3BR0A

Crystal structure of the complex of malachite green bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 75
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br0A02
3MKLA 1U78A 3ANGA 4B4CA 1GV5A 3M4OJ 2NVXJ 3GEUA 3GTLJ 2LTPA 3S2DJ 2G3BA 5EF6A 1MSFC 4C2MJ 1VFCA 1JGGA 3PASA 3PO2J 2F07A 2L9RA 1VI0A 3Q0WA 3IH3A 1E3OC 4JNNA 2NVTJ 3HE0A 2ECCA 3M3YJ 2QWTA 1AHDP 3HOUJ 1X2NA 4A3MJ 1R9TJ 4M6VA 1QPIA 2IBDA 4MLOA 1JUPA 5IOZA 2GLOA 2DG7A 2VI6A 3VW1A 3S14J 3VUQA 5EZGA 1LFUP 3CMYA 1JJ8C 2M0CA 5C4XJ 4X1EA 2Y2ZA 4V2FA 4M3GA 2LY9A 2DMTA 5JLWA 2ZCNA 4GCKA 2OERA 2WV1A 4XK4A 4W1UA 5GPCA 1QVUA 2K9SA 5FKKA 4DYQA 3VIBA 2XDNA 3HB9A 1RPWA 2O8KA 3CWRA 3NPIA 2MGQA 2LVSA 3BNIA 4BKXA 2E2IJ 3NNRA 1FTTA 4D5FA 2VKEA 3S17J 2LR8A 3GTOJ 2DMPA 3FISA 2GFNA 3WHBA 2AO9A 2M2EA 1FTZA 2QOPA 5HODA 2XB5A 4GFKA 2OPTA 1JKQC 2G7LA 2R7ZJ 2G7SA 2O7TA 3QKXA 2DA5A 1GUUA 3HEFA 1JT0A 1ETWA 3LHQA 3HOXJ 3RQIA 3CJDA 1MBHA 4A3EJ 3W6VA 1HDDC 1BW5A 1IGNA 2DJNA 3JRIA 2TCTA 2IU5A 3EUPA 3Q3SA 3BCGA 2YUSA 3JRFA 1ZGWA 4LOCA 1POGA 3BG3A 2R5YB 1ZQ3P 1IDZA 1IJWC 1I6HJ 2XRLA 5D19A 3FRQA 4D5CA 2XGEA 4IHXA 2DMQA 1Z0XA 1Z77A 3G1LA 4QSHA 4AC0A 3DEWA 3K2AA 5F0FA 4IHVA 1UI5A 3MNLA 1UG2A 4GCLA 5F0HA 1WPKA 5M5WJ 5IYCJ 3BR6A 5F27A 3VVYA 2M34A 3JRDA 3BG9A 4UDSA 2DA7A 3UKGA 3L1PA 1ORKA 4Y7NJ 1TWAJ 4DYCA 2GBYA 3IH2A 3NRGA 1JT6A 4IHWA 2MG4A 1ETQA 1LFBA 1QVTA 2JA6J 3A01B 2Y9ZA 3HTIA 1OFCX 1AU7A 4AUXA 2CJJA 2DA3A 4KWAA 2FX0A 3TP3A 5M5XJ 1NK3P 2NVQJ 1B72B 3HOVJ 2V57A 3K7AJ 4B1RA 2NX4A 2XB0X 5K7ZA 3IUVA 2ELKA 2IAIA 3JREA 3I4MJ 5JLXA 1MSEC 2OF7A 3GZIA 2NS8A 1P7JA 1JJ6C 2DA2A 3H0GJ 3V78A 3BR3A 4I76A 3BG5A 2XPUA 3NXCA 4AYBN 4QIWN 5C4YA 4C3HJ 2VKVA 5FJ8J 1GDTA 5J1RA 1UMQA 3BT9A 4A3GJ 4PXIA 1TWGJ 1Y1VJ 3FKIJ 3OSFA 5DS9A 1SGMA 1DU6A 1NK2P 3HTHA 3BTLA 1IDYA 4HNVA 1WH7A 3I4NJ 1O4XA 1B72A 3PO3J 4JYKA 1JUSA 2LD5A 1A5JA 1H89C 2YVEA 4UUSB 1HLVA 2JWTA 2K40A 1TWFJ 3VOKA 1HF0A 3HTJA 1RESA 2ZB9A 1X58A 2XSDC 4DZPA 2OI8A 3ZQFA 4JX4A 3SDGA 3MN2A 2Y0SN 5FLVA 5FLMJ 3IH4A 3PPBA 1SANA 2PMZN 2RAEA 3LSRA 4GFLA 5EFYA 2RASA 2D5VA 1IRZA 2VPRA 2ZOZA 3VP5A 2EH3A 2NS7A 2EZHA 2JN6A 3AQSA 1U8BA 4D7NA 4G12A 2NP5A 2LFBA 2LKXA 3S1NJ 2R92J 2FBQA 2MW8A 2R5ZB 3HOZJ 1B8IB 2M9HA 2XPWA 1BL0A 4CYCB 4UUSA 5J1YA 3VW2A 3HBLA 3WHCA 5E3MA 2L7ZA 1SFOJ 3B6AA 2G0EA 5CXGA 2E1OA 4MFEA 4DZJA 3JRBA 4A3BJ 3B81A 2UXOA 4MO7A 1WI3A 2W48A 2NOGA 3JRCA 4FCYA 1JKPC 5IOYA 3S1QJ 3CDLA 1W0UA 5FMPA 2AHQA 2QIBA 1ETKA 2EZIA 2H1KA 1NTCA 2JA8J 1T56A 5FKOA 3JRHA 1RKTA 2LP0A 3G1OA 4XRSA 2NP3A 4D7MA 2LK2A 5M3FJ 1BW6A 5EGOB 3BTJA 4BXXJ 4X6AJ 5M5YJ 1TC3C 1I50J 4FE4A 1Q1VA 2R5ZA 1B8IA 1A6IA 1GV2A 1X2MA 2G7GA 1FIAA 4CYCA 3LSPA 3JRGA 3LOCA 2WUIA 3LNQA 1MBKA 5J1UA 2HOSA 4XRMA 2HXIA 3C2BA 4M3DA 2YU9J 3BR5A 2GENA 5F0CA 1HOMA 1XS9A 1VF9A 4BY1J 5GPAA 5IYBJ 4MIMA 2FJ1A 3NAUA 1YRNB 3BJBA 4C3IJ 4MK6A 1MBJA 3ZOBA 4ABZA 2FD5A 4B3AA 1Y1WJ 2ME0A 2O7OA 5IP6A 1OCTC 2GM4A 2UXIA 2DA1A 1MH4A 3TW6A 3VVXA 3RH2A 4JX6A 2CQQA 5HBUA 4Y52J 4S0HB 1DU0A 1UHSA 4XRSG 5EGOA 2JMWA 2D6YA 3G1MA 4ICHA 9ANTA 3BR1A 3LSJA 2X48A 2R5YA 2WGBA 3A02A 2B63J 1ITYA 3BHQA 3DCFA 2HDDA 2UXUA 1BJZA 1IUFA 3VPRA 3GTPJ 5HSZA 2DA6A 5F04A 2CRGA 2JA7J 1AKHB 5EDNA 3RZDJ 3LJLA 3G56A 3KKCA 3ZQGA 3HGYA 4UUTA 3SFIA 2X6OA 4BBSJ 3B6CA 1IC8A 4M3FA 5E3OA 5DTDA 2CQXA 3NARA 4JX5A 5IYDJ 2O9LA 1ENHA 3V6GA 2UXHA 2HXOA 3O8HA 2HQ5A 3LSGA 3D1NI 2ID3A 1RKWA 1JTXA 2KDZA 2R0QC 2DG8A 2H8RA 1ZKGA 5IP9J 2YVHA 1OCPA 4M3EA 3HIMA 3RZOJ 5K7FA 2E2JJ 5HAWA 4MXMA 3A01A 1W0TA 1GT0C 3Q0VA 5FGLA 1ETVA 3F0CA 5K58A 4A69C 1LE8B 5J3LA 1T33A 1ZR2A 4DYRA 4JL3A 2ID6A 3OSGA 2HI3A 5E3LA 1AKHA 1WGXA 3BR2A 1CQTA 5C3EJ 5E3NA 1OJLA 1P7IA 1XG1A 3TEDA 1JKOC 2KT0A 2NVYJ 1JTYA 3HTAA 1GVDA 4AC6A 4RDUA 1F36A 4A3FJ 3BQYA 3ZQHA 1MH3A 3QPLA 2EQRA 1G2HA 4A3DJ 4EEFG 2QF7A 4ME9A 2XGDA 3T6NA 5EG0B 2X9DA 4A93J 4J19A 1LE8A 4M3BA 2Y31A 2VUMJ 4JKZA 2ZCXA 4W97A 5EZHA 2HKUA 3O60A 3RD3A 2DN0A 3GTQJ 5CW8A 4DW6A 5FKLA 2DMUA 2IEKA 3BTIA 3DPJA 2ZCMA 2E2HJ 2WAQN 3TP0A 1EF4A 2ZOYA 1U9OA 3FK6A 2CUEA 1VNDA 3P9TA 2REKA 3QQAA 4BY7J 1ZTRA 1RR7A 5FHPA 1I3QJ 2P81A 5C4JJ 2COBA 2ECBA 3FIWA 4NELA 3PM1A 1K61A 1APLC 1K83J 2TRTA 1RETA 2LLKA 3GTKJ 1PUFB 3G7RA 3SJMA 3F1BA 5EYRA 3ON4A 3S16J 3VVZA 3HOYJ 3IV5A 2PBXA 3O8GA 5C44J 4QTRA 2QKOA 4IHYA 5EG0A 2DMNA 5IPAA 4XIDA 4FTHA 3HDDA 1ETOA 3ZQLA 3GBGA 3CQZJ 4YZEA 3VOXA 2JK3A 1BA5A 1JUMA 3E7QA 3S5RA 2JA5J 1TWHJ 1H8AC 1F43A 3COLA 3JRAA 4CGRA 5F1JA 5GP9A 3CCYA 5EEAA 2Y30A 4HKUA 3ZQCA 2HYTA 3FK7A 4A3CJ 4BBRJ 4IEJA 2QCOA 2XGCA 1MBFA 1ZK8A 2EZLA 3BTCA 3S1RJ 1FIPA 2EBIA 5M3MJ 3S1MJ 1ETYA 3ON2A 1PUFA 4NN1A 2Y9YA 1H88C 2HOAA 3ANPA 2E19A 2I10A 2L7MP 5K7HA 1ZR4A 3NI7A 3OOUA 3AQTA 4A3LJ 3JR9A 4GCTA 4L62A 5FKMA 3JSJA 3A03A 2CUFA 2PZ9A 2WB1N 4RBOA 3KKDA 2K9NA 4I6ZA 3KZ9A 2L7FP 4XICA 4FISA 1S7EA 4GFBA 2DA4A 1MNMC 2ME6A 1ETXA 3KNWA 5DAJA 3GTGJ 3BQZA 3GTJJ 2N8GA 2XPVA 1FJLA 2HOTA 3BR0A 4L5EA 4A3JJ 3QBMA 1D5YA 3TW7A 2MSYA 4ACIA 1IV6A 5BNGA 3HGGA 1HDPA 4V2GA 5IP7J 1XC5A 1YRNA 2K9QA 3H3VK 3MVPA 1HCRA 2GUHA 5AQCA 4A3KJ 2YS9A 1WCMJ 3QPSA 5F08A 1QRYA 3S15J 5FKNA 4MFDA 1JKRC 2Q24A 4C3JJ 2HYJA 2QTQA 4NDLA 1U9NA 5D1RA 3HOWJ 1UI6A 3HM5A 1TWCJ 2M8GX 2W53A 4AF5A 3EGQA 3E7LA 1MBEA 2CU7A 5CXIA 2L0KA 1FEXA 4JP0A 3CRJA 3HKZN 3S2HJ 3Q0UA 2DTZA 3C07A 3OIOA 3ZQIA 3VW0A 2EZKA 3RKQA 5H9TA 2RHAA 1IG7A 4FE7A 5D18A 2JJ7A 2R93J 3BRUA 1MBGA 2FQ4A 4A3IJ 3LWJA 1WH5A 2UXPA 3GTMJ
chains in the Genus database with same CATH superfamily
4UHTA 4B4CA 3OS1A 3L09A 2NVXJ 2XROA 3LFUA 3QU6A 4IHTA 2COMA 2G3BA 4KYWA 2H8WA 3ZMDA 4UUVA 2F07A 3Q0WA 3IH3A 2NVUB 4HDVA 2VJJA 3A1YA 3T5XA 2XASA 3CJTB 2QWTA 2VOOA 3RPQA 1VQ5I 2QEXI 1W7PA 1X2NA 2KHMA 4A3MJ 1QPIA 1KQ9A 4MLOA 1QBJA 5D5UB 3PNVA 2GLOA 2HVRA 1WWXA 2VASA 2QM3A 2HEOA 3ZQ7A 3I9V2 2ZCWA 3OYNA 2FBHA 1FOWA 1R00A 4G8XA 3MCZA 2P7CB 4OIOF 3VW1A 4RB2C 2L9NA 2EPFA 3S14J 4E4HA 2P0WA 4HSRA 2CWEA 2IS6A 4Y4RA 1OCCH 2HZTA 2Z99A 1R4MB 4OOIA 1IUYA 4XKWA 3C18A 2ZCNA 3WU2C 1VQMI 1LEAA 5KCMA 4GCKA 4XK4A 2HKOA 2PMZA 4W1UA 2K9SA 3H3ZA 2A6TA 2ZSIB 3PUFA 3U21A 5B1BH 2OUMA 3EUHC 3K4NA 1E3PA 4G6QA 1OISA 3FHNA 2O03A 5DDGA 1X19A 3Q5FA 3F8NA 3K69A 3GW2A 4F7ZA 2KIUA 3ECHA 3FBIB 3FF5A 5FLXZ 1FTZA 1IV8A 2F6CA 4F92B 4UY8I 2CFXA 1B59A 4EGZA 4GFKA 3DF8A 2G7LA 2R7ZJ 2G7SA 3MWMA 3F8MA 1Z6TA 2DA5A 4RAGA 4WIBA 2KDOA 4EM2A 1WQ2A 3CJNA 5FD5A 3RDIA 1DGWY 2X0LA 1D0XA 3EUPA 1SVOA 1LB2A 5DYMA 4A6EA 3BG3A 1IDZA 2XVCA 3IRQA 2NXNB 3P5JA 2AS5F 2E1NA 5LD2C 5D19A 2EB7A 4BJTA 4MEXF 4D5CA 3IC7A 1Z0XA 2JPCA 3DEWA 4JOMA 4GCLA 4KN4X 1T98A 3FXMA 2EIMH 4RAZA 2M34A 1ODDA 3HPGA 3R4KA 3BG9A 1QQIA 2QZ8A 4BGDA 1ZHFA 4WXHA 2R7WA 4CO8A 3SZPA 3JTGA 4AWXB 1MIJA 1EH8A 3B73A 3G3ZA 4IHWA 1VQNI 1LDJA 2Z3YA 1VZ0A 3RPUD 1XN7A 1OFCX 1LVKA 1MGTA 4YFNF 1IN4A 2FX0A 3TP3A 2GAUA 4KWAA 2JUCA 1BIAA 2ZFWA 4CCNA 3KEQA 1B72B 5KVRA 1R58A 1VQ4I 1G3YA 4FASD 2NX4A 3KP7A 2DFFA 3V8KA 5K7ZA 3N97A 1JHFA 3K10A 1YYVA 2OU2A 5JLXA 1V5FA 3I4MJ 2NNNA 1BC7C 1QA6A 2V7FA 1P7JA 2PX9A 1JJ6C 1DDNA 1IN7A 5LHGA 2DA2A 2E7WA 4V19K 3DFGA 1OCOH 3KP3A 4B8XA 3HXLA 3MAJA 4I99C 3NXCA 1OQYA 4PGGA 2Z2SB 5H20A 2NYXA 3LA3A 3FXRA 1Y0UA 1TWGJ 2Q2EB 3FKIJ 5DM6F 3OSFA 1W1WE 1NK2P 2EK5A 3KETA 2D1HA 1BM9A 3GX4X 4BACA 1YX3A 2VIXA 3RKXA 4LG0A 3I4NJ 2L9VA 3D5SC 1O4XA 1B72A 1D8JA 3HRMA 1KZHA 4L18B 2C6YA 1H89C 1W4MA 1ZREA 1D3YA 1V3FA 4PDKA 5AIPA 5L3DA 1LFPA 4N4NB 2F5DA 1QO0D 3OYLA 2XGXA 1NH3A 2ZB9A 2MC4A 1I27A 4ZDLA 2L4MA 1WJDA 3SDGA 2DDAA 3CLOA 1SD4A 2IS2A 3GLLA 3KLOA 2P7VB 3PPBA 2NS0A 2E1MC 3ABLH 2W00A 2HU9A 2RASA 2E34A 2Q2EA 2VKDA 2QUFA 1DP7P 1S3JA 2EH3A 2JPBA 2YX7A 2EZHA 4KNYA 1TQIA 4G12A 3V7RA 4DOZA 2BGCA 2DT5A 4ZJZA 3SZTA 4E7HA 2JVHA 4G6DA 3VB2A 1J7KA 3LSHA 4AD9A 2R92J 2MW8A 4A5NA 1B8IB 4WXCA 5E1WA 2M30A 3H5AA 5CQEA 3VYUB 4L0ZB 2UXNA 3SYTA 1Y6IA 3B6AA 4E7SA 2VONA 4F52A 5CXGA 2ESNA 1IW7F 3BLYA 4MFEA 4DZJA 4UVAA 3OR2C 5F1RA 4BL0B 2GXBA 4ON0A 2H6BA 1WJ5A 2XAUA 3S1QJ 5IOYA 2AHQA 1S6LA 2Z16A 3DKXA 1G3WA 3GEZA 2ZMEB 1RKTA 3F8CA 4XRSA 4D7MA 2O3FA 1S7OA 4OMZA 2VQCA 1WJFA 2PG4A 2STWA 4BXXJ 5E20A 3FXLA 3OR1C 3K4KA 1I50J 4FE4A 1ZARA 2KP6A 2LRDA 2O5RA 3I3LA 4ZYEA 1HXDA 2P5VA 1B8IA 4S04A 1GV2A 4ZH4F 1X2MA 4HQMA 1FIAA 3KP4A 2V1UA 4DQ2A 2K85A 1KQ0A 1N77A 2HOSA 3C2BA 2YU9J 2PI0A 5FO5A 5F0CA 4AIJA 2IGOA 1HOMA 2WWYA 1TLHB 4EGYA 2FJ1A 2G7UA 1W7PD 2OA4A 3SZGA 3BC8A 4ZZLA 1Y1WJ 3IWFA 3OMYA 2YSRA 5TISC 2GM4A 2UXIA 3F23A 2DQRA 1XDUA 3T8TA 2CQQA 3CUQB 4NC6A 2D6YA 2JMWA 2F4MB 1G6NA 2KRCA 3G1MA 3TKYA 4LGWA 4H4KC 4B48A 4GO1A 1ITYA 2DI3A 3BHQA 3DCFA 2HDDA 1IUFA 3VPRA 3IWZA 2DA6A 4PZJA 5ILVA 3RZDJ 1WI9A 4KN7X 4NQWB 3G56A 4A0ZA 3F8FA 4UUTA 4BBSJ 1IC8A 3RCOA 4J00A 5DTDA 2W7NA 4F55A 3J80K 2R7FA 2UXHA 2HXOA 1R23A 1GLNA 3O3KA 4BH9A 4CICA 5L3BA 2K02A 4EQQA 1A35A 1A36A 2ID3A 4L9NA 1S7AA 1JTXA 4BEHB 3AG4H 3VTIA 2E1CA 4WK8F 3CCSI 1TQMA 2ETHA 1OCPA 3RZOJ 4C2MA 4PSWA 3BJOA 1W0TA 4MXMA 4PJNA 2ISYA 2X4HA 3CUQA 4IOCF 2WC2A 2BOLA 1ETVA 3F21A 5K5OA 1OR7C 4F91B 2XAHA 3IAS2 5J3LA 3ZMZA 1YW7A 4HF0A 3DWLE 2ZXIA 2ID6A 4LMYA 3KZYA 5E3LA 1BI1A 3LMMA 3M1EA 4I0BA 2VXDA 4UV8A 1CQTA 2G7HA 2W24A 3LA7A 4NQWA 1OJLA 1QNTA 1PDNC 4YFKF 3LQRA 4BHBA 1YJNI 2H27A 2NVYJ 2Q1ZB 3HTAA 2XF5A 4Y17A 1IN8A 4BEHA 1KU7A 5JI6A 5JVGF 3QPLA 4EEFG 2QF7A 1H9GA 3BPXA 3FM3A 3BP8A 2X85A 4A93J 2M7BA 2DT6A 3ISPA 2VUMJ 2DT7B 4XR6A 3G2BA 3OYKA 3L2VA 3PQJA 3E6BA 2UV1A 4C9YA 1WJBA 4X0GA 2DN0A 3WGIA 3WTWC 3GTQJ 2HKUA 5E79C 4DW6A 5FKLA 5FROA 2EILH 1Y56A 3CP8A 4M73A 3REOA 3DPJA 2ZCMA 2EIKH 2E2HJ 2ZOYA 5LHIA 1KU2A 5FFZA 2REKA 2QSFX 3QQAA 2DJIA 1I3QJ 2P81A 4BQOA 2ECBA 3J81Z 2KIMA 4D1QA 2BY3A 1K61A 1U0JA 2EA4A 1HW1A 1I3AA 1PUFB 1GHCA 1S5LC 2QWWA 3VVZA 1XD7A 3S16J 1XGOA 2PBXA 2VJ5A 3O8GA 4DIQA 4QTRA 1R1VA 2FU4A 4XIDA 2IS4A 3C2GA 3F72A 1QHGA 1ETOA 3H3UA 4MGRA 2W57A 5DV5A 3VOXA 2LG4A 4HLYA 2V1DA 2ZSHB 2JK3A 5ICFA 1T38A 4G94A 3HRUA 2CS3A 3S5RA 5H6QA 4L5JA 3IKVA 1F43A 3COLA 3JRAA 3U1DA 1V55H 5GP9A 5F1JA 5EEAA 4ENKA 3AG2H 2DYRH 3HUGB 3S32A 4A3CJ 1ON1A 4DNCA 1QZZA 2IPQX 1BR4A 2QQAA 3BCAA 5D4RA 1MBFA 1FX7A 4JK1X 5E8GA 4U0WA 1V4RA 4BHPA 3R60A 1ETYA 2XAQA 3ON2A 4KA4A 3DPUA 1PUFA 2P4WA 3K1NA 3CCRI 1Y8RB 4NN1A 4KFCA 1USTA 4P96A 3OOUA 4A3LJ 1ULYA 3JSJA 4BU2A 3A03A 2O0YA 4E7ZA 3W2AA 5FD6A 1RZ4A 1DP3A 2FBKA 4FISA 1ZG3A 2DA4A 2GXGA 3KNWA 2X51A 4U0VA 5JHUA 1XB4A 2XIGA 1JXSA 2L5QA 3GTJJ 1SMYF 4HAMA 5D4SA 4A3JJ 2KIQA 1P4XA 3TW7A 5CQGA 2IW5A 3TOAA 3DU6A 3KEOA 1A6QA 1YRNA 3H3VK 2MFZA 1YIOA 4A3KJ 4Y33A 3QPSA 3S15J 1T6SA 3VYRB 2WAFA 3SXYA 1JKRC 5BPDA 4C3JJ 4DBQA 1CGPA 2E5ZA 3FBNB 2CQ7A 2HWVA 1UI6A 2M8GX 1BI2A 1Z3XA 2R7DA 4WXDA 5A2QZ 5JR3A 3E7LA 2JQ7A 2HPIA 5CXIA 1XCVA 1MDMB 1SEUA 3DTKA 4RAYA 2P6TA 1W36D 3HKZN 2MABA 4CZZA 5L3CA 1RUNA 2BHZA 3ZQIA 2IGNA 4II3A 2LH9A 5H9TA 1CF7B 1IG7A 2H09A 5D18A 3BRUA 3R61A 3GTMJ 1U78A 1KONA 1GV5A 2EINH 4AYBA 1XTAA 3GTLJ 2P8TA 3ELKA 2BY0A 3HL2A 5EF6A 1VFCA 1KA8A 3SHFA 3DEEA 2KRHA 2OQGA 2LDUA 1QZEA 4DGWB 5CPRB 2L3DA 4BQQA 4CA0A 2EA2A 2BEOA 3M3YJ 3GFIA 1LVAA 4BQAA 2AXLA 2BE5F 1MDMA 5IOZA 5BMZA 2ZFUA 2RDPA 5LGTA 1ON2A 5GAEJ 2A5WA 2KL4A 3SEQA 3CLQA 2X1EA 3RPUA 1X1DA 1XGNA 4FX0A 1CF7A 1R4NB 2MYSA 1MJAA 3KEYA 1LFUP 2M0CA 3F6OA 2ZC2A 2Y2ZA 5LBQA 4OAZA 4V2FA 1ZG1A 4XN0A 4M3GA 2YR2A 3I55I 3OYCA 2WV1A 4F93B 4IKFA 3W6JB 3CJRB 4KISA 2CW7A 4HX4A 3OY9A 3WU1B 1R5HA 1S9HA 3B02A 4CGZA 2XDNA 3HB9A 3FHZA 3CWRA 4IJAA 2DFHA 3NPIA 3R0AA 3GLXA 2VQLA 2MH9A 4C30A 1J0RA 1WSUA 5DM7F 1WKMA 3A4CA 4A0XA 4KMFA 4M9ZA 2F4OB 3GTOJ 3FISA 2GFNA 2WY8Q 3J7AO 1P4WA 3MD2A 1ZYRF 1HKTA 3BG6A 2W25A 4ESJA 3ZRGA 2QOPA 5HODA 4YIRX 1WJEA 2KZVA 2OPTA 2O7TA 4OWRB 2CG4A 3C7JA 4RA2A 3FXOA 5TJJA 3CMMA 4R1HA 3M8FA 3RQIA 4BJ6C 3CJDA 1MBHA 1HDDC 1BW5A 3GWZA 1IGNA 3R0JA 4O5VA 4MEYF 3V7SA 3S8PA 3Q3SA 4GYIA 4YELA 3CCVI 1D0ZA 2DYSH 2R5YB 2BW3B 1TBXA 4XKCA 3LL7A 2XRLA 1R36A 1O7LA 3GXOA 1GXQA 3G1LA 3IRRA 5F0HA 5D5VB 3BCBA 3N4MA 3BR6A 3GZNB 3VVYA 2NAZA 4HG2A 1BIBA 4UDSA 3S2WA 2IA1A 4ITVA 1FNNA 3TO7A 2DA7A 4RM2A 4BAYA 1ORKA 2JTVA 4Y7NJ 2XF6A 5DD8A 1FWZA 5HLGA 2B3WA 3BDDA 3TGNA 2JA6J 1B9MA 5DUKA 3IP4B 1IF1A 2CYYA 2HVSA 4AUXA 1YS7A 2KZGA 3E3VA 5M5XJ 2UWMA 4UB6C 4U7BA 1K6OA 1I5ZA 2BW3A 3C1DA 5KNLA 3E6MA 2RKHA 2XB0X 4I09A 4LK0F 2TDXA 4RS8A 4OD5A 4ENMA 3CD6I 2OF7A 4EJVA 3GZIA 2NS8A 3KP6A 1Z1DA 2BHYA 3GO5A 1YFHA 3H0GJ 2R7SA 2PFVA 3M1CA 1ZAOA 4EJTA 3K4LA 3RKWA 3P7NA 3M8EA 3OL3A 5L3GA 4XLAA 4C3HJ 3J7YJ 5FJ8J 2JRMA 1UMQA 4G7HF 3BT9A 4A3GJ 4GRIA 5HOOA 1S72I 2XF7A 2FA5A 5DS9A 3HTHA 1G3SA 4YIIA 2LNBA 5J8FA 2DXIA 1FSEA 1TW2A 2ICWG 2M1BA 2FOWA 4CCOA 2F5FA 2MLKA 1B9NA 4JYKA 2W1OA 2LD5A 2B0LA 4NB5A 2LREA 3D5RC 3OV8A 2YVEA 4G7OF 2B7EA 1HLVA 3CUQC 2JWTA 2K40A 1KYZA 1TWFJ 4XLHA 3L2UA 1YE9A 1HF0A 5LRSA 3HG9A 3I0TA 2GIZA 2M8EA 1X58A 3ZXSA 1F9NA 4FX4A 1FSHA 1UG0A 3ZQFA 3L9FA 4ZZDA 3MKWB 5LHHA 5FLVA 5EFYA 1SANA 3LSRA 4GFLA 1V5EA 3KP5A 3LSKA 1U3EM 4O3MA 3TMOA 1Y39A 1YI2I 2QLZA 2R7OA 1IRZA 3L2QA 3I56I 3VP5A 1TT5B 2NS7A 1VQ8I 2ISZA 2JN6A 1FBQA 1A04A 4A2UA 1U6GA 1T08B 2LFBA 2FBQA 2DOFA 1WVRA 5GTIC 2ZJRF 4CYCB 2E71A 5J1YA 3L00A 4ZDPA 3WHCA 5E3MA 2E7XA 4HLXA 3QYFA 5KAFC 2G0EA 2L02A 3ONQA 2L7KA 3AG3H 3B81A 2WV0A 3QYBA 4FCYA 2A69F 1XMKA 5FMPA 3CDLA 1D8KA 2H1KA 3HTSB 3E6DA 4E7JA 2ELJA 2LP0A 3G1OA 2JVGA 3CJQB 3HPHA 3FWEA 4UVCA 1ZG5A 1BW6A 4BHCA 3SWHA 1UJ8A 4L9TA 4ESFA 2VL8A 1TC3C 5ILSA 4MQVA 5BPIA 1YIJI 1A6IA 1S8NA 3E5XA 3EYYA 3HHGA 4G9YA 4CYCA 5J40A 3LSPA 3K4CA 3MMYB 3LNQA 1BR2A 2HXIA 2OAZA 3PNYA 3DU5A 2E35A 1VF9A 4BY1J 1XGMA 4HEA2 3WTSC 3NAUA 1ZGAA 1SMTA 4C3IJ 5GADJ 4FQGA 4ABZA 1C0WA 2FD5A 2ME0A 4HOBA 5IT3A 2HTSA 4R8HA 1KYWA 1WJAA 2ZNYA 4PUSA 3TDUC 3W3CA 2CUZA 3ZN1A 2B1EA 3VVXA 4AVZA 3MFKA 3RH2A 2Z1DA 5HBUA 4Y52J 5HS7A 5DCMB 4ICHA 3CMAI 3GCMA 4GCVA 2X48A 3A02A 2B63J 5CKTA 2DDBA 2R7RA 2UXUA 1BJZA 3GTPJ 3E6CC 5F04A 4IHSA 1AKHB 1YW9A 5EDNA 3LJLA 4MTDA 1OYYA 2HYGD 1LQ1A 3KKCA 3SFIA 1YX5A 2VBYA 2X6OA 3KYCB 5DCFA 1T2KA 3HC7A 3W2WA 2YVXA 1Z7UA 2A05A 1HW2A 3JSOA 5IYDJ 1ENHA 1UHMA 3H36A 4U88A 4ZYAA 2HQ5A 3JW4A 1V54H 2KDZA 3TBIA 3ZMUA 2L9SA 2XV4S 5CVVA 2YVHA 3HIMA 5HAWA 5D8LB 3ESWB 4MTEA 4AIDA 5IY5H 4KT5C 1GT0C 3Q0VA 1EA3A 5HS9A 1J2XA 4D9JA 1T0FA 4C2TA 5L3EA 3H92A 5DCMA 1LE8B 2V9VA 4BYYA 4LG3A 2UUZA 2XSJC 3BZKA 1W5TA 1ZGJA 3WG7H 3TOBA 3QRFF 4ZC3A 1TT0A 1AKHA 3LA2A 2I8DA 1WGXA 1HBXG 5GAGJ 1P7IA 1XG1A 4XKVA 1SFKA 2J5PA 3O6BB 2KT0A 3HOSA 3BZ6A 2ESHA 5FRMA 4AC6A 1FZPB 1USSA 4RB0A 3NRVA 2BVLA 2RN7A 3BQYA 1QZYA 2VBWA 2EQRA 1VTNC 5LEJA 2OTLI 2QQBA 4A3DJ 1G2HA 2EV5A 4LLLA 2ZXHA 4DVYP 1X4PA 3NS4A 3T6NA 2DQLA 3WODF 4BS9A 2VE9A 1UCRA 1LE8A 2Y31A 3DV8A 1T8IA 4RGSA 3GZ6A 3JSPA 2BVMA 1R1UA 1RC9A 4BXFA 3RD3A 2VXZA 4A6DA 4KIFA 3KPHA 3EPZA 3RJPA 4XKBA 5EEGA 1EF4A 3A0HC 5J47A 3FK6A 4I7HA 4M71A 1TL8A 4BY7J 1SAUA 1RR7A 4OIPF 2WY7Q 1IXRC 2VBXA 5HLIA 4NELA 3PM1A 5D5XB 2WAQA 2TRTA 1RETA 2QENA 4CYDA 1PP8F 3SJMA 5EYRA 3ON4A 1Q1HA 2LSOA 4KMUX 3IV5A 2QYOA 3CCQI 4HX7A 2GXAA 4IHYA 2X6YA 2DMNA 3HDDA 2VODA 2QKOA 1O3QA 3DKYA 3KYLA 3GBGA 4L9JA 4OIRF 5CVIA 5GTHC 2R7QA 3OYEA 1XSDA 2WA0A 3OYFA 2STTA 1JUMA 3E7QA 1W5SA 4N4OB 3LSMA 2IGMA 5ERIA 2CO5A 3HSEA 1H8AC 1IRFA 4ZYGA 3FZVA 1VQLI 2K9MA 3CCYA 2LKPA 3CDHA 4LITA 2L4AA 4PJ0C 1E0EA 4HV6A 2IXSA 4RLQA 2QCOA 2XGCA 4Y3OA 3E5UA 1ZK8A 4YRVA 4U7DA 2EZLA 3S1RJ 2EBIA 1BI0A 2M0MA 2JRTA 2PN6A 3WGGA 2ZMEA 1U5TB 3QU3A 4TV7A 4Q5SF 2HOAA 2L7MP 3NI7A 2PMUA 2FNAA 3AQTA 3DBRB 2GWRA 5AIQA 5FKMA 1H0MA 3BWGA 3FM5A 2CUFA 3UR3C 4CSWA 3J80Z 3KZ9A 2L7FP 4XICA 1TW3A 2VQGA 3QWLA 5CVUA 4IQ4A 3VFZA 1QU3A 2K4BA 1UHWA 2WB1A 2HOTA 4JBAA 1YQAA 3BR0A 4L5EA 4EATA 3QBMA 3ML6A 1IV6A 5BNGA 3HGGA 3RQ4A 5IP7J 1IAWA 1HCRA 4B47A 5AQCA 4CHUA 1QRYA 4EVIA 5FKNA 4MFDA 2HYJA 4NDLA 3ABTA 1T95A 5F6FA 3H9JA 4L9VA 1FLIA 5HLHA 1F1ZA 4JP0A 4XNFA 2FBIA 3S2HJ 3E97A 2V1NA 4XN3A 4CCLA 3OIOA 3VW0A 2EZKA 2RHAA 1XPXA 2DBBA 2LYCA 2R93J 1HSTA 1MBGA 4A3IJ 1D1CA 3LWJA 4RLFA 1WH5A 3MKLA 3ANGA 3P9CA 2DODA 2K3PA 2LTPA 1X1CA 2E36A 2NRAC 1L3LA 2FE3A 2XAGA 3VSLA 4C2MJ 3L2WA 1NHAA 1JGGA 3PO2J 1IRXA 3PASA 4HF2A 1VI0A 4ENJA 1AOYA 1DGRM 1E3OC 2KISA 2NVTJ 3KFWX 2A5YB 2HTJA 3CO7C 1VQOI 3HE0A 3WGHA 3OYIA 2ZXJA 5EJCA 4U9LA 3OYAA 1R9TJ 1ZLKA 2LBFB 2RNGA 3L2CA 4HF1A 5GAHJ 1MZBA 2DG7A 4XSZF 3BY6A 4Z2YA 4P9UA 4EJWA 3VUQA 4KUMA 2FRHA 1JJ8C 5C4XJ 3ABUA 2Z5UA 2LY9A 2DMTA 2HR3A 3LSIA 2M4KA 1YO5C 1LJ9A 2CW0F 2ZBKA 5GPCA 5FKKA 2ZKZA 2R7UA 3VIBA 4U9NA 2DW4A 1E2XA 1SVMA 3ZN0A 2A61A 2MGQA 4LK1F 2LVSA 3K70D 3BNIA 4BKXA 3KLNA 1PYVA 4RAFA 5HNFA 3GFMA 4D5FA 4LIUA 2DMPA 3MZHA 4EM0B 2YX4A 2R3SA 3WHBA 2HDCA 2PJPA 1BJAA 4PFPA 1SFUA 1YOVB 1PP7U 2AQEA 4IQJA 3WTZA 4PK4A 1JKQC 1GXPA 1BOBA 1Z05A 1GUUA 3HEFA 3O2PE 1JT0A 3LHQA 3HOXJ 3GVAA 2XHKA 3ULQB 2CQKA 3W6VA 3CCJI 1LKXA 3G6EI 4QLCU 1D0YA 3JCUC 4XL9A 1R22A 3ERED 1LDKB 2YPRA 2Y0MA 1VQPI 2BV6A 1ZQ3P 4XLNF 5CJ9A 1IO2A 1IJWC 4I02A 2V6EA 1I6HJ 1LPQA 3C3WA 2JT1A 4CXFA 2IVMA 2XGEA 4IHXA 2DMQA 1Z77A 1YITI 4KDPA 3K2AA 3MNLA 1WPKA 1OLTA 3QODA 3I71A 5IYCJ 1G4DA 5TRDA 1HA8A 3JRDA 3BOQA 3EDPA 1K78B 2KMUA 1EH7A 2KLOA 4FHTA 5BQTA 3WTXC 1XSVA 2LC2A 2VQHA 1TWAJ 1R1TA 3FMSA 2FNPA 4HDUA 5B66C 4HZFA 2MG4A 1LFBA 1ETQA 4CCKA 3HUGA 4XRFA 3A01B 2M45A 2ZXWH 4OMYA 2KQRA 1IN6A 3GYHX 4DBRA 4ZYHA 3Q9SA 4E7KA 2NVQJ 2V57A 3HOVJ 4HRIA 4AVPA 2FOKA 4EJOA 3IUVA 1BOAA 2GQQA 1QGPA 2CSOA 1N75A 3VDXA 1VQKI 1B6AA 1OMIA 2KJBA 3C2HA 1MNEA 3E5QA 4OINF 4ASNA 1K78A 4I76A 1P4AA 2QQ9A 2XPUA 4XLPF 2FUG2 3L7WA 1Z7LA 4QIWN 4PCQA 2V1XA 4UVBA 5C4YA 1GDTA 5J1RA 2EV6A 4CCJA 4PJJA 3CTAA 4PXIA 4Y15A 3BJ6A 3HSFA 2EFWA 3DBLB 1H9TA 2L54A 2FMYA 5BOXA 1DU6A 1K6YA 1MMNA 3BTLA 3K70C 1BBYA 2MH2A 1IDYA 5ICEA 1IXCA 1UZCA 4HNVA 4ZTFA 1WH7A 2LY1A 3PUBA 2PJRB 1KU3A 2QKMB 3TQNA 1A5JA 3PQKA 1PVEA 4UUSB 4BE1A 1T0FC 4KT6A 4NC8A 4P9FA 4M6YA 3WTUC 3HTJA 2M4GA 4KITB 1RESA 2XSDC 2OBPA 5FGMA 3ERMA 4DZPA 2Q0OA 1X1PA 4JX4A 1WFXA 2NNYA 3MN2A 2AQFA 2ZO4A 2XC7A 2K9LA 5FLMJ 2HQAA 2VT2A 3IH4A 2O8XA 2PMZN 2RAEA 3AKZA 4EV0A 4BE0A 1FOKA 2D5VA 2IJLA 4P5OA 4WX9A 2VPRA 3QOPA 3EYIA 2Y0SA 2ZOZA 2X1DA 2QSGX 1Y8QB 3AQSA 4D7NA 1YS6A 2EFPA 3CZ6A 3KP2A 1EJ9A 2PJRA 2M9HA 3GZ5A 4M72A 4UUSA 2OZ6A 2GA1A 3CP2A 1ONVA 2PEXA 1SFOJ 2QSHX 2ZJQF 3S93A 5HNHA 5J4VA 2AXTC 5E1XA 5KHDA 2DK8A 1J9IA 2UXOA 3NEUA 1QPMA 4KIBA 2W48A 2XKPA 3GF2A 2F2EA 1JKPC 1W0UA 1TQPA 1G59A 2RGVA 4N9IA 2EZIA 1W5CC 4BNCA 1QHHD 2O6GE 1NTCA 3WU0A 2JA8J 1P6RA 1T56A 5FKOA 4ZDOA 2JZYA 2P6SA 4R79A 1FY7A 2Z33A 2R7VA 3AFHA 3OL4A 5M3FJ 4ZTJA 1IRGA 5EGOB 5K5QA 2GOXB 1XMAA 3BPVA 1W36C 4II2A 3M07A 1OCRH 3CCLI 4YG2F 3ECOA 4Q48A 2BY1A 3JRGA 2HQNA 3LOCA 4GXOA 3CO6C 1BC8C 2CGPA 2WUIA 3PSFA 5J1UA 2Y75A 3DPLC 1XS9A 5GPAA 3WE2A 4BQNA 4XLEA 1O7FA 3BJBA 2XUBA 3GFJA 3QP5A 3Q9VA 2IA2A 3MKYB 2B9SA 3ZR8X 4B3AA 2O7OA 5IP6A 1YLFA 2V9KA 2OQRA 3PFYA 1MH4A 1XCBA 5FRNA 2DLLA 5K1YA 1T39A 2JA2A 3AL0B 4XOTA 4N0BA 1DU0A 4CUGA 5EGOA 3NWTA 2IS1A 2MD5A 9ANTA 1STZA 3VWBA 2ZMEC 3BR1A 3LSJA 2R5YA 4OIQF 2PLYA 2EFQA 2QGUA 3ZGKA 2CRGA 3RIRA 3VODA 3U9GA 2FJI1 2EV0A 2F4IA 3HGYA 1P2FA 3B6CA 2CQXA 4JX5A 4UXNA 2O9LA 2XRNA 3V6GA 4A12A 1RRJA 1SAXA 2IRFG 3O8HA 1VQ7I 5HVQC 3OYBA 4LIVA 3S3MA 1RKWA 2R0QC 2H8RA 2ZNZA 1ZKGA 3D0SA 5IP9J 2ADUA 4LFUA 5K7FA 5K5RA 1N25A 1XMXA 2A2FX 5FGLA 3K2ZA 3JAMK 2BY2A 5JHFA 1O57A 2GZWA 2Q8KA 4H0EA 1B4AA 1U5TC 2Y69H 5B5EC 1ZR2A 4WWCA 1RUOA 4YIFA 2HKXA 2HI3A 2CV0A 2XAJA 5F64A 4GYGA 5C3EJ 4HSTA 5E3NA 3TEDA 1VQ6I 2DPUA 1OPCA 1JKOC 5HDNA 3OIPA 1JTYA 2PQ8A 1SD7A 2L2OA 3UNGC 2H6CA 3ZQHA 1MH3A 5DD4A 2RQQA 1FP1D 4HBLA 1FMWA 1X3WB 3KCCA 1L0OC 4ME9A 3ZP5A 4PSXA 2XGDA 3CF2A 3IL2A 2A68F 1TP4A 1D1AA 4CDGA 5EG0B 2X9DA 2IA0A 3PIOF 4M3BA 5D6EA 4NUBA 3DLAA 3IKTA 4RGXA 1XGSA 4M6XA 3O60A 1Z3YA 2W4SA 4HV5A 2FQ3A 5CW8A 4RB1A 3K4BA 1MNDA 2IEKA 4XM3A 3ZCOA 2WAQN 3TP0A 3H5RA 2EJRA 4AM3A 2CUEA 3P9TA 1FYLA 5D8KB 4LJZF 1ZTRA 1E3HA 1WZ2A 3FIWA 5J6XA 6PAXA 2GOMA 2X1CA 1APLC 3FXKA 2LLKA 3G7RA 2CV2A 2DFEA 3GTKJ 4WCGA 1EV7A 4ZYDA 3F1BA 1TTYA 5J8CA 2KPMA 3CUOA 2EWNA 1FOXA 2A3SA 2VE8A 5EG0A 2HZDA 1RNLA 1XSXA 4FTHA 4XONA 3VOEA 2CUJA 3CQZJ 5ICGA 3DTEA 3CDIA 1VQ9I 1YHQI 1WHUA 2LKSA 2DU9A 3PFIA 2K7LA 2VT3A 2DO7A 3HIFA 3RYPA 1G8XA 2JA5J 1SD6A 3W2VA 3TDZC 2DAOA 2KKOA 3KE2A 4CGRA 1UELB 3QAHA 3ZQCA 2QA4I 3FK7A 1P9QC 4BBRJ 3PSIA 2IT0A 2DPDA 4IEJA 5FLXK 5HDGA 3V7CA 3BTCA 5ED4A 3S1MJ 2V79A 2M87A 4IRHA 1J5YA 3N05A 3I64A 3ANPA 1MMDA 2P5KA 4WF2A 3I5UA 3JR9A 1O3RA 3GMEA 2R7XA 3LAJA 3CMEI 3PJRA 2VN2A 2WB1N 4RBOA 2IGKA 2K9NA 4P1WA 4QPQA 3DBHB 3WE3A 1WJCA 1MNMC 2ME6A 1ETXA 3AG1H 5DAJA 2ACJA 2XPVA 5E8IA 2PFBA 5DUIA 3ABKH 2MSYA 3R6SA 3MZ8A 3KYDB 1R5GA 2VC0A 5FFXA 1U8RA 3GUDA 3D5LA 4V2GA 2MLGA 4HA8A 5E17F 2K9QA 3MKZA 5LGUA 3ASNH 3TL4X 3MVPA 4LG0B 2R7TA 3K4MA 2YS9A 1WCMJ 5F08A 1TNTA 3HRSA 5H2FC 3ZMVA 2O61A 2QTQA 4BXUA 2V6CA 2DK5A 1Y0NA 2W53A 1NG6A 2M5WA 5ILUA 4AIHA 5H6RA 2D45A 3K0LA 2L0KA 5J4YA 2MA3A 4BJ5C 2OV7A 3K4JA 1AA7A 3HSRA 4IPAA 2X6XA 4FE7A 2FQ4A 3LQQA 4PGHA 1ZH5A 4I01A 4XLFA 5E1ZB 3QOEA 1MKMA 1FBSA 1ZRDA 3M4OJ 1DQUA 5KK1A 3QPHA 5ICCA 3GEUA 4BDZA 3S2DJ 4PJLA 3AAFA 1MSFC 1JHHA 3HOTA 2L9RA 3K9TA 4A5MA 4JNNA 4M9XA 2ECCA 1AHDP 3HOUJ 1BR1A 4LLGF 2WADA 4M6VA 2IBDA 1JUPA 2P5LC 3A2KA 2PMHA 2LF8A 5CYVA 4O6JA 2VI6A 2VB6A 4KICA 3F22A 2BXYA 3DP7A 2Z9OA 2H1LA 4IX7A 5EZGA 3DLLF 3MEXA 1N78A 2L01A 3IHUA 3PL8A 3CMYA 3M9AA 4X1EA 4OD4A 2E60A 1R7JA 5HDKA 3I58A 5JLWA 3CC2I 2OERA 1Z21A 1QVUA 3MQ0A 4DYQA 1RPWA 2O8KA 5TGTA 2HS5A 1HKSA 2E2IJ 3NNRA 1OYWA 1ZLJA 1FTTA 2F5VA 2VKEA 2LR8A 3S17J 2HVQA 4L5IA 1BN5A 2K86A 4DJAA 5B1AH 3U2RA 2AO9A 3OYGA 3LSTA 2M2EA 5LEKA 3P9IA 3G71I 3K8PC 2XB5A 4E6KG 3CCUI 3G4SI 2HOEA 3QKXA 3M7GA 3COAC 1A31A 1ETWA 4UV9A 3ROUA 1V5GA 4I0AA 4A3EJ 2FEZA 4KJZA 2DJNA 4A0YA 2TCTA 2HDWA 3JRIA 2RQPA 2IU5A 3CC7I 3T8RA 3F8BA 3BCGA 2YUSA 3JRFA 1ZGWA 4LOCA 1POGA 4Y13A 5CLSA 3VSKA 2KFDA 1MJBA 4ESBA 3FRQA 4Z6YA 5FB2A 4QSHA 2J5OA 4NC7A 4AC0A 4IHVA 1UI5A 5F0FA 3VEPA 1UG2A 2H94A 2D2WA 4YEJA 3F3XA 1NG7A 5M5WJ 1OKRA 5F27A 4N9HA 4Q47A 4YFXF 3FMQA 3UKGA 3L1PA 1LNWA 2FMLA 2OTJI 1E17A 4DYCA 2F48A 2GBYA 3IH2A 3DPTA 3NRGA 1JT6A 2UXXA 5LFAA 1QVTA 2CFOA 4E7IA 4MNUA 3H35A 1BI3A 2Y9ZA 1LEBA 3HTIA 1AU7A 2CJJA 2DA3A 3H9QA 4CCMA 4EM1A 3ZMTA 1NK3P 2WAEA 2UZKA 3IAM2 3K7AJ 1X3ZB 3TO9A 4B1RA 1D5VA 3ABMH 1MD0A 2VPLA 2ZY9A 1U5TA 3FX3A 3HJEA 2ELKA 3OOPA 2PBIA 1ZN2A 2IAIA 3JREA 4F3QA 2CH0A 2OC6A 1MSEC 1R5ID 3QYEA 1GVJA 2K3FA 2QQ8A 3CESA 2MC3A 3OS2A 3GFLA 3DXJF 4FETA 2IP2A 1HKQA 3BR3A 4M74A 3SEZA 3V78A 1IN5A 1Z67A 2JSPA 3BG5A 1I1SA 3RYRA 4AYBN 3J7ZI 2VKVA 3I54A 4LB5A 1HQCA 1UB9A 1Y1VJ 1REPC 4HPQA 1FBUA 1SGMA 1HW5A 2M3AA 2QVOA 2V4JC 2HPMA 5LRRA 2CQNA 1SC7A 2CV1A 5LLQA 3H9GA 4QWQA 2I5UA 2OD5A 3F9KA 3PO3J 4XSXF 1JUSA 3E0JB 2X6WA 3AL0C 3DTIA 5D6FA 4HNTA 3V4GA 1FOYA 2DOAA 3FXUA 3VOKA 4IOAF 3OS0A 2FF4A 2E5NA 2XAFA 3BG7A 4LD5A 4Q4ZF 3HRTA 4IRIA 1TNSA 3OYJA 4HNUA 3J7AY 2OI8A 3X2QH 3HYIA 2Y0SN 2F5CA 1IZ1A 2BYVE 2KJCA 3E1SA 1EH6A 5L3FA 4D0PA 1ACIA 3EUHA 1MW7A 5LGNA 3KX2A 1SFEA 4I98B 1FMVA 1U8BA 2NP5A 3ZMSA 3DKWA 3HTUA 4GGGA 4XOPA 4UB8C 3CCMI 2LKXA 3S1NJ 2VC1A 1FPQA 2R5ZB 3HOZJ 3PIPF 3G73A 1BL0A 2XPWA 3V8JA 3K6GA 3VW2A 3HBLA 2FSWA 2L7ZA 1IXSB 5JFRA 2VLAA 3FKJA 1LUJB 1S29A 1XX5A 2E1OA 4CH7A 3JRBA 1FP2A 2LBFA 4A3BJ 1UFMA 4MO7A 1WI3A 2VJIA 4LB6B 3ZPLA 3U1KA 2NOGA 4ETSA 3JRCA 1RIOH 3OWTA 4FT8A 1ETKA 2G9WA 2W82A 4HYEA 4EMSA 5JVTA 1AWCA 2QIBA 1JGSA 1U2WA 3JRHA 4KIGA 3ASOH 4NBQA 4IVNA 3P9KA 2NP3A 1DUXC 3I59B 4AIKA 2LK2A 3WTTC 2FXAA 2GA2A 3OYHA 3BTJA 1FYMA 1SD5A 3RI4A 1MMSA 4X6AJ 5M5YJ 2V26A 1R6RA 3J81K 3V42A 1Q1VA 2R5ZA 3KIOA 2G7GA 2RC4A 2GIVA 2LMDA 3SFZA 4S05A 1MBKA 4XRMA 4M3DA 4EJUA 3FDYA 1KU9A 3BR5A 2GENA 2VOPA 1I1GA 5IYBJ 2K5CA 4MIMA 1YRNB 4MK6A 1MBJA 3ZOBA 2RV8A 1FYKA 3FXQA 2EFNA 2EIJH 4XLCA 4U0YA 1OCTC 4B09A 2DA1A 3TW6A 2QKLB 3SQNA 1WRJA 3I59A 4JX6A 2HYFA 5AONA 2VJ4A 4S0HB 1X1BA 1UHSA 2OCEA 4XRSG 3WG9A 5E18F 3LAPA 5B3SH 2WGBA 3KZZA 1FT9A 2VKHA 4G6TB 4LLNA 3FMRA 4E70A 5HSZA 1X4OA 2JA7J 1R49A 2LF7A 4M9SA 1D1BA 3ZQGA 4M3FA 2E1MB 4RM3A 5HLTA 5E3OA 4I2OA 3NARA 5HS8A 1O3SA 2CMPA 1M1EB 1B1BA 1Z6RA 3LSGA 3D1NI 1J09A 2DOEA 4B43A 3DEUA 2DG8A 2EFOA 1EKEA 3HHHA 2WTEA 1J75A 2M7AA 2F5EA 2OCCH 3BJAA 3NQOA 4M3EA 2E2JJ 3OIQA 4IRGA 1OYIA 3A01A 2YU3A 4XBFA 1DPRA 4OAYA 1SVLA 3F0CA 4BE2A 5CVJA 4A69C 5K58A 2KIFA 1ZRCA 5IT9Z 4XMYA 1OCZH 1T33A 4IXAA 4DYRA 4JL3A 3LFKA 3OSGA 4B3XA 4J01A 1MMAA 3BR2A 5CVRA 2NOJB 3BZCA 3EUAA 4P55A 4G7ZF 5A2QK 4ENNA 5KAIC 1K4TA 2V9PA 5IT9K 2K4JA 4PJMA 3V8LA 3H0DA 1GVDA 1YG2A 2LOOA 4RDUA 3VYTB 3I4PA 1PUEE 1F4KA 1F36A 4A3FJ 1O3TA 3ZQQA 3CCEI 2OZUA 2MD0A 3F6VA 1SFXA 2A6HF 4J19A 2JUGA 4JKZA 2ZCXA 2JSCA 4W97A 5EZHA 2ELHA 1DPUA 4IF4A 2DMUA 3RTRA 3BTIA 4IO9F 1PJRA 2W84A 5D5WB 1U9OA 2ZJ2A 2K27A 3K1PA 2QBYB 1VNDA 2CW8A 2OJED 5FHPA 3QPTA 3PNTA 3VYSB 5C4JJ 2COBA 2LY2A 3EETA 4HQEA 1HC8A 3CC4I 1K83J 2MBFA 1Z9CA 4IL6C 4B44A 4ANJA 3OYMA 2D1VA 3EUKL 2DTRA 3HOYJ 2HNHA 1K7AA 4GDFA 4NHJA 5C44J 3TO6A 1Z91A 1ZELA 2BBYA 1YJWI 5IPAA 2BZTA 3NWSA 3FXJA 2Y48A 3ZQLA 3QP6A 4YZEA 3BROA 3RKYA 4CZCA 1BA5A 1JE8A 1I6XA 4L0YB 2RVCA 3EQLF 1TWHJ 1I39A 2DCEA 4MHGA 1X3UA 2HGCA 2Y30A 4HKUA 1P92A 2HYTA 4C2UA 3MZYA 3RSNA 1LDDA 2RREA 3L2RA 2QBYA 5DEQA 3JTHA 2KRFA 4XORA 2DFIA 3SDBA 1FIPA 3KZIC 4HW0A 5M3MJ 1YW8A 1KGSA 3IUOA 1RI7A 2Y9YA 1H88C 2E19A 2I10A 2XDVA 2A6EF 5K7HA 1ZR4A 3H5NA 4GCTA 4L62A 3T1BA 2BXZA 2A07F 2HFHA 4QPOA 4MQ9F 3W6KB 2PZ9A 1JI8A 4RGUA 3KKDA 4IZZA 4I6ZA 2WBMA 1S7EA 3DQVC 4GFBA 1MJ9A 1YJ9I 4UNOA 3WTYC 3OYDA 2R4GA 2W85A 3S3NA 3GTGJ 3BQZA 2N8GA 4RGRA 1FJLA 1XDSA 3WTVC 4JQFA 1K79A 1K4SA 1D5YA 4AU7A 4ACIA 4U87A 3I53A 3JAMZ 1FC3A 3A0BC 1HDPA 1HSJA 1XC5A 3HZJA 4BDYA 2GUHA 4HX8A 1TZLA 1OR7A 2XKOA 3K1MA 2Q24A 1J59A 5D1RA 1U9NA 1UAAA 1X1AA 3HOWJ 1F5TA 3HM5A 1TWCJ 4PFOA 1ZRFA 4AF5A 4K2EA 3EGQA 1W7PB 2HQRA 1RR8C 1MBEA 2CU7A 4OU0A 4E7LA 1FEXA 3CRJA 4BUPA 1MMGA 3Q0UA 4IRVA 2DTZA 3M8JA 2RNJA 3C07A 3LWFA 1KQ8A 5BS6A 3S3OA 4NNJA 3CF5F 3RKQA 4XQFA 1ERDA 5EEHA 2JJ7A 2ZJPF 3T0YA 1G3TA 1R71A 1YTYA 3HKZA 4RB3C 3H1CA 2UXPA 2VBZA 4RMNA
chains in the Genus database with same CATH topology
3MKLA 1U78A 3ANGA 4B4CA 1GV5A 3M4OJ 2NVXJ 3GEUA 3GTLJ 2LTPA 3S2DJ 2G3BA 5EF6A 1MSFC 4C2MJ 1VFCA 1JGGA 3PASA 3PO2J 2F07A 2L9RA 1VI0A 3Q0WA 3IH3A 1E3OC 4JNNA 2NVTJ 3HE0A 2ECCA 3M3YJ 2QWTA 1AHDP 3HOUJ 1X2NA 4A3MJ 1R9TJ 4M6VA 1QPIA 2IBDA 4MLOA 1JUPA 5IOZA 2GLOA 2DG7A 2VI6A 3VW1A 3S14J 3VUQA 5EZGA 1LFUP 3CMYA 1JJ8C 2M0CA 5C4XJ 4X1EA 2Y2ZA 4V2FA 4M3GA 2LY9A 2DMTA 5JLWA 2ZCNA 4GCKA 2OERA 2WV1A 4XK4A 4W1UA 5GPCA 1QVUA 2K9SA 5FKKA 4DYQA 3VIBA 2XDNA 3HB9A 1RPWA 2O8KA 3CWRA 3NPIA 2MGQA 2LVSA 3BNIA 4BKXA 2E2IJ 3NNRA 1FTTA 4D5FA 2VKEA 3S17J 2LR8A 3GTOJ 2DMPA 3FISA 2GFNA 3WHBA 2AO9A 2M2EA 1FTZA 2QOPA 5HODA 2XB5A 4GFKA 2OPTA 1JKQC 2G7LA 2R7ZJ 2G7SA 2O7TA 3QKXA 2DA5A 1GUUA 3HEFA 1JT0A 1ETWA 3LHQA 3HOXJ 3RQIA 3CJDA 1MBHA 4A3EJ 3W6VA 1HDDC 1BW5A 1IGNA 2DJNA 3JRIA 2TCTA 2IU5A 3EUPA 3Q3SA 3BCGA 2YUSA 3JRFA 1ZGWA 4LOCA 1POGA 3BG3A 2R5YB 1ZQ3P 1IDZA 1IJWC 1I6HJ 2XRLA 5D19A 3FRQA 4D5CA 2XGEA 4IHXA 2DMQA 1Z0XA 1Z77A 3G1LA 4QSHA 4AC0A 3DEWA 3K2AA 5F0FA 4IHVA 1UI5A 3MNLA 1UG2A 4GCLA 5F0HA 1WPKA 5M5WJ 5IYCJ 3BR6A 5F27A 3VVYA 2M34A 3JRDA 3BG9A 4UDSA 2DA7A 3UKGA 3L1PA 1ORKA 4Y7NJ 1TWAJ 4DYCA 2GBYA 3IH2A 3NRGA 1JT6A 4IHWA 2MG4A 1ETQA 1LFBA 1QVTA 2JA6J 3A01B 2Y9ZA 3HTIA 1OFCX 1AU7A 4AUXA 2CJJA 2DA3A 4KWAA 2FX0A 3TP3A 5M5XJ 1NK3P 2NVQJ 1B72B 3HOVJ 2V57A 3K7AJ 4B1RA 2NX4A 2XB0X 5K7ZA 3IUVA 2ELKA 2IAIA 3JREA 3I4MJ 5JLXA 1MSEC 2OF7A 3GZIA 2NS8A 1P7JA 1JJ6C 2DA2A 3H0GJ 3V78A 3BR3A 4I76A 3BG5A 2XPUA 3NXCA 4AYBN 4QIWN 5C4YA 4C3HJ 2VKVA 5FJ8J 1GDTA 5J1RA 1UMQA 3BT9A 4A3GJ 4PXIA 1TWGJ 1Y1VJ 3FKIJ 3OSFA 5DS9A 1SGMA 1DU6A 1NK2P 3HTHA 3BTLA 1IDYA 4HNVA 1WH7A 3I4NJ 1O4XA 1B72A 3PO3J 4JYKA 1JUSA 2LD5A 1A5JA 1H89C 2YVEA 4UUSB 1HLVA 2JWTA 2K40A 1TWFJ 3VOKA 1HF0A 3HTJA 1RESA 2ZB9A 1X58A 2XSDC 4DZPA 2OI8A 3ZQFA 4JX4A 3SDGA 3MN2A 2Y0SN 5FLVA 5FLMJ 3IH4A 3PPBA 1SANA 2PMZN 2RAEA 3LSRA 4GFLA 5EFYA 2RASA 2D5VA 1IRZA 2VPRA 2ZOZA 3VP5A 2EH3A 2NS7A 2EZHA 2JN6A 3AQSA 1U8BA 4D7NA 4G12A 2NP5A 2LFBA 2LKXA 3S1NJ 2R92J 2FBQA 2MW8A 2R5ZB 3HOZJ 1B8IB 2M9HA 2XPWA 1BL0A 4CYCB 4UUSA 5J1YA 3VW2A 3HBLA 3WHCA 5E3MA 2L7ZA 1SFOJ 3B6AA 2G0EA 5CXGA 2E1OA 4MFEA 4DZJA 3JRBA 4A3BJ 3B81A 2UXOA 4MO7A 1WI3A 2W48A 2NOGA 3JRCA 4FCYA 1JKPC 5IOYA 3S1QJ 3CDLA 1W0UA 5FMPA 2AHQA 2QIBA 1ETKA 2EZIA 2H1KA 1NTCA 2JA8J 1T56A 5FKOA 3JRHA 1RKTA 2LP0A 3G1OA 4XRSA 2NP3A 4D7MA 2LK2A 5M3FJ 1BW6A 5EGOB 3BTJA 4BXXJ 4X6AJ 5M5YJ 1TC3C 1I50J 4FE4A 1Q1VA 2R5ZA 1B8IA 1A6IA 1GV2A 1X2MA 2G7GA 1FIAA 4CYCA 3LSPA 3JRGA 3LOCA 2WUIA 3LNQA 1MBKA 5J1UA 2HOSA 4XRMA 2HXIA 3C2BA 4M3DA 2YU9J 3BR5A 2GENA 5F0CA 1HOMA 1XS9A 1VF9A 4BY1J 5GPAA 5IYBJ 4MIMA 2FJ1A 3NAUA 1YRNB 3BJBA 4C3IJ 4MK6A 1MBJA 3ZOBA 4ABZA 2FD5A 4B3AA 1Y1WJ 2ME0A 2O7OA 5IP6A 1OCTC 2GM4A 2UXIA 2DA1A 1MH4A 3TW6A 3VVXA 3RH2A 4JX6A 2CQQA 5HBUA 4Y52J 4S0HB 1DU0A 1UHSA 4XRSG 5EGOA 2JMWA 2D6YA 3G1MA 4ICHA 9ANTA 3BR1A 3LSJA 2X48A 2R5YA 2WGBA 3A02A 2B63J 1ITYA 3BHQA 3DCFA 2HDDA 2UXUA 1BJZA 1IUFA 3VPRA 3GTPJ 5HSZA 2DA6A 5F04A 2CRGA 2JA7J 1AKHB 5EDNA 3RZDJ 3LJLA 3G56A 3KKCA 3ZQGA 3HGYA 4UUTA 3SFIA 2X6OA 4BBSJ 3B6CA 1IC8A 4M3FA 5E3OA 5DTDA 2CQXA 3NARA 4JX5A 5IYDJ 2O9LA 1ENHA 3V6GA 2UXHA 2HXOA 3O8HA 2HQ5A 3LSGA 3D1NI 2ID3A 1RKWA 1JTXA 2KDZA 2R0QC 2DG8A 2H8RA 1ZKGA 5IP9J 2YVHA 1OCPA 4M3EA 3HIMA 3RZOJ 5K7FA 2E2JJ 5HAWA 4MXMA 3A01A 1W0TA 1GT0C 3Q0VA 5FGLA 1ETVA 3F0CA 5K58A 4A69C 1LE8B 5J3LA 1T33A 1ZR2A 4DYRA 4JL3A 2ID6A 3OSGA 2HI3A 5E3LA 1AKHA 1WGXA 3BR2A 1CQTA 5C3EJ 5E3NA 1OJLA 1P7IA 1XG1A 3TEDA 1JKOC 2KT0A 2NVYJ 1JTYA 3HTAA 1GVDA 4AC6A 4RDUA 1F36A 4A3FJ 3BQYA 3ZQHA 1MH3A 3QPLA 2EQRA 1G2HA 4A3DJ 4EEFG 2QF7A 4ME9A 2XGDA 3T6NA 5EG0B 2X9DA 4A93J 4J19A 1LE8A 4M3BA 2Y31A 2VUMJ 4JKZA 2ZCXA 4W97A 5EZHA 2HKUA 3O60A 3RD3A 2DN0A 3GTQJ 5CW8A 4DW6A 5FKLA 2DMUA 2IEKA 3BTIA 3DPJA 2ZCMA 2E2HJ 2WAQN 3TP0A 1EF4A 2ZOYA 1U9OA 3FK6A 2CUEA 1VNDA 3P9TA 2REKA 3QQAA 4BY7J 1ZTRA 1RR7A 5FHPA 1I3QJ 2P81A 5C4JJ 2COBA 2ECBA 3FIWA 4NELA 3PM1A 1K61A 1APLC 1K83J 2TRTA 1RETA 2LLKA 3GTKJ 1PUFB 3G7RA 3SJMA 3F1BA 5EYRA 3ON4A 3S16J 3VVZA 3HOYJ 3IV5A 2PBXA 3O8GA 5C44J 4QTRA 2QKOA 4IHYA 5EG0A 2DMNA 5IPAA 4XIDA 4FTHA 3HDDA 1ETOA 3ZQLA 3GBGA 3CQZJ 4YZEA 3VOXA 2JK3A 1BA5A 1JUMA 3E7QA 3S5RA 2JA5J 1TWHJ 1H8AC 1F43A 3COLA 3JRAA 4CGRA 5F1JA 5GP9A 3CCYA 5EEAA 2Y30A 4HKUA 3ZQCA 2HYTA 3FK7A 4A3CJ 4BBRJ 4IEJA 2QCOA 2XGCA 1MBFA 1ZK8A 2EZLA 3BTCA 3S1RJ 1FIPA 2EBIA 5M3MJ 3S1MJ 1ETYA 3ON2A 1PUFA 4NN1A 2Y9YA 1H88C 2HOAA 3ANPA 2E19A 2I10A 2L7MP 5K7HA 1ZR4A 3NI7A 3OOUA 3AQTA 4A3LJ 3JR9A 4GCTA 4L62A 5FKMA 3JSJA 3A03A 2CUFA 2PZ9A 2WB1N 4RBOA 3KKDA 2K9NA 4I6ZA 3KZ9A 2L7FP 4XICA 4FISA 1S7EA 4GFBA 2DA4A 1MNMC 2ME6A 1ETXA 3KNWA 5DAJA 3GTGJ 3BQZA 3GTJJ 2N8GA 2XPVA 1FJLA 2HOTA 3BR0A 4L5EA 4A3JJ 3QBMA 1D5YA 3TW7A 2MSYA 4ACIA 1IV6A 5BNGA 3HGGA 1HDPA 4V2GA 5IP7J 1XC5A 1YRNA 2K9QA 3H3VK 3MVPA 1HCRA 2GUHA 5AQCA 4A3KJ 2YS9A 1WCMJ 3QPSA 5F08A 1QRYA 3S15J 5FKNA 4MFDA 1JKRC 2Q24A 4C3JJ 2HYJA 2QTQA 4NDLA 1U9NA 5D1RA 3HOWJ 1UI6A 3HM5A 1TWCJ 2M8GX 2W53A 4AF5A 3EGQA 3E7LA 1MBEA 2CU7A 5CXIA 2L0KA 1FEXA 4JP0A 3CRJA 3HKZN 3S2HJ 3Q0UA 2DTZA 3C07A 3OIOA 3ZQIA 3VW0A 2EZKA 3RKQA 5H9TA 2RHAA 1IG7A 4FE7A 5D18A 2JJ7A 2R93J 3BRUA 1MBGA 2FQ4A 4A3IJ 3LWJA 1WH5A 2UXPA 3GTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKL A;  1U78 A;  3ANG A;  4B4C A;  1GV5 A;  3M4O J;  2NVX J;  3GEU A;  3GTL J;  2LTP A;  3S2D J;  2G3B A;  5EF6 A;  1MSF C;  4C2M J;  1VFC A;  1JGG A;  3PAS A;  3PO2 J;  2F07 A;  2L9R A;  1VI0 A;  3Q0W A;  3IH3 A;  1E3O C;  4JNN A;  2NVT J;  3HE0 A;  2ECC A;  3M3Y J;  2QWT A;  1AHD P;  3HOU J;  1X2N A;  4A3M J;  1R9T J;  4M6V A;  1QPI A;  2IBD A;  4MLO A;  1JUP A;  5IOZ A;  2GLO A;  2DG7 A;  2VI6 A;  3VW1 A;  3S14 J;  3VUQ A;  5EZG A;  1LFU P;  3CMY A;  1JJ8 C;  2M0C A;  5C4X J;  4X1E A;  2Y2Z A;  4V2F A;  4M3G A;  2LY9 A;  2DMT A;  5JLW A;  2ZCN A;  4GCK A;  2OER A;  2WV1 A;  4XK4 A;  4W1U A;  5GPC A;  1QVU A;  2K9S A;  5FKK A;  4DYQ A;  3VIB A;  2XDN A;  3HB9 A;  1RPW A;  2O8K A;  3CWR A;  3NPI A;  2MGQ A;  2LVS A;  3BNI A;  4BKX A;  2E2I J;  3NNR A;  1FTT A;  4D5F A;  2VKE A;  3S17 J;  2LR8 A;  3GTO J;  2DMP A;  3FIS A;  2GFN A;  3WHB A;  2AO9 A;  2M2E A;  1FTZ A;  2QOP A;  5HOD A;  2XB5 A;  4GFK A;  2OPT A;  1JKQ C;  2G7L A;  2R7Z J;  2G7S A;  2O7T A;  3QKX A;  2DA5 A;  1GUU A;  3HEF A;  1JT0 A;  1ETW A;  3LHQ A;  3HOX J;  3RQI A;  3CJD A;  1MBH A;  4A3E J;  3W6V A;  1HDD C;  1BW5 A;  1IGN A;  2DJN A;  3JRI A;  2TCT A;  2IU5 A;  3EUP A;  3Q3S A;  3BCG A;  2YUS A;  3JRF A;  1ZGW A;  4LOC A;  1POG A;  3BG3 A;  2R5Y B;  1ZQ3 P;  1IDZ A;  1IJW C;  1I6H J;  2XRL A;  5D19 A;  3FRQ A;  4D5C A;  2XGE A;  4IHX A;  2DMQ A;  1Z0X A;  1Z77 A;  3G1L A;  4QSH A;  4AC0 A;  3DEW A;  3K2A A;  5F0F A;  4IHV A;  1UI5 A;  3MNL A;  1UG2 A;  4GCL A;  5F0H A;  1WPK A;  5M5W J;  5IYC J;  3BR6 A;  5F27 A;  3VVY A;  2M34 A;  3JRD A;  3BG9 A;  4UDS A;  2DA7 A;  3UKG A;  3L1P A;  1ORK A;  4Y7N J;  1TWA J;  4DYC A;  2GBY A;  3IH2 A;  3NRG A;  1JT6 A;  4IHW A;  2MG4 A;  1ETQ A;  1LFB A;  1QVT A;  2JA6 J;  3A01 B;  2Y9Z A;  3HTI A;  1OFC X;  1AU7 A;  4AUX A;  2CJJ A;  2DA3 A;  4KWA A;  2FX0 A;  3TP3 A;  5M5X J;  1NK3 P;  2NVQ J;  1B72 B;  3HOV J;  2V57 A;  3K7A J;  4B1R A;  2NX4 A;  2XB0 X;  5K7Z A;  3IUV A;  2ELK A;  2IAI A;  3JRE A;  3I4M J;  5JLX A;  1MSE C;  2OF7 A;  3GZI A;  2NS8 A;  1P7J A;  1JJ6 C;  2DA2 A;  3H0G J;  3V78 A;  3BR3 A;  4I76 A;  3BG5 A;  2XPU A;  3NXC A;  4AYB N;  4QIW N;  5C4Y A;  4C3H J;  2VKV A;  5FJ8 J;  1GDT A;  5J1R A;  1UMQ A;  3BT9 A;  4A3G J;  4PXI A;  1TWG J;  1Y1V J;  3FKI J;  3OSF A;  5DS9 A;  1SGM A;  1DU6 A;  1NK2 P;  3HTH A;  3BTL A;  1IDY A;  4HNV A;  1WH7 A;  3I4N J;  1O4X A;  1B72 A;  3PO3 J;  4JYK A;  1JUS A;  2LD5 A;  1A5J A;  1H89 C;  2YVE A;  4UUS B;  1HLV A;  2JWT A;  2K40 A;  1TWF J;  3VOK A;  1HF0 A;  3HTJ A;  1RES A;  2ZB9 A;  1X58 A;  2XSD C;  4DZP A;  2OI8 A;  3ZQF A;  4JX4 A;  3SDG A;  3MN2 A;  2Y0S N;  5FLV A;  5FLM J;  3IH4 A;  3PPB A;  1SAN A;  2PMZ N;  2RAE A;  3LSR A;  4GFL A;  5EFY A;  2RAS A;  2D5V A;  1IRZ A;  2VPR A;  2ZOZ A;  3VP5 A;  2EH3 A;  2NS7 A;  2EZH A;  2JN6 A;  3AQS A;  1U8B A;  4D7N A;  4G12 A;  2NP5 A;  2LFB A;  2LKX A;  3S1N J;  2R92 J;  2FBQ A;  2MW8 A;  2R5Z B;  3HOZ J;  1B8I B;  2M9H A;  2XPW A;  1BL0 A;  4CYC B;  4UUS A;  5J1Y A;  3VW2 A;  3HBL A;  3WHC A;  5E3M A;  2L7Z A;  1SFO J;  3B6A A;  2G0E A;  5CXG A;  2E1O A;  4MFE A;  4DZJ A;  3JRB A;  4A3B J;  3B81 A;  2UXO A;  4MO7 A;  1WI3 A;  2W48 A;  2NOG A;  3JRC A;  4FCY A;  1JKP C;  5IOY A;  3S1Q J;  3CDL A;  1W0U A;  5FMP A;  2AHQ A;  2QIB A;  1ETK A;  2EZI A;  2H1K A;  1NTC A;  2JA8 J;  1T56 A;  5FKO A;  3JRH A;  1RKT A;  2LP0 A;  3G1O A;  4XRS A;  2NP3 A;  4D7M A;  2LK2 A;  5M3F J;  1BW6 A;  5EGO B;  3BTJ A;  4BXX J;  4X6A J;  5M5Y J;  1TC3 C;  1I50 J;  4FE4 A;  1Q1V A;  2R5Z A;  1B8I A;  1A6I A;  1GV2 A;  1X2M A;  2G7G A;  1FIA A;  4CYC A;  3LSP A;  3JRG A;  3LOC A;  2WUI A;  3LNQ A;  1MBK A;  5J1U A;  2HOS A;  4XRM A;  2HXI A;  3C2B A;  4M3D A;  2YU9 J;  3BR5 A;  2GEN A;  5F0C A;  1HOM A;  1XS9 A;  1VF9 A;  4BY1 J;  5GPA A;  5IYB J;  4MIM A;  2FJ1 A;  3NAU A;  1YRN B;  3BJB A;  4C3I J;  4MK6 A;  1MBJ A;  3ZOB A;  4ABZ A;  2FD5 A;  4B3A A;  1Y1W J;  2ME0 A;  2O7O A;  5IP6 A;  1OCT C;  2GM4 A;  2UXI A;  2DA1 A;  1MH4 A;  3TW6 A;  3VVX A;  3RH2 A;  4JX6 A;  2CQQ A;  5HBU A;  4Y52 J;  4S0H B;  1DU0 A;  1UHS A;  4XRS G;  5EGO A;  2JMW A;  2D6Y A;  3G1M A;  4ICH A;  9ANT A;  3BR1 A;  3LSJ A;  2X48 A;  2R5Y A;  2WGB A;  3A02 A;  2B63 J;  1ITY A;  3BHQ A;  3DCF A;  2HDD A;  2UXU A;  1BJZ A;  1IUF A;  3VPR A;  3GTP J;  5HSZ A;  2DA6 A;  5F04 A;  2CRG A;  2JA7 J;  1AKH B;  5EDN A;  3RZD J;  3LJL A;  3G56 A;  3KKC A;  3ZQG A;  3HGY A;  4UUT A;  3SFI A;  2X6O A;  4BBS J;  3B6C A;  1IC8 A;  4M3F A;  5E3O A;  5DTD A;  2CQX A;  3NAR A;  4JX5 A;  5IYD J;  2O9L A;  1ENH A;  3V6G A;  2UXH A;  2HXO A;  3O8H A;  2HQ5 A;  3LSG A;  3D1N I;  2ID3 A;  1RKW A;  1JTX A;  2KDZ A;  2R0Q C;  2DG8 A;  2H8R A;  1ZKG A;  5IP9 J;  2YVH A;  1OCP A;  4M3E A;  3HIM A;  3RZO J;  5K7F A;  2E2J J;  5HAW A;  4MXM A;  3A01 A;  1W0T A;  1GT0 C;  3Q0V A;  5FGL A;  1ETV A;  3F0C A;  5K58 A;  4A69 C;  1LE8 B;  5J3L A;  1T33 A;  1ZR2 A;  4DYR A;  4JL3 A;  2ID6 A;  3OSG A;  2HI3 A;  5E3L A;  1AKH A;  1WGX A;  3BR2 A;  1CQT A;  5C3E J;  5E3N A;  1OJL A;  1P7I A;  1XG1 A;  3TED A;  1JKO C;  2KT0 A;  2NVY J;  1JTY A;  3HTA A;  1GVD A;  4AC6 A;  4RDU A;  1F36 A;  4A3F J;  3BQY A;  3ZQH A;  1MH3 A;  3QPL A;  2EQR A;  1G2H A;  4A3D J;  4EEF G;  2QF7 A;  4ME9 A;  2XGD A;  3T6N A;  5EG0 B;  2X9D A;  4A93 J;  4J19 A;  1LE8 A;  4M3B A;  2Y31 A;  2VUM J;  4JKZ A;  2ZCX A;  4W97 A;  5EZH A;  2HKU A;  3O60 A;  3RD3 A;  2DN0 A;  3GTQ J;  5CW8 A;  4DW6 A;  5FKL A;  2DMU A;  2IEK A;  3BTI A;  3DPJ A;  2ZCM A;  2E2H J;  2WAQ N;  3TP0 A;  1EF4 A;  2ZOY A;  1U9O A;  3FK6 A;  2CUE A;  1VND A;  3P9T A;  2REK A;  3QQA A;  4BY7 J;  1ZTR A;  1RR7 A;  5FHP A;  1I3Q J;  2P81 A;  5C4J J;  2COB A;  2ECB A;  3FIW A;  4NEL A;  3PM1 A;  1K61 A;  1APL C;  1K83 J;  2TRT A;  1RET A;  2LLK A;  3GTK J;  1PUF B;  3G7R A;  3SJM A;  3F1B A;  5EYR A;  3ON4 A;  3S16 J;  3VVZ A;  3HOY J;  3IV5 A;  2PBX A;  3O8G A;  5C44 J;  4QTR A;  2QKO A;  4IHY A;  5EG0 A;  2DMN A;  5IPA A;  4XID A;  4FTH A;  3HDD A;  1ETO A;  3ZQL A;  3GBG A;  3CQZ J;  4YZE A;  3VOX A;  2JK3 A;  1BA5 A;  1JUM A;  3E7Q A;  3S5R A;  2JA5 J;  1TWH J;  1H8A C;  1F43 A;  3COL A;  3JRA A;  4CGR A;  5F1J A;  5GP9 A;  3CCY A;  5EEA A;  2Y30 A;  4HKU A;  3ZQC A;  2HYT A;  3FK7 A;  4A3C J;  4BBR J;  4IEJ A;  2QCO A;  2XGC A;  1MBF A;  1ZK8 A;  2EZL A;  3BTC A;  3S1R J;  1FIP A;  2EBI A;  5M3M J;  3S1M J;  1ETY A;  3ON2 A;  1PUF A;  4NN1 A;  2Y9Y A;  1H88 C;  2HOA A;  3ANP A;  2E19 A;  2I10 A;  2L7M P;  5K7H A;  1ZR4 A;  3NI7 A;  3OOU A;  3AQT A;  4A3L J;  3JR9 A;  4GCT A;  4L62 A;  5FKM A;  3JSJ A;  3A03 A;  2CUF A;  2PZ9 A;  2WB1 N;  4RBO A;  3KKD A;  2K9N A;  4I6Z A;  3KZ9 A;  2L7F P;  4XIC A;  4FIS A;  1S7E A;  4GFB A;  2DA4 A;  1MNM C;  2ME6 A;  1ETX A;  3KNW A;  5DAJ A;  3GTG J;  3BQZ A;  3GTJ J;  2N8G A;  2XPV A;  1FJL A;  2HOT A;  3BR0 A;  4L5E A;  4A3J J;  3QBM A;  1D5Y A;  3TW7 A;  2MSY A;  4ACI A;  1IV6 A;  5BNG A;  3HGG A;  1HDP A;  4V2G A;  5IP7 J;  1XC5 A;  1YRN A;  2K9Q A;  3H3V K;  3MVP A;  1HCR A;  2GUH A;  5AQC A;  4A3K J;  2YS9 A;  1WCM J;  3QPS A;  5F08 A;  1QRY A;  3S15 J;  5FKN A;  4MFD A;  1JKR C;  2Q24 A;  4C3J J;  2HYJ A;  2QTQ A;  4NDL A;  1U9N A;  5D1R A;  3HOW J;  1UI6 A;  3HM5 A;  1TWC J;  2M8G X;  2W53 A;  4AF5 A;  3EGQ A;  3E7L A;  1MBE A;  2CU7 A;  5CXI A;  2L0K A;  1FEX A;  4JP0 A;  3CRJ A;  3HKZ N;  3S2H J;  3Q0U A;  2DTZ A;  3C07 A;  3OIO A;  3ZQI A;  3VW0 A;  2EZK A;  3RKQ A;  5H9T A;  2RHA A;  1IG7 A;  4FE7 A;  5D18 A;  2JJ7 A;  2R93 J;  3BRU A;  1MBG A;  2FQ4 A;  4A3I J;  3LWJ A;  1WH5 A;  2UXP A;  3GTM J; 
#chains in the Genus database with same CATH topology
 4UHT A;  4B4C A;  3OS1 A;  3L09 A;  2NVX J;  2XRO A;  3LFU A;  3QU6 A;  4IHT A;  2COM A;  2G3B A;  4KYW A;  2H8W A;  3ZMD A;  4UUV A;  2F07 A;  3Q0W A;  3IH3 A;  2NVU B;  4HDV A;  2VJJ A;  3A1Y A;  3T5X A;  2XAS A;  3CJT B;  2QWT A;  2VOO A;  3RPQ A;  1VQ5 I;  2QEX I;  1W7P A;  1X2N A;  2KHM A;  4A3M J;  1QPI A;  1KQ9 A;  4MLO A;  1QBJ A;  5D5U B;  3PNV A;  2GLO A;  2HVR A;  1WWX A;  2VAS A;  2QM3 A;  2HEO A;  3ZQ7 A;  3I9V 2;  2ZCW A;  3OYN A;  2FBH A;  1FOW A;  1R00 A;  4G8X A;  3MCZ A;  2P7C B;  4OIO F;  3VW1 A;  4RB2 C;  2L9N A;  2EPF A;  3S14 J;  4E4H A;  2P0W A;  4HSR A;  2CWE A;  2IS6 A;  4Y4R A;  1OCC H;  2HZT A;  2Z99 A;  1R4M B;  4OOI A;  1IUY A;  4XKW A;  3C18 A;  2ZCN A;  3WU2 C;  1VQM I;  1LEA A;  5KCM A;  4GCK A;  4XK4 A;  2HKO A;  2PMZ A;  4W1U A;  2K9S A;  3H3Z A;  2A6T A;  2ZSI B;  3PUF A;  3U21 A;  5B1B H;  2OUM A;  3EUH C;  3K4N A;  1E3P A;  4G6Q A;  1OIS A;  3FHN A;  2O03 A;  5DDG A;  1X19 A;  3Q5F A;  3F8N A;  3K69 A;  3GW2 A;  4F7Z A;  2KIU A;  3ECH A;  3FBI B;  3FF5 A;  5FLX Z;  1FTZ A;  1IV8 A;  2F6C A;  4F92 B;  4UY8 I;  2CFX A;  1B59 A;  4EGZ A;  4GFK A;  3DF8 A;  2G7L A;  2R7Z J;  2G7S A;  3MWM A;  3F8M A;  1Z6T A;  2DA5 A;  4RAG A;  4WIB A;  2KDO A;  4EM2 A;  1WQ2 A;  3CJN A;  5FD5 A;  3RDI A;  1DGW Y;  2X0L A;  1D0X A;  3EUP A;  1SVO A;  1LB2 A;  5DYM A;  4A6E A;  3BG3 A;  1IDZ A;  2XVC A;  3IRQ A;  2NXN B;  3P5J A;  2AS5 F;  2E1N A;  5LD2 C;  5D19 A;  2EB7 A;  4BJT A;  4MEX F;  4D5C A;  3IC7 A;  1Z0X A;  2JPC A;  3DEW A;  4JOM A;  4GCL A;  4KN4 X;  1T98 A;  3FXM A;  2EIM H;  4RAZ A;  2M34 A;  1ODD A;  3HPG A;  3R4K A;  3BG9 A;  1QQI A;  2QZ8 A;  4BGD A;  1ZHF A;  4WXH A;  2R7W A;  4CO8 A;  3SZP A;  3JTG A;  4AWX B;  1MIJ A;  1EH8 A;  3B73 A;  3G3Z A;  4IHW A;  1VQN I;  1LDJ A;  2Z3Y A;  1VZ0 A;  3RPU D;  1XN7 A;  1OFC X;  1LVK A;  1MGT A;  4YFN F;  1IN4 A;  2FX0 A;  3TP3 A;  2GAU A;  4KWA A;  2JUC A;  1BIA A;  2ZFW A;  4CCN A;  3KEQ A;  1B72 B;  5KVR A;  1R58 A;  1VQ4 I;  1G3Y A;  4FAS D;  2NX4 A;  3KP7 A;  2DFF A;  3V8K A;  5K7Z A;  3N97 A;  1JHF A;  3K10 A;  1YYV A;  2OU2 A;  5JLX A;  1V5F A;  3I4M J;  2NNN A;  1BC7 C;  1QA6 A;  2V7F A;  1P7J A;  2PX9 A;  1JJ6 C;  1DDN A;  1IN7 A;  5LHG A;  2DA2 A;  2E7W A;  4V19 K;  3DFG A;  1OCO H;  3KP3 A;  4B8X A;  3HXL A;  3MAJ A;  4I99 C;  3NXC A;  1OQY A;  4PGG A;  2Z2S B;  5H20 A;  2NYX A;  3LA3 A;  3FXR A;  1Y0U A;  1TWG J;  2Q2E B;  3FKI J;  5DM6 F;  3OSF A;  1W1W E;  1NK2 P;  2EK5 A;  3KET A;  2D1H A;  1BM9 A;  3GX4 X;  4BAC A;  1YX3 A;  2VIX A;  3RKX A;  4LG0 A;  3I4N J;  2L9V A;  3D5S C;  1O4X A;  1B72 A;  1D8J A;  3HRM A;  1KZH A;  4L18 B;  2C6Y A;  1H89 C;  1W4M A;  1ZRE A;  1D3Y A;  1V3F A;  4PDK A;  5AIP A;  5L3D A;  1LFP A;  4N4N B;  2F5D A;  1QO0 D;  3OYL A;  2XGX A;  1NH3 A;  2ZB9 A;  2MC4 A;  1I27 A;  4ZDL A;  2L4M A;  1WJD A;  3SDG A;  2DDA A;  3CLO A;  1SD4 A;  2IS2 A;  3GLL A;  3KLO A;  2P7V B;  3PPB A;  2NS0 A;  2E1M C;  3ABL H;  2W00 A;  2HU9 A;  2RAS A;  2E34 A;  2Q2E A;  2VKD A;  2QUF A;  1DP7 P;  1S3J A;  2EH3 A;  2JPB A;  2YX7 A;  2EZH A;  4KNY A;  1TQI A;  4G12 A;  3V7R A;  4DOZ A;  2BGC A;  2DT5 A;  4ZJZ A;  3SZT A;  4E7H A;  2JVH A;  4G6D A;  3VB2 A;  1J7K A;  3LSH A;  4AD9 A;  2R92 J;  2MW8 A;  4A5N A;  1B8I B;  4WXC A;  5E1W A;  2M30 A;  3H5A A;  5CQE A;  3VYU B;  4L0Z B;  2UXN A;  3SYT A;  1Y6I A;  3B6A A;  4E7S A;  2VON A;  4F52 A;  5CXG A;  2ESN A;  1IW7 F;  3BLY A;  4MFE A;  4DZJ A;  4UVA A;  3OR2 C;  5F1R A;  4BL0 B;  2GXB A;  4ON0 A;  2H6B A;  1WJ5 A;  2XAU A;  3S1Q J;  5IOY A;  2AHQ A;  1S6L A;  2Z16 A;  3DKX A;  1G3W A;  3GEZ A;  2ZME B;  1RKT A;  3F8C A;  4XRS A;  4D7M A;  2O3F A;  1S7O A;  4OMZ A;  2VQC A;  1WJF A;  2PG4 A;  2STW A;  4BXX J;  5E20 A;  3FXL A;  3OR1 C;  3K4K A;  1I50 J;  4FE4 A;  1ZAR A;  2KP6 A;  2LRD A;  2O5R A;  3I3L A;  4ZYE A;  1HXD A;  2P5V A;  1B8I A;  4S04 A;  1GV2 A;  4ZH4 F;  1X2M A;  4HQM A;  1FIA A;  3KP4 A;  2V1U A;  4DQ2 A;  2K85 A;  1KQ0 A;  1N77 A;  2HOS A;  3C2B A;  2YU9 J;  2PI0 A;  5FO5 A;  5F0C A;  4AIJ A;  2IGO A;  1HOM A;  2WWY A;  1TLH B;  4EGY A;  2FJ1 A;  2G7U A;  1W7P D;  2OA4 A;  3SZG A;  3BC8 A;  4ZZL A;  1Y1W J;  3IWF A;  3OMY A;  2YSR A;  5TIS C;  2GM4 A;  2UXI A;  3F23 A;  2DQR A;  1XDU A;  3T8T A;  2CQQ A;  3CUQ B;  4NC6 A;  2D6Y A;  2JMW A;  2F4M B;  1G6N A;  2KRC A;  3G1M A;  3TKY A;  4LGW A;  4H4K C;  4B48 A;  4GO1 A;  1ITY A;  2DI3 A;  3BHQ A;  3DCF A;  2HDD A;  1IUF A;  3VPR A;  3IWZ A;  2DA6 A;  4PZJ A;  5ILV A;  3RZD J;  1WI9 A;  4KN7 X;  4NQW B;  3G56 A;  4A0Z A;  3F8F A;  4UUT A;  4BBS J;  1IC8 A;  3RCO A;  4J00 A;  5DTD A;  2W7N A;  4F55 A;  3J80 K;  2R7F A;  2UXH A;  2HXO A;  1R23 A;  1GLN A;  3O3K A;  4BH9 A;  4CIC A;  5L3B A;  2K02 A;  4EQQ A;  1A35 A;  1A36 A;  2ID3 A;  4L9N A;  1S7A A;  1JTX A;  4BEH B;  3AG4 H;  3VTI A;  2E1C A;  4WK8 F;  3CCS I;  1TQM A;  2ETH A;  1OCP A;  3RZO J;  4C2M A;  4PSW A;  3BJO A;  1W0T A;  4MXM A;  4PJN A;  2ISY A;  2X4H A;  3CUQ A;  4IOC F;  2WC2 A;  2BOL A;  1ETV A;  3F21 A;  5K5O A;  1OR7 C;  4F91 B;  2XAH A;  3IAS 2;  5J3L A;  3ZMZ A;  1YW7 A;  4HF0 A;  3DWL E;  2ZXI A;  2ID6 A;  4LMY A;  3KZY A;  5E3L A;  1BI1 A;  3LMM A;  3M1E A;  4I0B A;  2VXD A;  4UV8 A;  1CQT A;  2G7H A;  2W24 A;  3LA7 A;  4NQW A;  1OJL A;  1QNT A;  1PDN C;  4YFK F;  3LQR A;  4BHB A;  1YJN I;  2H27 A;  2NVY J;  2Q1Z B;  3HTA A;  2XF5 A;  4Y17 A;  1IN8 A;  4BEH A;  1KU7 A;  5JI6 A;  5JVG F;  3QPL A;  4EEF G;  2QF7 A;  1H9G A;  3BPX A;  3FM3 A;  3BP8 A;  2X85 A;  4A93 J;  2M7B A;  2DT6 A;  3ISP A;  2VUM J;  2DT7 B;  4XR6 A;  3G2B A;  3OYK A;  3L2V A;  3PQJ A;  3E6B A;  2UV1 A;  4C9Y A;  1WJB A;  4X0G A;  2DN0 A;  3WGI A;  3WTW C;  3GTQ J;  2HKU A;  5E79 C;  4DW6 A;  5FKL A;  5FRO A;  2EIL H;  1Y56 A;  3CP8 A;  4M73 A;  3REO A;  3DPJ A;  2ZCM A;  2EIK H;  2E2H J;  2ZOY A;  5LHI A;  1KU2 A;  5FFZ A;  2REK A;  2QSF X;  3QQA A;  2DJI A;  1I3Q J;  2P81 A;  4BQO A;  2ECB A;  3J81 Z;  2KIM A;  4D1Q A;  2BY3 A;  1K61 A;  1U0J A;  2EA4 A;  1HW1 A;  1I3A A;  1PUF B;  1GHC A;  1S5L C;  2QWW A;  3VVZ A;  1XD7 A;  3S16 J;  1XGO A;  2PBX A;  2VJ5 A;  3O8G A;  4DIQ A;  4QTR A;  1R1V A;  2FU4 A;  4XID A;  2IS4 A;  3C2G A;  3F72 A;  1QHG A;  1ETO A;  3H3U A;  4MGR A;  2W57 A;  5DV5 A;  3VOX A;  2LG4 A;  4HLY A;  2V1D A;  2ZSH B;  2JK3 A;  5ICF A;  1T38 A;  4G94 A;  3HRU A;  2CS3 A;  3S5R A;  5H6Q A;  4L5J A;  3IKV A;  1F43 A;  3COL A;  3JRA A;  3U1D A;  1V55 H;  5GP9 A;  5F1J A;  5EEA A;  4ENK A;  3AG2 H;  2DYR H;  3HUG B;  3S32 A;  4A3C J;  1ON1 A;  4DNC A;  1QZZ A;  2IPQ X;  1BR4 A;  2QQA A;  3BCA A;  5D4R A;  1MBF A;  1FX7 A;  4JK1 X;  5E8G A;  4U0W A;  1V4R A;  4BHP A;  3R60 A;  1ETY A;  2XAQ A;  3ON2 A;  4KA4 A;  3DPU A;  1PUF A;  2P4W A;  3K1N A;  3CCR I;  1Y8R B;  4NN1 A;  4KFC A;  1UST A;  4P96 A;  3OOU A;  4A3L J;  1ULY A;  3JSJ A;  4BU2 A;  3A03 A;  2O0Y A;  4E7Z A;  3W2A A;  5FD6 A;  1RZ4 A;  1DP3 A;  2FBK A;  4FIS A;  1ZG3 A;  2DA4 A;  2GXG A;  3KNW A;  2X51 A;  4U0V A;  5JHU A;  1XB4 A;  2XIG A;  1JXS A;  2L5Q A;  3GTJ J;  1SMY F;  4HAM A;  5D4S A;  4A3J J;  2KIQ A;  1P4X A;  3TW7 A;  5CQG A;  2IW5 A;  3TOA A;  3DU6 A;  3KEO A;  1A6Q A;  1YRN A;  3H3V K;  2MFZ A;  1YIO A;  4A3K J;  4Y33 A;  3QPS A;  3S15 J;  1T6S A;  3VYR B;  2WAF A;  3SXY A;  1JKR C;  5BPD A;  4C3J J;  4DBQ A;  1CGP A;  2E5Z A;  3FBN B;  2CQ7 A;  2HWV A;  1UI6 A;  2M8G X;  1BI2 A;  1Z3X A;  2R7D A;  4WXD A;  5A2Q Z;  5JR3 A;  3E7L A;  2JQ7 A;  2HPI A;  5CXI A;  1XCV A;  1MDM B;  1SEU A;  3DTK A;  4RAY A;  2P6T A;  1W36 D;  3HKZ N;  2MAB A;  4CZZ A;  5L3C A;  1RUN A;  2BHZ A;  3ZQI A;  2IGN A;  4II3 A;  2LH9 A;  5H9T A;  1CF7 B;  1IG7 A;  2H09 A;  5D18 A;  3BRU A;  3R61 A;  3GTM J;  1U78 A;  1KON A;  1GV5 A;  2EIN H;  4AYB A;  1XTA A;  3GTL J;  2P8T A;  3ELK A;  2BY0 A;  3HL2 A;  5EF6 A;  1VFC A;  1KA8 A;  3SHF A;  3DEE A;  2KRH A;  2OQG A;  2LDU A;  1QZE A;  4DGW B;  5CPR B;  2L3D A;  4BQQ A;  4CA0 A;  2EA2 A;  2BEO A;  3M3Y J;  3GFI A;  1LVA A;  4BQA A;  2AXL A;  2BE5 F;  1MDM A;  5IOZ A;  5BMZ A;  2ZFU A;  2RDP A;  5LGT A;  1ON2 A;  5GAE J;  2A5W A;  2KL4 A;  3SEQ A;  3CLQ A;  2X1E A;  3RPU A;  1X1D A;  1XGN A;  4FX0 A;  1CF7 A;  1R4N B;  2MYS A;  1MJA A;  3KEY A;  1LFU P;  2M0C A;  3F6O A;  2ZC2 A;  2Y2Z A;  5LBQ A;  4OAZ A;  4V2F A;  1ZG1 A;  4XN0 A;  4M3G A;  2YR2 A;  3I55 I;  3OYC A;  2WV1 A;  4F93 B;  4IKF A;  3W6J B;  3CJR B;  4KIS A;  2CW7 A;  4HX4 A;  3OY9 A;  3WU1 B;  1R5H A;  1S9H A;  3B02 A;  4CGZ A;  2XDN A;  3HB9 A;  3FHZ A;  3CWR A;  4IJA A;  2DFH A;  3NPI A;  3R0A A;  3GLX A;  2VQL A;  2MH9 A;  4C30 A;  1J0R A;  1WSU A;  5DM7 F;  1WKM A;  3A4C A;  4A0X A;  4KMF A;  4M9Z A;  2F4O B;  3GTO J;  3FIS A;  2GFN A;  2WY8 Q;  3J7A O;  1P4W A;  3MD2 A;  1ZYR F;  1HKT A;  3BG6 A;  2W25 A;  4ESJ A;  3ZRG A;  2QOP A;  5HOD A;  4YIR X;  1WJE A;  2KZV A;  2OPT A;  2O7T A;  4OWR B;  2CG4 A;  3C7J A;  4RA2 A;  3FXO A;  5TJJ A;  3CMM A;  4R1H A;  3M8F A;  3RQI A;  4BJ6 C;  3CJD A;  1MBH A;  1HDD C;  1BW5 A;  3GWZ A;  1IGN A;  3R0J A;  4O5V A;  4MEY F;  3V7S A;  3S8P A;  3Q3S A;  4GYI A;  4YEL A;  3CCV I;  1D0Z A;  2DYS H;  2R5Y B;  2BW3 B;  1TBX A;  4XKC A;  3LL7 A;  2XRL A;  1R36 A;  1O7L A;  3GXO A;  1GXQ A;  3G1L A;  3IRR A;  5F0H A;  5D5V B;  3BCB A;  3N4M A;  3BR6 A;  3GZN B;  3VVY A;  2NAZ A;  4HG2 A;  1BIB A;  4UDS A;  3S2W A;  2IA1 A;  4ITV A;  1FNN A;  3TO7 A;  2DA7 A;  4RM2 A;  4BAY A;  1ORK A;  2JTV A;  4Y7N J;  2XF6 A;  5DD8 A;  1FWZ A;  5HLG A;  2B3W A;  3BDD A;  3TGN A;  2JA6 J;  1B9M A;  5DUK A;  3IP4 B;  1IF1 A;  2CYY A;  2HVS A;  4AUX A;  1YS7 A;  2KZG A;  3E3V A;  5M5X J;  2UWM A;  4UB6 C;  4U7B A;  1K6O A;  1I5Z A;  2BW3 A;  3C1D A;  5KNL A;  3E6M A;  2RKH A;  2XB0 X;  4I09 A;  4LK0 F;  2TDX A;  4RS8 A;  4OD5 A;  4ENM A;  3CD6 I;  2OF7 A;  4EJV A;  3GZI A;  2NS8 A;  3KP6 A;  1Z1D A;  2BHY A;  3GO5 A;  1YFH A;  3H0G J;  2R7S A;  2PFV A;  3M1C A;  1ZAO A;  4EJT A;  3K4L A;  3RKW A;  3P7N A;  3M8E A;  3OL3 A;  5L3G A;  4XLA A;  4C3H J;  3J7Y J;  5FJ8 J;  2JRM A;  1UMQ A;  4G7H F;  3BT9 A;  4A3G J;  4GRI A;  5HOO A;  1S72 I;  2XF7 A;  2FA5 A;  5DS9 A;  3HTH A;  1G3S A;  4YII A;  2LNB A;  5J8F A;  2DXI A;  1FSE A;  1TW2 A;  2ICW G;  2M1B A;  2FOW A;  4CCO A;  2F5F A;  2MLK A;  1B9N A;  4JYK A;  2W1O A;  2LD5 A;  2B0L A;  4NB5 A;  2LRE A;  3D5R C;  3OV8 A;  2YVE A;  4G7O F;  2B7E A;  1HLV A;  3CUQ C;  2JWT A;  2K40 A;  1KYZ A;  1TWF J;  4XLH A;  3L2U A;  1YE9 A;  1HF0 A;  5LRS A;  3HG9 A;  3I0T A;  2GIZ A;  2M8E A;  1X58 A;  3ZXS A;  1F9N A;  4FX4 A;  1FSH A;  1UG0 A;  3ZQF A;  3L9F A;  4ZZD A;  3MKW B;  5LHH A;  5FLV A;  5EFY A;  1SAN A;  3LSR A;  4GFL A;  1V5E A;  3KP5 A;  3LSK A;  1U3E M;  4O3M A;  3TMO A;  1Y39 A;  1YI2 I;  2QLZ A;  2R7O A;  1IRZ A;  3L2Q A;  3I56 I;  3VP5 A;  1TT5 B;  2NS7 A;  1VQ8 I;  2ISZ A;  2JN6 A;  1FBQ A;  1A04 A;  4A2U A;  1U6G A;  1T08 B;  2LFB A;  2FBQ A;  2DOF A;  1WVR A;  5GTI C;  2ZJR F;  4CYC B;  2E71 A;  5J1Y A;  3L00 A;  4ZDP A;  3WHC A;  5E3M A;  2E7X A;  4HLX A;  3QYF A;  5KAF C;  2G0E A;  2L02 A;  3ONQ A;  2L7K A;  3AG3 H;  3B81 A;  2WV0 A;  3QYB A;  4FCY A;  2A69 F;  1XMK A;  5FMP A;  3CDL A;  1D8K A;  2H1K A;  3HTS B;  3E6D A;  4E7J A;  2ELJ A;  2LP0 A;  3G1O A;  2JVG A;  3CJQ B;  3HPH A;  3FWE A;  4UVC A;  1ZG5 A;  1BW6 A;  4BHC A;  3SWH A;  1UJ8 A;  4L9T A;  4ESF A;  2VL8 A;  1TC3 C;  5ILS A;  4MQV A;  5BPI A;  1YIJ I;  1A6I A;  1S8N A;  3E5X A;  3EYY A;  3HHG A;  4G9Y A;  4CYC A;  5J40 A;  3LSP A;  3K4C A;  3MMY B;  3LNQ A;  1BR2 A;  2HXI A;  2OAZ A;  3PNY A;  3DU5 A;  2E35 A;  1VF9 A;  4BY1 J;  1XGM A;  4HEA 2;  3WTS C;  3NAU A;  1ZGA A;  1SMT A;  4C3I J;  5GAD J;  4FQG A;  4ABZ A;  1C0W A;  2FD5 A;  2ME0 A;  4HOB A;  5IT3 A;  2HTS A;  4R8H A;  1KYW A;  1WJA A;  2ZNY A;  4PUS A;  3TDU C;  3W3C A;  2CUZ A;  3ZN1 A;  2B1E A;  3VVX A;  4AVZ A;  3MFK A;  3RH2 A;  2Z1D A;  5HBU A;  4Y52 J;  5HS7 A;  5DCM B;  4ICH A;  3CMA I;  3GCM A;  4GCV A;  2X48 A;  3A02 A;  2B63 J;  5CKT A;  2DDB A;  2R7R A;  2UXU A;  1BJZ A;  3GTP J;  3E6C C;  5F04 A;  4IHS A;  1AKH B;  1YW9 A;  5EDN A;  3LJL A;  4MTD A;  1OYY A;  2HYG D;  1LQ1 A;  3KKC A;  3SFI A;  1YX5 A;  2VBY A;  2X6O A;  3KYC B;  5DCF A;  1T2K A;  3HC7 A;  3W2W A;  2YVX A;  1Z7U A;  2A05 A;  1HW2 A;  3JSO A;  5IYD J;  1ENH A;  1UHM A;  3H36 A;  4U88 A;  4ZYA A;  2HQ5 A;  3JW4 A;  1V54 H;  2KDZ A;  3TBI A;  3ZMU A;  2L9S A;  2XV4 S;  5CVV A;  2YVH A;  3HIM A;  5HAW A;  5D8L B;  3ESW B;  4MTE A;  4AID A;  5IY5 H;  4KT5 C;  1GT0 C;  3Q0V A;  1EA3 A;  5HS9 A;  1J2X A;  4D9J A;  1T0F A;  4C2T A;  5L3E A;  3H92 A;  5DCM A;  1LE8 B;  2V9V A;  4BYY A;  4LG3 A;  2UUZ A;  2XSJ C;  3BZK A;  1W5T A;  1ZGJ A;  3WG7 H;  3TOB A;  3QRF F;  4ZC3 A;  1TT0 A;  1AKH A;  3LA2 A;  2I8D A;  1WGX A;  1HBX G;  5GAG J;  1P7I A;  1XG1 A;  4XKV A;  1SFK A;  2J5P A;  3O6B B;  2KT0 A;  3HOS A;  3BZ6 A;  2ESH A;  5FRM A;  4AC6 A;  1FZP B;  1USS A;  4RB0 A;  3NRV A;  2BVL A;  2RN7 A;  3BQY A;  1QZY A;  2VBW A;  2EQR A;  1VTN C;  5LEJ A;  2OTL I;  2QQB A;  4A3D J;  1G2H A;  2EV5 A;  4LLL A;  2ZXH A;  4DVY P;  1X4P A;  3NS4 A;  3T6N A;  2DQL A;  3WOD F;  4BS9 A;  2VE9 A;  1UCR A;  1LE8 A;  2Y31 A;  3DV8 A;  1T8I A;  4RGS A;  3GZ6 A;  3JSP A;  2BVM A;  1R1U A;  1RC9 A;  4BXF A;  3RD3 A;  2VXZ A;  4A6D A;  4KIF A;  3KPH A;  3EPZ A;  3RJP A;  4XKB A;  5EEG A;  1EF4 A;  3A0H C;  5J47 A;  3FK6 A;  4I7H A;  4M71 A;  1TL8 A;  4BY7 J;  1SAU A;  1RR7 A;  4OIP F;  2WY7 Q;  1IXR C;  2VBX A;  5HLI A;  4NEL A;  3PM1 A;  5D5X B;  2WAQ A;  2TRT A;  1RET A;  2QEN A;  4CYD A;  1PP8 F;  3SJM A;  5EYR A;  3ON4 A;  1Q1H A;  2LSO A;  4KMU X;  3IV5 A;  2QYO A;  3CCQ I;  4HX7 A;  2GXA A;  4IHY A;  2X6Y A;  2DMN A;  3HDD A;  2VOD A;  2QKO A;  1O3Q A;  3DKY A;  3KYL A;  3GBG A;  4L9J A;  4OIR F;  5CVI A;  5GTH C;  2R7Q A;  3OYE A;  1XSD A;  2WA0 A;  3OYF A;  2STT A;  1JUM A;  3E7Q A;  1W5S A;  4N4O B;  3LSM A;  2IGM A;  5ERI A;  2CO5 A;  3HSE A;  1H8A C;  1IRF A;  4ZYG A;  3FZV A;  1VQL I;  2K9M A;  3CCY A;  2LKP A;  3CDH A;  4LIT A;  2L4A A;  4PJ0 C;  1E0E A;  4HV6 A;  2IXS A;  4RLQ A;  2QCO A;  2XGC A;  4Y3O A;  3E5U A;  1ZK8 A;  4YRV A;  4U7D A;  2EZL A;  3S1R J;  2EBI A;  1BI0 A;  2M0M A;  2JRT A;  2PN6 A;  3WGG A;  2ZME A;  1U5T B;  3QU3 A;  4TV7 A;  4Q5S F;  2HOA A;  2L7M P;  3NI7 A;  2PMU A;  2FNA A;  3AQT A;  3DBR B;  2GWR A;  5AIQ A;  5FKM A;  1H0M A;  3BWG A;  3FM5 A;  2CUF A;  3UR3 C;  4CSW A;  3J80 Z;  3KZ9 A;  2L7F P;  4XIC A;  1TW3 A;  2VQG A;  3QWL A;  5CVU A;  4IQ4 A;  3VFZ A;  1QU3 A;  2K4B A;  1UHW A;  2WB1 A;  2HOT A;  4JBA A;  1YQA A;  3BR0 A;  4L5E A;  4EAT A;  3QBM A;  3ML6 A;  1IV6 A;  5BNG A;  3HGG A;  3RQ4 A;  5IP7 J;  1IAW A;  1HCR A;  4B47 A;  5AQC A;  4CHU A;  1QRY A;  4EVI A;  5FKN A;  4MFD A;  2HYJ A;  4NDL A;  3ABT A;  1T95 A;  5F6F A;  3H9J A;  4L9V A;  1FLI A;  5HLH A;  1F1Z A;  4JP0 A;  4XNF A;  2FBI A;  3S2H J;  3E97 A;  2V1N A;  4XN3 A;  4CCL A;  3OIO A;  3VW0 A;  2EZK A;  2RHA A;  1XPX A;  2DBB A;  2LYC A;  2R93 J;  1HST A;  1MBG A;  4A3I J;  1D1C A;  3LWJ A;  4RLF A;  1WH5 A;  3MKL A;  3ANG A;  3P9C A;  2DOD A;  2K3P A;  2LTP A;  1X1C A;  2E36 A;  2NRA C;  1L3L A;  2FE3 A;  2XAG A;  3VSL A;  4C2M J;  3L2W A;  1NHA A;  1JGG A;  3PO2 J;  1IRX A;  3PAS A;  4HF2 A;  1VI0 A;  4ENJ A;  1AOY A;  1DGR M;  1E3O C;  2KIS A;  2NVT J;  3KFW X;  2A5Y B;  2HTJ A;  3CO7 C;  1VQO I;  3HE0 A;  3WGH A;  3OYI A;  2ZXJ A;  5EJC A;  4U9L A;  3OYA A;  1R9T J;  1ZLK A;  2LBF B;  2RNG A;  3L2C A;  4HF1 A;  5GAH J;  1MZB A;  2DG7 A;  4XSZ F;  3BY6 A;  4Z2Y A;  4P9U A;  4EJW A;  3VUQ A;  4KUM A;  2FRH A;  1JJ8 C;  5C4X J;  3ABU A;  2Z5U A;  2LY9 A;  2DMT A;  2HR3 A;  3LSI A;  2M4K A;  1YO5 C;  1LJ9 A;  2CW0 F;  2ZBK A;  5GPC A;  5FKK A;  2ZKZ A;  2R7U A;  3VIB A;  4U9N A;  2DW4 A;  1E2X A;  1SVM A;  3ZN0 A;  2A61 A;  2MGQ A;  4LK1 F;  2LVS A;  3K70 D;  3BNI A;  4BKX A;  3KLN A;  1PYV A;  4RAF A;  5HNF A;  3GFM A;  4D5F A;  4LIU A;  2DMP A;  3MZH A;  4EM0 B;  2YX4 A;  2R3S A;  3WHB A;  2HDC A;  2PJP A;  1BJA A;  4PFP A;  1SFU A;  1YOV B;  1PP7 U;  2AQE A;  4IQJ A;  3WTZ A;  4PK4 A;  1JKQ C;  1GXP A;  1BOB A;  1Z05 A;  1GUU A;  3HEF A;  3O2P E;  1JT0 A;  3LHQ A;  3HOX J;  3GVA A;  2XHK A;  3ULQ B;  2CQK A;  3W6V A;  3CCJ I;  1LKX A;  3G6E I;  4QLC U;  1D0Y A;  3JCU C;  4XL9 A;  1R22 A;  3ERE D;  1LDK B;  2YPR A;  2Y0M A;  1VQP I;  2BV6 A;  1ZQ3 P;  4XLN F;  5CJ9 A;  1IO2 A;  1IJW C;  4I02 A;  2V6E A;  1I6H J;  1LPQ A;  3C3W A;  2JT1 A;  4CXF A;  2IVM A;  2XGE A;  4IHX A;  2DMQ A;  1Z77 A;  1YIT I;  4KDP A;  3K2A A;  3MNL A;  1WPK A;  1OLT A;  3QOD A;  3I71 A;  5IYC J;  1G4D A;  5TRD A;  1HA8 A;  3JRD A;  3BOQ A;  3EDP A;  1K78 B;  2KMU A;  1EH7 A;  2KLO A;  4FHT A;  5BQT A;  3WTX C;  1XSV A;  2LC2 A;  2VQH A;  1TWA J;  1R1T A;  3FMS A;  2FNP A;  4HDU A;  5B66 C;  4HZF A;  2MG4 A;  1LFB A;  1ETQ A;  4CCK A;  3HUG A;  4XRF A;  3A01 B;  2M45 A;  2ZXW H;  4OMY A;  2KQR A;  1IN6 A;  3GYH X;  4DBR A;  4ZYH A;  3Q9S A;  4E7K A;  2NVQ J;  2V57 A;  3HOV J;  4HRI A;  4AVP A;  2FOK A;  4EJO A;  3IUV A;  1BOA A;  2GQQ A;  1QGP A;  2CSO A;  1N75 A;  3VDX A;  1VQK I;  1B6A A;  1OMI A;  2KJB A;  3C2H A;  1MNE A;  3E5Q A;  4OIN F;  4ASN A;  1K78 A;  4I76 A;  1P4A A;  2QQ9 A;  2XPU A;  4XLP F;  2FUG 2;  3L7W A;  1Z7L A;  4QIW N;  4PCQ A;  2V1X A;  4UVB A;  5C4Y A;  1GDT A;  5J1R A;  2EV6 A;  4CCJ A;  4PJJ A;  3CTA A;  4PXI A;  4Y15 A;  3BJ6 A;  3HSF A;  2EFW A;  3DBL B;  1H9T A;  2L54 A;  2FMY A;  5BOX A;  1DU6 A;  1K6Y A;  1MMN A;  3BTL A;  3K70 C;  1BBY A;  2MH2 A;  1IDY A;  5ICE A;  1IXC A;  1UZC A;  4HNV A;  4ZTF A;  1WH7 A;  2LY1 A;  3PUB A;  2PJR B;  1KU3 A;  2QKM B;  3TQN A;  1A5J A;  3PQK A;  1PVE A;  4UUS B;  4BE1 A;  1T0F C;  4KT6 A;  4NC8 A;  4P9F A;  4M6Y A;  3WTU C;  3HTJ A;  2M4G A;  4KIT B;  1RES A;  2XSD C;  2OBP A;  5FGM A;  3ERM A;  4DZP A;  2Q0O A;  1X1P A;  4JX4 A;  1WFX A;  2NNY A;  3MN2 A;  2AQF A;  2ZO4 A;  2XC7 A;  2K9L A;  5FLM J;  2HQA A;  2VT2 A;  3IH4 A;  2O8X A;  2PMZ N;  2RAE A;  3AKZ A;  4EV0 A;  4BE0 A;  1FOK A;  2D5V A;  2IJL A;  4P5O A;  4WX9 A;  2VPR A;  3QOP A;  3EYI A;  2Y0S A;  2ZOZ A;  2X1D A;  2QSG X;  1Y8Q B;  3AQS A;  4D7N A;  1YS6 A;  2EFP A;  3CZ6 A;  3KP2 A;  1EJ9 A;  2PJR A;  2M9H A;  3GZ5 A;  4M72 A;  4UUS A;  2OZ6 A;  2GA1 A;  3CP2 A;  1ONV A;  2PEX A;  1SFO J;  2QSH X;  2ZJQ F;  3S93 A;  5HNH A;  5J4V A;  2AXT C;  5E1X A;  5KHD A;  2DK8 A;  1J9I A;  2UXO A;  3NEU A;  1QPM A;  4KIB A;  2W48 A;  2XKP A;  3GF2 A;  2F2E A;  1JKP C;  1W0U A;  1TQP A;  1G59 A;  2RGV A;  4N9I A;  2EZI A;  1W5C C;  4BNC A;  1QHH D;  2O6G E;  1NTC A;  3WU0 A;  2JA8 J;  1P6R A;  1T56 A;  5FKO A;  4ZDO A;  2JZY A;  2P6S A;  4R79 A;  1FY7 A;  2Z33 A;  2R7V A;  3AFH A;  3OL4 A;  5M3F J;  4ZTJ A;  1IRG A;  5EGO B;  5K5Q A;  2GOX B;  1XMA A;  3BPV A;  1W36 C;  4II2 A;  3M07 A;  1OCR H;  3CCL I;  4YG2 F;  3ECO A;  4Q48 A;  2BY1 A;  3JRG A;  2HQN A;  3LOC A;  4GXO A;  3CO6 C;  1BC8 C;  2CGP A;  2WUI A;  3PSF A;  5J1U A;  2Y75 A;  3DPL C;  1XS9 A;  5GPA A;  3WE2 A;  4BQN A;  4XLE A;  1O7F A;  3BJB A;  2XUB A;  3GFJ A;  3QP5 A;  3Q9V A;  2IA2 A;  3MKY B;  2B9S A;  3ZR8 X;  4B3A A;  2O7O A;  5IP6 A;  1YLF A;  2V9K A;  2OQR A;  3PFY A;  1MH4 A;  1XCB A;  5FRN A;  2DLL A;  5K1Y A;  1T39 A;  2JA2 A;  3AL0 B;  4XOT A;  4N0B A;  1DU0 A;  4CUG A;  5EGO A;  3NWT A;  2IS1 A;  2MD5 A;  9ANT A;  1STZ A;  3VWB A;  2ZME C;  3BR1 A;  3LSJ A;  2R5Y A;  4OIQ F;  2PLY A;  2EFQ A;  2QGU A;  3ZGK A;  2CRG A;  3RIR A;  3VOD A;  3U9G A;  2FJI 1;  2EV0 A;  2F4I A;  3HGY A;  1P2F A;  3B6C A;  2CQX A;  4JX5 A;  4UXN A;  2O9L A;  2XRN A;  3V6G A;  4A12 A;  1RRJ A;  1SAX A;  2IRF G;  3O8H A;  1VQ7 I;  5HVQ C;  3OYB A;  4LIV A;  3S3M A;  1RKW A;  2R0Q C;  2H8R A;  2ZNZ A;  1ZKG A;  3D0S A;  5IP9 J;  2ADU A;  4LFU A;  5K7F A;  5K5R A;  1N25 A;  1XMX A;  2A2F X;  5FGL A;  3K2Z A;  3JAM K;  2BY2 A;  5JHF A;  1O57 A;  2GZW A;  2Q8K A;  4H0E A;  1B4A A;  1U5T C;  2Y69 H;  5B5E C;  1ZR2 A;  4WWC A;  1RUO A;  4YIF A;  2HKX A;  2HI3 A;  2CV0 A;  2XAJ A;  5F64 A;  4GYG A;  5C3E J;  4HST A;  5E3N A;  3TED A;  1VQ6 I;  2DPU A;  1OPC A;  1JKO C;  5HDN A;  3OIP A;  1JTY A;  2PQ8 A;  1SD7 A;  2L2O A;  3UNG C;  2H6C A;  3ZQH A;  1MH3 A;  5DD4 A;  2RQQ A;  1FP1 D;  4HBL A;  1FMW A;  1X3W B;  3KCC A;  1L0O C;  4ME9 A;  3ZP5 A;  4PSX A;  2XGD A;  3CF2 A;  3IL2 A;  2A68 F;  1TP4 A;  1D1A A;  4CDG A;  5EG0 B;  2X9D A;  2IA0 A;  3PIO F;  4M3B A;  5D6E A;  4NUB A;  3DLA A;  3IKT A;  4RGX A;  1XGS A;  4M6X A;  3O60 A;  1Z3Y A;  2W4S A;  4HV5 A;  2FQ3 A;  5CW8 A;  4RB1 A;  3K4B A;  1MND A;  2IEK A;  4XM3 A;  3ZCO A;  2WAQ N;  3TP0 A;  3H5R A;  2EJR A;  4AM3 A;  2CUE A;  3P9T A;  1FYL A;  5D8K B;  4LJZ F;  1ZTR A;  1E3H A;  1WZ2 A;  3FIW A;  5J6X A;  6PAX A;  2GOM A;  2X1C A;  1APL C;  3FXK A;  2LLK A;  3G7R A;  2CV2 A;  2DFE A;  3GTK J;  4WCG A;  1EV7 A;  4ZYD A;  3F1B A;  1TTY A;  5J8C A;  2KPM A;  3CUO A;  2EWN A;  1FOX A;  2A3S A;  2VE8 A;  5EG0 A;  2HZD A;  1RNL A;  1XSX A;  4FTH A;  4XON A;  3VOE A;  2CUJ A;  3CQZ J;  5ICG A;  3DTE A;  3CDI A;  1VQ9 I;  1YHQ I;  1WHU A;  2LKS A;  2DU9 A;  3PFI A;  2K7L A;  2VT3 A;  2DO7 A;  3HIF A;  3RYP A;  1G8X A;  2JA5 J;  1SD6 A;  3W2V A;  3TDZ C;  2DAO A;  2KKO A;  3KE2 A;  4CGR A;  1UEL B;  3QAH A;  3ZQC A;  2QA4 I;  3FK7 A;  1P9Q C;  4BBR J;  3PSI A;  2IT0 A;  2DPD A;  4IEJ A;  5FLX K;  5HDG A;  3V7C A;  3BTC A;  5ED4 A;  3S1M J;  2V79 A;  2M87 A;  4IRH A;  1J5Y A;  3N05 A;  3I64 A;  3ANP A;  1MMD A;  2P5K A;  4WF2 A;  3I5U A;  3JR9 A;  1O3R A;  3GME A;  2R7X A;  3LAJ A;  3CME I;  3PJR A;  2VN2 A;  2WB1 N;  4RBO A;  2IGK A;  2K9N A;  4P1W A;  4QPQ A;  3DBH B;  3WE3 A;  1WJC A;  1MNM C;  2ME6 A;  1ETX A;  3AG1 H;  5DAJ A;  2ACJ A;  2XPV A;  5E8I A;  2PFB A;  5DUI A;  3ABK H;  2MSY A;  3R6S A;  3MZ8 A;  3KYD B;  1R5G A;  2VC0 A;  5FFX A;  1U8R A;  3GUD A;  3D5L A;  4V2G A;  2MLG A;  4HA8 A;  5E17 F;  2K9Q A;  3MKZ A;  5LGU A;  3ASN H;  3TL4 X;  3MVP A;  4LG0 B;  2R7T A;  3K4M A;  2YS9 A;  1WCM J;  5F08 A;  1TNT A;  3HRS A;  5H2F C;  3ZMV A;  2O61 A;  2QTQ A;  4BXU A;  2V6C A;  2DK5 A;  1Y0N A;  2W53 A;  1NG6 A;  2M5W A;  5ILU A;  4AIH A;  5H6R A;  2D45 A;  3K0L A;  2L0K A;  5J4Y A;  2MA3 A;  4BJ5 C;  2OV7 A;  3K4J A;  1AA7 A;  3HSR A;  4IPA A;  2X6X A;  4FE7 A;  2FQ4 A;  3LQQ A;  4PGH A;  1ZH5 A;  4I01 A;  4XLF A;  5E1Z B;  3QOE A;  1MKM A;  1FBS A;  1ZRD A;  3M4O J;  1DQU A;  5KK1 A;  3QPH A;  5ICC A;  3GEU A;  4BDZ A;  3S2D J;  4PJL A;  3AAF A;  1MSF C;  1JHH A;  3HOT A;  2L9R A;  3K9T A;  4A5M A;  4JNN A;  4M9X A;  2ECC A;  1AHD P;  3HOU J;  1BR1 A;  4LLG F;  2WAD A;  4M6V A;  2IBD A;  1JUP A;  2P5L C;  3A2K A;  2PMH A;  2LF8 A;  5CYV A;  4O6J A;  2VI6 A;  2VB6 A;  4KIC A;  3F22 A;  2BXY A;  3DP7 A;  2Z9O A;  2H1L A;  4IX7 A;  5EZG A;  3DLL F;  3MEX A;  1N78 A;  2L01 A;  3IHU A;  3PL8 A;  3CMY A;  3M9A A;  4X1E A;  4OD4 A;  2E60 A;  1R7J A;  5HDK A;  3I58 A;  5JLW A;  3CC2 I;  2OER A;  1Z21 A;  1QVU A;  3MQ0 A;  4DYQ A;  1RPW A;  2O8K A;  5TGT A;  2HS5 A;  1HKS A;  2E2I J;  3NNR A;  1OYW A;  1ZLJ A;  1FTT A;  2F5V A;  2VKE A;  2LR8 A;  3S17 J;  2HVQ A;  4L5I A;  1BN5 A;  2K86 A;  4DJA A;  5B1A H;  3U2R A;  2AO9 A;  3OYG A;  3LST A;  2M2E A;  5LEK A;  3P9I A;  3G71 I;  3K8P C;  2XB5 A;  4E6K G;  3CCU I;  3G4S I;  2HOE A;  3QKX A;  3M7G A;  3COA C;  1A31 A;  1ETW A;  4UV9 A;  3ROU A;  1V5G A;  4I0A A;  4A3E J;  2FEZ A;  4KJZ A;  2DJN A;  4A0Y A;  2TCT A;  2HDW A;  3JRI A;  2RQP A;  2IU5 A;  3CC7 I;  3T8R A;  3F8B A;  3BCG A;  2YUS A;  3JRF A;  1ZGW A;  4LOC A;  1POG A;  4Y13 A;  5CLS A;  3VSK A;  2KFD A;  1MJB A;  4ESB A;  3FRQ A;  4Z6Y A;  5FB2 A;  4QSH A;  2J5O A;  4NC7 A;  4AC0 A;  4IHV A;  1UI5 A;  5F0F A;  3VEP A;  1UG2 A;  2H94 A;  2D2W A;  4YEJ A;  3F3X A;  1NG7 A;  5M5W J;  1OKR A;  5F27 A;  4N9H A;  4Q47 A;  4YFX F;  3FMQ A;  3UKG A;  3L1P A;  1LNW A;  2FML A;  2OTJ I;  1E17 A;  4DYC A;  2F48 A;  2GBY A;  3IH2 A;  3DPT A;  3NRG A;  1JT6 A;  2UXX A;  5LFA A;  1QVT A;  2CFO A;  4E7I A;  4MNU A;  3H35 A;  1BI3 A;  2Y9Z A;  1LEB A;  3HTI A;  1AU7 A;  2CJJ A;  2DA3 A;  3H9Q A;  4CCM A;  4EM1 A;  3ZMT A;  1NK3 P;  2WAE A;  2UZK A;  3IAM 2;  3K7A J;  1X3Z B;  3TO9 A;  4B1R A;  1D5V A;  3ABM H;  1MD0 A;  2VPL A;  2ZY9 A;  1U5T A;  3FX3 A;  3HJE A;  2ELK A;  3OOP A;  2PBI A;  1ZN2 A;  2IAI A;  3JRE A;  4F3Q A;  2CH0 A;  2OC6 A;  1MSE C;  1R5I D;  3QYE A;  1GVJ A;  2K3F A;  2QQ8 A;  3CES A;  2MC3 A;  3OS2 A;  3GFL A;  3DXJ F;  4FET A;  2IP2 A;  1HKQ A;  3BR3 A;  4M74 A;  3SEZ A;  3V78 A;  1IN5 A;  1Z67 A;  2JSP A;  3BG5 A;  1I1S A;  3RYR A;  4AYB N;  3J7Z I;  2VKV A;  3I54 A;  4LB5 A;  1HQC A;  1UB9 A;  1Y1V J;  1REP C;  4HPQ A;  1FBU A;  1SGM A;  1HW5 A;  2M3A A;  2QVO A;  2V4J C;  2HPM A;  5LRR A;  2CQN A;  1SC7 A;  2CV1 A;  5LLQ A;  3H9G A;  4QWQ A;  2I5U A;  2OD5 A;  3F9K A;  3PO3 J;  4XSX F;  1JUS A;  3E0J B;  2X6W A;  3AL0 C;  3DTI A;  5D6F A;  4HNT A;  3V4G A;  1FOY A;  2DOA A;  3FXU A;  3VOK A;  4IOA F;  3OS0 A;  2FF4 A;  2E5N A;  2XAF A;  3BG7 A;  4LD5 A;  4Q4Z F;  3HRT A;  4IRI A;  1TNS A;  3OYJ A;  4HNU A;  3J7A Y;  2OI8 A;  3X2Q H;  3HYI A;  2Y0S N;  2F5C A;  1IZ1 A;  2BYV E;  2KJC A;  3E1S A;  1EH6 A;  5L3F A;  4D0P A;  1ACI A;  3EUH A;  1MW7 A;  5LGN A;  3KX2 A;  1SFE A;  4I98 B;  1FMV A;  1U8B A;  2NP5 A;  3ZMS A;  3DKW A;  3HTU A;  4GGG A;  4XOP A;  4UB8 C;  3CCM I;  2LKX A;  3S1N J;  2VC1 A;  1FPQ A;  2R5Z B;  3HOZ J;  3PIP F;  3G73 A;  1BL0 A;  2XPW A;  3V8J A;  3K6G A;  3VW2 A;  3HBL A;  2FSW A;  2L7Z A;  1IXS B;  5JFR A;  2VLA A;  3FKJ A;  1LUJ B;  1S29 A;  1XX5 A;  2E1O A;  4CH7 A;  3JRB A;  1FP2 A;  2LBF A;  4A3B J;  1UFM A;  4MO7 A;  1WI3 A;  2VJI A;  4LB6 B;  3ZPL A;  3U1K A;  2NOG A;  4ETS A;  3JRC A;  1RIO H;  3OWT A;  4FT8 A;  1ETK A;  2G9W A;  2W82 A;  4HYE A;  4EMS A;  5JVT A;  1AWC A;  2QIB A;  1JGS A;  1U2W A;  3JRH A;  4KIG A;  3ASO H;  4NBQ A;  4IVN A;  3P9K A;  2NP3 A;  1DUX C;  3I59 B;  4AIK A;  2LK2 A;  3WTT C;  2FXA A;  2GA2 A;  3OYH A;  3BTJ A;  1FYM A;  1SD5 A;  3RI4 A;  1MMS A;  4X6A J;  5M5Y J;  2V26 A;  1R6R A;  3J81 K;  3V42 A;  1Q1V A;  2R5Z A;  3KIO A;  2G7G A;  2RC4 A;  2GIV A;  2LMD A;  3SFZ A;  4S05 A;  1MBK A;  4XRM A;  4M3D A;  4EJU A;  3FDY A;  1KU9 A;  3BR5 A;  2GEN A;  2VOP A;  1I1G A;  5IYB J;  2K5C A;  4MIM A;  1YRN B;  4MK6 A;  1MBJ A;  3ZOB A;  2RV8 A;  1FYK A;  3FXQ A;  2EFN A;  2EIJ H;  4XLC A;  4U0Y A;  1OCT C;  4B09 A;  2DA1 A;  3TW6 A;  2QKL B;  3SQN A;  1WRJ A;  3I59 A;  4JX6 A;  2HYF A;  5AON A;  2VJ4 A;  4S0H B;  1X1B A;  1UHS A;  2OCE A;  4XRS G;  3WG9 A;  5E18 F;  3LAP A;  5B3S H;  2WGB A;  3KZZ A;  1FT9 A;  2VKH A;  4G6T B;  4LLN A;  3FMR A;  4E70 A;  5HSZ A;  1X4O A;  2JA7 J;  1R49 A;  2LF7 A;  4M9S A;  1D1B A;  3ZQG A;  4M3F A;  2E1M B;  4RM3 A;  5HLT A;  5E3O A;  4I2O A;  3NAR A;  5HS8 A;  1O3S A;  2CMP A;  1M1E B;  1B1B A;  1Z6R A;  3LSG A;  3D1N I;  1J09 A;  2DOE A;  4B43 A;  3DEU A;  2DG8 A;  2EFO A;  1EKE A;  3HHH A;  2WTE A;  1J75 A;  2M7A A;  2F5E A;  2OCC H;  3BJA A;  3NQO A;  4M3E A;  2E2J J;  3OIQ A;  4IRG A;  1OYI A;  3A01 A;  2YU3 A;  4XBF A;  1DPR A;  4OAY A;  1SVL A;  3F0C A;  4BE2 A;  5CVJ A;  4A69 C;  5K58 A;  2KIF A;  1ZRC A;  5IT9 Z;  4XMY A;  1OCZ H;  1T33 A;  4IXA A;  4DYR A;  4JL3 A;  3LFK A;  3OSG A;  4B3X A;  4J01 A;  1MMA A;  3BR2 A;  5CVR A;  2NOJ B;  3BZC A;  3EUA A;  4P55 A;  4G7Z F;  5A2Q K;  4ENN A;  5KAI C;  1K4T A;  2V9P A;  5IT9 K;  2K4J A;  4PJM A;  3V8L A;  3H0D A;  1GVD A;  1YG2 A;  2LOO A;  4RDU A;  3VYT B;  3I4P A;  1PUE E;  1F4K A;  1F36 A;  4A3F J;  1O3T A;  3ZQQ A;  3CCE I;  2OZU A;  2MD0 A;  3F6V A;  1SFX A;  2A6H F;  4J19 A;  2JUG A;  4JKZ A;  2ZCX A;  2JSC A;  4W97 A;  5EZH A;  2ELH A;  1DPU A;  4IF4 A;  2DMU A;  3RTR A;  3BTI A;  4IO9 F;  1PJR A;  2W84 A;  5D5W B;  1U9O A;  2ZJ2 A;  2K27 A;  3K1P A;  2QBY B;  1VND A;  2CW8 A;  2OJE D;  5FHP A;  3QPT A;  3PNT A;  3VYS B;  5C4J J;  2COB A;  2LY2 A;  3EET A;  4HQE A;  1HC8 A;  3CC4 I;  1K83 J;  2MBF A;  1Z9C A;  4IL6 C;  4B44 A;  4ANJ A;  3OYM A;  2D1V A;  3EUK L;  2DTR A;  3HOY J;  2HNH A;  1K7A A;  4GDF A;  4NHJ A;  5C44 J;  3TO6 A;  1Z91 A;  1ZEL A;  2BBY A;  1YJW I;  5IPA A;  2BZT A;  3NWS A;  3FXJ A;  2Y48 A;  3ZQL A;  3QP6 A;  4YZE A;  3BRO A;  3RKY A;  4CZC A;  1BA5 A;  1JE8 A;  1I6X A;  4L0Y B;  2RVC A;  3EQL F;  1TWH J;  1I39 A;  2DCE A;  4MHG A;  1X3U A;  2HGC A;  2Y30 A;  4HKU A;  1P92 A;  2HYT A;  4C2U A;  3MZY A;  3RSN A;  1LDD A;  2RRE A;  3L2R A;  2QBY A;  5DEQ A;  3JTH A;  2KRF A;  4XOR A;  2DFI A;  3SDB A;  1FIP A;  3KZI C;  4HW0 A;  5M3M J;  1YW8 A;  1KGS A;  3IUO A;  1RI7 A;  2Y9Y A;  1H88 C;  2E19 A;  2I10 A;  2XDV A;  2A6E F;  5K7H A;  1ZR4 A;  3H5N A;  4GCT A;  4L62 A;  3T1B A;  2BXZ A;  2A07 F;  2HFH A;  4QPO A;  4MQ9 F;  3W6K B;  2PZ9 A;  1JI8 A;  4RGU A;  3KKD A;  4IZZ A;  4I6Z A;  2WBM A;  1S7E A;  3DQV C;  4GFB A;  1MJ9 A;  1YJ9 I;  4UNO A;  3WTY C;  3OYD A;  2R4G A;  2W85 A;  3S3N A;  3GTG J;  3BQZ A;  2N8G A;  4RGR A;  1FJL A;  1XDS A;  3WTV C;  4JQF A;  1K79 A;  1K4S A;  1D5Y A;  4AU7 A;  4ACI A;  4U87 A;  3I53 A;  3JAM Z;  1FC3 A;  3A0B C;  1HDP A;  1HSJ A;  1XC5 A;  3HZJ A;  4BDY A;  2GUH A;  4HX8 A;  1TZL A;  1OR7 A;  2XKO A;  3K1M A;  2Q24 A;  1J59 A;  5D1R A;  1U9N A;  1UAA A;  1X1A A;  3HOW J;  1F5T A;  3HM5 A;  1TWC J;  4PFO A;  1ZRF A;  4AF5 A;  4K2E A;  3EGQ A;  1W7P B;  2HQR A;  1RR8 C;  1MBE A;  2CU7 A;  4OU0 A;  4E7L A;  1FEX A;  3CRJ A;  4BUP A;  1MMG A;  3Q0U A;  4IRV A;  2DTZ A;  3M8J A;  2RNJ A;  3C07 A;  3LWF A;  1KQ8 A;  5BS6 A;  3S3O A;  4NNJ A;  3CF5 F;  3RKQ A;  4XQF A;  1ERD A;  5EEH A;  2JJ7 A;  2ZJP F;  3T0Y A;  1G3T A;  1R71 A;  1YTY A;  3HKZ A;  4RB3 C;  3H1C A;  2UXP A;  2VBZ A;  4RMN A; 
#chains in the Genus database with same CATH homology
 3MKL A;  1U78 A;  3ANG A;  4B4C A;  1GV5 A;  3M4O J;  2NVX J;  3GEU A;  3GTL J;  2LTP A;  3S2D J;  2G3B A;  5EF6 A;  1MSF C;  4C2M J;  1VFC A;  1JGG A;  3PAS A;  3PO2 J;  2F07 A;  2L9R A;  1VI0 A;  3Q0W A;  3IH3 A;  1E3O C;  4JNN A;  2NVT J;  3HE0 A;  2ECC A;  3M3Y J;  2QWT A;  1AHD P;  3HOU J;  1X2N A;  4A3M J;  1R9T J;  4M6V A;  1QPI A;  2IBD A;  4MLO A;  1JUP A;  5IOZ A;  2GLO A;  2DG7 A;  2VI6 A;  3VW1 A;  3S14 J;  3VUQ A;  5EZG A;  1LFU P;  3CMY A;  1JJ8 C;  2M0C A;  5C4X J;  4X1E A;  2Y2Z A;  4V2F A;  4M3G A;  2LY9 A;  2DMT A;  5JLW A;  2ZCN A;  4GCK A;  2OER A;  2WV1 A;  4XK4 A;  4W1U A;  5GPC A;  1QVU A;  2K9S A;  5FKK A;  4DYQ A;  3VIB A;  2XDN A;  3HB9 A;  1RPW A;  2O8K A;  3CWR A;  3NPI A;  2MGQ A;  2LVS A;  3BNI A;  4BKX A;  2E2I J;  3NNR A;  1FTT A;  4D5F A;  2VKE A;  3S17 J;  2LR8 A;  3GTO J;  2DMP A;  3FIS A;  2GFN A;  3WHB A;  2AO9 A;  2M2E A;  1FTZ A;  2QOP A;  5HOD A;  2XB5 A;  4GFK A;  2OPT A;  1JKQ C;  2G7L A;  2R7Z J;  2G7S A;  2O7T A;  3QKX A;  2DA5 A;  1GUU A;  3HEF A;  1JT0 A;  1ETW A;  3LHQ A;  3HOX J;  3RQI A;  3CJD A;  1MBH A;  4A3E J;  3W6V A;  1HDD C;  1BW5 A;  1IGN A;  2DJN A;  3JRI A;  2TCT A;  2IU5 A;  3EUP A;  3Q3S A;  3BCG A;  2YUS A;  3JRF A;  1ZGW A;  4LOC A;  1POG A;  3BG3 A;  2R5Y B;  1ZQ3 P;  1IDZ A;  1IJW C;  1I6H J;  2XRL A;  5D19 A;  3FRQ A;  4D5C A;  2XGE A;  4IHX A;  2DMQ A;  1Z0X A;  1Z77 A;  3G1L A;  4QSH A;  4AC0 A;  3DEW A;  3K2A A;  5F0F A;  4IHV A;  1UI5 A;  3MNL A;  1UG2 A;  4GCL A;  5F0H A;  1WPK A;  5M5W J;  5IYC J;  3BR6 A;  5F27 A;  3VVY A;  2M34 A;  3JRD A;  3BG9 A;  4UDS A;  2DA7 A;  3UKG A;  3L1P A;  1ORK A;  4Y7N J;  1TWA J;  4DYC A;  2GBY A;  3IH2 A;  3NRG A;  1JT6 A;  4IHW A;  2MG4 A;  1ETQ A;  1LFB A;  1QVT A;  2JA6 J;  3A01 B;  2Y9Z A;  3HTI A;  1OFC X;  1AU7 A;  4AUX A;  2CJJ A;  2DA3 A;  4KWA A;  2FX0 A;  3TP3 A;  5M5X J;  1NK3 P;  2NVQ J;  1B72 B;  3HOV J;  2V57 A;  3K7A J;  4B1R A;  2NX4 A;  2XB0 X;  5K7Z A;  3IUV A;  2ELK A;  2IAI A;  3JRE A;  3I4M J;  5JLX A;  1MSE C;  2OF7 A;  3GZI A;  2NS8 A;  1P7J A;  1JJ6 C;  2DA2 A;  3H0G J;  3V78 A;  3BR3 A;  4I76 A;  3BG5 A;  2XPU A;  3NXC A;  4AYB N;  4QIW N;  5C4Y A;  4C3H J;  2VKV A;  5FJ8 J;  1GDT A;  5J1R A;  1UMQ A;  3BT9 A;  4A3G J;  4PXI A;  1TWG J;  1Y1V J;  3FKI J;  3OSF A;  5DS9 A;  1SGM A;  1DU6 A;  1NK2 P;  3HTH A;  3BTL A;  1IDY A;  4HNV A;  1WH7 A;  3I4N J;  1O4X A;  1B72 A;  3PO3 J;  4JYK A;  1JUS A;  2LD5 A;  1A5J A;  1H89 C;  2YVE A;  4UUS B;  1HLV A;  2JWT A;  2K40 A;  1TWF J;  3VOK A;  1HF0 A;  3HTJ A;  1RES A;  2ZB9 A;  1X58 A;  2XSD C;  4DZP A;  2OI8 A;  3ZQF A;  4JX4 A;  3SDG A;  3MN2 A;  2Y0S N;  5FLV A;  5FLM J;  3IH4 A;  3PPB A;  1SAN A;  2PMZ N;  2RAE A;  3LSR A;  4GFL A;  5EFY A;  2RAS A;  2D5V A;  1IRZ A;  2VPR A;  2ZOZ A;  3VP5 A;  2EH3 A;  2NS7 A;  2EZH A;  2JN6 A;  3AQS A;  1U8B A;  4D7N A;  4G12 A;  2NP5 A;  2LFB A;  2LKX A;  3S1N J;  2R92 J;  2FBQ A;  2MW8 A;  2R5Z B;  3HOZ J;  1B8I B;  2M9H A;  2XPW A;  1BL0 A;  4CYC B;  4UUS A;  5J1Y A;  3VW2 A;  3HBL A;  3WHC A;  5E3M A;  2L7Z A;  1SFO J;  3B6A A;  2G0E A;  5CXG A;  2E1O A;  4MFE A;  4DZJ A;  3JRB A;  4A3B J;  3B81 A;  2UXO A;  4MO7 A;  1WI3 A;  2W48 A;  2NOG A;  3JRC A;  4FCY A;  1JKP C;  5IOY A;  3S1Q J;  3CDL A;  1W0U A;  5FMP A;  2AHQ A;  2QIB A;  1ETK A;  2EZI A;  2H1K A;  1NTC A;  2JA8 J;  1T56 A;  5FKO A;  3JRH A;  1RKT A;  2LP0 A;  3G1O A;  4XRS A;  2NP3 A;  4D7M A;  2LK2 A;  5M3F J;  1BW6 A;  5EGO B;  3BTJ A;  4BXX J;  4X6A J;  5M5Y J;  1TC3 C;  1I50 J;  4FE4 A;  1Q1V A;  2R5Z A;  1B8I A;  1A6I A;  1GV2 A;  1X2M A;  2G7G A;  1FIA A;  4CYC A;  3LSP A;  3JRG A;  3LOC A;  2WUI A;  3LNQ A;  1MBK A;  5J1U A;  2HOS A;  4XRM A;  2HXI A;  3C2B A;  4M3D A;  2YU9 J;  3BR5 A;  2GEN A;  5F0C A;  1HOM A;  1XS9 A;  1VF9 A;  4BY1 J;  5GPA A;  5IYB J;  4MIM A;  2FJ1 A;  3NAU A;  1YRN B;  3BJB A;  4C3I J;  4MK6 A;  1MBJ A;  3ZOB A;  4ABZ A;  2FD5 A;  4B3A A;  1Y1W J;  2ME0 A;  2O7O A;  5IP6 A;  1OCT C;  2GM4 A;  2UXI A;  2DA1 A;  1MH4 A;  3TW6 A;  3VVX A;  3RH2 A;  4JX6 A;  2CQQ A;  5HBU A;  4Y52 J;  4S0H B;  1DU0 A;  1UHS A;  4XRS G;  5EGO A;  2JMW A;  2D6Y A;  3G1M A;  4ICH A;  9ANT A;  3BR1 A;  3LSJ A;  2X48 A;  2R5Y A;  2WGB A;  3A02 A;  2B63 J;  1ITY A;  3BHQ A;  3DCF A;  2HDD A;  2UXU A;  1BJZ A;  1IUF A;  3VPR A;  3GTP J;  5HSZ A;  2DA6 A;  5F04 A;  2CRG A;  2JA7 J;  1AKH B;  5EDN A;  3RZD J;  3LJL A;  3G56 A;  3KKC A;  3ZQG A;  3HGY A;  4UUT A;  3SFI A;  2X6O A;  4BBS J;  3B6C A;  1IC8 A;  4M3F A;  5E3O A;  5DTD A;  2CQX A;  3NAR A;  4JX5 A;  5IYD J;  2O9L A;  1ENH A;  3V6G A;  2UXH A;  2HXO A;  3O8H A;  2HQ5 A;  3LSG A;  3D1N I;  2ID3 A;  1RKW A;  1JTX A;  2KDZ A;  2R0Q C;  2DG8 A;  2H8R A;  1ZKG A;  5IP9 J;  2YVH A;  1OCP A;  4M3E A;  3HIM A;  3RZO J;  5K7F A;  2E2J J;  5HAW A;  4MXM A;  3A01 A;  1W0T A;  1GT0 C;  3Q0V A;  5FGL A;  1ETV A;  3F0C A;  5K58 A;  4A69 C;  1LE8 B;  5J3L A;  1T33 A;  1ZR2 A;  4DYR A;  4JL3 A;  2ID6 A;  3OSG A;  2HI3 A;  5E3L A;  1AKH A;  1WGX A;  3BR2 A;  1CQT A;  5C3E J;  5E3N A;  1OJL A;  1P7I A;  1XG1 A;  3TED A;  1JKO C;  2KT0 A;  2NVY J;  1JTY A;  3HTA A;  1GVD A;  4AC6 A;  4RDU A;  1F36 A;  4A3F J;  3BQY A;  3ZQH A;  1MH3 A;  3QPL A;  2EQR A;  1G2H A;  4A3D J;  4EEF G;  2QF7 A;  4ME9 A;  2XGD A;  3T6N A;  5EG0 B;  2X9D A;  4A93 J;  4J19 A;  1LE8 A;  4M3B A;  2Y31 A;  2VUM J;  4JKZ A;  2ZCX A;  4W97 A;  5EZH A;  2HKU A;  3O60 A;  3RD3 A;  2DN0 A;  3GTQ J;  5CW8 A;  4DW6 A;  5FKL A;  2DMU A;  2IEK A;  3BTI A;  3DPJ A;  2ZCM A;  2E2H J;  2WAQ N;  3TP0 A;  1EF4 A;  2ZOY A;  1U9O A;  3FK6 A;  2CUE A;  1VND A;  3P9T A;  2REK A;  3QQA A;  4BY7 J;  1ZTR A;  1RR7 A;  5FHP A;  1I3Q J;  2P81 A;  5C4J J;  2COB A;  2ECB A;  3FIW A;  4NEL A;  3PM1 A;  1K61 A;  1APL C;  1K83 J;  2TRT A;  1RET A;  2LLK A;  3GTK J;  1PUF B;  3G7R A;  3SJM A;  3F1B A;  5EYR A;  3ON4 A;  3S16 J;  3VVZ A;  3HOY J;  3IV5 A;  2PBX A;  3O8G A;  5C44 J;  4QTR A;  2QKO A;  4IHY A;  5EG0 A;  2DMN A;  5IPA A;  4XID A;  4FTH A;  3HDD A;  1ETO A;  3ZQL A;  3GBG A;  3CQZ J;  4YZE A;  3VOX A;  2JK3 A;  1BA5 A;  1JUM A;  3E7Q A;  3S5R A;  2JA5 J;  1TWH J;  1H8A C;  1F43 A;  3COL A;  3JRA A;  4CGR A;  5F1J A;  5GP9 A;  3CCY A;  5EEA A;  2Y30 A;  4HKU A;  3ZQC A;  2HYT A;  3FK7 A;  4A3C J;  4BBR J;  4IEJ A;  2QCO A;  2XGC A;  1MBF A;  1ZK8 A;  2EZL A;  3BTC A;  3S1R J;  1FIP A;  2EBI A;  5M3M J;  3S1M J;  1ETY A;  3ON2 A;  1PUF A;  4NN1 A;  2Y9Y A;  1H88 C;  2HOA A;  3ANP A;  2E19 A;  2I10 A;  2L7M P;  5K7H A;  1ZR4 A;  3NI7 A;  3OOU A;  3AQT A;  4A3L J;  3JR9 A;  4GCT A;  4L62 A;  5FKM A;  3JSJ A;  3A03 A;  2CUF A;  2PZ9 A;  2WB1 N;  4RBO A;  3KKD A;  2K9N A;  4I6Z A;  3KZ9 A;  2L7F P;  4XIC A;  4FIS A;  1S7E A;  4GFB A;  2DA4 A;  1MNM C;  2ME6 A;  1ETX A;  3KNW A;  5DAJ A;  3GTG J;  3BQZ A;  3GTJ J;  2N8G A;  2XPV A;  1FJL A;  2HOT A;  3BR0 A;  4L5E A;  4A3J J;  3QBM A;  1D5Y A;  3TW7 A;  2MSY A;  4ACI A;  1IV6 A;  5BNG A;  3HGG A;  1HDP A;  4V2G A;  5IP7 J;  1XC5 A;  1YRN A;  2K9Q A;  3H3V K;  3MVP A;  1HCR A;  2GUH A;  5AQC A;  4A3K J;  2YS9 A;  1WCM J;  3QPS A;  5F08 A;  1QRY A;  3S15 J;  5FKN A;  4MFD A;  1JKR C;  2Q24 A;  4C3J J;  2HYJ A;  2QTQ A;  4NDL A;  1U9N A;  5D1R A;  3HOW J;  1UI6 A;  3HM5 A;  1TWC J;  2M8G X;  2W53 A;  4AF5 A;  3EGQ A;  3E7L A;  1MBE A;  2CU7 A;  5CXI A;  2L0K A;  1FEX A;  4JP0 A;  3CRJ A;  3HKZ N;  3S2H J;  3Q0U A;  2DTZ A;  3C07 A;  3OIO A;  3ZQI A;  3VW0 A;  2EZK A;  3RKQ A;  5H9T A;  2RHA A;  1IG7 A;  4FE7 A;  5D18 A;  2JJ7 A;  2R93 J;  3BRU A;  1MBG A;  2FQ4 A;  4A3I J;  3LWJ A;  1WH5 A;  2UXP A;  3GTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...