1F43A 4A2UA 3K1PA 1ETQA 1HC8A 4S0HB 1R5ID 3BR3A 4PGHA 4KDPA 3W2AA 4ENKA 4G7HF 2XAJA 3BR5A 2R7TA 2DDAA 3RD3A 3S15J 1K4SA 3OS1A 5K7FA 1MNEA 2ZSIB 4UUSA 3BP8A 2QCOA 2A5YB 1EA3A 2MLKA 1QPIA 1O3QA 3RSNA 4D1QA 1SFOJ 1XS9A 1W5TA 3NAUA 4AVPA 5TJJA 3O60A 1MGTA 4GDFA 3LQQA 4OMYA 2F4IA 4CSWA 2EFWA 3L2RA 2X48A 2H09A 2X1CA 3NWTA 1FOWA 3M4OJ 4EMSA 2VUMJ 1SFKA 2ETHA 4OAZA 5LRSA 3KYCB 2Y0MA 4X1EA 4KYWA 2LSOA 1K79A 4FHTA 3RPUA 1IXSB 3BG6A 4MXMA 2X6XA 1X1PA 2O03A 2Y30A 4MQVA 3DCFA 3EPZA 3REOA 1SFXA 3AG3H 2LC2A 3CLQA 2NXNB 3S1NJ 1A36A 5E8IA 2ECCA 2G7GA 2HVRA 1OYWA 5GAGJ 2KQRA 2PQ8A 3L9FA 3LSKA 3ZOBA 3OL4A 2D1HA 1QHGA 3B02A 1A04A 3B81A 1T08B 3LFKA 4WCGA 3F72A 2BY0A 4BXFA 4NBQA 1RUNA 1FMVA 2LF7A 3FMSA 2W25A 2E2HJ 4HQMA 4NN1A 4B4CA 4YG2F 1HKTA 2XHKA 2XIGA 3KYLA 4X6AJ 1WGXA 5K5QA 3MKWB 2CQKA 2HOTA 3ZMZA 2IAIA 2GBYA 1E17A 3Q5FA 1S72I 1SMTA 2K85A 1N78A 1MMNA 3G3ZA 3K9TA 3IRQA 1H9TA 4OIOF 3VW0A 2GXAA 5M3MJ 2GXGA 1GDTA 1FOXA 5D4SA 2LKXA 2L2OA 5J1UA 4AIKA 3CMYA 3HOSA 3VSKA 3I4MJ 4ITVA 4P55A 4NHJA 1IDYA 4KIFA 5K5RA 4P5OA 2R7SA 1YHQI 2R7UA 4IRHA 2AQEA 1VFCA 2DODA 4C3JJ 3NRGA 3CCVI 4H0EA 5HDKA 3BCBA 3K4NA 5LEJA 3OWTA 2BY3A 1JJ8C 3H3UA 4CCJA 4XBFA 4EQQA 3M3YJ 1OQYA 5B3SH 5IPAA 2JQ7A 2UXPA 4R8HA 5LHHA 2DOAA 3GVAA 1W1WE 1KQ9A 1POGA 2XASA 4BXUA 2HS5A 2UXXA 1MBFA 4GYGA 2AO9A 4XRMA 3AL0B 1T6SA 2W48A 2V4JC 3RJPA 3ULQB 3N4MA 3HOZJ 1Y6IA 2V9PA 3CLOA 4HYEA 5FRMA 4MEXF 5HBUA 2QQAA 3HE0A 3BHQA 4RB3C 2M30A 2B3WA 3P9CA 2KRHA 4XMYA 5EEHA 1MIJA 3BROA 3GUDA 3F23A 4GFLA 4IKFA 3H35A 3EUKL 3CCYA 3RQ4A 3SDBA 1S7AA 2F5FA 5IOYA 2VQHA 1IN5A 2QA4I 3NARA 3ZPLA 1SAUA 2EWNA 2H8WA 1D3YA 4ZTJA 3S16J 1IUYA 2RQPA 4LIVA 2K9SA 2ZB9A 4WF2A 2DOFA 2EFOA 5F64A 3BG5A 4ETSA 3F21A 3CO6C 3BR6A 5D18A 2MYSA 4E7HA 3HGYA 3KP5A 1LUJB 4BAYA 1VQ4I 2P6TA 5KAIC 1JT0A 4I99C 1Q1HA 2XDNA 1JHFA 4DYQA 2DCEA 5H6QA 3HIMA 4AWXB 2DTRA 1T95A 5LBQA 4F93B 1BBYA 3Q0UA 4AIJA 3HIFA 1J09A 2AQFA 3SXYA 2ESNA 2ZCXA 2BVMA 4HZFA 2QM3A 1RRJA 1DGWY 1IG7A 5K5OA 2A6HF 5FD5A 3NI7A 3RDIA 1SVLA 2GLOA 1W7PA 2O5RA 1A6IA 3MKYB 2Y69H 2HYFA 3V4GA 3OYAA 3WG9A 3F6OA 2IA0A 5FKKA 1PDNC 4B44A 3BG7A 2WY7Q 3FWEA 3K10A 3DEWA 2VKDA 3E1SA 1B72B 4UNOA 2GXBA 3LA2A 4E7ZA 2AS5F 4A3BJ 1R9TJ 1DPUA 2M9HA 4PFPA 3HTHA 4XOTA 5JVTA 1HCRA 1FZPB 1ZGJA 4XSZF 1VNDA 2K02A 5L3GA 2J5PA 2A61A 1Q1VA 1T33A 2DBBA 1XGNA 4PUSA 3G2BA 2DA6A 1TC3C 3CC7I 2VQGA 3DXJF 5K7HA 4RB2C 3OYHA 1U2WA 5C4XJ 3S2HJ 4U0WA 2Z33A 2HOAA 1USTA 4P9UA 4RM3A 2CMPA 3FXQA 3BPVA 2ZKZA 2O7OA 2OAZA 4Y13A 2RV8A 5DM7F 4G94A 1S9HA 3BT9A 3K8PC 5EZHA 4BE0A 2HI3A 3JAMK 5K1YA 2M1BA 2EV5A 3ANPA 5AQCA 2BXYA 3S8PA 1H0MA 3VTIA 3IWZA 2QIBA 3RH2A 3QRFF 2Q1ZB 3G73A 3OR1C 2KT0A 1OCOH 1MSFC 2B7EA 2F07A 5D5XB 2XRNA 3AFHA 2FA5A 2GQQA 2UZKA 1QBJA 3RZOJ 5F0HA 2I8DA 3TDZC 1AKHB 2JA7J 4HF1A 2XF5A 1ZTRA 3FXRA 4AIHA 2B0LA 2QBYB 2R7WA 3FM3A 2EV0A 5CVUA 4E70A 1IRZA 4ZC3A 1IJWC 3M9AA 3SJMA 2OZUA 4XKWA 3GTJJ 2ZJRF 2DW4A 2OA4A 2MGQA 3NS4A 5H9TA 1QO0D 2IXSA 1B8IB 3W3CA 4WXCA 2JWTA 4HV5A 2CG4A 1WFXA 2RNGA 3WU2C 2K3PA 4GCKA 1FOKA 2BW3B 2W00A 1Z3YA 2LP0A 2Q2EB 3QP5A 1KQ0A 1STZA 2NAZA 4XKBA 2VT2A 3P9KA 1JE8A 5GPCA 3PSFA 1FYKA 1ETOA 3SFIA 2LBFB 2P7CB 1V5GA 4UV9A 3O6BB 2LKPA 1P6RA 3QU3A 1X4OA 4KN4X 2W24A 3A03A 1EH7A 3OYCA 4TV7A 4RM2A 1IV6A 3W6VA 2XC7A 2TRTA 2F5DA 1XMAA 1OISA 2XB0X 2Q8KA 1XSVA 2X9DA 2Z16A 5EG0B 1A35A 3CJNA 1ZG3A 1VQPI 4YIIA 2LH9A 3ZMTA 1XD7A 2R4GA 4E7IA 1XDUA 2IJLA 4CICA 3GYHX 2A2FX 1BI0A 2E1OA 5FMPA 2JZYA 1RKWA 1IN6A 2COBA 5HNHA 5HDNA 2IU5A 3KZYA 3HTUA 1B9MA 2ADUA 2LOOA 1WJFA 3GCMA 1SC7A 5DUKA 4EJTA 3VP5A 4KIBA 3PNYA 4L9JA 2NVTJ 4N0BA 3GX4X 4R1HA 3J81K 3K4MA 1D5VA 4IL6C 3LJLA 1VI0A 1YX5A 2BY1A 1R1TA 3S2WA 3BR1A 4L18B 3MZYA 4Y33A 2LREA 2QWWA 1TTYA 2HQ5A 4CCLA 2L01A 4XKCA 3H0GJ 3V8LA 2STTA 3HEFA 3L7WA 5EGOA 2H8RA 2IGOA 1ZELA 4GFKA 2KLOA 1MMAA 5BPIA 3HKZN 2BXZA 3FKIJ 2ISYA 1BW5A 5EEGA 1UG0A 4EVIA 1RESA 2N8GA 2XB5A 3HOWJ 4OIQF 2JTVA 3SDGA 2ESHA 4FCYA 3RI4A 4NB5A 3DV8A 3PUFA 3QU6A 3WG7H 1YE9A 2MW8A 3JW4A 5BS6A 4OAYA 3IRRA 2E1MB 3EETA 2ME6A 3CP2A 4M71A 1PYVA 4KUMA 2UXIA 2KIFA 2QUFA 4RGUA 2G7SA 1E0EA 4M74A 1K78B 2MD5A 2EZIA 3PSIA 2A05A 3LSTA 2V79A 4U0VA 4ICHA 2FUG2 1B72A 4AUXA 3BDDA 2AHQA 2CH0A 2VC1A 3FZVA 5ICCA 2M7AA 4BE1A 2KRFA 2R0QC 3TOBA 1D5YA 1MSEC 4D7MA 2H27A 2OC6A 4NDLA 1YFHA 4PJNA 2FU4A 1I3QJ 2OF7A 1KYWA 4AYBA 2UXNA 1R1VA 3EUAA 2DOEA 4BDZA 2DA4A 4XLFA 2ECBA 3BOQA 3CMMA 5E18F 1FSEA 1I1SA 2HKOA 2MC3A 5B1AH 2G3BA 2BHYA 4C3IJ 3AL0C 2RDPA 3G4SI 3VYUB 4N4OB 1MBKA 2EH3A 1U78A 2DT6A 3F8NA 2Y2ZA 4M3BA 1BI1A 4Y7NJ 3K1MA 1W36C 3T8RA 1FP1D 4ZYEA 5FGLA 2JRMA 2R5YB 1ENHA 2JA2A 5EF6A 2IS1A 1PUFB 4BU2A 3OIPA 1EF4A 5IT3A 4ZJZA 2WC2A 9ANTA 5AIPA 5LGUA 4F92B 1AKHA 2E19A 2GIZA 5CXGA 3CCSI 4U0YA 3KETA 2ELHA 4HDUA 2RQQA 1YTYA 2XKOA 1QZZA 2DI3A 1REPC 2EZKA 2CU7A 5KNLA 2M2EA 2PFVA 3GW2A 1BI3A 3CCLI 1ORKA 2HFHA 4RLFA 2KISA 2OJED 1SANA 2BOLA 3HKZA 2C6YA 3RYPA 1GT0C 5IT9K 1MNDA 1RI7A 1RR8C 1J2XA 1HW1A 3H92A 4I98B 3ZQQA 3BTIA 3DPJA 1GVJA 4XL9A 2BW3A 1YS6A 2Q2EA 3HC7A 3GFIA 1XTAA 2L9SA 3HOXJ 2WB1N 1QNTA 2MC4A 3I9V2 1Y0NA 1IRGA 1Z1DA 2QQ8A 2VONA 3PFIA 3T8TA 2HNHA 2F6CA 3M8FA 2CYYA 3QBMA 1M1EB 2LBFA 1R36A 5KHDA 2MLGA 3U1DA 3QYFA 2HKXA 1OKRA 2GAUA 3KP4A 1K7AA 5IYBJ 4HX4A 2F48A 1MMDA 4JK1X 2ME0A 3ANGA 3HZJA 2OERA 4EJVA 1NK2P 3ZGKA 2CQQA 3SZTA 3L00A 4M3FA 3ZMUA 3L2VA 4HA8A 1FBSA 3TO7A 3FXUA 2F5VA 2TCTA 3RPUD 4MFDA 2QEXI 3T1BA 1X19A 2NP3A 2KMUA 3CMAI 2DK8A 3R0AA 1SEUA 4HV6A 2A6EF 3CJQB 2RHAA 3Q0VA 4V2GA 1IRXA 3BJBA 5LHGA 5CPRB 2KFDA 3PIOF 2PMUA 3QOEA 1UI5A 4BBRJ 3HTSB 1ZG1A 3OYMA 1VQLI 3VWBA 2RASA 2GA1A 2QF7A 5FGMA 4AD9A 4BJ6C 3OV8A 4GCTA 1UAAA 1H9GA 2NOGA 2BE5F 1SVMA 4EJUA 2FBQA 2MBFA 3VPRA 4RAGA 2E71A 2ZCMA 2OZ6A 1HKQA 4RAZA 2VLAA 4D7NA 4BHPA 4QPQA 3GFLA 4QWQA 2CSOA 1I39A 2E36A 4I0AA 2JSCA 1QZYA 2YSRA 6PAXA 4B3XA 1NG6A 5D6EA 4JX5A 2BZTA 5JLWA 1WSUA 2DMNA 1T0FA 2WAFA 3WTYC 2E5ZA 5H20A 3AAFA 3MCZA 1FIPA 5J6XA 3FHZA 4NUBA 1ZLJA 2H1LA 1K78A 2A3SA 4P96A 2WB1A 2IGMA 2FJ1A 3JAMZ 2QOPA 3BQZA 3JRDA 4IRVA 3VOXA 4CCOA 3KZZA 1FOYA 4G7OF 2V9VA 1WHUA 2VN2A 3EUHC 4CCNA 4A3JJ 3IL2A 2DMQA 3KP3A 4P9FA 1OYIA 2DA3A 4IQ4A 2I10A 1G2HA 4IRIA 3HRTA 4LLGF 3TW6A 5D8KB 3VYRB 1FBQA 1FTZA 3GTPJ 2XSDC 4JYKA 3DKXA 3K4LA 2WAEA 3IV5A 3FRQA 1IXCA 4E7SA 2XPVA 4B09A 5BQTA 5AIQA 3D5LA 2ZOYA 2XKPA 2OD5A 5FFZA 5D8LB 2NS8A 1JKOC 2HZTA 2ZFUA 2Z9OA 2CO5A 5KAFC 3BY6A 2R5YA 1VQ6I 2IA2A 3JREA 1PUFA 2DG8A 4D5FA 4CCMA 3BZ6A 2PMZN 1O57A 3HOTA 4ZZLA 1S7OA 1JUMA 3CTAA 4M9ZA 3HPHA 3KX2A 2QENA 4NC6A 5LEKA 5D1RA 4A3EJ 3NEUA 1BM9A 3AQSA 2P8TA 1UCRA 1MMSA 2BGCA 2RVCA 4NNJA 4HAMA 3G1MA 1IW7F 1ZAOA 5E1ZB 2KIUA 1QQIA 3GZ6A 2XROA 1P4XA 3E5XA 4CUGA 3BCGA 4XRSA 2RN7A 3L1PA 4ENJA 3A02A 3G7RA 3S32A 1VZ0A 4AC0A 4KFCA 1UHMA 2HYJA 5EEAA 1W7PD 3DTIA 2E1MC 4PZJA 4RMNA 1D8JA 1T0FC 2HOEA 2XGCA 3R4KA 5J8CA 2QQBA 4MNUA 4BL0B 4DW6A 3LSJA 2XVCA 3J81Z 3LAJA 2LK2A 4BKXA 2DT7B 4W1UA 4V19K 3IUOA 1BR4A 5EJCA 1FWZA 4M3DA 2VBYA 3LSRA 3OSFA 3IUVA 1YJ9I 2IA1A 4O6JA 1D0YA 2V6EA 3BR2A 4HOBA 1T2KA 2GM4A 3V7RA 3VYSB 3L2WA 5F27A 1V54H 3S5RA 2OQRA 2EZLA 3S3NA 3GFMA 2ID3A 5L3BA 2L7ZA 2KDOA 4ME9A 4MLOA 3AG1H 4PJLA 3CC4I 1HW2A 2XF6A 3FXKA 1X1CA 2VQLA 2F4OB 2K5CA 3CDHA 4WXHA 4XSXF 3Q9SA 1J75A 3FHNA 3G56A 2DK5A 2CS3A 2JRTA 4O3MA 3CUQB 4XLPF 3FF5A 3FK6A 3L09A 3A1YA 4A6EA 4Q47A 3I59B 1TW3A 4PK4A 1LKXA 3DPUA 3E7LA 2HZDA 2DN0A 4KN7X 3ZMDA 2B1EA 1A6QA 2L7KA 2PMZA 4EEFG 1XG1A 2VOPA 2ELKA 2EK5A 2ZO4A 3BNIA 3OS2A 2QKLB 3CCUI 2L9NA 4A3FJ 1IN7A 1ZR4A 4AF5A 4Y52J 2EJRA 1IZ1A 2NVYJ 4U88A 3ON2A 2A6TA 3CCMI 5E3OA 2QSFX 1XX5A 4BJ5C 5K7ZA 1HSTA 2WA0A 3L2QA 1G3SA 5HVQC 1YLFA 2K27A 3VYTB 2YUSA 1HLVA 3OYLA 1HSJA 5DYMA 1R4MB 4IHYA 3SEZA 3F8MA 4UHTA 3SEQA 1RKTA 3VB2A 5HLGA 5IYDJ 3WU0A 1TP4A 3ECHA 5GPAA 3LSHA 4DQ2A 2X85A 3KP7A 3CJDA 3ZQHA 4PXIA 2DFFA 2FNPA 5F1RA 2MG4A 1XMXA 4HSRA 3CCJI 2YVXA 5FO5A 1OFCX 3DKWA 3QPHA 2K86A 3DPLC 1I1GA 2H1KA 4GO1A 4OIRF 3ISPA 2IP2A 3LSPA 1FYLA 5DUIA 2RC4A 5IYCJ 3IWFA 3K1NA 1W4MA 3LA7A 3GTLJ 1IC8A 4I02A 1AA7A 1W0UA 1MH3A 5ILUA 2CJJA 3C1DA 2LLKA 1X1BA 5IT9Z 3TO6A 3TL4X 2XPUA 1HBXG 2QKOA 4G6TB 1Z77A 3R60A 4QTRA 3ZXSA 5L3EA 3H9JA 2OQGA 2AXTC 3P9IA 1TWAJ 2DMUA 3M7GA 4L9NA 3JRCA 1KU9A 4F3QA 5TRDA 1X2MA 4C2TA 2V26A 1MBJA 3LSGA 1XN7A 3DU6A 3I53A 2L9RA 4LJZF 3HYIA 2Y48A 5JI6A 1WJAA 3MAJA 3K4JA 1GV2A 2P7VB 2VI6A 2LDUA 1Y56A 3KEQA 3O2PE 1OMIA 3R6SA 5C4JJ 1U9NA 2XGDA 2DYRH 2IVMA 1TBXA 2IW5A 3TKYA 5GADJ 1MD0A 2ZCNA 2GOXB 4RBOA 2G9WA 1ULYA 2QSHX 1BOAA 3HPGA 3NWSA 2ELJA 4BQQA 4D5CA 1JGGA 3HOYJ 3BRUA 5C3EJ 3ZN1A 2DQRA 2K40A 3LWFA 4N9IA 1GV5A 2YPRA 5D4RA 1D0ZA 3NQOA 2HGCA 4KT5C 2REKA 4HBLA 3JSOA 3S1RJ 2DPDA 1WJ5A 1VQNI 4IOCF 4CO8A 3R61A 1YW8A 3BTJA 1WI3A 3GO5A 2JA6J 2BYVE 2ZMEC 4A93J 3JRIA 1J59A 4DIQA 2KZVA 2M8EA 2CUJA 2A69F 3JRBA 3H3VK 5D6FA 3HB9A 3PJRA 2FMYA 1GVDA 1OCPA 3ABUA 3T5XA 2F2EA 4M3GA 5FLXK 4GCVA 3C2GA 3GZ5A 1IAWA 4N4NB 4DYCA 1USSA 4BY1J 1VQ7I 3MMYB 5HOOA 3K69A 1R22A 4ZZDA 4ZYGA 2DJNA 2V7FA 3PL8A 4JL3A 4CGRA 1IN8A 3CJRB 1TNSA 1NG7A 2QZ8A 3F3XA 3PIPF 3QOPA 5CVVA 4YFNF 3FX3A 3QODA 5HLHA 4IHXA 4EM1A 3S93A 3I4NJ 2DA5A 2I5UA 2K4BA 3CUQA 4HPQA 3ROUA 4L5JA 4DVYP 1GUUA 3CESA 4JBAA 1YX3A 2V57A 2VPLA 2P6SA 2XAHA 4I0BA 1B1BA 3I59A 3KP6A 4HRIA 2G7UA 2K3FA 4A5MA 3VUQA 1S7EA 3HUGB 2WAQN 2JUGA 4RB1A 5A2QK 1MZBA 4S05A 3I55I 3HL2A 1WPKA 1K4TA 3HBLA 4EM2A 4BDYA 1X58A 1ZHFA 3QPSA 1T98A 2W84A 1V5EA 1MKMA 2ZJ2A 5H6RA 4YRVA 2M7BA 4UXNA 3WU1B 4LFUA 1V3FA 2WY8Q 3VEPA 5EYRA 3W6JB 1A31A 4FASD 1ZH5A 2ID6A 4HX8A 2HXOA 5M5YJ 3F22A 3CC2I 2CWEA 2DA7A 1O7FA 3QP6A 1ON1A 2HU9A 3JRAA 2LVSA 3AG4H 3M1EA 2D2WA 2EFPA 4HF2A 2H6CA 1A5JA 1R5HA 1JGSA 1ZREA 2DQLA 4AYBN 4ON0A 1APLC 1U5TB 3L2CA 2XAFA 4HNVA 3ZP5A 3DBHB 2EA2A 2F4MB 2MH9A 2DG7A 2XGEA 1HA8A 1YO5C 5DTDA 5LGTA 3CUOA 1B4AA 3BZKA 2R7RA 3ZN0A 1X1DA 3FMRA 4HSTA 4L5IA 1ZK8A 1OCTC 4G9YA 1E3OC 5DAJA 3CO7C 4LB6B 4A3IJ 4F7ZA 4BQNA 3WTTC 3EYYA 2ZBKA 3GMEA 2DFEA 4KICA 4F52A 3HDDA 3PO2J 1EV7A 1KU3A 4XRFA 1OCRH 3DLAA 5CQEA 4ESBA 5F0CA 1HF0A 4LLNA 2HQAA 4II3A 1ETWA 1HDDC 3J7AO 4ESFA 1O3RA 3TP3A 4AU7A 5CLSA 3IC7A 3ABKH 4ZYAA 2GZWA 3ABMH 3KNWA 4UVCA 1XMKA 2OTLI 2XF7A 1FIAA 1HQCA 4OINF 2DFIA 1XDSA 4BH9A 1BC7C 1LNWA 4BUPA 3HM5A 3IKVA 4A0ZA 2CGPA 3HHGA 2CV1A 2CUZA 3QKXA 3CUQC 2O0YA 4Y4RA 4PJ0C 2DJIA 4UY8I 2FBIA 1F5TA 2WAQA 2DMTA 4F55A 1WKMA 2FD5A 3OR2C 3VOEA 5TISC 5GTHC 5EDNA 1D1CA 1CGPA 1UZCA 4UUVA 3E7QA 3K0LA 4Q48A 2R7OA 2M0CA 3VW2A 3DU5A 1TWCJ 4EM0B 1ZRCA 1O4XA 1JJ6C 2K9QA 4DNCA 4A3MJ 4EGYA 1UMQA 4FTHA 1R00A 5J47A 2NVQJ 4S04A 2EZHA 2BEOA 1DPRA 2DU9A 2XGXA 2CUEA 2R7ZJ 2MH2A 4D0PA 1H8AC 4JP0A 3ONQA 4YZEA 5JHFA 3GEUA 2KP6A 4J19A 2RAEA 1V5FA 3ASNH 3PNVA 3CDIA 1W0TA 2R93J 3PO3J 3FXMA 2DDBA 2VPRA 1KZHA 5HODA 3JTHA 2DLLA 3ZR8X 1X2NA 1U6GA 2ICWG 1E3PA 1ETYA 1ZARA 2VB6A 1BC8C 3CP8A 3BPXA 3TBIA 1AU7A 1G6NA 2WADA 3H9GA 4RA2A 5GAEJ 3GBGA 3NNRA 1BOBA 2E5NA 3BG9A 3KCCA 3CDLA 1OCCH 2V1NA 3H36A 2XV4S 5E1WA 2YR2A 5JFRA 2VOOA 4ZYDA 4HF0A 4XIDA 3GTMJ 2HDWA 2STWA 2VKVA 2NOJB 4B48A 3FM5A 2KDZA 4YIFA 1OR7C 4UVBA 3GXOA 2IGKA 3ABLH 1U8BA 2VBXA 3LMMA 1GXQA 5HLIA 5FB2A 4A3KJ 2CW0F 2P4WA 4A6DA 4IEJA 1TWGJ 2OUMA 5M5WJ 4MHGA 3VOKA 1ONVA 4PFOA 3ERMA 1KA8A 1VQ9I 4HLYA 2P5KA 2CQ7A 2DA2A 2VKHA 3X2QH 4BE2A 4L0ZB 2EILH 3SYTA 4YEJA 4ESJA 3O8GA 2O6GE 3JR9A 4QIWN 2F5EA 2CW8A 4M9XA 4B47A 1JKQC 4ZDOA 1ZGWA 1T38A 1JKRC 1YOVB 4LB5A 3HUGA 2QBYA 4FE4A 1F1ZA 2AXLA 3FXLA 1RZ4A 2M4GA 3S17J 2X1EA 4CYDA 2VL8A 4I01A 3KEOA 5E79C 4EJOA 3HOUJ 2G7HA 1Y8RB 1FX7A 3ERED 1B8IA 3VW1A 4DBRA 2Q0OA 4OWRB 5ERIA 5DS9A 2WV0A 1IO2A 1G3WA 4RGXA 4IHTA 4PJJA 3NPIA 1VQOI 2K7LA 3H9QA 2Y9ZA 3E0JB 2V1UA 5CVIA 3F8FA 1HW5A 2OCCH 1H88C 3LHQA 2BBYA 5BNGA 1TZLA 2IT0A 4XR6A 3EUHA 3I58A 2HR3A 2R7DA 3KZIC 1XC5A 5F04A 4G12A 1U5TA 5J1RA 1R58A 2VJJA 1B9NA 1N77A 4OD4A 4GCLA 4E6KG 2BVLA 1P4WA 3ABTA 1Z3XA 4PSXA 3FIWA 4UUSB 5BOXA 1MDMB 2FX0A 2PJRB 4YFKF 5EG0A 3ZRGA 4K2EA 5DV5A 2PBXA 2V9KA 1OPCA 3RTRA 1J5YA 4FQGA 3BCAA 4UB6C 1RIOH 4GFBA 4LK1F 2D5VA 4PCQA 1P4AA 2H6BA 4M6VA 3MWMA 1H89C 1EJ9A 4ACIA 3HGGA 5CKTA 5DEQA 2IRFG 1X3ZB 3OIOA 2KL4A 3C18A 3RPQA 3DBRB 3SFZA 3E5UA 5H2FC 2P5LC 4YFXF 3OYEA 3K4KA 2OBPA 4Z2YA 4WIBA 3RZDJ 4M9SA 3BJ6A 3K2ZA 2LNBA 2WTEA 5GP9A 5LRRA 3U9GA 2COMA 5FRNA 3KIOA 4LITA 4HDVA 3I64A 1YW9A 1XCBA 3FMQA 2KKOA 4XONA 1KU2A 1TWHJ 1Z05A 2OV7A 4G8XA 3SHFA 2UUZA 3RYRA 5HS9A 3COAC 4XLNF 3ZQLA 4E7KA 3IH3A 3D5SC 3I54A 3TEDA 2DMPA 4L62A 3LSIA 4IPAA 2KIMA 4MQ9F 3BZCA 3TW7A 1XSDA 1TQMA 3TMOA 2VQCA 4N9HA 5FLXZ 2L4MA 1X4PA 2YU3A 2A5WA 4DJAA 2YVHA 4HQEA 4E4HA 1YJNI 2GFNA 2LRDA 1P92A 2QQ9A 2ZMEB 1BN5A 3IAS2 4R79A 3OYFA 2JA5J 1EH6A 4DZPA 2HQRA 1YIOA 4RAYA 1I3AA 3HTAA 5D19A 3MFKA 2EA4A 2Z5UA 3BWGA 2FXAA 4Y17A 4I6ZA 3MN2A 1RNLA 3F8CA 4FETA 3HXLA 2NNNA 4L5EA 3ZMVA 5LD2C 4ASNA 2PI0A 2JJ7A 5JHUA 2KIQA 3DTEA 1UFMA 2E60A 2FBKA 3D1NI 2L7MP 3DLLF 1TLHB 4JNNA 1SD5A 2HPIA 4FX4A 4IOAF 1QVTA 5JLXA 1U5TC 1ODDA 2RGVA 3BQYA 2G0EA 3E6DA 1I5ZA 4XLAA 4WK8F 1BIBA 2QYOA 5A2QZ 4ZYHA 1QVUA 3C2BA 2FNAA 2KJBA 1LFBA 1Y1WJ 4CA0A 1NTCA 3DBLB 2XAGA 3HOVJ 2Y31A 2EIKH 4DBQA 4E7LA 3ZQIA 2E7WA 3DPTA 3WGHA 1B59A 1F9NA 5E20A 3GLLA 5IP6A 3LSMA 3T6NA 3PM1A 1S29A 1MBEA 1MMGA 2EINH 2LMDA 1Z7LA 2LYCA 4IHSA 1LEBA 3ZQFA 4UUTA 3CMEI 4HW0A 3EQLF 1IF1A 3P5JA 4ANJA 3HSFA 1VQMI 1D0XA 1TQPA 1LE8B 3UR3C 4LK0F 3GTGJ 1ETVA 1TT5B 2ACJA 1MH4A 2O3FA 4BNCA 5KVRA 2B9SA 3MD2A 3CZ6A 2KZGA 2B63J 1KGSA 1Y8QB 2YX4A 2PFBA 3AG2H 1QA6A 4EATA 1FSHA 5CW8A 3RKXA 3CWRA 3F1BA 4I09A 2HVQA 2UV1A 2EPFA 4LGWA 3HTIA 5D5WB 1N25A 1BR2A 3PQJA 3PQKA 5M3FJ 2PN6A 2MD0A 3TQNA 4ZTFA 5E17F 2M34A 2Q24A 1LDJA 2LFBA 1V4RA 4UDSA 2L7FP 3OYBA 3M8EA 2FQ3A 1NH3A 2QTQA 4NC7A 1ZR2A 3FK7A 4WX9A 1JHHA 1WWXA 2CQXA 3OYNA 4FE7A 4DZJA 2FEZA 5FKNA 3H5RA 2M3AA 3SQNA 4DOZA 3B6CA 3LA3A 4ZDPA 3UKGA 3DQVC 3CD6I 3A4CA
chains in the Genus database with same CATH topology
3QQAA 3VP5A 1U9NA 3BTCA 1I50J 2XGDA 2NVTJ 2VKEA 3KZ9A 1UHSA 2ZCNA 4RBOA 3CRJA 2UXUA 3LJLA 1MBGA 1VI0A 3BR1A 1JGGA 3HOYJ 4D5CA 3OOUA 3IH2A 3BRUA 2HQ5A 5C3EJ 4AC6A 1FJLA 1YRNA 2K40A 2X6OA 3H0GJ 1IGNA 3HEFA 5EGOA 1GV5A 2H8RA 2YS9A 4GFKA 2REKA 3EGQA 3HKZN 3COLA 3FKIJ 3S1RJ 1BW5A 5HSZA 3BTJA 1RESA 2N8GA 1WI3A 2XRLA 4IHWA 2XB5A 2JA6J 3HOWJ 3S1QJ 4A3CJ 1ETXA 3SDGA 1NK3P 4A93J 1RR7A 3JRIA 4FCYA 3JSJA 5J3LA 1UG2A 2MW8A 3JRBA 3H3VK 4NELA 3GTKJ 1BA5A 3HB9A 3K7AJ 4A3DJ 1GVDA 2HOSA 1OCPA 4JX4A 2ME6A 1SGMA 2UXIA 4M3GA 2JN6A 2G7SA 1Y1VJ 2EQRA 2O9LA 3JRGA 2JK3A 4DYCA 2EBIA 2EZIA 1BJZA 2P81A 3BR0A 4BY1J 3VVYA 2R92J 4ICHA 4XRSG 3MNLA 2DJNA 4AUXA 1B72A 2AHQA 4BXXJ 4JL3A 2R0QC 4CGRA 1D5YA 5F1JA 4D7MA 1MSEC 3JRFA 4NDLA 5E3MA 3Q0WA 1I3QJ 2OF7A 5CXIA 1FTTA 1HOMA 4IHXA 4KWAA 3I4NJ 2DA5A 3RKQA 5E3LA 1LFUP 2DA4A 1GUUA 5FKOA 2L0KA 2V57A 2ECBA 1ZQ3P 2PZ9A 2GUHA 4MFEA 3PPBA 4A3GJ 3VUQA 1HDPA 1S7EA 2WAQN 2G3BA 4C3IJ 3QPLA 5J1YA 2YU9J 1WPKA 3HBLA 5EZGA 1MBKA 2EH3A 1U78A 1K83J 1X58A 3QPSA 2Y2ZA 4M3BA 4MO7A 4Y7NJ 2YVEA 3LNQA 3EUPA 2DTZA 5FGLA 2CRGA 1RPWA 1P7JA 5C4YA 5EYRA 1ENHA 2R5YB 5EF6A 1PUFB 3B6AA 1EF4A 2ID6A 2HXOA 5M5YJ 9ANTA 2DA7A 5FHPA 1AKHA 2E19A 2IEKA 3JRAA 5CXGA 2LVSA 3WHCA 3VIBA 3KKDA 2EZKA 1IDZA 2CU7A 1A5JA 1JUPA 2M2EA 3ON4A 2UXHA 4XICA 4AYBN 1VF9A 1APLC 1ORKA 3BTLA 5K58A 5IOZA 4HNVA 1SANA 2DG7A 2XGEA 1GT0C 3S2DJ 5DTDA 2HKUA 3DPJA 3OSGA 3BTIA 3VVZA 3A01A 3HOXJ 2WB1N 2G7LA 1ZK8A 1JKPC 1LE8A 1OCTC 1E3OC 5DAJA 1DU6A 4A3IJ 1IUFA 3ZQGA 3PASA 3QBMA 3HDDA 1MNMC 1F43A 4A3LJ 1ETQA 3PO2J 4A69C 4S0HB 3BR3A 5IYBJ 2ME0A 5F0CA 2NS7A 3Q3SA 3ANGA 3BR5A 1HF0A 2OERA 3RD3A 1ETWA 1HDDC 1NK2P 3S15J 5K7FA 3TP3A 2W53A 2CQQA 2WGBA 4UUSA 3KNWA 2QCOA 4M3FA 1CQTA 5EGOB 1QPIA 1FIAA 2TCTA 4MFDA 4CYCB 1XS9A 1SFOJ 3NAUA 5HAWA 2NP3A 3O60A 1F36A 4BBSJ 3HM5A 2X48A 3QKXA 2RHAA 3M4OJ 3Q0VA 2VUMJ 4V2GA 1K61A 3BJBA 4X1EA 3IH4A 2DMTA 2FD5A 3AQTA 1FEXA 2R5ZB 1UI5A 5EDNA 4BBRJ 3E7QA 3VW2A 2M0CA 4MXMA 1TWCJ 2RASA 1O4XA 2Y30A 1OJLA 1TWFJ 2K9QA 2QF7A 1JJ6C 3DCFA 4A3MJ 1UMQA 5F08A 4FTHA 5EFYA 2LR8A 2NVQJ 4GCTA 2CUFA 2EZHA 2FBQA 2NOGA 1MBHA 2CUEA 2R7ZJ 3S1NJ 1H8AC 3VPRA 4JP0A 2ECCA 2G7GA 2HYTA 3GEUA 4YZEA 4J19A 2HDDA 2ZCMA 2RAEA 1I6HJ 4D7NA 3ZOBA 1W0TA 5F0FA 1AHDP 2R93J 3B81A 3PO3J 2VPRA 5HODA 1X2NA 4DYRA 1ETYA 2E2HJ 2JMWA 4NN1A 4B4CA 1AU7A 4JX5A 4X6AJ 3GBGA 5JLWA 4RDUA 3NNRA 3WHBA 1WGXA 2DMNA 3BG9A 3GTOJ 3CDLA 2HOTA 5C44J 5FLMJ 2IAIA 2GBYA 2NP5A 1FIPA 4XIDA 3K2AA 3GTMJ 2O8KA 3GTQJ 2VKVA 3VW0A 2IBDA 2FJ1A 5M3MJ 2KDZA 1JTYA 2QOPA 1GDTA 1UI6A 2LKXA 1U8BA 3BQZA 3JRDA 5J1UA 3VOXA 3V6GA 4A3KJ 3CMYA 4IEJA 3I4MJ 1TWGJ 2Y0SN 5M5WJ 1IDYA 3VOKA 4A3JJ 2DMQA 1JTXA 2DA3A 2DA2A 2I10A 1VFCA 1G2HA 4C3JJ 3O8GA 3NRGA 3JR9A 4QIWN 2O7TA 3TW6A 1FTZA 1JKQC 3GTPJ 1JJ8C 2XSDC 1ZGWA 1JKRC 4JYKA 4FE4A 3FISA 3M3YJ 3S1MJ 5IPAA 3IV5A 3FRQA 2UXPA 2XPVA 3S17J 3HOUJ 2ZOYA 4JKZA 1POGA 3RQIA 1B8IA 3VW1A 2NS8A 5DS9A 1JKOC 1MBFA 2AO9A 2R5YA 4XRMA 3NPIA 3JREA 2Y9ZA 1PUFA 2DG8A 2W48A 4D5FA 3HOZJ 2PMZN 2XPWA 2D6YA 5HBUA 1JUMA 4V2FA 3LWJA 3HE0A 3BHQA 1H88C 3LHQA 5BNGA 5D1RA 4A3EJ 4ABZA 3AQSA 4GFLA 1XC5A 5F04A 4G12A 1JUSA 1U9OA 2MSYA 3CCYA 5J1RA 5IOYA 3G1MA 4GCLA 2LD5A 3NARA 4QSHA 3FIWA 4UUSB 3S16J 2FX0A 2K9SA 2ZB9A 5M5XJ 5EG0A 3BCGA 4XRSA 4HKUA 3L1PA 3A02A 3G7RA 3BG5A 5FJ8J 5D18A 2PBXA 3BR6A 4AC0A 1YRNB 3HGYA 2HYJA 2HXIA 1JT0A 4GFBA 5EEAA 2NX4A 2D5VA 4DYQA 2XDNA 3HIMA 4M6VA 1H89C 4ACIA 3HGGA 2FQ4A 2XGCA 3MKLA 2NVXJ 5FKMA 4DW6A 3OIOA 3LSJA 2LK2A 4BKXA 3Q0UA 4I76A 4W1UA 2ZCXA 4M3DA 3RZDJ 1IG7A 3NI7A 3LSRA 3OSFA 3IUVA 3JRHA 2GLOA 3LOCA 2GENA 2DA1A 3BR2A 5GP9A 1A6IA 2GM4A 5F27A 3S5RA 4B3AA 4CYCA 5FKKA 2EZLA 1T56A 2LTPA 4BY7J 2ID3A 2L7ZA 4IHVA 4ME9A 3DEWA 1B72B 1TWHJ 4MLOA 4A3BJ 2M8GX 3ZQLA 1R9TJ 2M9HA 3MVPA 3IH3A 3HTHA 1ZKGA 3TEDA 1HCRA 2DMPA 1QRYA 4L62A 5E3NA 3G1LA 1VNDA 2R5ZA 5FLVA 3TW7A 3G56A 1Q1VA 1T33A 2DA6A 1TC3C 5FKLA 2OI8A 3FK6A 3BG3A 5K7HA 5C4XJ 2YVHA 4JX6A 3S2HJ 1JT6A 2HOAA 2OPTA 2GFNA 2WV1A 2O7OA 2JA5J 3E7LA 4DZPA 2DN0A 1DU0A 3HTAA 5D19A 4I6ZA 3BT9A 3MN2A 5EZHA 3O8HA 4EEFG 1WCMJ 1XG1A 2HI3A 4L5EA 2ELKA 3ANPA 5AQCA 2JJ7A 5IP9J 3BNIA 2JA8J 2QIBA 3RH2A 3D1NI 2L7MP 4A3FJ 4JNNA 1ZR4A 2KT0A 3GZIA 1WH5A 3F0CA 1MSFC 4Y52J 4AF5A 2NVYJ 2F07A 3ON2A 3VVXA 1WH7A 2E2JJ 5E3OA 2K9NA 1QVTA 3RZOJ 1ITYA 5JLXA 5K7ZA 2UXOA 3BQYA 2Y9YA 1ETKA 5F0HA 2E2IJ 1AKHB 2JA7J 2G0EA 1HLVA 2YUSA 5IP7J 1ZTRA 1QVUA 3C2BA 4IHYA 5IYDJ 1Y1WJ 1LFBA 4MK6A 1RKTA 1NTCA 3HOVJ 1IRZA 3NXCA 2Y31A 3ZQCA 1IJWC 4XK4A 3ZQIA 3SJMA 4MIMA 5GPAA 3GTJJ 2MGQA 3G1OA 1BL0A 3CJDA 3ZQHA 5H9TA 5IP6A 4PXIA 1B8IB 3PM1A 3T6NA 1MBEA 3V78A 2MG4A 3TP0A 2JWTA 3ZQFA 4UUTA 1Z0XA 2LY9A 4GCKA 4LOCA 2LP0A 4W97A 1OFCX 3A01B 2H1KA 1LE8B 3GTGJ 4C2MJ 1ETVA 5GPCA 3LSPA 1MH4A 3S14J 3P9TA 1RETA 1P7IA 1ETOA 5IYCJ 2B63J 3KKCA 3SFIA 3GTLJ 1IC8A 5CW8A 1W0UA 1MH3A 3CWRA 2CJJA 3F1BA 2LLKA 3A03A 2XPUA 1IV6A 3W6VA 2WUIA 2TRTA 3HTIA 2QKOA 2XB0X 1Z77A 5M3FJ 2X9DA 4QTRA 5EG0B 2ZOZA 2Q24A 2QWTA 2M34A 3C07A 3HTJA 2LFBA 4UDSA 1TWAJ 2DMUA 2L7FP 3JRCA 4M3EA 4C3HJ 2QTQA 1BW6A 4B1RA 1X2MA 1ZR2A 2E1OA 3FK7A 1MBJA 3LSGA 5FMPA 2CQXA 1RKWA 4FE7A 2COBA 4DZJA 2L9RA 5FKNA 4FISA 2IU5A 1GV2A 3B6CA 3CQZJ 2VI6A 3UKGA 5C4JJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQA A;  3VP5 A;  1U9N A;  3BTC A;  1I50 J;  2XGD A;  2NVT J;  2VKE A;  3KZ9 A;  1UHS A;  2ZCN A;  4RBO A;  3CRJ A;  2UXU A;  3LJL A;  1MBG A;  1VI0 A;  3BR1 A;  1JGG A;  3HOY J;  4D5C A;  3OOU A;  3IH2 A;  3BRU A;  2HQ5 A;  5C3E J;  4AC6 A;  1FJL A;  1YRN A;  2K40 A;  2X6O A;  3H0G J;  1IGN A;  3HEF A;  5EGO A;  1GV5 A;  2H8R A;  2YS9 A;  4GFK A;  2REK A;  3EGQ A;  3HKZ N;  3COL A;  3FKI J;  3S1R J;  1BW5 A;  5HSZ A;  3BTJ A;  1RES A;  2N8G A;  1WI3 A;  2XRL A;  4IHW A;  2XB5 A;  2JA6 J;  3HOW J;  3S1Q J;  4A3C J;  1ETX A;  3SDG A;  1NK3 P;  4A93 J;  1RR7 A;  3JRI A;  4FCY A;  3JSJ A;  5J3L A;  1UG2 A;  2MW8 A;  3JRB A;  3H3V K;  4NEL A;  3GTK J;  1BA5 A;  3HB9 A;  3K7A J;  4A3D J;  1GVD A;  2HOS A;  1OCP A;  4JX4 A;  2ME6 A;  1SGM A;  2UXI A;  4M3G A;  2JN6 A;  2G7S A;  1Y1V J;  2EQR A;  2O9L A;  3JRG A;  2JK3 A;  4DYC A;  2EBI A;  2EZI A;  1BJZ A;  2P81 A;  3BR0 A;  4BY1 J;  3VVY A;  2R92 J;  4ICH A;  4XRS G;  3MNL A;  2DJN A;  4AUX A;  1B72 A;  2AHQ A;  4BXX J;  4JL3 A;  2R0Q C;  4CGR A;  1D5Y A;  5F1J A;  4D7M A;  1MSE C;  3JRF A;  4NDL A;  5E3M A;  3Q0W A;  1I3Q J;  2OF7 A;  5CXI A;  1FTT A;  1HOM A;  4IHX A;  4KWA A;  3I4N J;  2DA5 A;  3RKQ A;  5E3L A;  1LFU P;  2DA4 A;  1GUU A;  5FKO A;  2L0K A;  2V57 A;  2ECB A;  1ZQ3 P;  2PZ9 A;  2GUH A;  4MFE A;  3PPB A;  4A3G J;  3VUQ A;  1HDP A;  1S7E A;  2WAQ N;  2G3B A;  4C3I J;  3QPL A;  5J1Y A;  2YU9 J;  1WPK A;  3HBL A;  5EZG A;  1MBK A;  2EH3 A;  1U78 A;  1K83 J;  1X58 A;  3QPS A;  2Y2Z A;  4M3B A;  4MO7 A;  4Y7N J;  2YVE A;  3LNQ A;  3EUP A;  2DTZ A;  5FGL A;  2CRG A;  1RPW A;  1P7J A;  5C4Y A;  5EYR A;  1ENH A;  2R5Y B;  5EF6 A;  1PUF B;  3B6A A;  1EF4 A;  2ID6 A;  2HXO A;  5M5Y J;  9ANT A;  2DA7 A;  5FHP A;  1AKH A;  2E19 A;  2IEK A;  3JRA A;  5CXG A;  2LVS A;  3WHC A;  3VIB A;  3KKD A;  2EZK A;  1IDZ A;  2CU7 A;  1A5J A;  1JUP A;  2M2E A;  3ON4 A;  2UXH A;  4XIC A;  4AYB N;  1VF9 A;  1APL C;  1ORK A;  3BTL A;  5K58 A;  5IOZ A;  4HNV A;  1SAN A;  2DG7 A;  2XGE A;  1GT0 C;  3S2D J;  5DTD A;  2HKU A;  3DPJ A;  3OSG A;  3BTI A;  3VVZ A;  3A01 A;  3HOX J;  2WB1 N;  2G7L A;  1ZK8 A;  1JKP C;  1LE8 A;  1OCT C;  1E3O C;  5DAJ A;  1DU6 A;  4A3I J;  1IUF A;  3ZQG A;  3PAS A;  3QBM A;  3HDD A;  1MNM C;  1F43 A;  4A3L J;  1ETQ A;  3PO2 J;  4A69 C;  4S0H B;  3BR3 A;  5IYB J;  2ME0 A;  5F0C A;  2NS7 A;  3Q3S A;  3ANG A;  3BR5 A;  1HF0 A;  2OER A;  3RD3 A;  1ETW A;  1HDD C;  1NK2 P;  3S15 J;  5K7F A;  3TP3 A;  2W53 A;  2CQQ A;  2WGB A;  4UUS A;  3KNW A;  2QCO A;  4M3F A;  1CQT A;  5EGO B;  1QPI A;  1FIA A;  2TCT A;  4MFD A;  4CYC B;  1XS9 A;  1SFO J;  3NAU A;  5HAW A;  2NP3 A;  3O60 A;  1F36 A;  4BBS J;  3HM5 A;  2X48 A;  3QKX A;  2RHA A;  3M4O J;  3Q0V A;  2VUM J;  4V2G A;  1K61 A;  3BJB A;  4X1E A;  3IH4 A;  2DMT A;  2FD5 A;  3AQT A;  1FEX A;  2R5Z B;  1UI5 A;  5EDN A;  4BBR J;  3E7Q A;  3VW2 A;  2M0C A;  4MXM A;  1TWC J;  2RAS A;  1O4X A;  2Y30 A;  1OJL A;  1TWF J;  2K9Q A;  2QF7 A;  1JJ6 C;  3DCF A;  4A3M J;  1UMQ A;  5F08 A;  4FTH A;  5EFY A;  2LR8 A;  2NVQ J;  4GCT A;  2CUF A;  2EZH A;  2FBQ A;  2NOG A;  1MBH A;  2CUE A;  2R7Z J;  3S1N J;  1H8A C;  3VPR A;  4JP0 A;  2ECC A;  2G7G A;  2HYT A;  3GEU A;  4YZE A;  4J19 A;  2HDD A;  2ZCM A;  2RAE A;  1I6H J;  4D7N A;  3ZOB A;  1W0T A;  5F0F A;  1AHD P;  2R93 J;  3B81 A;  3PO3 J;  2VPR A;  5HOD A;  1X2N A;  4DYR A;  1ETY A;  2E2H J;  2JMW A;  4NN1 A;  4B4C A;  1AU7 A;  4JX5 A;  4X6A J;  3GBG A;  5JLW A;  4RDU A;  3NNR A;  3WHB A;  1WGX A;  2DMN A;  3BG9 A;  3GTO J;  3CDL A;  2HOT A;  5C44 J;  5FLM J;  2IAI A;  2GBY A;  2NP5 A;  1FIP A;  4XID A;  3K2A A;  3GTM J;  2O8K A;  3GTQ J;  2VKV A;  3VW0 A;  2IBD A;  2FJ1 A;  5M3M J;  2KDZ A;  1JTY A;  2QOP A;  1GDT A;  1UI6 A;  2LKX A;  1U8B A;  3BQZ A;  3JRD A;  5J1U A;  3VOX A;  3V6G A;  4A3K J;  3CMY A;  4IEJ A;  3I4M J;  1TWG J;  2Y0S N;  5M5W J;  1IDY A;  3VOK A;  4A3J J;  2DMQ A;  1JTX A;  2DA3 A;  2DA2 A;  2I10 A;  1VFC A;  1G2H A;  4C3J J;  3O8G A;  3NRG A;  3JR9 A;  4QIW N;  2O7T A;  3TW6 A;  1FTZ A;  1JKQ C;  3GTP J;  1JJ8 C;  2XSD C;  1ZGW A;  1JKR C;  4JYK A;  4FE4 A;  3FIS A;  3M3Y J;  3S1M J;  5IPA A;  3IV5 A;  3FRQ A;  2UXP A;  2XPV A;  3S17 J;  3HOU J;  2ZOY A;  4JKZ A;  1POG A;  3RQI A;  1B8I A;  3VW1 A;  2NS8 A;  5DS9 A;  1JKO C;  1MBF A;  2AO9 A;  2R5Y A;  4XRM A;  3NPI A;  3JRE A;  2Y9Z A;  1PUF A;  2DG8 A;  2W48 A;  4D5F A;  3HOZ J;  2PMZ N;  2XPW A;  2D6Y A;  5HBU A;  1JUM A;  4V2F A;  3LWJ A;  3HE0 A;  3BHQ A;  1H88 C;  3LHQ A;  5BNG A;  5D1R A;  4A3E J;  4ABZ A;  3AQS A;  4GFL A;  1XC5 A;  5F04 A;  4G12 A;  1JUS A;  1U9O A;  2MSY A;  3CCY A;  5J1R A;  5IOY A;  3G1M A;  4GCL A;  2LD5 A;  3NAR A;  4QSH A;  3FIW A;  4UUS B;  3S16 J;  2FX0 A;  2K9S A;  2ZB9 A;  5M5X J;  5EG0 A;  3BCG A;  4XRS A;  4HKU A;  3L1P A;  3A02 A;  3G7R A;  3BG5 A;  5FJ8 J;  5D18 A;  2PBX A;  3BR6 A;  4AC0 A;  1YRN B;  3HGY A;  2HYJ A;  2HXI A;  1JT0 A;  4GFB A;  5EEA A;  2NX4 A;  2D5V A;  4DYQ A;  2XDN A;  3HIM A;  4M6V A;  1H89 C;  4ACI A;  3HGG A;  2FQ4 A;  2XGC A;  3MKL A;  2NVX J;  5FKM A;  4DW6 A;  3OIO A;  3LSJ A;  2LK2 A;  4BKX A;  3Q0U A;  4I76 A;  4W1U A;  2ZCX A;  4M3D A;  3RZD J;  1IG7 A;  3NI7 A;  3LSR A;  3OSF A;  3IUV A;  3JRH A;  2GLO A;  3LOC A;  2GEN A;  2DA1 A;  3BR2 A;  5GP9 A;  1A6I A;  2GM4 A;  5F27 A;  3S5R A;  4B3A A;  4CYC A;  5FKK A;  2EZL A;  1T56 A;  2LTP A;  4BY7 J;  2ID3 A;  2L7Z A;  4IHV A;  4ME9 A;  3DEW A;  1B72 B;  1TWH J;  4MLO A;  4A3B J;  2M8G X;  3ZQL A;  1R9T J;  2M9H A;  3MVP A;  3IH3 A;  3HTH A;  1ZKG A;  3TED A;  1HCR A;  2DMP A;  1QRY A;  4L62 A;  5E3N A;  3G1L A;  1VND A;  2R5Z A;  5FLV A;  3TW7 A;  3G56 A;  1Q1V A;  1T33 A;  2DA6 A;  1TC3 C;  5FKL A;  2OI8 A;  3FK6 A;  3BG3 A;  5K7H A;  5C4X J;  2YVH A;  4JX6 A;  3S2H J;  1JT6 A;  2HOA A;  2OPT A;  2GFN A;  2WV1 A;  2O7O A;  2JA5 J;  3E7L A;  4DZP A;  2DN0 A;  1DU0 A;  3HTA A;  5D19 A;  4I6Z A;  3BT9 A;  3MN2 A;  5EZH A;  3O8H A;  4EEF G;  1WCM J;  1XG1 A;  2HI3 A;  4L5E A;  2ELK A;  3ANP A;  5AQC A;  2JJ7 A;  5IP9 J;  3BNI A;  2JA8 J;  2QIB A;  3RH2 A;  3D1N I;  2L7M P;  4A3F J;  4JNN A;  1ZR4 A;  2KT0 A;  3GZI A;  1WH5 A;  3F0C A;  1MSF C;  4Y52 J;  4AF5 A;  2NVY J;  2F07 A;  3ON2 A;  3VVX A;  1WH7 A;  2E2J J;  5E3O A;  2K9N A;  1QVT A;  3RZO J;  1ITY A;  5JLX A;  5K7Z A;  2UXO A;  3BQY A;  2Y9Y A;  1ETK A;  5F0H A;  2E2I J;  1AKH B;  2JA7 J;  2G0E A;  1HLV A;  2YUS A;  5IP7 J;  1ZTR A;  1QVU A;  3C2B A;  4IHY A;  5IYD J;  1Y1W J;  1LFB A;  4MK6 A;  1RKT A;  1NTC A;  3HOV J;  1IRZ A;  3NXC A;  2Y31 A;  3ZQC A;  1IJW C;  4XK4 A;  3ZQI A;  3SJM A;  4MIM A;  5GPA A;  3GTJ J;  2MGQ A;  3G1O A;  1BL0 A;  3CJD A;  3ZQH A;  5H9T A;  5IP6 A;  4PXI A;  1B8I B;  3PM1 A;  3T6N A;  1MBE A;  3V78 A;  2MG4 A;  3TP0 A;  2JWT A;  3ZQF A;  4UUT A;  1Z0X A;  2LY9 A;  4GCK A;  4LOC A;  2LP0 A;  4W97 A;  1OFC X;  3A01 B;  2H1K A;  1LE8 B;  3GTG J;  4C2M J;  1ETV A;  5GPC A;  3LSP A;  1MH4 A;  3S14 J;  3P9T A;  1RET A;  1P7I A;  1ETO A;  5IYC J;  2B63 J;  3KKC A;  3SFI A;  3GTL J;  1IC8 A;  5CW8 A;  1W0U A;  1MH3 A;  3CWR A;  2CJJ A;  3F1B A;  2LLK A;  3A03 A;  2XPU A;  1IV6 A;  3W6V A;  2WUI A;  2TRT A;  3HTI A;  2QKO A;  2XB0 X;  1Z77 A;  5M3F J;  2X9D A;  4QTR A;  5EG0 B;  2ZOZ A;  2Q24 A;  2QWT A;  2M34 A;  3C07 A;  3HTJ A;  2LFB A;  4UDS A;  1TWA J;  2DMU A;  2L7F P;  3JRC A;  4M3E A;  4C3H J;  2QTQ A;  1BW6 A;  4B1R A;  1X2M A;  1ZR2 A;  2E1O A;  3FK7 A;  1MBJ A;  3LSG A;  5FMP A;  2CQX A;  1RKW A;  4FE7 A;  2COB A;  4DZJ A;  2L9R A;  5FKN A;  4FIS A;  2IU5 A;  1GV2 A;  3B6C A;  3CQZ J;  2VI6 A;  3UKG A;  5C4J J; 
#chains in the Genus database with same CATH topology
 2E1N A;  4CZZ A;  5FFX A;  2E35 A;  2VT3 A;  1DUX C;  3ELK A;  3K70 C;  4HLX A;  3KZ9 A;  4NQW B;  2UXU A;  1QPM A;  5L3F A;  1E3H A;  1MBG A;  1MDM A;  4G7Z F;  1O7L A;  2D1V A;  2PJR A;  1W7P B;  1R1U A;  1E2X A;  1D8K A;  3SZG A;  3OOU A;  3IH2 A;  5ILS A;  4AC6 A;  2CFX A;  1IGN A;  3E5Q A;  2ZCW A;  3A2K A;  2K9M A;  4XQF A;  4U9L A;  3FXO A;  4IZZ A;  3EGQ A;  2HTS A;  3C2H A;  2LG4 A;  5J4V A;  3WGI A;  1WZ2 A;  1FBU A;  2XRL A;  3IKT A;  4A3C J;  4IHW A;  2VBZ A;  3S1Q J;  1ETX A;  2RNJ A;  1NK3 P;  5CVJ A;  3U1K A;  1RR7 A;  1TQI A;  3EYI A;  3G71 I;  3JSJ A;  2DT5 A;  2EFN A;  1UG2 A;  5JR3 A;  3GTK J;  2VJ5 A;  1KYZ A;  1UEL B;  1BA5 A;  4EV0 A;  4A3D J;  3J7A Y;  3R0J A;  5LLQ A;  1DDN A;  1SGM A;  2KHM A;  2BY2 A;  1R5G A;  2JN6 A;  3RKW A;  2NRA C;  2EQR A;  1GLN A;  1G3Y A;  2JVG A;  4JOM A;  1PVE A;  5L3D A;  2JK3 A;  3JRG A;  2P81 A;  4C2U A;  2R92 J;  4Q4Z F;  1XSX A;  1SFU A;  3MNL A;  3OL3 A;  4IQJ A;  3S3M A;  4NC8 A;  2DXI A;  1D1B A;  4BYY A;  5CQG A;  4BXX J;  3SZP A;  4BQO A;  5F1J A;  3OYD A;  5J4Y A;  2Z99 A;  3JRF A;  5E3M A;  3Q0W A;  5L3C A;  3IAM 2;  3RIR A;  3MQ0 A;  1IRF A;  1Z9C A;  4DGW B;  1LDD A;  1C0W A;  2D45 A;  3F6V A;  3FDY A;  1YI2 I;  1YJW I;  1HOM A;  2MAB A;  4XKV A;  3FBI B;  3V8J A;  4LG3 A;  1XPX A;  2QGU A;  3M07 A;  2L0K A;  5F6F A;  2GUH A;  4MFE A;  3U21 A;  2ZME A;  3V7S A;  1HDP A;  2W4S A;  3PPB A;  2MFZ A;  3QPL A;  3N97 A;  4U7D A;  5E1X A;  3I3L A;  2L4A A;  5EZG A;  4H4K C;  2FJI 1;  1K83 J;  5B66 C;  2XAQ A;  1XGM A;  4C2M A;  2X0L A;  1S3J A;  4MO7 A;  2YVE A;  3LNQ A;  1L0O C;  4IRG A;  2DTZ A;  4GGG A;  1RPW A;  1P7J A;  2TDX A;  2KRC A;  5C4Y A;  3BLY A;  2JVH A;  3LQR A;  2A68 F;  2FML A;  2DYS H;  1KON A;  2IGN A;  1PJR A;  5J8F A;  4GRI A;  3WHC A;  4F91 B;  3VIB A;  2QVO A;  4L9T A;  3TO9 A;  5DCF A;  3KKD A;  1IDZ A;  1JUP A;  4UVA A;  1U3E M;  3ON4 A;  2UXH A;  4XOP A;  2XAU A;  4CH7 A;  3WTW C;  3HSE A;  1VF9 A;  5LHI A;  1LVK A;  3BTL A;  5K58 A;  1W36 D;  5CYV A;  1IN4 A;  2ZNZ A;  2JUC A;  2FSW A;  4I7H A;  3FBN B;  2XUB A;  3OSG A;  1G4D A;  5ED4 A;  1LQ1 A;  2G7L A;  1LE8 A;  3OS0 A;  3D5R C;  3P7N A;  1DP7 P;  2L3D A;  4OIP F;  1L3L A;  2VOD A;  3N05 A;  1IXR C;  2QLZ A;  2CFO A;  3ZQG A;  3H3Z A;  3ML6 A;  1G8X A;  4MGR A;  3CF2 A;  3KE2 A;  1XB4 A;  4A3L J;  3WTU C;  5HNF A;  4A69 C;  4II2 A;  2M87 A;  2WBM A;  3IHU A;  4Y3O A;  4RLQ A;  2FOW A;  2NS7 A;  3Q3S A;  2E7X A;  2GA2 A;  1Z67 A;  2ZSH B;  2W53 A;  2FF4 A;  5J40 A;  2WGB A;  5LFA A;  2Z2S B;  3F9K A;  1CQT A;  2Z1D A;  1O3S A;  5EGO B;  4CYC B;  1R23 A;  3JSP A;  4MTD A;  3OYG A;  5HAW A;  3WTS C;  1PP7 U;  1PP8 F;  1F36 A;  4BBS J;  1R7J A;  2EIJ H;  5D5V B;  4IVN A;  3OOP A;  2CV0 A;  2ZXI A;  3PUB A;  4M72 A;  1SD6 A;  2L54 A;  4XM3 A;  1K61 A;  1PUE E;  3IH4 A;  3M8J A;  3E6C C;  4BGD A;  1ON2 A;  3AQT A;  1SD4 A;  1FEX A;  2R5Z B;  2ZY9 A;  4NQW A;  4BEH B;  3MZ8 A;  3A0B C;  5DD8 A;  4ENN A;  1OJL A;  1TWF J;  2CW7 A;  2JSP A;  5FRO A;  2HEO A;  1DP3 A;  1EH8 A;  3GF2 A;  5F08 A;  1DQU A;  2HPM A;  5EFY A;  1X3U A;  2LR8 A;  2CUF A;  5IY5 H;  2X51 A;  4XLE A;  1MBH A;  2HYT A;  4RGS A;  3HRS A;  3OIQ A;  4M6Y A;  1MJB A;  1X1A A;  3GEZ A;  3ASO H;  3GFJ A;  2E1C A;  1VQ8 I;  2HDD A;  1I6H J;  4KMU X;  1TW2 A;  5F0F A;  1AHD P;  4B43 A;  5HS7 A;  1FP2 A;  3BJA A;  1R4N B;  3RKY A;  1ERD A;  4RAF A;  4EJW A;  4DYR A;  2GIV A;  4BHC A;  2JMW A;  2L9V A;  3DEE A;  1V55 H;  1UJ8 A;  4Z6Y A;  2X6W A;  4RDU A;  3WHB A;  3KPH A;  4A0X A;  3GTO J;  1P2F A;  5C44 J;  5FLM J;  4HG2 A;  2NP5 A;  3I0T A;  1XGO A;  1Z6T A;  2RRE A;  3KP2 A;  2BV6 A;  2M5W A;  2PG4 A;  3C7J A;  3K2A A;  3GTQ J;  2O8K A;  4FX0 A;  4B8X A;  3BJO A;  2IBD A;  4UB8 C;  1Y39 A;  1JTY A;  1P9Q C;  1UI6 A;  2K4J A;  3MEX A;  5ICG A;  3J80 K;  4XN0 A;  4MTE A;  2ZJQ F;  1YQA A;  3V6G A;  3L2U A;  1ZYR F;  1SD7 A;  4HNT A;  3LAP A;  2BHZ A;  2Y0S N;  1SFE A;  3CCQ I;  4LG0 B;  1SAX A;  4LMY A;  3MZH A;  5ICF A;  5D5U B;  2HWV A;  2DO7 A;  2LY1 A;  3K6G A;  3HSR A;  1JTX A;  5GAH J;  1TT0 A;  3DTK A;  2E34 A;  3E97 A;  4OOI A;  4BQA A;  5DDG A;  4BS9 A;  2WWY A;  4M73 A;  2O7T A;  3HJE A;  1AOY A;  2VC0 A;  3FXJ A;  2R7Q A;  5DM6 F;  2Z3Y A;  3KLO A;  4LIU A;  3KEY A;  3FIS A;  4CGZ A;  3S1M J;  1Z6R A;  2QSG X;  3I5U A;  3QYB A;  4KIT B;  2UWM A;  5JVG F;  1BR1 A;  4JKZ A;  1D1A A;  3RQI A;  3DWL E;  3W2W A;  5DCM B;  4PJM A;  1X3W B;  3I56 I;  3OYJ A;  1OR7 A;  3OYI A;  2XPW A;  1Z91 A;  4KNY A;  3B73 A;  2D6Y A;  4V2F A;  3LWJ A;  3CF5 F;  2VIX A;  4ENM A;  4PGG A;  2ZJP F;  4ABZ A;  2HVS A;  1I27 A;  4U87 A;  4UV8 A;  1ZN2 A;  4WWC A;  1JUS A;  1U9O A;  2MSY A;  4LLL A;  4OU0 A;  4ZH4 F;  2EB7 A;  1WRJ A;  2M0M A;  2FOK A;  1WJE A;  2LD5 A;  1LPQ A;  2NVU B;  4QSH A;  2ZXH A;  2A07 F;  4HKU A;  5M5X J;  2ZXJ A;  1YIT I;  5FJ8 J;  1LEA A;  2PJP A;  3HRM A;  1YRN B;  2R7X A;  4XN3 A;  4EGZ A;  2V1X A;  4JQF A;  2HXI A;  1FC3 A;  3HRU A;  3OYK A;  2XSJ C;  2NX4 A;  3ZMS A;  3WTX C;  2RKH A;  1HXD A;  1S8N A;  1YYV A;  4CHU A;  2DAO A;  2YX7 A;  4BHB A;  3Q9V A;  2R3S A;  1W5C C;  2FQ4 A;  2M45 A;  3MKL A;  5BMZ A;  2NVX J;  1GXP A;  2LKS A;  5FKM A;  2VXZ A;  3H0D A;  2HDC A;  4YIR X;  4I76 A;  4BAC A;  1I6X A;  1Y0U A;  1VQ5 I;  1RUO A;  2NNY A;  1VTN C;  1VQK I;  4IXA A;  2CV2 A;  3OMY A;  3JRH A;  3LOC A;  2GEN A;  1LDK B;  1MJA A;  2DA1 A;  2OU2 A;  2Y0S A;  3K4C A;  1S6L A;  2DFH A;  4B3A A;  4CYC A;  1T56 A;  2LTP A;  4BY7 J;  3HHH A;  4J00 A;  1XGS A;  4IHV A;  4A12 A;  4HEA 2;  3M1C A;  4C9Y A;  4ZDL A;  3K70 D;  2ZNY A;  3JTG A;  5AON A;  2M8G X;  1OLT A;  3MVP A;  1UB9 A;  1ZKG A;  3H5A A;  1QRY A;  2VJ4 A;  3U2R A;  5E3N A;  3G1L A;  1QZE A;  3CCE I;  2R5Z A;  3VFZ A;  5FLV A;  4BEH A;  1ZGA A;  3LL7 A;  1R6R A;  5FKL A;  2OI8 A;  2HYG D;  3BG3 A;  1U0J A;  1FLI A;  4JX6 A;  1R71 A;  1JT6 A;  4IO9 F;  1NHA A;  1J0R A;  2OPT A;  1LVA A;  3IP4 B;  3V42 A;  2P5V A;  4QLC U;  2WV1 A;  2NS0 A;  4KIG A;  4M6X A;  2P0W A;  4HX7 A;  1DU0 A;  2L5Q A;  2GWR A;  3O8H A;  1WCM J;  1DGR M;  1OCZ H;  5IP9 J;  5HS8 A;  3DEU A;  2JA8 J;  4YEL A;  2CQN A;  1WH5 A;  1FPQ A;  3F0C A;  3GZI A;  1T39 A;  4PDK A;  1WI9 A;  3VVX A;  1WH7 A;  2E2J J;  2K9N A;  1ITY A;  4C30 A;  3WOD F;  2UXO A;  4OMZ A;  2Y9Y A;  1ETK A;  4G6D A;  4CCK A;  2X1D A;  2E2I J;  5CJ9 A;  2V6C A;  2PMH A;  1O3T A;  5IP7 J;  4MK6 A;  3NXC A;  3ZQC A;  3WTZ A;  5KK1 A;  3AKZ A;  4XK4 A;  1JXS A;  4MIM A;  5FD6 A;  3TDU C;  1T8I A;  3DFG A;  1FT9 A;  3G1O A;  1YIJ I;  1BL0 A;  1ZRF A;  2R7V A;  4RGR A;  2V1D A;  2M4K A;  3V78 A;  2EFQ A;  3RCO A;  3TP0 A;  3EDP A;  4OD5 A;  1Z0X A;  4RS8 A;  2FRH A;  2LY9 A;  4LG0 A;  2OCE A;  3T0Y A;  4LOC A;  1WJB A;  4W97 A;  3A01 B;  1N75 A;  3VSL A;  4C2M J;  2FE3 A;  2ZXW H;  3S14 J;  3P9T A;  1RET A;  1P7I A;  2F5C A;  3KKC A;  2JPB A;  1FNN A;  1CF7 B;  1G59 A;  2L02 A;  2ZFW A;  3ECO A;  3SWH A;  3I71 A;  3E3V A;  2FBH A;  4GYI A;  2VXD A;  1ACI A;  1BIA A;  2WUI A;  2PBI A;  3ESW B;  4WXD A;  3J7Z I;  3WGG A;  5HLT A;  4L9V A;  3WTV C;  5DCM A;  2ZOZ A;  2QWT A;  3C07 A;  3HTJ A;  2EV6 A;  4CDG A;  1TL8 A;  2O61 A;  4M3E A;  4C3H J;  1KQ8 A;  1BW6 A;  4B1R A;  4E7J A;  1MW7 A;  4GXO A;  3MKZ A;  4XNF A;  2EIM H;  1ZG5 A;  1G3T A;  1OYY A;  1Z21 A;  2XDV A;  3GWZ A;  4FIS A;  1YS7 A;  2W57 A;  3W6K B;  3CQZ J;  1SVO A;  2DPU A;  2JT1 A;  3QQA A;  3BTC A;  1I50 J;  3H5N A;  4G6Q A;  4P1W A;  3WE2 A;  2VKE A;  1JI8 A;  3FKJ A;  2HTJ A;  4KIS A;  1UHS A;  3DF8 A;  3KLN A;  4KT6 A;  4I2O A;  3CRJ A;  2VBW A;  4Y15 A;  1IV8 A;  5ILV A;  3W2V A;  4IF4 A;  1WQ2 A;  1YG2 A;  3PNT A;  1FJL A;  1YRN A;  2IPQ X;  2X6O A;  1FY7 A;  2IS6 A;  1Z7U A;  2YS9 A;  1J7K A;  2W1O A;  3TGN A;  3DP7 A;  2LY2 A;  2O8X A;  4U9N A;  3COL A;  3E6B A;  3LFU A;  1FMW A;  4MEY F;  3V7C A;  4LD5 A;  5HSZ A;  3KYD B;  5DD4 A;  3GZN B;  2IS4 A;  1K6Y A;  1U8R A;  5HDG A;  1ZRD A;  3CJT B;  3O3K A;  5J3L A;  1GHC A;  2JPC A;  1FYM A;  3OY9 A;  1QU3 A;  4NEL A;  3BC8 A;  1BJA A;  3GLX A;  3K7A J;  1TNT A;  3V8K A;  1UHW A;  2HOS A;  4L0Y B;  4JX4 A;  1AWC A;  1LFP A;  1QHH D;  4QPO A;  3D0S A;  1Y1V J;  4A0Y A;  4RB0 A;  1LB2 A;  5BPD A;  2O9L A;  2IS2 A;  2EBI A;  3NRV A;  1BJZ A;  3BR0 A;  3VVY A;  3E6M A;  4XRS G;  1QGP A;  2QKM B;  4U7B A;  2KJC A;  2W82 A;  1WJC A;  4KJZ A;  2KPM A;  4XOR A;  4X0G A;  1K6O A;  1KU7 A;  2K9L A;  4Q5S F;  5LGN A;  3UNG C;  2X6Y A;  4A5N A;  4IX7 A;  2NYX A;  3VDX A;  4BJT A;  5CXI A;  1FTT A;  2Y75 A;  1SMY F;  1BI2 A;  1S5L C;  2X4H A;  4KWA A;  3WE3 A;  1RC9 A;  3RKQ A;  1B6A A;  5E3L A;  1LFU P;  2ISZ A;  2LF8 A;  2GOM A;  5FKO A;  4KA4 A;  1ZQ3 P;  1EKE A;  2PZ9 A;  4A3G J;  3DKY A;  4XLH A;  4XLC A;  4CZC A;  5J1Y A;  3QWL A;  2YU9 J;  3J80 Z;  2ZC2 A;  4AVZ A;  2VAS A;  1R49 A;  4AM3 A;  3C3W A;  2VJI A;  3EUP A;  2HQN A;  4PSW A;  4KMF A;  2CRG A;  3JCU C;  3F8B A;  4D9J A;  2VE9 A;  1F4K A;  5KCM A;  2MA3 A;  5E8G A;  1W5S A;  3QPT A;  2W85 A;  3B6A A;  2PX9 A;  1MJ9 A;  2PEX A;  3ZCO A;  5CVR A;  3PFY A;  5B1B H;  5FHP A;  2IEK A;  4AID A;  3I4P A;  3QAH A;  1HKS A;  2W7N A;  2PLY A;  4HNU A;  5GTI C;  3ZQ7 A;  2H94 A;  3KFW X;  3HG9 A;  3TOA A;  4XIC A;  4J01 A;  4CXF A;  1J9I A;  2J5O A;  2VE8 A;  2OTJ I;  3S3O A;  5IOZ A;  1WJD A;  4IJA A;  5B5E C;  3S2D J;  5TGT A;  1LJ9 A;  3CCR I;  2HKU A;  1XCV A;  4O5V A;  3A0H C;  3VVZ A;  2R7F A;  3G6E I;  3J7Y J;  3A01 A;  1ZLK A;  1JKP C;  1DU6 A;  3VOD A;  5ICE A;  3H1C A;  4FT8 A;  1IUF A;  1YW7 A;  3K4B A;  1WVR A;  3PAS A;  3QYE A;  1CF7 A;  1MNM C;  1F43 A;  4A2U A;  3K1P A;  1ETQ A;  1HC8 A;  4S0H B;  1R5I D;  3BR3 A;  4PGH A;  4KDP A;  3W2A A;  4ENK A;  4G7H F;  2XAJ A;  3BR5 A;  2R7T A;  2DDA A;  3RD3 A;  3S15 J;  1K4S A;  3OS1 A;  5K7F A;  1MNE A;  2ZSI B;  4UUS A;  3BP8 A;  2QCO A;  2A5Y B;  1EA3 A;  2MLK A;  1QPI A;  1O3Q A;  3RSN A;  4D1Q A;  1SFO J;  1XS9 A;  1W5T A;  3NAU A;  4AVP A;  5TJJ A;  3O60 A;  1MGT A;  4GDF A;  3LQQ A;  4OMY A;  2F4I A;  4CSW A;  2EFW A;  3L2R A;  2X48 A;  2H09 A;  2X1C A;  3NWT A;  1FOW A;  3M4O J;  4EMS A;  2VUM J;  1SFK A;  2ETH A;  4OAZ A;  5LRS A;  3KYC B;  2Y0M A;  4X1E A;  4KYW A;  2LSO A;  1K79 A;  4FHT A;  3RPU A;  1IXS B;  3BG6 A;  4MXM A;  2X6X A;  1X1P A;  2O03 A;  2Y30 A;  4MQV A;  3DCF A;  3EPZ A;  3REO A;  1SFX A;  3AG3 H;  2LC2 A;  3CLQ A;  2NXN B;  3S1N J;  1A36 A;  5E8I A;  2ECC A;  2G7G A;  2HVR A;  1OYW A;  5GAG J;  2KQR A;  2PQ8 A;  3L9F A;  3LSK A;  3ZOB A;  3OL4 A;  2D1H A;  1QHG A;  3B02 A;  1A04 A;  3B81 A;  1T08 B;  3LFK A;  4WCG A;  3F72 A;  2BY0 A;  4BXF A;  4NBQ A;  1RUN A;  1FMV A;  2LF7 A;  3FMS A;  2W25 A;  2E2H J;  4HQM A;  4NN1 A;  4B4C A;  4YG2 F;  1HKT A;  2XHK A;  2XIG A;  3KYL A;  4X6A J;  1WGX A;  5K5Q A;  3MKW B;  2CQK A;  2HOT A;  3ZMZ A;  2IAI A;  2GBY A;  1E17 A;  3Q5F A;  1S72 I;  1SMT A;  2K85 A;  1N78 A;  1MMN A;  3G3Z A;  3K9T A;  3IRQ A;  1H9T A;  4OIO F;  3VW0 A;  2GXA A;  5M3M J;  2GXG A;  1GDT A;  1FOX A;  5D4S A;  2LKX A;  2L2O A;  5J1U A;  4AIK A;  3CMY A;  3HOS A;  3VSK A;  3I4M J;  4ITV A;  4P55 A;  4NHJ A;  1IDY A;  4KIF A;  5K5R A;  4P5O A;  2R7S A;  1YHQ I;  2R7U A;  4IRH A;  2AQE A;  1VFC A;  2DOD A;  4C3J J;  3NRG A;  3CCV I;  4H0E A;  5HDK A;  3BCB A;  3K4N A;  5LEJ A;  3OWT A;  2BY3 A;  1JJ8 C;  3H3U A;  4CCJ A;  4XBF A;  4EQQ A;  3M3Y J;  1OQY A;  5B3S H;  5IPA A;  2JQ7 A;  2UXP A;  4R8H A;  5LHH A;  2DOA A;  3GVA A;  1W1W E;  1KQ9 A;  1POG A;  2XAS A;  4BXU A;  2HS5 A;  2UXX A;  1MBF A;  4GYG A;  2AO9 A;  4XRM A;  3AL0 B;  1T6S A;  2W48 A;  2V4J C;  3RJP A;  3ULQ B;  3N4M A;  3HOZ J;  1Y6I A;  2V9P A;  3CLO A;  4HYE A;  5FRM A;  4MEX F;  5HBU A;  2QQA A;  3HE0 A;  3BHQ A;  4RB3 C;  2M30 A;  2B3W A;  3P9C A;  2KRH A;  4XMY A;  5EEH A;  1MIJ A;  3BRO A;  3GUD A;  3F23 A;  4GFL A;  4IKF A;  3H35 A;  3EUK L;  3CCY A;  3RQ4 A;  3SDB A;  1S7A A;  2F5F A;  5IOY A;  2VQH A;  1IN5 A;  2QA4 I;  3NAR A;  3ZPL A;  1SAU A;  2EWN A;  2H8W A;  1D3Y A;  4ZTJ A;  3S16 J;  1IUY A;  2RQP A;  4LIV A;  2K9S A;  2ZB9 A;  4WF2 A;  2DOF A;  2EFO A;  5F64 A;  3BG5 A;  4ETS A;  3F21 A;  3CO6 C;  3BR6 A;  5D18 A;  2MYS A;  4E7H A;  3HGY A;  3KP5 A;  1LUJ B;  4BAY A;  1VQ4 I;  2P6T A;  5KAI C;  1JT0 A;  4I99 C;  1Q1H A;  2XDN A;  1JHF A;  4DYQ A;  2DCE A;  5H6Q A;  3HIM A;  4AWX B;  2DTR A;  1T95 A;  5LBQ A;  4F93 B;  1BBY A;  3Q0U A;  4AIJ A;  3HIF A;  1J09 A;  2AQF A;  3SXY A;  2ESN A;  2ZCX A;  2BVM A;  4HZF A;  2QM3 A;  1RRJ A;  1DGW Y;  1IG7 A;  5K5O A;  2A6H F;  5FD5 A;  3NI7 A;  3RDI A;  1SVL A;  2GLO A;  1W7P A;  2O5R A;  1A6I A;  3MKY B;  2Y69 H;  2HYF A;  3V4G A;  3OYA A;  3WG9 A;  3F6O A;  2IA0 A;  5FKK A;  1PDN C;  4B44 A;  3BG7 A;  2WY7 Q;  3FWE A;  3K10 A;  3DEW A;  2VKD A;  3E1S A;  1B72 B;  4UNO A;  2GXB A;  3LA2 A;  4E7Z A;  2AS5 F;  4A3B J;  1R9T J;  1DPU A;  2M9H A;  4PFP A;  3HTH A;  4XOT A;  5JVT A;  1HCR A;  1FZP B;  1ZGJ A;  4XSZ F;  1VND A;  2K02 A;  5L3G A;  2J5P A;  2A61 A;  1Q1V A;  1T33 A;  2DBB A;  1XGN A;  4PUS A;  3G2B A;  2DA6 A;  1TC3 C;  3CC7 I;  2VQG A;  3DXJ F;  5K7H A;  4RB2 C;  3OYH A;  1U2W A;  5C4X J;  3S2H J;  4U0W A;  2Z33 A;  2HOA A;  1UST A;  4P9U A;  4RM3 A;  2CMP A;  3FXQ A;  3BPV A;  2ZKZ A;  2O7O A;  2OAZ A;  4Y13 A;  2RV8 A;  5DM7 F;  4G94 A;  1S9H A;  3BT9 A;  3K8P C;  5EZH A;  4BE0 A;  2HI3 A;  3JAM K;  5K1Y A;  2M1B A;  2EV5 A;  3ANP A;  5AQC A;  2BXY A;  3S8P A;  1H0M A;  3VTI A;  3IWZ A;  2QIB A;  3RH2 A;  3QRF F;  2Q1Z B;  3G73 A;  3OR1 C;  2KT0 A;  1OCO H;  1MSF C;  2B7E A;  2F07 A;  5D5X B;  2XRN A;  3AFH A;  2FA5 A;  2GQQ A;  2UZK A;  1QBJ A;  3RZO J;  5F0H A;  2I8D A;  3TDZ C;  1AKH B;  2JA7 J;  4HF1 A;  2XF5 A;  1ZTR A;  3FXR A;  4AIH A;  2B0L A;  2QBY B;  2R7W A;  3FM3 A;  2EV0 A;  5CVU A;  4E70 A;  1IRZ A;  4ZC3 A;  1IJW C;  3M9A A;  3SJM A;  2OZU A;  4XKW A;  3GTJ J;  2ZJR F;  2DW4 A;  2OA4 A;  2MGQ A;  3NS4 A;  5H9T A;  1QO0 D;  2IXS A;  1B8I B;  3W3C A;  4WXC A;  2JWT A;  4HV5 A;  2CG4 A;  1WFX A;  2RNG A;  3WU2 C;  2K3P A;  4GCK A;  1FOK A;  2BW3 B;  2W00 A;  1Z3Y A;  2LP0 A;  2Q2E B;  3QP5 A;  1KQ0 A;  1STZ A;  2NAZ A;  4XKB A;  2VT2 A;  3P9K A;  1JE8 A;  5GPC A;  3PSF A;  1FYK A;  1ETO A;  3SFI A;  2LBF B;  2P7C B;  1V5G A;  4UV9 A;  3O6B B;  2LKP A;  1P6R A;  3QU3 A;  1X4O A;  4KN4 X;  2W24 A;  3A03 A;  1EH7 A;  3OYC A;  4TV7 A;  4RM2 A;  1IV6 A;  3W6V A;  2XC7 A;  2TRT A;  2F5D A;  1XMA A;  1OIS A;  2XB0 X;  2Q8K A;  1XSV A;  2X9D A;  2Z16 A;  5EG0 B;  1A35 A;  3CJN A;  1ZG3 A;  1VQP I;  4YII A;  2LH9 A;  3ZMT A;  1XD7 A;  2R4G A;  4E7I A;  1XDU A;  2IJL A;  4CIC A;  3GYH X;  2A2F X;  1BI0 A;  2E1O A;  5FMP A;  2JZY A;  1RKW A;  1IN6 A;  2COB A;  5HNH A;  5HDN A;  2IU5 A;  3KZY A;  3HTU A;  1B9M A;  2ADU A;  2LOO A;  1WJF A;  3GCM A;  1SC7 A;  5DUK A;  4EJT A;  3VP5 A;  4KIB A;  3PNY A;  4L9J A;  2NVT J;  4N0B A;  3GX4 X;  4R1H A;  3J81 K;  3K4M A;  1D5V A;  4IL6 C;  3LJL A;  1VI0 A;  1YX5 A;  2BY1 A;  1R1T A;  3S2W A;  3BR1 A;  4L18 B;  3MZY A;  4Y33 A;  2LRE A;  2QWW A;  1TTY A;  2HQ5 A;  4CCL A;  2L01 A;  4XKC A;  3H0G J;  3V8L A;  2STT A;  3HEF A;  3L7W A;  5EGO A;  2H8R A;  2IGO A;  1ZEL A;  4GFK A;  2KLO A;  1MMA A;  5BPI A;  3HKZ N;  2BXZ A;  3FKI J;  2ISY A;  1BW5 A;  5EEG A;  1UG0 A;  4EVI A;  1RES A;  2N8G A;  2XB5 A;  3HOW J;  4OIQ F;  2JTV A;  3SDG A;  2ESH A;  4FCY A;  3RI4 A;  4NB5 A;  3DV8 A;  3PUF A;  3QU6 A;  3WG7 H;  1YE9 A;  2MW8 A;  3JW4 A;  5BS6 A;  4OAY A;  3IRR A;  2E1M B;  3EET A;  2ME6 A;  3CP2 A;  4M71 A;  1PYV A;  4KUM A;  2UXI A;  2KIF A;  2QUF A;  4RGU A;  2G7S A;  1E0E A;  4M74 A;  1K78 B;  2MD5 A;  2EZI A;  3PSI A;  2A05 A;  3LST A;  2V79 A;  4U0V A;  4ICH A;  2FUG 2;  1B72 A;  4AUX A;  3BDD A;  2AHQ A;  2CH0 A;  2VC1 A;  3FZV A;  5ICC A;  2M7A A;  4BE1 A;  2KRF A;  2R0Q C;  3TOB A;  1D5Y A;  1MSE C;  4D7M A;  2H27 A;  2OC6 A;  4NDL A;  1YFH A;  4PJN A;  2FU4 A;  1I3Q J;  2OF7 A;  1KYW A;  4AYB A;  2UXN A;  1R1V A;  3EUA A;  2DOE A;  4BDZ A;  2DA4 A;  4XLF A;  2ECB A;  3BOQ A;  3CMM A;  5E18 F;  1FSE A;  1I1S A;  2HKO A;  2MC3 A;  5B1A H;  2G3B A;  2BHY A;  4C3I J;  3AL0 C;  2RDP A;  3G4S I;  3VYU B;  4N4O B;  1MBK A;  2EH3 A;  1U78 A;  2DT6 A;  3F8N A;  2Y2Z A;  4M3B A;  1BI1 A;  4Y7N J;  3K1M A;  1W36 C;  3T8R A;  1FP1 D;  4ZYE A;  5FGL A;  2JRM A;  2R5Y B;  1ENH A;  2JA2 A;  5EF6 A;  2IS1 A;  1PUF B;  4BU2 A;  3OIP A;  1EF4 A;  5IT3 A;  4ZJZ A;  2WC2 A;  9ANT A;  5AIP A;  5LGU A;  4F92 B;  1AKH A;  2E19 A;  2GIZ A;  5CXG A;  3CCS I;  4U0Y A;  3KET A;  2ELH A;  4HDU A;  2RQQ A;  1YTY A;  2XKO A;  1QZZ A;  2DI3 A;  1REP C;  2EZK A;  2CU7 A;  5KNL A;  2M2E A;  2PFV A;  3GW2 A;  1BI3 A;  3CCL I;  1ORK A;  2HFH A;  4RLF A;  2KIS A;  2OJE D;  1SAN A;  2BOL A;  3HKZ A;  2C6Y A;  3RYP A;  1GT0 C;  5IT9 K;  1MND A;  1RI7 A;  1RR8 C;  1J2X A;  1HW1 A;  3H92 A;  4I98 B;  3ZQQ A;  3BTI A;  3DPJ A;  1GVJ A;  4XL9 A;  2BW3 A;  1YS6 A;  2Q2E A;  3HC7 A;  3GFI A;  1XTA A;  2L9S A;  3HOX J;  2WB1 N;  1QNT A;  2MC4 A;  3I9V 2;  1Y0N A;  1IRG A;  1Z1D A;  2QQ8 A;  2VON A;  3PFI A;  3T8T A;  2HNH A;  2F6C A;  3M8F A;  2CYY A;  3QBM A;  1M1E B;  2LBF A;  1R36 A;  5KHD A;  2MLG A;  3U1D A;  3QYF A;  2HKX A;  1OKR A;  2GAU A;  3KP4 A;  1K7A A;  5IYB J;  4HX4 A;  2F48 A;  1MMD A;  4JK1 X;  2ME0 A;  3ANG A;  3HZJ A;  2OER A;  4EJV A;  1NK2 P;  3ZGK A;  2CQQ A;  3SZT A;  3L00 A;  4M3F A;  3ZMU A;  3L2V A;  4HA8 A;  1FBS A;  3TO7 A;  3FXU A;  2F5V A;  2TCT A;  3RPU D;  4MFD A;  2QEX I;  3T1B A;  1X19 A;  2NP3 A;  2KMU A;  3CMA I;  2DK8 A;  3R0A A;  1SEU A;  4HV6 A;  2A6E F;  3CJQ B;  2RHA A;  3Q0V A;  4V2G A;  1IRX A;  3BJB A;  5LHG A;  5CPR B;  2KFD A;  3PIO F;  2PMU A;  3QOE A;  1UI5 A;  4BBR J;  3HTS B;  1ZG1 A;  3OYM A;  1VQL I;  3VWB A;  2RAS A;  2GA1 A;  2QF7 A;  5FGM A;  4AD9 A;  4BJ6 C;  3OV8 A;  4GCT A;  1UAA A;  1H9G A;  2NOG A;  2BE5 F;  1SVM A;  4EJU A;  2FBQ A;  2MBF A;  3VPR A;  4RAG A;  2E71 A;  2ZCM A;  2OZ6 A;  1HKQ A;  4RAZ A;  2VLA A;  4D7N A;  4BHP A;  4QPQ A;  3GFL A;  4QWQ A;  2CSO A;  1I39 A;  2E36 A;  4I0A A;  2JSC A;  1QZY A;  2YSR A;  6PAX A;  4B3X A;  1NG6 A;  5D6E A;  4JX5 A;  2BZT A;  5JLW A;  1WSU A;  2DMN A;  1T0F A;  2WAF A;  3WTY C;  2E5Z A;  5H20 A;  3AAF A;  3MCZ A;  1FIP A;  5J6X A;  3FHZ A;  4NUB A;  1ZLJ A;  2H1L A;  1K78 A;  2A3S A;  4P96 A;  2WB1 A;  2IGM A;  2FJ1 A;  3JAM Z;  2QOP A;  3BQZ A;  3JRD A;  4IRV A;  3VOX A;  4CCO A;  3KZZ A;  1FOY A;  4G7O F;  2V9V A;  1WHU A;  2VN2 A;  3EUH C;  4CCN A;  4A3J J;  3IL2 A;  2DMQ A;  3KP3 A;  4P9F A;  1OYI A;  2DA3 A;  4IQ4 A;  2I10 A;  1G2H A;  4IRI A;  3HRT A;  4LLG F;  3TW6 A;  5D8K B;  3VYR B;  1FBQ A;  1FTZ A;  3GTP J;  2XSD C;  4JYK A;  3DKX A;  3K4L A;  2WAE A;  3IV5 A;  3FRQ A;  1IXC A;  4E7S A;  2XPV A;  4B09 A;  5BQT A;  5AIQ A;  3D5L A;  2ZOY A;  2XKP A;  2OD5 A;  5FFZ A;  5D8L B;  2NS8 A;  1JKO C;  2HZT A;  2ZFU A;  2Z9O A;  2CO5 A;  5KAF C;  3BY6 A;  2R5Y A;  1VQ6 I;  2IA2 A;  3JRE A;  1PUF A;  2DG8 A;  4D5F A;  4CCM A;  3BZ6 A;  2PMZ N;  1O57 A;  3HOT A;  4ZZL A;  1S7O A;  1JUM A;  3CTA A;  4M9Z A;  3HPH A;  3KX2 A;  2QEN A;  4NC6 A;  5LEK A;  5D1R A;  4A3E J;  3NEU A;  1BM9 A;  3AQS A;  2P8T A;  1UCR A;  1MMS A;  2BGC A;  2RVC A;  4NNJ A;  4HAM A;  3G1M A;  1IW7 F;  1ZAO A;  5E1Z B;  2KIU A;  1QQI A;  3GZ6 A;  2XRO A;  1P4X A;  3E5X A;  4CUG A;  3BCG A;  4XRS A;  2RN7 A;  3L1P A;  4ENJ A;  3A02 A;  3G7R A;  3S32 A;  1VZ0 A;  4AC0 A;  4KFC A;  1UHM A;  2HYJ A;  5EEA A;  1W7P D;  3DTI A;  2E1M C;  4PZJ A;  4RMN A;  1D8J A;  1T0F C;  2HOE A;  2XGC A;  3R4K A;  5J8C A;  2QQB A;  4MNU A;  4BL0 B;  4DW6 A;  3LSJ A;  2XVC A;  3J81 Z;  3LAJ A;  2LK2 A;  4BKX A;  2DT7 B;  4W1U A;  4V19 K;  3IUO A;  1BR4 A;  5EJC A;  1FWZ A;  4M3D A;  2VBY A;  3LSR A;  3OSF A;  3IUV A;  1YJ9 I;  2IA1 A;  4O6J A;  1D0Y A;  2V6E A;  3BR2 A;  4HOB A;  1T2K A;  2GM4 A;  3V7R A;  3VYS B;  3L2W A;  5F27 A;  1V54 H;  3S5R A;  2OQR A;  2EZL A;  3S3N A;  3GFM A;  2ID3 A;  5L3B A;  2L7Z A;  2KDO A;  4ME9 A;  4MLO A;  3AG1 H;  4PJL A;  3CC4 I;  1HW2 A;  2XF6 A;  3FXK A;  1X1C A;  2VQL A;  2F4O B;  2K5C A;  3CDH A;  4WXH A;  4XSX F;  3Q9S A;  1J75 A;  3FHN A;  3G56 A;  2DK5 A;  2CS3 A;  2JRT A;  4O3M A;  3CUQ B;  4XLP F;  3FF5 A;  3FK6 A;  3L09 A;  3A1Y A;  4A6E A;  4Q47 A;  3I59 B;  1TW3 A;  4PK4 A;  1LKX A;  3DPU A;  3E7L A;  2HZD A;  2DN0 A;  4KN7 X;  3ZMD A;  2B1E A;  1A6Q A;  2L7K A;  2PMZ A;  4EEF G;  1XG1 A;  2VOP A;  2ELK A;  2EK5 A;  2ZO4 A;  3BNI A;  3OS2 A;  2QKL B;  3CCU I;  2L9N A;  4A3F J;  1IN7 A;  1ZR4 A;  4AF5 A;  4Y52 J;  2EJR A;  1IZ1 A;  2NVY J;  4U88 A;  3ON2 A;  2A6T A;  3CCM I;  5E3O A;  2QSF X;  1XX5 A;  4BJ5 C;  5K7Z A;  1HST A;  2WA0 A;  3L2Q A;  1G3S A;  5HVQ C;  1YLF A;  2K27 A;  3VYT B;  2YUS A;  1HLV A;  3OYL A;  1HSJ A;  5DYM A;  1R4M B;  4IHY A;  3SEZ A;  3F8M A;  4UHT A;  3SEQ A;  1RKT A;  3VB2 A;  5HLG A;  5IYD J;  3WU0 A;  1TP4 A;  3ECH A;  5GPA A;  3LSH A;  4DQ2 A;  2X85 A;  3KP7 A;  3CJD A;  3ZQH A;  4PXI A;  2DFF A;  2FNP A;  5F1R A;  2MG4 A;  1XMX A;  4HSR A;  3CCJ I;  2YVX A;  5FO5 A;  1OFC X;  3DKW A;  3QPH A;  2K86 A;  3DPL C;  1I1G A;  2H1K A;  4GO1 A;  4OIR F;  3ISP A;  2IP2 A;  3LSP A;  1FYL A;  5DUI A;  2RC4 A;  5IYC J;  3IWF A;  3K1N A;  1W4M A;  3LA7 A;  3GTL J;  1IC8 A;  4I02 A;  1AA7 A;  1W0U A;  1MH3 A;  5ILU A;  2CJJ A;  3C1D A;  2LLK A;  1X1B A;  5IT9 Z;  3TO6 A;  3TL4 X;  2XPU A;  1HBX G;  2QKO A;  4G6T B;  1Z77 A;  3R60 A;  4QTR A;  3ZXS A;  5L3E A;  3H9J A;  2OQG A;  2AXT C;  3P9I A;  1TWA J;  2DMU A;  3M7G A;  4L9N A;  3JRC A;  1KU9 A;  4F3Q A;  5TRD A;  1X2M A;  4C2T A;  2V26 A;  1MBJ A;  3LSG A;  1XN7 A;  3DU6 A;  3I53 A;  2L9R A;  4LJZ F;  3HYI A;  2Y48 A;  5JI6 A;  1WJA A;  3MAJ A;  3K4J A;  1GV2 A;  2P7V B;  2VI6 A;  2LDU A;  1Y56 A;  3KEQ A;  3O2P E;  1OMI A;  3R6S A;  5C4J J;  1U9N A;  2XGD A;  2DYR H;  2IVM A;  1TBX A;  2IW5 A;  3TKY A;  5GAD J;  1MD0 A;  2ZCN A;  2GOX B;  4RBO A;  2G9W A;  1ULY A;  2QSH X;  1BOA A;  3HPG A;  3NWS A;  2ELJ A;  4BQQ A;  4D5C A;  1JGG A;  3HOY J;  3BRU A;  5C3E J;  3ZN1 A;  2DQR A;  2K40 A;  3LWF A;  4N9I A;  1GV5 A;  2YPR A;  5D4R A;  1D0Z A;  3NQO A;  2HGC A;  4KT5 C;  2REK A;  4HBL A;  3JSO A;  3S1R J;  2DPD A;  1WJ5 A;  1VQN I;  4IOC F;  4CO8 A;  3R61 A;  1YW8 A;  3BTJ A;  1WI3 A;  3GO5 A;  2JA6 J;  2BYV E;  2ZME C;  4A93 J;  3JRI A;  1J59 A;  4DIQ A;  2KZV A;  2M8E A;  2CUJ A;  2A69 F;  3JRB A;  3H3V K;  5D6F A;  3HB9 A;  3PJR A;  2FMY A;  1GVD A;  1OCP A;  3ABU A;  3T5X A;  2F2E A;  4M3G A;  5FLX K;  4GCV A;  3C2G A;  3GZ5 A;  1IAW A;  4N4N B;  4DYC A;  1USS A;  4BY1 J;  1VQ7 I;  3MMY B;  5HOO A;  3K69 A;  1R22 A;  4ZZD A;  4ZYG A;  2DJN A;  2V7F A;  3PL8 A;  4JL3 A;  4CGR A;  1IN8 A;  3CJR B;  1TNS A;  1NG7 A;  2QZ8 A;  3F3X A;  3PIP F;  3QOP A;  5CVV A;  4YFN F;  3FX3 A;  3QOD A;  5HLH A;  4IHX A;  4EM1 A;  3S93 A;  3I4N J;  2DA5 A;  2I5U A;  2K4B A;  3CUQ A;  4HPQ A;  3ROU A;  4L5J A;  4DVY P;  1GUU A;  3CES A;  4JBA A;  1YX3 A;  2V57 A;  2VPL A;  2P6S A;  2XAH A;  4I0B A;  1B1B A;  3I59 A;  3KP6 A;  4HRI A;  2G7U A;  2K3F A;  4A5M A;  3VUQ A;  1S7E A;  3HUG B;  2WAQ N;  2JUG A;  4RB1 A;  5A2Q K;  1MZB A;  4S05 A;  3I55 I;  3HL2 A;  1WPK A;  1K4T A;  3HBL A;  4EM2 A;  4BDY A;  1X58 A;  1ZHF A;  3QPS A;  1T98 A;  2W84 A;  1V5E A;  1MKM A;  2ZJ2 A;  5H6R A;  4YRV A;  2M7B A;  4UXN A;  3WU1 B;  4LFU A;  1V3F A;  2WY8 Q;  3VEP A;  5EYR A;  3W6J B;  1A31 A;  4FAS D;  1ZH5 A;  2ID6 A;  4HX8 A;  2HXO A;  5M5Y J;  3F22 A;  3CC2 I;  2CWE A;  2DA7 A;  1O7F A;  3QP6 A;  1ON1 A;  2HU9 A;  3JRA A;  2LVS A;  3AG4 H;  3M1E A;  2D2W A;  2EFP A;  4HF2 A;  2H6C A;  1A5J A;  1R5H A;  1JGS A;  1ZRE A;  2DQL A;  4AYB N;  4ON0 A;  1APL C;  1U5T B;  3L2C A;  2XAF A;  4HNV A;  3ZP5 A;  3DBH B;  2EA2 A;  2F4M B;  2MH9 A;  2DG7 A;  2XGE A;  1HA8 A;  1YO5 C;  5DTD A;  5LGT A;  3CUO A;  1B4A A;  3BZK A;  2R7R A;  3ZN0 A;  1X1D A;  3FMR A;  4HST A;  4L5I A;  1ZK8 A;  1OCT C;  4G9Y A;  1E3O C;  5DAJ A;  3CO7 C;  4LB6 B;  4A3I J;  4F7Z A;  4BQN A;  3WTT C;  3EYY A;  2ZBK A;  3GME A;  2DFE A;  4KIC A;  4F52 A;  3HDD A;  3PO2 J;  1EV7 A;  1KU3 A;  4XRF A;  1OCR H;  3DLA A;  5CQE A;  4ESB A;  5F0C A;  1HF0 A;  4LLN A;  2HQA A;  4II3 A;  1ETW A;  1HDD C;  3J7A O;  4ESF A;  1O3R A;  3TP3 A;  4AU7 A;  5CLS A;  3IC7 A;  3ABK H;  4ZYA A;  2GZW A;  3ABM H;  3KNW A;  4UVC A;  1XMK A;  2OTL I;  2XF7 A;  1FIA A;  1HQC A;  4OIN F;  2DFI A;  1XDS A;  4BH9 A;  1BC7 C;  1LNW A;  4BUP A;  3HM5 A;  3IKV A;  4A0Z A;  2CGP A;  3HHG A;  2CV1 A;  2CUZ A;  3QKX A;  3CUQ C;  2O0Y A;  4Y4R A;  4PJ0 C;  2DJI A;  4UY8 I;  2FBI A;  1F5T A;  2WAQ A;  2DMT A;  4F55 A;  1WKM A;  2FD5 A;  3OR2 C;  3VOE A;  5TIS C;  5GTH C;  5EDN A;  1D1C A;  1CGP A;  1UZC A;  4UUV A;  3E7Q A;  3K0L A;  4Q48 A;  2R7O A;  2M0C A;  3VW2 A;  3DU5 A;  1TWC J;  4EM0 B;  1ZRC A;  1O4X A;  1JJ6 C;  2K9Q A;  4DNC A;  4A3M J;  4EGY A;  1UMQ A;  4FTH A;  1R00 A;  5J47 A;  2NVQ J;  4S04 A;  2EZH A;  2BEO A;  1DPR A;  2DU9 A;  2XGX A;  2CUE A;  2R7Z J;  2MH2 A;  4D0P A;  1H8A C;  4JP0 A;  3ONQ A;  4YZE A;  5JHF A;  3GEU A;  2KP6 A;  4J19 A;  2RAE A;  1V5F A;  3ASN H;  3PNV A;  3CDI A;  1W0T A;  2R93 J;  3PO3 J;  3FXM A;  2DDB A;  2VPR A;  1KZH A;  5HOD A;  3JTH A;  2DLL A;  3ZR8 X;  1X2N A;  1U6G A;  2ICW G;  1E3P A;  1ETY A;  1ZAR A;  2VB6 A;  1BC8 C;  3CP8 A;  3BPX A;  3TBI A;  1AU7 A;  1G6N A;  2WAD A;  3H9G A;  4RA2 A;  5GAE J;  3GBG A;  3NNR A;  1BOB A;  2E5N A;  3BG9 A;  3KCC A;  3CDL A;  1OCC H;  2V1N A;  3H36 A;  2XV4 S;  5E1W A;  2YR2 A;  5JFR A;  2VOO A;  4ZYD A;  4HF0 A;  4XID A;  3GTM J;  2HDW A;  2STW A;  2VKV A;  2NOJ B;  4B48 A;  3FM5 A;  2KDZ A;  4YIF A;  1OR7 C;  4UVB A;  3GXO A;  2IGK A;  3ABL H;  1U8B A;  2VBX A;  3LMM A;  1GXQ A;  5HLI A;  5FB2 A;  4A3K J;  2CW0 F;  2P4W A;  4A6D A;  4IEJ A;  1TWG J;  2OUM A;  5M5W J;  4MHG A;  3VOK A;  1ONV A;  4PFO A;  3ERM A;  1KA8 A;  1VQ9 I;  4HLY A;  2P5K A;  2CQ7 A;  2DA2 A;  2VKH A;  3X2Q H;  4BE2 A;  4L0Z B;  2EIL H;  3SYT A;  4YEJ A;  4ESJ A;  3O8G A;  2O6G E;  3JR9 A;  4QIW N;  2F5E A;  2CW8 A;  4M9X A;  4B47 A;  1JKQ C;  4ZDO A;  1ZGW A;  1T38 A;  1JKR C;  1YOV B;  4LB5 A;  3HUG A;  2QBY A;  4FE4 A;  1F1Z A;  2AXL A;  3FXL A;  1RZ4 A;  2M4G A;  3S17 J;  2X1E A;  4CYD A;  2VL8 A;  4I01 A;  3KEO A;  5E79 C;  4EJO A;  3HOU J;  2G7H A;  1Y8R B;  1FX7 A;  3ERE D;  1B8I A;  3VW1 A;  4DBR A;  2Q0O A;  4OWR B;  5ERI A;  5DS9 A;  2WV0 A;  1IO2 A;  1G3W A;  4RGX A;  4IHT A;  4PJJ A;  3NPI A;  1VQO I;  2K7L A;  3H9Q A;  2Y9Z A;  3E0J B;  2V1U A;  5CVI A;  3F8F A;  1HW5 A;  2OCC H;  1H88 C;  3LHQ A;  2BBY A;  5BNG A;  1TZL A;  2IT0 A;  4XR6 A;  3EUH A;  3I58 A;  2HR3 A;  2R7D A;  3KZI C;  1XC5 A;  5F04 A;  4G12 A;  1U5T A;  5J1R A;  1R58 A;  2VJJ A;  1B9N A;  1N77 A;  4OD4 A;  4GCL A;  4E6K G;  2BVL A;  1P4W A;  3ABT A;  1Z3X A;  4PSX A;  3FIW A;  4UUS B;  5BOX A;  1MDM B;  2FX0 A;  2PJR B;  4YFK F;  5EG0 A;  3ZRG A;  4K2E A;  5DV5 A;  2PBX A;  2V9K A;  1OPC A;  3RTR A;  1J5Y A;  4FQG A;  3BCA A;  4UB6 C;  1RIO H;  4GFB A;  4LK1 F;  2D5V A;  4PCQ A;  1P4A A;  2H6B A;  4M6V A;  3MWM A;  1H89 C;  1EJ9 A;  4ACI A;  3HGG A;  5CKT A;  5DEQ A;  2IRF G;  1X3Z B;  3OIO A;  2KL4 A;  3C18 A;  3RPQ A;  3DBR B;  3SFZ A;  3E5U A;  5H2F C;  2P5L C;  4YFX F;  3OYE A;  3K4K A;  2OBP A;  4Z2Y A;  4WIB A;  3RZD J;  4M9S A;  3BJ6 A;  3K2Z A;  2LNB A;  2WTE A;  5GP9 A;  5LRR A;  3U9G A;  2COM A;  5FRN A;  3KIO A;  4LIT A;  4HDV A;  3I64 A;  1YW9 A;  1XCB A;  3FMQ A;  2KKO A;  4XON A;  1KU2 A;  1TWH J;  1Z05 A;  2OV7 A;  4G8X A;  3SHF A;  2UUZ A;  3RYR A;  5HS9 A;  3COA C;  4XLN F;  3ZQL A;  4E7K A;  3IH3 A;  3D5S C;  3I54 A;  3TED A;  2DMP A;  4L62 A;  3LSI A;  4IPA A;  2KIM A;  4MQ9 F;  3BZC A;  3TW7 A;  1XSD A;  1TQM A;  3TMO A;  2VQC A;  4N9H A;  5FLX Z;  2L4M A;  1X4P A;  2YU3 A;  2A5W A;  4DJA A;  2YVH A;  4HQE A;  4E4H A;  1YJN I;  2GFN A;  2LRD A;  1P92 A;  2QQ9 A;  2ZME B;  1BN5 A;  3IAS 2;  4R79 A;  3OYF A;  2JA5 J;  1EH6 A;  4DZP A;  2HQR A;  1YIO A;  4RAY A;  1I3A A;  3HTA A;  5D19 A;  3MFK A;  2EA4 A;  2Z5U A;  3BWG A;  2FXA A;  4Y17 A;  4I6Z A;  3MN2 A;  1RNL A;  3F8C A;  4FET A;  3HXL A;  2NNN A;  4L5E A;  3ZMV A;  5LD2 C;  4ASN A;  2PI0 A;  2JJ7 A;  5JHU A;  2KIQ A;  3DTE A;  1UFM A;  2E60 A;  2FBK A;  3D1N I;  2L7M P;  3DLL F;  1TLH B;  4JNN A;  1SD5 A;  2HPI A;  4FX4 A;  4IOA F;  1QVT A;  5JLX A;  1U5T C;  1ODD A;  2RGV A;  3BQY A;  2G0E A;  3E6D A;  1I5Z A;  4XLA A;  4WK8 F;  1BIB A;  2QYO A;  5A2Q Z;  4ZYH A;  1QVU A;  3C2B A;  2FNA A;  2KJB A;  1LFB A;  1Y1W J;  4CA0 A;  1NTC A;  3DBL B;  2XAG A;  3HOV J;  2Y31 A;  2EIK H;  4DBQ A;  4E7L A;  3ZQI A;  2E7W A;  3DPT A;  3WGH A;  1B59 A;  1F9N A;  5E20 A;  3GLL A;  5IP6 A;  3LSM A;  3T6N A;  3PM1 A;  1S29 A;  1MBE A;  1MMG A;  2EIN H;  2LMD A;  1Z7L A;  2LYC A;  4IHS A;  1LEB A;  3ZQF A;  4UUT A;  3CME I;  4HW0 A;  3EQL F;  1IF1 A;  3P5J A;  4ANJ A;  3HSF A;  1VQM I;  1D0X A;  1TQP A;  1LE8 B;  3UR3 C;  4LK0 F;  3GTG J;  1ETV A;  1TT5 B;  2ACJ A;  1MH4 A;  2O3F A;  4BNC A;  5KVR A;  2B9S A;  3MD2 A;  3CZ6 A;  2KZG A;  2B63 J;  1KGS A;  1Y8Q B;  2YX4 A;  2PFB A;  3AG2 H;  1QA6 A;  4EAT A;  1FSH A;  5CW8 A;  3RKX A;  3CWR A;  3F1B A;  4I09 A;  2HVQ A;  2UV1 A;  2EPF A;  4LGW A;  3HTI A;  5D5W B;  1N25 A;  1BR2 A;  3PQJ A;  3PQK A;  5M3F J;  2PN6 A;  2MD0 A;  3TQN A;  4ZTF A;  5E17 F;  2M34 A;  2Q24 A;  1LDJ A;  2LFB A;  1V4R A;  4UDS A;  2L7F P;  3OYB A;  3M8E A;  2FQ3 A;  1NH3 A;  2QTQ A;  4NC7 A;  1ZR2 A;  3FK7 A;  4WX9 A;  1JHH A;  1WWX A;  2CQX A;  3OYN A;  4FE7 A;  4DZJ A;  2FEZ A;  5FKN A;  3H5R A;  2M3A A;  3SQN A;  4DOZ A;  3B6C A;  3LA3 A;  4ZDP A;  3UKG A;  3DQV C;  3CD6 I;  3A4C A; 
#chains in the Genus database with same CATH homology
 3QQA A;  3VP5 A;  1U9N A;  3BTC A;  1I50 J;  2XGD A;  2NVT J;  2VKE A;  3KZ9 A;  1UHS A;  2ZCN A;  4RBO A;  3CRJ A;  2UXU A;  3LJL A;  1MBG A;  1VI0 A;  3BR1 A;  1JGG A;  3HOY J;  4D5C A;  3OOU A;  3IH2 A;  3BRU A;  2HQ5 A;  5C3E J;  4AC6 A;  1FJL A;  1YRN A;  2K40 A;  2X6O A;  3H0G J;  1IGN A;  3HEF A;  5EGO A;  1GV5 A;  2H8R A;  2YS9 A;  4GFK A;  2REK A;  3EGQ A;  3HKZ N;  3COL A;  3FKI J;  3S1R J;  1BW5 A;  5HSZ A;  3BTJ A;  1RES A;  2N8G A;  1WI3 A;  2XRL A;  4IHW A;  2XB5 A;  2JA6 J;  3HOW J;  3S1Q J;  4A3C J;  1ETX A;  3SDG A;  1NK3 P;  4A93 J;  1RR7 A;  3JRI A;  4FCY A;  3JSJ A;  5J3L A;  1UG2 A;  2MW8 A;  3JRB A;  3H3V K;  4NEL A;  3GTK J;  1BA5 A;  3HB9 A;  3K7A J;  4A3D J;  1GVD A;  2HOS A;  1OCP A;  4JX4 A;  2ME6 A;  1SGM A;  2UXI A;  4M3G A;  2JN6 A;  2G7S A;  1Y1V J;  2EQR A;  2O9L A;  3JRG A;  2JK3 A;  4DYC A;  2EBI A;  2EZI A;  1BJZ A;  2P81 A;  3BR0 A;  4BY1 J;  3VVY A;  2R92 J;  4ICH A;  4XRS G;  3MNL A;  2DJN A;  4AUX A;  1B72 A;  2AHQ A;  4BXX J;  4JL3 A;  2R0Q C;  4CGR A;  1D5Y A;  5F1J A;  4D7M A;  1MSE C;  3JRF A;  4NDL A;  5E3M A;  3Q0W A;  1I3Q J;  2OF7 A;  5CXI A;  1FTT A;  1HOM A;  4IHX A;  4KWA A;  3I4N J;  2DA5 A;  3RKQ A;  5E3L A;  1LFU P;  2DA4 A;  1GUU A;  5FKO A;  2L0K A;  2V57 A;  2ECB A;  1ZQ3 P;  2PZ9 A;  2GUH A;  4MFE A;  3PPB A;  4A3G J;  3VUQ A;  1HDP A;  1S7E A;  2WAQ N;  2G3B A;  4C3I J;  3QPL A;  5J1Y A;  2YU9 J;  1WPK A;  3HBL A;  5EZG A;  1MBK A;  2EH3 A;  1U78 A;  1K83 J;  1X58 A;  3QPS A;  2Y2Z A;  4M3B A;  4MO7 A;  4Y7N J;  2YVE A;  3LNQ A;  3EUP A;  2DTZ A;  5FGL A;  2CRG A;  1RPW A;  1P7J A;  5C4Y A;  5EYR A;  1ENH A;  2R5Y B;  5EF6 A;  1PUF B;  3B6A A;  1EF4 A;  2ID6 A;  2HXO A;  5M5Y J;  9ANT A;  2DA7 A;  5FHP A;  1AKH A;  2E19 A;  2IEK A;  3JRA A;  5CXG A;  2LVS A;  3WHC A;  3VIB A;  3KKD A;  2EZK A;  1IDZ A;  2CU7 A;  1A5J A;  1JUP A;  2M2E A;  3ON4 A;  2UXH A;  4XIC A;  4AYB N;  1VF9 A;  1APL C;  1ORK A;  3BTL A;  5K58 A;  5IOZ A;  4HNV A;  1SAN A;  2DG7 A;  2XGE A;  1GT0 C;  3S2D J;  5DTD A;  2HKU A;  3DPJ A;  3OSG A;  3BTI A;  3VVZ A;  3A01 A;  3HOX J;  2WB1 N;  2G7L A;  1ZK8 A;  1JKP C;  1LE8 A;  1OCT C;  1E3O C;  5DAJ A;  1DU6 A;  4A3I J;  1IUF A;  3ZQG A;  3PAS A;  3QBM A;  3HDD A;  1MNM C;  1F43 A;  4A3L J;  1ETQ A;  3PO2 J;  4A69 C;  4S0H B;  3BR3 A;  5IYB J;  2ME0 A;  5F0C A;  2NS7 A;  3Q3S A;  3ANG A;  3BR5 A;  1HF0 A;  2OER A;  3RD3 A;  1ETW A;  1HDD C;  1NK2 P;  3S15 J;  5K7F A;  3TP3 A;  2W53 A;  2CQQ A;  2WGB A;  4UUS A;  3KNW A;  2QCO A;  4M3F A;  1CQT A;  5EGO B;  1QPI A;  1FIA A;  2TCT A;  4MFD A;  4CYC B;  1XS9 A;  1SFO J;  3NAU A;  5HAW A;  2NP3 A;  3O60 A;  1F36 A;  4BBS J;  3HM5 A;  2X48 A;  3QKX A;  2RHA A;  3M4O J;  3Q0V A;  2VUM J;  4V2G A;  1K61 A;  3BJB A;  4X1E A;  3IH4 A;  2DMT A;  2FD5 A;  3AQT A;  1FEX A;  2R5Z B;  1UI5 A;  5EDN A;  4BBR J;  3E7Q A;  3VW2 A;  2M0C A;  4MXM A;  1TWC J;  2RAS A;  1O4X A;  2Y30 A;  1OJL A;  1TWF J;  2K9Q A;  2QF7 A;  1JJ6 C;  3DCF A;  4A3M J;  1UMQ A;  5F08 A;  4FTH A;  5EFY A;  2LR8 A;  2NVQ J;  4GCT A;  2CUF A;  2EZH A;  2FBQ A;  2NOG A;  1MBH A;  2CUE A;  2R7Z J;  3S1N J;  1H8A C;  3VPR A;  4JP0 A;  2ECC A;  2G7G A;  2HYT A;  3GEU A;  4YZE A;  4J19 A;  2HDD A;  2ZCM A;  2RAE A;  1I6H J;  4D7N A;  3ZOB A;  1W0T A;  5F0F A;  1AHD P;  2R93 J;  3B81 A;  3PO3 J;  2VPR A;  5HOD A;  1X2N A;  4DYR A;  1ETY A;  2E2H J;  2JMW A;  4NN1 A;  4B4C A;  1AU7 A;  4JX5 A;  4X6A J;  3GBG A;  5JLW A;  4RDU A;  3NNR A;  3WHB A;  1WGX A;  2DMN A;  3BG9 A;  3GTO J;  3CDL A;  2HOT A;  5C44 J;  5FLM J;  2IAI A;  2GBY A;  2NP5 A;  1FIP A;  4XID A;  3K2A A;  3GTM J;  2O8K A;  3GTQ J;  2VKV A;  3VW0 A;  2IBD A;  2FJ1 A;  5M3M J;  2KDZ A;  1JTY A;  2QOP A;  1GDT A;  1UI6 A;  2LKX A;  1U8B A;  3BQZ A;  3JRD A;  5J1U A;  3VOX A;  3V6G A;  4A3K J;  3CMY A;  4IEJ A;  3I4M J;  1TWG J;  2Y0S N;  5M5W J;  1IDY A;  3VOK A;  4A3J J;  2DMQ A;  1JTX A;  2DA3 A;  2DA2 A;  2I10 A;  1VFC A;  1G2H A;  4C3J J;  3O8G A;  3NRG A;  3JR9 A;  4QIW N;  2O7T A;  3TW6 A;  1FTZ A;  1JKQ C;  3GTP J;  1JJ8 C;  2XSD C;  1ZGW A;  1JKR C;  4JYK A;  4FE4 A;  3FIS A;  3M3Y J;  3S1M J;  5IPA A;  3IV5 A;  3FRQ A;  2UXP A;  2XPV A;  3S17 J;  3HOU J;  2ZOY A;  4JKZ A;  1POG A;  3RQI A;  1B8I A;  3VW1 A;  2NS8 A;  5DS9 A;  1JKO C;  1MBF A;  2AO9 A;  2R5Y A;  4XRM A;  3NPI A;  3JRE A;  2Y9Z A;  1PUF A;  2DG8 A;  2W48 A;  4D5F A;  3HOZ J;  2PMZ N;  2XPW A;  2D6Y A;  5HBU A;  1JUM A;  4V2F A;  3LWJ A;  3HE0 A;  3BHQ A;  1H88 C;  3LHQ A;  5BNG A;  5D1R A;  4A3E J;  4ABZ A;  3AQS A;  4GFL A;  1XC5 A;  5F04 A;  4G12 A;  1JUS A;  1U9O A;  2MSY A;  3CCY A;  5J1R A;  5IOY A;  3G1M A;  4GCL A;  2LD5 A;  3NAR A;  4QSH A;  3FIW A;  4UUS B;  3S16 J;  2FX0 A;  2K9S A;  2ZB9 A;  5M5X J;  5EG0 A;  3BCG A;  4XRS A;  4HKU A;  3L1P A;  3A02 A;  3G7R A;  3BG5 A;  5FJ8 J;  5D18 A;  2PBX A;  3BR6 A;  4AC0 A;  1YRN B;  3HGY A;  2HYJ A;  2HXI A;  1JT0 A;  4GFB A;  5EEA A;  2NX4 A;  2D5V A;  4DYQ A;  2XDN A;  3HIM A;  4M6V A;  1H89 C;  4ACI A;  3HGG A;  2FQ4 A;  2XGC A;  3MKL A;  2NVX J;  5FKM A;  4DW6 A;  3OIO A;  3LSJ A;  2LK2 A;  4BKX A;  3Q0U A;  4I76 A;  4W1U A;  2ZCX A;  4M3D A;  3RZD J;  1IG7 A;  3NI7 A;  3LSR A;  3OSF A;  3IUV A;  3JRH A;  2GLO A;  3LOC A;  2GEN A;  2DA1 A;  3BR2 A;  5GP9 A;  1A6I A;  2GM4 A;  5F27 A;  3S5R A;  4B3A A;  4CYC A;  5FKK A;  2EZL A;  1T56 A;  2LTP A;  4BY7 J;  2ID3 A;  2L7Z A;  4IHV A;  4ME9 A;  3DEW A;  1B72 B;  1TWH J;  4MLO A;  4A3B J;  2M8G X;  3ZQL A;  1R9T J;  2M9H A;  3MVP A;  3IH3 A;  3HTH A;  1ZKG A;  3TED A;  1HCR A;  2DMP A;  1QRY A;  4L62 A;  5E3N A;  3G1L A;  1VND A;  2R5Z A;  5FLV A;  3TW7 A;  3G56 A;  1Q1V A;  1T33 A;  2DA6 A;  1TC3 C;  5FKL A;  2OI8 A;  3FK6 A;  3BG3 A;  5K7H A;  5C4X J;  2YVH A;  4JX6 A;  3S2H J;  1JT6 A;  2HOA A;  2OPT A;  2GFN A;  2WV1 A;  2O7O A;  2JA5 J;  3E7L A;  4DZP A;  2DN0 A;  1DU0 A;  3HTA A;  5D19 A;  4I6Z A;  3BT9 A;  3MN2 A;  5EZH A;  3O8H A;  4EEF G;  1WCM J;  1XG1 A;  2HI3 A;  4L5E A;  2ELK A;  3ANP A;  5AQC A;  2JJ7 A;  5IP9 J;  3BNI A;  2JA8 J;  2QIB A;  3RH2 A;  3D1N I;  2L7M P;  4A3F J;  4JNN A;  1ZR4 A;  2KT0 A;  3GZI A;  1WH5 A;  3F0C A;  1MSF C;  4Y52 J;  4AF5 A;  2NVY J;  2F07 A;  3ON2 A;  3VVX A;  1WH7 A;  2E2J J;  5E3O A;  2K9N A;  1QVT A;  3RZO J;  1ITY A;  5JLX A;  5K7Z A;  2UXO A;  3BQY A;  2Y9Y A;  1ETK A;  5F0H A;  2E2I J;  1AKH B;  2JA7 J;  2G0E A;  1HLV A;  2YUS A;  5IP7 J;  1ZTR A;  1QVU A;  3C2B A;  4IHY A;  5IYD J;  1Y1W J;  1LFB A;  4MK6 A;  1RKT A;  1NTC A;  3HOV J;  1IRZ A;  3NXC A;  2Y31 A;  3ZQC A;  1IJW C;  4XK4 A;  3ZQI A;  3SJM A;  4MIM A;  5GPA A;  3GTJ J;  2MGQ A;  3G1O A;  1BL0 A;  3CJD A;  3ZQH A;  5H9T A;  5IP6 A;  4PXI A;  1B8I B;  3PM1 A;  3T6N A;  1MBE A;  3V78 A;  2MG4 A;  3TP0 A;  2JWT A;  3ZQF A;  4UUT A;  1Z0X A;  2LY9 A;  4GCK A;  4LOC A;  2LP0 A;  4W97 A;  1OFC X;  3A01 B;  2H1K A;  1LE8 B;  3GTG J;  4C2M J;  1ETV A;  5GPC A;  3LSP A;  1MH4 A;  3S14 J;  3P9T A;  1RET A;  1P7I A;  1ETO A;  5IYC J;  2B63 J;  3KKC A;  3SFI A;  3GTL J;  1IC8 A;  5CW8 A;  1W0U A;  1MH3 A;  3CWR A;  2CJJ A;  3F1B A;  2LLK A;  3A03 A;  2XPU A;  1IV6 A;  3W6V A;  2WUI A;  2TRT A;  3HTI A;  2QKO A;  2XB0 X;  1Z77 A;  5M3F J;  2X9D A;  4QTR A;  5EG0 B;  2ZOZ A;  2Q24 A;  2QWT A;  2M34 A;  3C07 A;  3HTJ A;  2LFB A;  4UDS A;  1TWA J;  2DMU A;  2L7F P;  3JRC A;  4M3E A;  4C3H J;  2QTQ A;  1BW6 A;  4B1R A;  1X2M A;  1ZR2 A;  2E1O A;  3FK7 A;  1MBJ A;  3LSG A;  5FMP A;  2CQX A;  1RKW A;  4FE7 A;  2COB A;  4DZJ A;  2L9R A;  5FKN A;  4FIS A;  2IU5 A;  1GV2 A;  3B6C A;  3CQZ J;  2VI6 A;  3UKG A;  5C4J J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...