3VPRA

Crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
189
Chain Sequence
VTTTRDRILEEAAKLFTEKGYEATSVQDLAQALGLSKAALYHHFGSKEEILYEISLLALKGLVAAGEKALEVADPKEALRRFMEAHARYFEENYPFFVTMLQGIKSLSPENRLKTIALRDRHEENLRAILRRGVEQGVFREVDVALAGRAVLSMLNWMIRWFRPDGPMRAEEVARAYHDLILRGLERGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcriptional repression mediated by a TetR family protein, PfmR, from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, TetR family
total genus 71
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3vprA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vprA02
1FEXA 1Q1VA 2G7SA 1LFUP 3HBLA 4C2MJ 1IUFA 4XICA 1RESA 4UUTA 2YU9J 2ID3A 1DU6A 1P7JA 2DMPA 1NK3P 5IOZA 1WGXA 2FD5A 3LSRA 4GCKA 4UUSA 1O4XA 2K40A 3SFIA 4AC0A 3HGGA 3LSGA 4RBOA 4JX4A 1ETWA 2EZKA 2UXHA 5D18A 1ORKA 3G56A 4L62A 3GTJJ 2Y31A 4V2GA 3S16J 5E3MA 1FTZA 2ZCXA 5FLMJ 1ETOA 2EQRA 1JKPC 3BR5A 3OOUA 4GCLA 3Q0VA 4I6ZA 4A3EJ 3LJLA 1CQTA 3GEUA 4MLOA 2GBYA 1MNMC 3KNWA 5EGOA 5AQCA 3JRBA 5K7ZA 2DA1A 4HNVA 3P9TA 4A3KJ 1UI6A 4A3BJ 3PO3J 3RZDJ 4QSHA 1ITYA 4JL3A 3GTPJ 3Q3SA 2UXOA 2IBDA 3OSGA 3EGQA 1S7EA 1WCMJ 2ZCNA 2KT0A 4AC6A 2LFBA 5C3EJ 4I76A 3HOVJ 1VNDA 5F1JA 2DA7A 2XRLA 2R0QC 4UDSA 2L7ZA 5F0FA 2NS8A 2G7LA 4CGRA 2DN0A 3ZQCA 1I3QJ 4CYCB 3EUPA 4D7NA 2HYTA 2E2JJ 3O8HA 4X1EA 5F08A 2HYJA 1ETVA 4A3IJ 3V6GA 3BR6A 1OFCX 4NDLA 3BG3A 1X2NA 1IDZA 3JSJA 2WUIA 2EZHA 3G1LA 3JRIA 4C3HJ 3BTLA 2ELKA 1H8AC 3QBMA 3QKXA 3JRHA 4UUSB 5DTDA 3Q0WA 2R5ZB 4FE7A 4MIMA 2HDDA 1SGMA 1ETQA 5M3MJ 2L9RA 3BQZA 2G0EA 1UMQA 3MKLA 4IEJA 2NP3A 1BA5A 5FMPA 2XB0X 2YVHA 2X6OA 1MSEC 1AU7A 3MN2A 2XPVA 2FJ1A 2XGCA 4Y7NJ 1YRNB 4ACIA 1OCPA 1TWAJ 2NS7A 1EF4A 3H3VK 5HSZA 5F0CA 3LWJA 3S15J 4CYCA 4W97A 2ZCMA 1JUMA 3VPRA 9ANTA 1ZK8A 4G12A 4BXXJ 4C3JJ 1HDPA 2TRTA 1FJLA 2RHAA 3GBGA 3TEDA 4DYRA 2JMWA 1U9OA 2DA5A 1JJ8C 4B4CA 1B72B 3CJDA 3PO2J 3JRFA 2LR8A 3IV5A 2FBQA 1MSFC 3QPSA 1GVDA 5D1RA 4HKUA 3GZIA 1JKOC 3JR9A 2X48A 5EEAA 2PMZN 5IYDJ 2PBXA 3IH2A 1JUSA 4AYBN 2ECBA 1YRNA 4BKXA 2F07A 2GUHA 4MXMA 4AF5A 1TWCJ 3BJBA 3GTQJ 2E1OA 4QTRA 4PXIA 2LTPA 1ETKA 2XPWA 5IYBJ 2R5ZA 1Z0XA 1IGNA 3HEFA 5IYCJ 2NVXJ 3OSFA 2ID6A 3MNLA 2Y30A 4JNNA 1LE8B 4BY1J 2X9DA 2CQQA 1LE8A 2K9QA 1H88C 3TW6A 1GT0C 5GPAA 1B72A 1MBGA 3VIBA 1R9TJ 3AQSA 2Y0SN 1ZR4A 3A01B 2DG7A 5EF6A 2Y2ZA 2OPTA 5GP9A 5H9TA 2GLOA 1BJZA 3HM5A 2DTZA 3B6AA 4S0HB 2ME6A 5M5XJ 2JA5J 5M3FJ 2DMUA 3TW7A 2QOPA 2E19A 2Y9YA 2D6YA 4M3DA 4XIDA 1W0TA 3NI7A 5E3NA 1HCRA 2HOSA 2CUFA 2JK3A 2EZIA 2WAQN 5J1UA 2LY9A 1GUUA 3BR1A 3FISA 2QTQA 2XGEA 3DCFA 4W1UA 3NAUA 4ICHA 2ECCA 2RASA 3S1MJ 1XS9A 1XG1A 2QWTA 5JLXA 4JYKA 2ZOYA 3CMYA 3HOYJ 4V2FA 2XB5A 3LHQA 2E2HJ 2FQ4A 3IH3A 2G7GA 4LOCA 2YS9A 2H8RA 1ETXA 3S2HJ 2P81A 2R7ZJ 1A5JA 1T56A 2GFNA 5C4JJ 1IC8A 2O7TA 2NX4A 1JUPA 2DA2A 2HXIA 1GV2A 4A3DJ 1F43A 1G2HA 1FIPA 1QVUA 2REKA 3ZOBA 3QPLA 2VPRA 4A3FJ 2XDNA 1NK2P 2XGDA 2HOAA 1MH3A 5J1YA 2CJJA 2COBA 3BR0A 3H0GJ 1AKHA 1APLC 1U8BA 3A01A 4MFDA 3W6VA 1OJLA 5EZGA 3I4NJ 5K7HA 5IPAA 2AO9A 5CXGA 5K7FA 1I6HJ 5E3LA 1HLVA 2IU5A 3PPBA 1BW6A 3M3YJ 5M5YJ 3ANPA 3C07A 2DMTA 3VUQA 1BW5A 2W53A 3C2BA 2K9NA 2HI3A 3PM1A 5M5WJ 2CRGA 3JRAA 2WB1N 5HODA 3BNIA 3VOXA 4BBSJ 2CU7A 3NARA 3BG5A 4NELA 1IJWC 1WPKA 5DAJA 3RH2A 3ANGA 1IG7A 1RR7A 3FRQA 4BBRJ 3HE0A 1NTCA 3RKQA 1FTTA 3ZQIA 2Q24A 3HOZJ 1WI3A 4GFKA 3E7QA 1D5YA 3LSJA 5F0HA 2YUSA 1IDYA 3NRGA 2FX0A 1UI5A 3SJMA 5E3OA 5J1RA 1MBHA 2DMQA 3JRGA 1U78A 2WGBA 1POGA 5EGOB 5EFYA 1QPIA 3FK6A 2MSYA 2QIBA 3RQIA 3GTKJ 3S1NJ 3BTCA 4ABZA 4L5EA 3DEWA 2R93J 2JA6J 2LK2A 3I4MJ 3HTHA 3TP0A 2UXUA 3VOKA 4A3LJ 3OIOA 4JX5A 2JWTA 4IHYA 3S14J 5FGLA 1UHSA 3MVPA 3V78A 4IHXA 3JRCA 1Y1WJ 2M8GX 3VVZA 2I10A 4B3AA 2UXPA 2MGQA 2RAEA 2R5YA 4A3JJ 2GM4A 3RD3A 2HKUA 4DW6A 3WHBA 1DU0A 3S1RJ 1MH4A 5C4XJ 2YVEA 3IH4A 5GPCA 2N8GA 2CQXA 4FTHA 3BR2A 2NVQJ 3GTLJ 3VW1A 2PZ9A 5HAWA 1TC3C 2JA8J 1JT0A 4FCYA 1ZGWA 2LLKA 2L7MP 2MG4A 3HOXJ 5F27A 3LNQA 3A02A 2L7FP 1PUFB 3M4OJ 3Q0UA 4D5CA 3S5RA 5J3LA 2XPUA 2AHQA 1ZTRA 3E7LA 2DJNA 2UXIA 4MFEA 1ZR2A 3AQTA 5DS9A 3G1OA 5EZHA 2ZOZA 4JP0A 1VI0A 2E2IJ 1IRZA 4JX6A 1U9NA 3COLA 3LSPA 3D1NI 3DPJA 4M3EA 1T33A 2NP5A 1K83J 3JRDA 2VKEA 2VKVA 4DZJA 4EEFG 2R5YB 3K7AJ 3KKCA 4KWAA 3T6NA 3BR3A 1JJ6C 3HKZN 2MW8A 5IP7J 4X6AJ 3VVYA 2OERA 1H89C 4QIWN 2VUMJ 4XRMA 2HXOA 5FKMA 2JN6A 5FKLA 4A93J 3IUVA 4DYCA 5HBUA 2DA6A 5C44J 3BHQA 4GCTA 2NVTJ 2WV1A 4RDUA 3CCYA 1MBEA 1ENHA 5EDNA 4M3FA 1P7IA 3F1BA 2LVSA 3NPIA 4NN1A 2L0KA 1JGGA 1SANA 1A6IA 2IEKA 3FIWA 5F04A 3HOUJ 3CRJA 4XRSG 3S17J 4C3IJ 1X58A 1SFOJ 1RKTA 2O9LA 1WH5A 5BNGA 2H1KA 4XK4A 5C4YA 5FKNA 5FKKA 4MK6A 5IP6A 3JREA 3G1MA 3QQAA 4A69C 4AUXA 5EG0A 1MBKA 1Y1VJ 4GFBA 1B8IA 1BL0A 4DZPA 3ON2A 2VI6A 1GV5A 1ETYA 3VVXA 3ON4A 1QRYA 1MBJA 2LD5A 1Z77A 4B1RA 3FK7A 3BRUA 2JA7J 1AKHB 3CWRA 4YZEA 3UKGA 3HTAA 2W48A 3GTOJ 1I50J 3BQYA 4IHVA 3FKIJ 1JKQC 2DA4A 2JJ7A 5FJ8J 1PUFA 2ME0A 2OI8A 4MO7A 5EG0B 1GDTA 3NNRA 2O8KA 3LOCA 1RETA 2LKXA 1FIAA 4A3CJ 1X2MA 2B63J 3KZ9A 3ZQHA 3ZQGA 2K9SA 2V57A 4A3MJ 2M2EA 2D5VA 3HB9A 3NXCA 3G7RA 1JTXA 3BG9A 1LFBA 2TCTA 3CDLA 5CW8A 2NVYJ 2M34A 4J19A 3HGYA 3F0CA 1E3OC 2G3BA 4IHWA 5IP9J 2QKOA 3TP3A 2DMNA 1VF9A 3CQZJ 3BCGA 1JKRC 1XC5A 2M0CA 3BTJA 3HTJA 4XRSA 3KKDA 3HDDA 3BTIA 5FLVA 5FHPA 2DG8A 5D19A 3A03A 5K58A 4ME9A 4BY7J 3B81A 1TWGJ 3GTGJ 1W0UA 1JTYA 3O60A 4JKZA 1WH7A 2ZB9A 3RZOJ 3S2DJ 3SDGA 2QF7A 4Y52J 5CXIA 2DA3A 3PASA 3ZQFA 3VP5A 3HTIA 3K2AA 3VW2A 5JLWA 2KDZA 1ZQ3P 1TWFJ 2CUEA 1QVTA 1ZKGA 4M6VA 3S1QJ 3ZQLA 2NOGA 4FISA 3HIMA 3B6CA 2GENA 4A3GJ 5IOYA 2IAIA 1OCTC 2R92J 2HOTA 1K61A 1HF0A 1MBFA 1RPWA 3GTMJ 4M3BA 4M3GA 2M9HA 5FKOA 1UG2A 1VFCA 1AHDP 3HOWJ 2Y9ZA 1TWHJ 4FE4A 1IV6A 5EYRA 1RKWA 4D7MA 1HDDC 4GFLA 3WHCA 2OF7A 1JT6A 1HOMA 3O8GA 1B8IB 3VW0A 2QCOA 1F36A 2EBIA 3BT9A 2XSDC 4DYQA 2HQ5A 2O7OA 2EH3A 3L1PA 2LP0A 4D5FA 2EZLA
chains in the Genus database with same CATH superfamily
1Q1VA 3FXKA 3G2BA 4KJZA 1IUFA 3F9KA 4UUTA 1VQ7I 4BHBA 4CSWA 1F9NA 4G8XA 2FD5A 1BI0A 3M9AA 1R5ID 5BQTA 2BGCA 3DP7A 2K40A 3SFIA 2R7VA 2ADUA 3HGGA 4F92B 5DEQA 3ZMVA 2XDVA 1VQOI 2Y31A 2K7LA 4CGZA 1YW7A 2B1EA 3FXLA 4RAYA 2IRFG 4Q47A 4GCLA 2GQQA 3Q0VA 3ROUA 3G71I 4I6ZA 1PDNC 1QGPA 2KJBA 5HDKA 4P9FA 5EGOA 5GADJ 2EPFA 4HNVA 1UI6A 1J75A 5L3BA 1DPUA 4Y3OA 5B1AH 2VXZA 3ZP5A 2V1DA 5EEHA 1E3PA 1HQCA 3Q3SA 1JHHA 3RJPA 5ICEA 4GGGA 2A6TA 3P9KA 3X2QH 1SD4A 2RQPA 2JRMA 4LG3A 4OWRB 2DK5A 3FBNB 4NUBA 2DA7A 2XVCA 4CO8A 4YIRX 3NEUA 5F0FA 2OZ6A 2NS8A 3L2VA 1LKXA 4XLHA 2B9SA 2G7LA 5GAGJ 2Z5UA 4EVIA 2JSPA 3O8HA 1V5GA 3BJAA 4X1EA 1ETVA 1XDUA 2DFIA 4MHGA 2IVMA 1YFHA 3VFZA 3JSJA 1P9QC 2VBXA 2LBFA 5K1YA 2W57A 1KU7A 2VC0A 2FF4A 5D5XB 3QBMA 5KNLA 3SWHA 1PP7U 4N4NB 1R58A 3KP2A 3JRHA 2DOEA 3AG2H 5DTDA 3ZMDA 1XMKA 2DLLA 2QQBA 2ESNA 3BJ6A 4BYYA 2OTJI 2ICWG 1LUJB 3BQZA 2G0EA 1UMQA 3K1NA 3DV8A 2ZXJA 4IEJA 5FD5A 3QP5A 3Q9VA 2KIQA 1MSEC 3CLOA 4XKVA 1AU7A 4CDGA 1TNSA 4Y7NJ 2M1BA 4I02A 4ACIA 5HSZA 2B7EA 2NS7A 1EF4A 2FOWA 3FM5A 1OYWA 3A2KA 5DCFA 1WJCA 3SFZA 3OYKA 2VC1A 3MMYB 9ANTA 5B3SH 3S2WA 1FJLA 2KRHA 2X6XA 2CMPA 3GBGA 1S7OA 4CYDA 4II3A 4XOPA 2E60A 2BXZA 3R60A 1TTYA 1U9OA 3GFJA 1JJ8C 3IV5A 2FUG2 1XGNA 2UV1A 4J00A 4YRVA 5EJCA 1VQ6I 4HKUA 4HSTA 4DQ2A 4BS9A 1CF7A 2X48A 3WGGA 1OYIA 1HW5A 2KMUA 5EEAA 2GUHA 4BKXA 4WXDA 3PUBA 4AF5A 3BJBA 4G94A 3GTQJ 3LSKA 4QTRA 3VSKA 3F8NA 2Q2EA 2BY0A 2VJ4A 4KIGA 2R5ZA 1UJ8A 3E5QA 4UY8I 3M1CA 4Y13A 2ID6A 3OSFA 2H6BA 4JNNA 1KU2A 1LE8B 4A2UA 2FMLA 3S3MA 3DF8A 4BQAA 2K9QA 1H88C 4YEJA 5HDNA 1TL8A 3VODA 1T39A 4L18B 1GT0C 1MMNA 3VIBA 4PGHA 1D1CA 1AWCA 3OYFA 2Z1DA 2VN2A 2O03A 3A01B 1V3FA 3CO6C 3WTZA 1G4DA 2DG7A 1OQYA 4M6XA 5GP9A 3OWTA 1CF7B 2GLOA 2BVMA 4CXFA 3HM5A 1TLHB 2DTZA 4OOIA 5M5XJ 2VLAA 2H27A 2JA5J 5M3FJ 3TW7A 2Z3YA 3VYTB 4DIQA 1SVMA 5LBQA 1X19A 2HYFA 3J7AO 2D6YA 4U9NA 2IJLA 1UFMA 1LPQA 1UCRA 1T0FC 1HCRA 2HOSA 2CUFA 1YX3A 1B4AA 2HZDA 3K70C 4PK4A 3S1MJ 4G6QA 4PJNA 5JLXA 4B09A 2ZOYA 3CMYA 5D5WB 4V2FA 2XB5A 1IO2A 2RDPA 2X51A 2FQ4A 3BJOA 3IH3A 2X85A 3QP6A 1ETXA 1IRGA 1A5JA 2V7FA 2PMZA 2GFNA 5C4JJ 1IC8A 2O7TA 4YFKF 1JUPA 5FGMA 4A3DJ 2UZKA 1JGSA 1FIPA 3RYRA 2D1VA 1USSA 3KP5A 1FT9A 1RI7A 2BV6A 3ABTA 1A31A 2C6YA 2IGNA 2A05A 5D6FA 2XGDA 2R7DA 3CCRI 3BPVA 1SAUA 2WA0A 2GOXB 1XMAA 3K70D 2A6EF 2F5VA 3JAMK 2RN7A 2UUZA 5K7HA 4L5JA 4M72A 3FHZA 5K7FA 5D8LB 2CQ7A 4AVPA 1VQ4I 3M3YJ 3H9GA 1X4OA 4HX8A 3QYBA 4YFNF 3LFKA 3ABUA 1P2FA 4XN3A 3ABKH 3FXJA 3PM1A 5M5WJ 3M8EA 4BE0A 4XONA 3LSMA 2CU7A 2DAOA 5H6QA 3BG5A 2VB6A 4NELA 4B48A 3IP4B 3OYDA 1MMDA 5K5QA 1RR7A 2KRFA 2WTEA 4CZCA 4HDVA 3J81K 3PFIA 3RDIA 1SC7A 5F0HA 4AIHA 4A5NA 1LNWA 1YLFA 1PVEA 3L2CA 3LMMA 5DV5A 1RIOH 1UI5A 2QKLB 3SJMA 3O6BB 3K1MA 4GCVA 2ZY9A 2XAJA 2K27A 2VQHA 3GTKJ 2E34A 3S3NA 2GA2A 3BTCA 1YW8A 2W00A 1ZELA 3DEWA 4CA0A 3WE2A 2JA6J 3I4MJ 3HTHA 3VOKA 2W82A 4XR6A 1HC8A 3OIOA 1O3TA 3KCCA 3S14J 3GEZA 1T95A 3V78A 2HOEA 2QVOA 3JRCA 1WJEA 3CP2A 3AKZA 1EH7A 1F5TA 5FROA 3CUQB 2GM4A 1OPCA 3MKYB 4RAZA 3LFUA 4DW6A 2EINH 5LHIA 1ULYA 2JVGA 3MEXA 5HS8A 1Y39A 3TO7A 3V42A 4JBAA 2YVEA 5GPCA 3RKXA 2EFPA 2NYXA 3BR2A 3SDBA 4KIFA 3OYBA 4BU2A 5BPIA 4PUSA 3SXYA 2JA8J 1ZGWA 4BQNA 2AQFA 2OQGA 4KMFA 3HOXJ 3ECOA 3A02A 3M4OJ 3DPUA 2R4GA 3R0JA 2QBYA 4Q4ZF 5HS9A 5F64A 4BJTA 4MFEA 3BLYA 1ZR2A 2HFHA 1TW3A 2ZOZA 1BOAA 3BDDA 1R4NB 3RSNA 3E1SA 3LAPA 5TJJA 3SQNA 4HNTA 3D1NI 2NP5A 4LLGF 3D5RC 3JRDA 3U9GA 4EEFG 1Z7LA 3PL8A 1IN4A 3L7WA 1RUNA 1SVLA 3K7AJ 4MQ9F 3WODF 1UG0A 1V54H 3T6NA 3BR3A 4BXUA 2VUMJ 5FKMA 4A93J 3GZ5A 3CMMA 2WAFA 3KZZA 3VTIA 2D45A 2KISA 3IWFA 2BVLA 2DW4A 3FF5A 1MJ9A 2IGOA 5KVRA 5LD2C 3C3WA 1PJRA 2G9WA 3PUFA 3CCEI 3H1CA 5KK1A 3NPIA 2ELJA 2XC7A 5HOOA 3FIWA 2O3FA 3GZ6A 3EDPA 4G7OF 3IUOA 2F4OB 4ZYGA 4C3IJ 1X58A 3KLNA 2K3FA 4IJAA 2I5UA 3QOPA 1PYVA 1J7KA 2NAZA 2E35A 2B3WA 3ZGKA 3U21A 5IP6A 3JREA 3TL4X 4LK0F 4A69C 4AUXA 2W7NA 1X1BA 4RB0A 3ON2A 2IGMA 2QSHX 2KIMA 3W2VA 1S72I 3ON4A 3K8PC 1MBJA 2LSOA 1HW2A 1E0EA 3ZN1A 3SEQA 3BRUA 3UKGA 3ZQ7A 4U7DA 3BCBA 1I50J 2J5OA 4EJOA 1YI2I 2JT1A 2DA4A 1SD5A 1FSEA 2A6HF 1TZLA 2O8KA 1VQMI 4P55A 4G7ZF 4IRIA 3CJTB 2ETHA 1QZZA 2DT5A 1IXSB 2B63J 3GLLA 3ZQGA 4BQOA 3KYCB 4M9SA 5LGUA 3QPHA 1TBXA 2CS3A 2D5VA 2Z9OA 3G7RA 2A61A 1LFBA 2NVYJ 3F0CA 3MKWB 3L2QA 1E3OC 3MKZA 4GO1A 4EJUA 3E5UA 2TDXA 2V1XA 1OYYA 2ZJQF 5CVJA 1JKRC 3F22A 3BTIA 5FLVA 5D19A 3U1KA 3A03A 4Y4RA 3B81A 4RGUA 3WTWC 2BEOA 3SDGA 3IC7A 1LFPA 1J2XA 5CXIA 3BOQA 2DA3A 2VJIA 4HOBA 1W7PB 4IOCF 2DODA 3CCJI 1ZQ3P 3FXQA 2FE3A 5DUIA 3KIOA 2VBZA 1QVTA 1Z9CA 4NC7A 4HNUA 1AOYA 2VQGA 2W25A 1WI9A 1IRXA 2NOGA 4FISA 4RB2C 1O3RA 3KEOA 4ZTJA 5J8CA 4IZZA 1GLNA 4A3GJ 3G3ZA 2IAIA 2R92J 4IPAA 3EPZA 1HKSA 3HHHA 2HS5A 5E8GA 3E6CC 1LEBA 4C2MA 1U6GA 4XLPF 5FKOA 3HOWJ 1L0OC 3CTAA 3LL7A 5EYRA 1RKWA 1BI2A 1IRFA 2HWVA 3EUHC 1OKRA 2IP2A 2OV7A 4A5MA 4LIUA 4QPQA 1MJBA 3ERED 3PNVA 3CJRB 2QENA 1B8IB 4OMYA 1HOMA 2Z33A 4BNCA 2CUZA 2A68F 4E7LA 1WZ2A 2O7OA 3ZMZA 4HV5A 5CQEA 1OCCH 1FEXA 4Z2YA 2G7SA 1LFUP 2NOJB 2VQCA 2GIVA 2NNYA 3CD6I 4ZJZA 4KDPA 3IAS2 2BXYA 2YU9J 6PAXA 2PMHA 4I7HA 3PIOF 1W5TA 2VKHA 1P7JA 4F52A 1NK3P 1MMGA 1MZBA 4LG0A 3IKVA 4U0VA 4OINF 5IT3A 3HTSB 2O8XA 1MW7A 2F5CA 3D0SA 3VEPA 4GCKA 3BZ6A 3FMRA 3MWMA 5L3CA 2PG4A 4JX4A 1ETWA 2LRDA 4RBOA 4ZYDA 1DP7P 2UXHA 4UB8C 3GTJJ 4V2GA 4EJWA 4OMZA 3GO5A 4OD5A 5IT9Z 2ZCXA 2EQRA 2XAFA 1OMIA 2GA1A 3CF2A 5CKTA 3HL2A 1JKPC 1FMVA 1WJAA 1SFEA 3BR5A 3OOUA 2F5DA 1A04A 4ETSA 1O3QA 4A3EJ 1CQTA 2X4HA 3GYHX 1QU3A 1MNMC 4PFOA 4DBQA 4QPOA 1DPRA 4UV9A 3LSTA 4HX4A 5GTIC 5ILVA 3GLXA 3P9TA 1S29A 4A3BJ 2K5CA 3PO3J 3IWZA 3KEYA 3HSRA 4QSHA 3G4SI 3QODA 3BZKA 4JL3A 5F1RA 1BI1A 2IW5A 4C30A 1T38A 3P5JA 1R4MB 2H1LA 2V9VA 3DEUA 2HR3A 2KL4A 1S7EA 2FNPA 1FP1D 5C3EJ 4I76A 2GXBA 1NH3A 4WK8F 3HOVJ 4PDKA 5F1JA 2XRLA 1G3YA 1WHUA 1MGTA 3DKXA 4L0ZB 4LK1F 1ZREA 3PNYA 1Y0NA 4BQQA 1XB4A 2HKXA 2HTJA 4I98B 3I9V2 5FB2A 3EUPA 2E2JJ 1X4PA 3L2UA 5F08A 2PJRA 4A3IJ 3I4PA 2RQQA 3BG3A 2ELHA 1IDZA 4L9NA 3SZGA 1HW1A 3JRIA 1R36A 4C3HJ 3FHNA 2ELKA 4PJLA 3SEZA 1BR2A 2PBIA 5LGNA 2O6GE 4Q5SF 3I59B 3QKXA 4RB3C 3RTRA 1I27A 3CESA 3WU1B 4ESBA 2KZVA 3Q0WA 5EEGA 2DPDA 5HLGA 1S5LC 3VWBA 5CLSA 4MIMA 2BW3A 5FFXA 2HDDA 1SGMA 4BUPA 2L02A 3MKLA 2NP3A 1BA5A 1EV7A 4XLNF 4HZFA 2X6OA 2FJ1A 4II2A 3LWFA 2IA2A 2HPMA 4JK1X 3LWJA 3S15J 4ZYHA 1P4XA 2HU9A 2ZCMA 3K2ZA 4LG0B 3VPRA 1ZK8A 4ZZDA 4BXXJ 1HDPA 2TRTA 3ZCOA 3CF5F 3CCQI 4NC8A 1X1AA 2F48A 2H6CA 2DA5A 4BXFA 1EA3A 1VQ5I 3OYNA 5DYMA 2FBQA 3UNGC 2R7UA 3QPSA 1KQ9A 2RNGA 3HRUA 1GVDA 1ZG1A 3GZIA 3OYAA 2PMZN 4U0WA 5GAEJ 2ZJPF 4FX4A 1U8RA 5IYDJ 2PBXA 2ECBA 3VYRB 2DU9A 2FJI1 4WX9A 3LSIA 2X1CA 3WTXC 3MZ8A 4PXIA 5FLXZ 1TW2A 2LTPA 2XPWA 5JI6A 1IGNA 5IYCJ 2NVXJ 4M74A 1K4SA 4IRVA 3H5AA 3L2WA 3QRFF 1SEUA 1LB2A 2VODA 1C0WA 5GPAA 1MBGA 4NNJA 4QWQA 3CCLI 1VQ8I 1H9TA 4RGXA 3F3XA 4BAYA 3F8MA 2ME6A 1TQMA 2DMUA 3EUAA 2QOPA 2EJRA 4XRFA 1FYKA 1T2KA 4M3DA 2H94A 5D5VB 4XIDA 1W0TA 1BM9A 2MD0A 2LY9A 1GUUA 3BR1A 4L9VA 2BZTA 2QTQA 3DCFA 2R7OA 1Q1HA 4ICHA 1TT5B 2ECCA 3DBLB 1KQ8A 2RASA 4OIOF 3AG1H 3AAFA 3KX2A 2DQRA 1FWZA 2XAUA 3HOYJ 2K85A 3LA7A 2XAGA 2ZMEB 1QHHD 1XX5A 2YS9A 4DJAA 3S2HJ 1SMTA 1J09A 4L0YB 1UAAA 2FBIA 2IS6A 3PJRA 3JTHA 2NX4A 2DA2A 2KFDA 2R7QA 2P0WA 1KONA 3V8JA 1MMSA 1HSTA 5FO5A 2QA4I 1Z05A 2V26A 2VPRA 1A6QA 1Z91A 2HOAA 3ZMSA 5FRMA 3AG3H 1MIJA 2CJJA 3BR0A 2CQKA 3CUQC 3H0GJ 5J1YA 3GX4X 1U8BA 2XKPA 4NC6A 2ZSHB 3W6VA 2COMA 3FXRA 2VT2A 2EA2A 4HBLA 2AO9A 1WSUA 1I6HJ 5E3LA 2GOMA 1ZLJA 1HLVA 3KZYA 4P1WA 4A6EA 3KEQA 4F3QA 4Q48A 2CW8A 3RIRA 3VUQA 2YU3A 2ESHA 1XSXA 4ENNA 2W53A 1X1PA 4IHSA 1G59A 2WB1N 1LDDA 2H8WA 2P5KA 2AXLA 5HODA 1W5CC 3F8FA 3NARA 3QWLA 2ISZA 1WPKA 1Y8RB 3GFMA 1F1ZA 3IRQA 4XN0A 3FRQA 3HE0A 3WG9A 1NTCA 2X6YA 5ICCA 2Q24A 3HOZJ 1BR1A 2W84A 1WI3A 4GFKA 1D8KA 4A0ZA 4O6JA 1D5YA 4ZDOA 2M4KA 2YUSA 1IDYA 5H2FC 3NRGA 4MEYF 3GW2A 2VT3A 5J1RA 1MBHA 2VXDA 2GWRA 2IA1A 2LF8A 3ZMTA 3I64A 3PQJA 3FK6A 2MSYA 4HV6A 3ZPLA 1HXDA 4XL9A 3EYYA 4ABZA 1YQAA 1FX7A 3CP8A 1O3SA 2CW0F 2PFVA 2GIZA 2LK2A 2FBHA 2OBPA 3GF2A 4JX5A 4IHYA 1UHSA 1YYVA 2BW3B 3CMEI 2IGKA 1YTYA 4DBRA 2M8GX 2V6CA 1Y1WJ 3H5RA 4F93B 2FA5A 2I10A 2L9SA 3I59A 4PZJA 2E1NA 3IL2A 5JVGF 1JXSA 3RD3A 5JVTA 3FXUA 3WHBA 4MNUA 4E7JA 1I1GA 4XKWA 5IT9K 1DP3A 2YSRA 1MNDA 1X1DA 3S1RJ 5C4XJ 2EK5A 2EV5A 3H3ZA 2K3PA 4Y15A 3J7ZI 2PZ9A 4PJMA 2X1EA 1YJNI 2LLKA 4HX7A 3LNQA 1R1UA 2P7VB 1PUFB 2ZMEC 3Q0UA 5K5OA 2ZXWH 3N4MA 4MQVA 3W6JB 3TKYA 2WADA 3AQTA 3G1OA 3OYJA 4UVCA 2LY2A 3J80Z 2E2IJ 1IRZA 3C2HA 4JX6A 1WRJA 4ENJA 3HOSA 5B1BH 3GZNB 5KCMA 3GXOA 1XSDA 4HLYA 2VKVA 1FOYA 3WU2C 2R5YB 1LQ1A 4EJTA 3BG6A 3TO6A 5ED4A 2XAQA 2JSCA 4MGRA 3VVYA 3HKZN 2MW8A 1SD6A 2OERA 1E3HA 4AIDA 4QIWN 2HVQA 5D4RA 2HXOA 4L5IA 2JN6A 2OD5A 3DBHB 2LREA 5FKLA 1R5HA 5LEJA 5E1WA 1H0MA 3ONQA 2RVCA 3BHQA 3AFHA 1ONVA 2DBBA 4NBQA 3CCYA 2DI3A 1ERDA 4Z6YA 3QU3A 2RV8A 2IA0A 3FXMA 3H9QA 1P92A 1A6IA 2RC4A 5H20A 2IEKA 3HOUJ 4JQFA 3PQKA 3OY9A 5HLHA 3CRJA 2FQ3A 4EGZA 4RM2A 2KZGA 3S17J 3R6SA 2HVSA 3CO7C 1RKTA 2QQ8A 2E1CA 2LYCA 5BNGA 5C4YA 4ENMA 2W1OA 3G1MA 3F8CA 5LHHA 1MBKA 1FOKA 4EJVA 4DZPA 5CVIA 3MD2A 3L2RA 1QPMA 3DBRB 3TOBA 2QYOA 4ANJA 4CICA 2LD5A 4XBFA 2MFZA 5DD4A 3CWRA 1G3WA 3OYEA 3HTAA 2IPQX 3TQNA 4EMSA 3BQYA 3FKIJ 5BMZA 1QBJA 4RB1A 2OCCH 4BE2A 2JJ7A 4FASD 2VONA 4EM2A 4IKFA 3OIQA 3B73A 2HDCA 1MKMA 1GDTA 5EG0B 3NNRA 2MC3A 2J5PA 2LKXA 1FIAA 2HQNA 1X2MA 1J59A 5AIPA 1K78A 3KZ9A 1H9GA 2DFHA 2HGCA 2V57A 2PJRB 1IXRC 2A69F 1VQKI 1ZRFA 3HB9A 1G3TA 2F6CA 4KIBA 2QGUA 2WWYA 3CDLA 5CW8A 1EKEA 2JA2A 4KNYA 1KYWA 2G3BA 2IS4A 2Q0OA 2R3SA 5IP9J 4ZC3A 2QKOA 3TP3A 2EV0A 1VF9A 2IXSA 3CQZJ 1LJ9A 2M0CA 4KT5C 3G73A 4LITA 4XRSA 2A5WA 1ZGAA 4HQMA 2ZJRF 3K0LA 2DG8A 2QKMB 4XSZF 2KKOA 1Z3XA 2XV4S 1TWGJ 4HAMA 3O60A 4ME9A 5K58A 1WH7A 4Y52J 3OR2C 1IN8A 4YELA 5FRNA 3PASA 3ZQFA 1BN5A 3ZXSA 3KP4A 2CUEA 1D0YA 3ULQB 3V7CA 1I5ZA 1R1TA 3JCUC 3B6CA 1MNEA 1RZ4A 5FD6A 2GENA 2GXGA 4FETA 4U9LA 4AD9A 4AYBA 1ZG5A 2HOTA 1MBFA 1RPWA 3GTMJ 5KAIC 4IX7A 4OD4A 1FOWA 4XKBA 1AHDP 1D3YA 4PGGA 4GFLA 3P9CA 4D7MA 3WHCA 2OF7A 3EETA 2VBWA 3S93A 2M5WA 3E3VA 3BT9A 2WAEA 1I1SA 1Z6RA 3L1PA 2LMDA 2A5YB 2EZLA 3SYTA 3OYHA 1Y0UA 4JOMA 3HBLA 2QWWA 1K7AA 2FBKA 2FSWA 2L7KA 2M0MA 1B1BA 1IAWA 2P8TA 3E97A 1TQIA 1ZARA 2JUCA 1ACIA 4FT8A 4WIBA 5IOZA 2BYVE 4N9IA 1WGXA 3A4CA 3CUQA 4HYEA 3O3KA 3IKTA 1WKMA 1YO5C 2DOAA 1CGPA 4KN7X 2PMUA 1O4XA 2M4GA 5JHUA 1ORKA 3G56A 4L62A 2V1NA 1FTZA 2CV0A 2O5RA 1BJAA 1ETOA 1N75A 2CGPA 4V19K 2RGVA 4KA4A 2M7AA 3ABLH 5K5RA 3WE3A 3C1DA 5JFRA 5FLXK 3G6EI 3GEUA 2GBYA 1Z7UA 4ZH4F 4DNCA 1T6SA 3OOPA 3CCSI 5K7ZA 2DA1A 3I54A 3SHFA 3QYEA 1X3WB 3HTUA 4F7ZA 1K6YA 3RZDJ 3HSEA 1QZYA 1ITYA 4BDYA 4OIPF 4O5VA 2UXOA 4B8XA 3E5XA 2OAZA 4MEXF 3EGQA 1X1CA 3JW4A 1WCMJ 3EYIA 3KPHA 3UR3C 2ZCNA 2KT0A 4AC6A 4FQGA 2LFBA 1NHAA 2K9LA 3ZMUA 4UDSA 2LY1A 2L4MA 2OJED 4HW0A 3KLOA 1FNNA 2DN0A 3ZQCA 2A2FX 1FBQA 2YPRA 3HKZA 3TGNA 4CYCB 1FC3A 4U87A 5AONA 3MZHA 2UXXA 4EV0A 3V6GA 1U5TC 4TV7A 1WJ5A 3BR6A 2L9VA 3MFKA 4NDLA 4HRIA 1DGWY 3NWTA 2WUIA 2EZHA 3G1LA 1MMAA 1IXCA 2W4SA 4X0GA 3MAJA 4PCQA 2M8EA 1H8AC 3VYUB 2PX9A 4E7HA 2V6EA 3I5UA 4UUSB 3RQ4A 2R5ZB 4FE7A 2JQ7A 1VQLI 2VL8A 3WG7H 4WF2A 4UXNA 4IRGA 4AU7A 5M3MJ 5HNFA 5FMPA 2M7BA 3EUHA 4XORA 2XB0X 3JAMZ 2YVHA 3KYDB 5D4SA 2XPVA 1JI8A 2HQRA 4UV8A 1XCVA 2EIKH 4RS8A 1IW7F 2O0YA 3H3VK 3MZYA 5ICGA 4CYCA 1WFXA 4W97A 4UVAA 4WWCA 1R22A 3TDZC 4XLEA 1ZG3A 4PFPA 4G12A 4E7ZA 4RAGA 4GXOA 3L9FA 3WTUC 1MJAA 5B5EC 2VOOA 1XD7A 2CG4A 1XN7A 2UXNA 4ZDPA 1YG2A 4DYRA 3CJDA 1G3SA 4B4CA 3PO2J 5D6EA 4ITVA 3NQOA 3M8JA 1FMWA 1MSFC 5GTHC 3I71A 3COAC 2CFXA 5D1RA 4XNFA 2DOFA 5ICFA 1RR8C 1JKOC 3JR9A 4AYBN 2F07A 2O61A 1STZA 4DGWB 1BR4A 1ETKA 3J7YJ 4NHJA 1ZN2A 1Z0XA 3MNLA 2HVRA 3ASNH 2M30A 1U5TA 2CQQA 3HPGA 3TW6A 5TISC 2DJIA 2LKSA 1IN6A 3OIPA 4PSWA 1W36D 4K2EA 1UELB 3F72A 4M9ZA 1ZR4A 3E6MA 5EF6A 2Y2ZA 2VJ5A 3GMEA 3CJNA 1QQIA 2CH0A 1BJZA 3I0TA 3B6AA 3TOAA 3E6DA 1YHQI 2EB7A 1Z67A 2E19A 2Y9YA 5CVVA 4S05A 3WTSC 2RREA 3VB2A 3NI7A 1DUXC 4UNOA 4KISA 4O3MA 2EZIA 2WAQN 1ZGJA 1YJ9I 1S8NA 2EV6A 1YIOA 3FISA 1ODDA 2XGEA 2QZ8A 4W1UA 4BGDA 5AIQA 1J0RA 3CJQB 1XG1A 2QWTA 2KLOA 5HDGA 2R7XA 1FBSA 2Y0SA 4I0BA 2EFWA 2AXTC 3GCMA 2DXIA 1S6LA 4DOZA 2E2HJ 2P4WA 1S7AA 1XGMA 3FMSA 3ML6A 1D1AA 2R7ZJ 1T56A 2VASA 3PFYA 2WY7Q 1G2HA 1GV2A 1TT0A 3ZOBA 4KFCA 3QPLA 3FXOA 1EH8A 1OR7A 4I2OA 1MH3A 2KIUA 2COBA 4HF2A 4CCOA 2CQNA 1AKHA 3W2AA 4UUVA 4MFDA 1SMYF 1OJLA 5EZGA 5LGTA 3I4NJ 2BOLA 1ON1A 1EH6A 5IPAA 5CXGA 3W3CA 3FKJA 4HSRA 2IU5A 3PPBA 2FNAA 3HOTA 3DKWA 5M5YJ 1SAXA 2M45A 1B6AA 3C2BA 3DQVC 2K9NA 2KRCA 4OAYA 2ZFUA 3V7SA 2BBYA 3Q5FA 2CRGA 2BY2A 5H6RA 4LLLA 2KP6A 5J40A 1SFUA 3VOXA 4D1QA 1B59A 2XF5A 4AVZA 4EQQA 5DAJA 3S8PA 5B66C 3ANGA 1T08B 2RNJA 5LHGA 1IG7A 1D0ZA 3GFLA 4IF4A 2F5EA 3V8KA 1DDNA 2E7XA 1K78B 5L3FA 1LVAA 3CCMI 1GVJA 1FYLA 5TRDA 3M7GA 2VQLA 3GVAA 2EFQA 1HKTA 1XMXA 2VPLA 2V4JC 1U78A 2WGBA 2Q8KA 2Y69H 5CVRA 1QPIA 2QIBA 4WXHA 3RQIA 3S1NJ 1IN7A 4L5EA 2R93J 2EIMH 3HRSA 3TO9A 2EFOA 3TP0A 3WGHA 4EM0B 4A3LJ 1SFXA 2FXAA 5FGLA 1GXQA 4GRIA 3MVPA 4IHXA 3VVZA 1W7PA 1W5SA 4KMUX 2Q1ZB 1WJBA 3I55I 4RGRA 4B3AA 4L9JA 2RAEA 2UXPA 2DFEA 3OV8A 4A3JJ 1VQNI 1ZLKA 4WXCA 3DPLC 3ESWB 1OCRH 2HPIA 2KPMA 1L3LA 1FBUA 5HLIA 1MH4A 2MH2A 2HKOA 2VKDA 3IH4A 5ERIA 2CQXA 1NG6A 3GTLJ 2VJJA 5ILSA 3VW1A 5HAWA 1RC9A 4FCYA 1JT0A 2XUBA 1YE9A 5F27A 4IVNA 4QLCU 3V4GA 1X3ZB 3ABMH 2CSOA 3S5RA 1FOXA 5J3LA 2XPUA 2AHQA 1ZTRA 2UXIA 3HRMA 2RKHA 3PSFA 5DS9A 5EZHA 2WC2A 3T8TA 4JP0A 1VI0A 3ASOH 2D2WA 2NVUB 3CC4I 3KP7A 1UB9A 1U9NA 3COLA 3LSPA 4BEHA 3F6OA 3DPJA 3D5SC 2G7UA 1BI3A 4M3EA 5E1XA 1K83J 1U2WA 1OISA 2VKEA 3KP3A 1USTA 2QSGX 4CZZA 5J8FA 3HZJA 2MLKA 1EJ9A 2DPUA 3KKCA 4KWAA 5DCMB 3T5XA 2HYGD 3TMOA 2ZBKA 3LQQA 4AM3A 4X6AJ 5IP7J 1FP2A 4XMYA 1BBYA 3K69A 3P9IA 4XRMA 1YITI 2L2OA 1H89C 1ON2A 1U3EM 3R0AA 4DYCA 4B44A 2L3DA 5HBUA 4HPQA 2YVXA 1YS6A 5C44J 5LEKA 1DQUA 1IUYA 3NWSA 2WV1A 4XLFA 4RDUA 2E36A 4HF1A 5EDNA 4M3FA 1P7IA 3F1BA 1JE8A 3I58A 2M3AA 3GFIA 2L0KA 1SANA 3S32A 3VOEA 5F04A 4D0PA 2KQRA 2ACJA 2L9NA 4XRSG 1UHMA 3FX3A 2V1UA 4RGSA 1LDJA 1YS7A 3N05A 3CDIA 3I3LA 5J47A 3HSFA 5LLQA 5BOXA 2O9LA 2K86A 2K4JA 2H1KA 5FKNA 1OR7C 3H9JA 1SVOA 3C18A 3CLQA 1P4WA 1Y1VJ 4GFBA 1B8IA 1K6OA 3KZIC 2XROA 5E17F 3VVXA 4IHTA 4OAZA 4I09A 1SD7A 1T98A 1QRYA 2JRTA 1QA6A 1Z77A 4B1RA 2E1MB 2KHMA 2V9KA 4CCKA 4NQWB 3S3OA 2JA7J 3K4JA 1AKHB 2R7SA 2FEZA 4EATA 4YZEA 2BY1A 2WAQA 3K1PA 2KDOA 4B43A 3FWEA 3GTOJ 1KGSA 3H35A 2X1DA 5A2QZ 2DDAA 5IY5H 2EILH 3DFGA 2JPCA 1YX5A 2ZXHA 1PUFA 2MYSA 2ME0A 2OI8A 1IN5A 2LG4A 1M1EB 2LBFB 3SZPA 2OQRA 2R7FA 2ZO4A 2P5LC 4GDFA 1RETA 2X0LA 2ZMEA 3B02A 4E70A 1A35A 5KHDA 3ZN0A 3VDXA 3F8BA 2ZXIA 3LA3A 3JTGA 2CYYA 2K9SA 2YR2A 4LJZF 4RLQA 4A3MJ 3OS2A 2M2EA 2ZNYA 5E18F 4Y17A 3NXCA 1JTXA 4B47A 4HF0A 1D8JA 1D1BA 3OYGA 2TCTA 4BJ5C 3N97A 2PFBA 3HGYA 3M07A 2W85A 1XCBA 1XTAA 4IHWA 4BE1A 2OTLI 3FDYA 3F23A 3BCGA 2R7RA 4U7BA 3L00A 3BTJA 2HTSA 3RCOA 2P7CB 3BZCA 3HDDA 2OU2A 3AL0B 2MC4A 1S9HA 5LRSA 1BIBA 3GTGJ 1JTYA 1E17A 3P7NA 4JKZA 2XKOA 3S2DJ 3LSHA 1ZHFA 2P5VA 2ZC2A 2BHZA 4ZZLA 5L3DA 3VP5A 2STTA 1G6NA 5JLWA 1TWFJ 2IT0A 3VSLA 1ZKGA 2LOOA 4M6VA 3OL3A 4BDZA 3ZQLA 4YIFA 1XPXA 1A36A 3T0YA 3KETA 3SZTA 3BP8A 4RLFA 4LFUA 1E2XA 4H0EA 1OCTC 1K61A 5J6XA 1HF0A 1WVRA 2I8DA 2K02A 3R61A 4LB6B 1R1VA 3JSPA 2LNBA 4LD5A 2M9HA 3QPTA 5TGTA 1UG2A 4UHTA 1HDDC 1JHFA 1JT6A 4E7IA 3ZR8X 3RPUA 2E5ZA 1YIJI 3O8GA 1XGSA 2QCOA 2L4AA 2EBIA 2XSDC 4DYQA 2LP0A 4ZYAA 2MBFA 3K6GA 3I56I 3RKYA 2PQ8A 2MD5A 3EUKL 4C2MJ 2GAUA 2BE5F 4XICA 4IQJA 1RESA 1D5VA 4LIVA 2ID3A 4S04A 1DU6A 2R7WA 2DMPA 4RMNA 3HJEA 1FSHA 2HQAA 1OCZH 1ZRDA 3LSRA 4UUSA 1N77A 2CV2A 4AC0A 4R8HA 3KE2A 3HC7A 3LSGA 4KICA 2EZKA 3K4LA 1I39A 5D18A 2OUMA 3K4BA 3HIFA 3S16J 4A12A 5E3MA 2KIFA 4BEHB 3RPUD 5FLMJ 4XSXF 1I6XA 3A0HC 4XOTA 3LJLA 1KU3A 4MLOA 1FYMA 5DD8A 3KNWA 5AQCA 3CCUI 3JRBA 3H5NA 2EWNA 4A3KJ 2NNNA 5LFAA 3BC8A 1XSVA 1Z3YA 3A0BC 4KUMA 3HRTA 2LKPA 1TP4A 4CCLA 2XF6A 2CFOA 3GTPJ 1F4KA 2STWA 2IBDA 1GHCA 3OSGA 3K4KA 1N78A 1Z21A 2PLYA 4ON0A 3ERMA 1QHGA 1Y6IA 4E7SA 4GYIA 1VNDA 2R0QC 4RM3A 2L7ZA 3AL0C 2QQAA 4N4OB 4CGRA 2XRNA 4E6KG 1B9NA 1R23A 4GYGA 1HSJA 3H36A 1I3QJ 3H0DA 3IAM2 4D7NA 3WGIA 1V55H 2HZTA 2HYTA 2FOKA 3PIPF 2HYJA 4NQWA 5E1ZB 4IL6C 4IXAA 4LB5A 1OFCX 3A1YA 1X2NA 3DTEA 3C2GA 3BTLA 2ZSIB 2QEXI 1U0JA 2CWEA 3MCZA 1I3AA 2VE9A 1RRJA 1R7JA 3GWZA 2HEOA 4I99C 5J4YA 2ISYA 2DTRA 4KYWA 3DEEA 2R7TA 4R79A 1YOVB 2VOPA 2BY3A 4KT6A 2XIGA 1ETQA 3LAJA 2L9RA 5DM7F 5A2QK 2DDBA 4IRHA 3CDHA 5CJ9A 2YX7A 2AQEA 3MN2A 1FY7A 2XGCA 4CCNA 2MA3A 1VZ0A 1YRNB 1OCPA 1TWAJ 4FX0A 4XQFA 4G9YA 5F0CA 3BCAA 4EM1A 2VIXA 5DDGA 4YIIA 5CVUA 1JUMA 3DU6A 3OL4A 4IO9F 4C3JJ 3RI4A 2GZWA 2CW7A 2RHAA 3CMAI 1N25A 1RUOA 4FHTA 3K4NA 2DT7B 4IQ4A 3TEDA 2JMWA 1B72B 3JRFA 1REPC 2LR8A 1WWXA 1T8IA 3TDUC 3M8FA 1O7FA 3V7RA 1WJFA 3ISPA 5JHFA 4KITB 3IH2A 1JUSA 1YRNA 4MXMA 1TWCJ 4UVBA 4DVYP 2E1OA 2B0LA 2QM3A 3DPTA 3HHGA 1AA7A 5IYBJ 1KU9A 2DYRH 2F4IA 4CH7A 3HEFA 3O2PE 4C9YA 5HVQC 3V8LA 2Y30A 4BY1J 2X9DA 1KA8A 2DQLA 1LE8A 2PJPA 1IF1A 2Y48A 3RPQA 1B72A 2XASA 3MQ0A 1HKQA 5BPDA 1R9TJ 1V4RA 3OMYA 5J4VA 3AQSA 2Y0SN 4RA2A 2OPTA 5H9TA 5D5UB 3GUDA 4S0HB 3ELKA 3WTTC 1R5GA 4I01A 2UWMA 1Z6TA 4C2TA 1KYZA 1MD0A 4HEA2 1P4AA 5E3NA 3RKWA 1OCOH 2JK3A 3U2RA 4YFXF 5J1UA 2HDWA 3M1EA 1MDMB 1V5EA 2MABA 2K9MA 2E71A 3NAUA 1QZEA 4G6DA 4ESFA 5DUKA 2DYSH 4XM3A 1XS9A 4RAFA 2F2EA 2JPBA 1BC8C 1UZCA 4JYKA 1Z1DA 3WU0A 4WCGA 3DKYA 4M9XA 2DFFA 4B3XA 4LLNA 1YW9A 1BIAA 3QAHA 3LHQA 1R71A 2Z2SB 4J01A 2G7GA 4LOCA 3BROA 1T0FA 2H8RA 1X3UA 2P81A 1W4MA 5E8IA 1PP8F 4P96A 2HXIA 2EFNA 2Y75A 3WTYC 1QO0D 3KFWX 1F43A 2REKA 1QVUA 2JTVA 4A3FJ 1V5FA 1Y56A 2XDNA 1NK2P 3OYCA 2F4MB 4BL0B 3TBIA 2XF7A 1ZYRF 2JUGA 2PN6A 1APLC 4AIJA 3K10A 4N9HA 3A01A 1HA8A 4G7HF 1KZHA 2Q2EB 4ZTFA 2VE8A 2ZCWA 2LC2A 3KP6A 1O57A 1BW6A 2FRHA 3ANPA 4OIRF 4OU0A 4CCMA 4A0YA 3C07A 1Y8QB 2DMTA 1BW5A 2ZKZA 2HI3A 2CV1A 2EA4A 3JRAA 1XDSA 1O7LA 2VBYA 3BNIA 4BBSJ 3VYSB 5FFZA 1IJWC 5L3GA 3H3UA 3RH2A 1VQPI 5GAHJ 1K79A 3IHUA 2XSJC 1BOBA 3OYMA 4BBRJ 3RKQA 1FTTA 3ZQIA 2WB1A 1KQ0A 2G7HA 2IS2A 2DT6A 3NRVA 4CHUA 1W1WE 3E7QA 3JSOA 3LSJA 1SFKA 2L01A 2M87A 2CO5A 4PJJA 1NG7A 2FX0A 2DK8A 5CQGA 2WY8Q 4CUGA 5E3OA 3T8RA 2DMQA 3JRGA 2JVHA 1POGA 5EGOB 5EFYA 4HLXA 3L09A 3RYPA 2CUJA 1K4TA 3ZRGA 3WTVC 1RNLA 3W6KB 2E7WA 3HG9A 4ASNA 1W36C 1R00A 2UXUA 2PEXA 4M71A 2JWTA 1ZRCA 5D8KB 3OS1A 4N0BA 3OR1C 4BHPA 1VQ9I 2XGXA 2BHYA 4BHCA 3I53A 2LF7A 2NRAC 5DCMA 1ZAOA 4M6YA 1P6RA 2H09A 2MGQA 3K4CA 3U1DA 2R5YA 2EIJH 2HKUA 5HNHA 1BC7C 1S3JA 3CZ6A 3K4MA 1DU0A 4F55A 2OC6A 3EQLF 2QLZA 1DGRM 4R1HA 3T1BA 3BWGA 2N8GA 4LMYA 4FTHA 3J7AY 2NVQJ 3OS0A 1LEAA 2HNHA 3PNTA 1TC3C 3F21A 4OIQF 2K4BA 2L7MP 2A3SA 2MG4A 3DU5A 3QYFA 2NXNB 4PSXA 3PSIA 2IS1A 2L7FP 2OA4A 4D5CA 5HS7A 3E7LA 2DJNA 3K9TA 4ENKA 3CUOA 4KN4X 2E1MC 1TQPA 4IOAF 4UB6C 4LGWA 1WQ2A 3CC2I 5L3EA 1QNTA 4L9TA 2V79A 1T33A 4P9UA 5KAFC 3D5LA 3LQRA 3Q9SA 4DZJA 3OYIA 2KJCA 4A0XA 3HUGB 3W2WA 5F6FA 1XGOA 1G8XA 1JJ6C 3OYLA 2Y0MA 4C2UA 1YJWI 4P5OA 2FU4A 2A07F 3CC7I 4XKCA 1IZ1A 2MLGA 2QUFA 5HLTA 3IUVA 1PUEE 1FPQA 2DA6A 3BPXA 3DWLE 4GCTA 2ZJ2A 3HPHA 1HBXG 2NVTJ 1MBEA 3DLLF 1ENHA 3J81Z 4NN1A 2LVSA 1B9MA 3E0JB 1JGGA 4ZDLA 4F91B 1J5YA 4BH9A 2QBYB 1J9IA 5DM6F 3LA2A 1SFOJ 1MDMA 1WH5A 4XK4A 5FKKA 4MK6A 4CCJA 5BS6A 2WV0A 2DCEA 3QQAA 1LVKA 1IV8A 2D1HA 2LDUA 5E79C 5EG0A 3H92A 1BL0A 3HUGA 2VI6A 1GV5A 1ETYA 3F6VA 3CCVI 4MTEA 3E6BA 1D0XA 2OZUA 3QU6A 3FK7A 2X6WA 1R6RA 2YX4A 3J80K 3KYLA 1UHWA 2W48A 4XLCA 3R4KA 2F5FA 2L54A 4IHVA 4M73A 2P6TA 2ZFWA 4D9JA 3HXLA 1JKQC 4U0YA 4AWXB 2E5NA 2QSFX 5FJ8J 1LDKB 1TNTA 3HYIA 1FZPB 1VTNC 4MO7A 1WJDA 3LOCA 3ECHA 2XHKA 4HDUA 4BJ6C 2AS5F 4A3CJ 2ZNZA 3ZQHA 4AIKA 2Z16A 3DXJF 2XAHA 4I0AA 3REOA 2W24A 1W7PD 2V9PA 4PJ0C 3NS4A 2LH9A 3FMQA 2P6SA 3FBIB 3BG9A 4MTDA 2JZYA 2M34A 4ZYEA 4J19A 2DMNA 5E20A 1OLTA 3DLAA 1XC5A 4U88A 3HTJA 3KKDA 3DTKA 3QOEA 2PI0A 5FHPA 4BY7J 2WBMA 4HG2A 1W0UA 1R49A 2ZB9A 3RZOJ 2L5QA 2QF7A 3BG7A 4ESJA 4YG2F 4H4KC 1U5TB 3AG4H 3DTIA 4NB5A 5JR3A 3FM3A 3HTIA 2NS0A 3K2AA 3VW2A 2KDZA 4G6TB 4Y33A 2MH9A 4E7KA 3S1QJ 1ZH5A 3C7JA 3HIMA 2OCEA 1GXPA 5IOYA 4E4HA 4EGYA 2QQ9A 2FMYA 4A6DA 4M3BA 5CYVA 3IRRA 5ILUA 4M3GA 5LRRA 1VFCA 2GXAA 2Y9ZA 1TWHJ 4FE4A 1IV6A 1FLIA 3FZVA 4XLAA 4HA8A 4BACA 2Z99A 3BY6A 3ZQQA 3VW0A 2DO7A 1F36A 2HQ5A 5CPRB 2EH3A 4HQEA 4D5FA
chains in the Genus database with same CATH topology
1FEXA 1Q1VA 2G7SA 1LFUP 3HBLA 4C2MJ 1IUFA 4XICA 1RESA 4UUTA 2YU9J 2ID3A 1DU6A 1P7JA 2DMPA 1NK3P 5IOZA 1WGXA 2FD5A 3LSRA 4GCKA 4UUSA 1O4XA 2K40A 3SFIA 4AC0A 3HGGA 3LSGA 4RBOA 4JX4A 1ETWA 2EZKA 2UXHA 5D18A 1ORKA 3G56A 4L62A 3GTJJ 2Y31A 4V2GA 3S16J 5E3MA 1FTZA 2ZCXA 5FLMJ 1ETOA 2EQRA 1JKPC 3BR5A 3OOUA 4GCLA 3Q0VA 4I6ZA 4A3EJ 3LJLA 1CQTA 3GEUA 4MLOA 2GBYA 1MNMC 3KNWA 5EGOA 5AQCA 3JRBA 5K7ZA 2DA1A 4HNVA 3P9TA 4A3KJ 1UI6A 4A3BJ 3PO3J 3RZDJ 4QSHA 1ITYA 4JL3A 3GTPJ 3Q3SA 2UXOA 2IBDA 3OSGA 3EGQA 1S7EA 1WCMJ 2ZCNA 2KT0A 4AC6A 2LFBA 5C3EJ 4I76A 3HOVJ 1VNDA 5F1JA 2DA7A 2XRLA 2R0QC 4UDSA 2L7ZA 5F0FA 2NS8A 2G7LA 4CGRA 2DN0A 3ZQCA 1I3QJ 4CYCB 3EUPA 4D7NA 2HYTA 2E2JJ 3O8HA 4X1EA 5F08A 2HYJA 1ETVA 4A3IJ 3V6GA 3BR6A 1OFCX 4NDLA 3BG3A 1X2NA 1IDZA 3JSJA 2WUIA 2EZHA 3G1LA 3JRIA 4C3HJ 3BTLA 2ELKA 1H8AC 3QBMA 3QKXA 3JRHA 4UUSB 5DTDA 3Q0WA 2R5ZB 4FE7A 4MIMA 2HDDA 1SGMA 1ETQA 5M3MJ 2L9RA 3BQZA 2G0EA 1UMQA 3MKLA 4IEJA 2NP3A 1BA5A 5FMPA 2XB0X 2YVHA 2X6OA 1MSEC 1AU7A 3MN2A 2XPVA 2FJ1A 2XGCA 4Y7NJ 1YRNB 4ACIA 1OCPA 1TWAJ 2NS7A 1EF4A 3H3VK 5HSZA 5F0CA 3LWJA 3S15J 4CYCA 4W97A 2ZCMA 1JUMA 3VPRA 9ANTA 1ZK8A 4G12A 4BXXJ 4C3JJ 1HDPA 2TRTA 1FJLA 2RHAA 3GBGA 3TEDA 4DYRA 2JMWA 1U9OA 2DA5A 1JJ8C 4B4CA 1B72B 3CJDA 3PO2J 3JRFA 2LR8A 3IV5A 2FBQA 1MSFC 3QPSA 1GVDA 5D1RA 4HKUA 3GZIA 1JKOC 3JR9A 2X48A 5EEAA 2PMZN 5IYDJ 2PBXA 3IH2A 1JUSA 4AYBN 2ECBA 1YRNA 4BKXA 2F07A 2GUHA 4MXMA 4AF5A 1TWCJ 3BJBA 3GTQJ 2E1OA 4QTRA 4PXIA 2LTPA 1ETKA 2XPWA 5IYBJ 2R5ZA 1Z0XA 1IGNA 3HEFA 5IYCJ 2NVXJ 3OSFA 2ID6A 3MNLA 2Y30A 4JNNA 1LE8B 4BY1J 2X9DA 2CQQA 1LE8A 2K9QA 1H88C 3TW6A 1GT0C 5GPAA 1B72A 1MBGA 3VIBA 1R9TJ 3AQSA 2Y0SN 1ZR4A 3A01B 2DG7A 5EF6A 2Y2ZA 2OPTA 5GP9A 5H9TA 2GLOA 1BJZA 3HM5A 2DTZA 3B6AA 4S0HB 2ME6A 5M5XJ 2JA5J 5M3FJ 2DMUA 3TW7A 2QOPA 2E19A 2Y9YA 2D6YA 4M3DA 4XIDA 1W0TA 3NI7A 5E3NA 1HCRA 2HOSA 2CUFA 2JK3A 2EZIA 2WAQN 5J1UA 2LY9A 1GUUA 3BR1A 3FISA 2QTQA 2XGEA 3DCFA 4W1UA 3NAUA 4ICHA 2ECCA 2RASA 3S1MJ 1XS9A 1XG1A 2QWTA 5JLXA 4JYKA 2ZOYA 3CMYA 3HOYJ 4V2FA 2XB5A 3LHQA 2E2HJ 2FQ4A 3IH3A 2G7GA 4LOCA 2YS9A 2H8RA 1ETXA 3S2HJ 2P81A 2R7ZJ 1A5JA 1T56A 2GFNA 5C4JJ 1IC8A 2O7TA 2NX4A 1JUPA 2DA2A 2HXIA 1GV2A 4A3DJ 1F43A 1G2HA 1FIPA 1QVUA 2REKA 3ZOBA 3QPLA 2VPRA 4A3FJ 2XDNA 1NK2P 2XGDA 2HOAA 1MH3A 5J1YA 2CJJA 2COBA 3BR0A 3H0GJ 1AKHA 1APLC 1U8BA 3A01A 4MFDA 3W6VA 1OJLA 5EZGA 3I4NJ 5K7HA 5IPAA 2AO9A 5CXGA 5K7FA 1I6HJ 5E3LA 1HLVA 2IU5A 3PPBA 1BW6A 3M3YJ 5M5YJ 3ANPA 3C07A 2DMTA 3VUQA 1BW5A 2W53A 3C2BA 2K9NA 2HI3A 3PM1A 5M5WJ 2CRGA 3JRAA 2WB1N 5HODA 3BNIA 3VOXA 4BBSJ 2CU7A 3NARA 3BG5A 4NELA 1IJWC 1WPKA 5DAJA 3RH2A 3ANGA 1IG7A 1RR7A 3FRQA 4BBRJ 3HE0A 1NTCA 3RKQA 1FTTA 3ZQIA 2Q24A 3HOZJ 1WI3A 4GFKA 3E7QA 1D5YA 3LSJA 5F0HA 2YUSA 1IDYA 3NRGA 2FX0A 1UI5A 3SJMA 5E3OA 5J1RA 1MBHA 2DMQA 3JRGA 1U78A 2WGBA 1POGA 5EGOB 5EFYA 1QPIA 3FK6A 2MSYA 2QIBA 3RQIA 3GTKJ 3S1NJ 3BTCA 4ABZA 4L5EA 3DEWA 2R93J 2JA6J 2LK2A 3I4MJ 3HTHA 3TP0A 2UXUA 3VOKA 4A3LJ 3OIOA 4JX5A 2JWTA 4IHYA 3S14J 5FGLA 1UHSA 3MVPA 3V78A 4IHXA 3JRCA 1Y1WJ 2M8GX 3VVZA 2I10A 4B3AA 2UXPA 2MGQA 2RAEA 2R5YA 4A3JJ 2GM4A 3RD3A 2HKUA 4DW6A 3WHBA 1DU0A 3S1RJ 1MH4A 5C4XJ 2YVEA 3IH4A 5GPCA 2N8GA 2CQXA 4FTHA 3BR2A 2NVQJ 3GTLJ 3VW1A 2PZ9A 5HAWA 1TC3C 2JA8J 1JT0A 4FCYA 1ZGWA 2LLKA 2L7MP 2MG4A 3HOXJ 5F27A 3LNQA 3A02A 2L7FP 1PUFB 3M4OJ 3Q0UA 4D5CA 3S5RA 5J3LA 2XPUA 2AHQA 1ZTRA 3E7LA 2DJNA 2UXIA 4MFEA 1ZR2A 3AQTA 5DS9A 3G1OA 5EZHA 2ZOZA 4JP0A 1VI0A 2E2IJ 1IRZA 4JX6A 1U9NA 3COLA 3LSPA 3D1NI 3DPJA 4M3EA 1T33A 2NP5A 1K83J 3JRDA 2VKEA 2VKVA 4DZJA 4EEFG 2R5YB 3K7AJ 3KKCA 4KWAA 3T6NA 3BR3A 1JJ6C 3HKZN 2MW8A 5IP7J 4X6AJ 3VVYA 2OERA 1H89C 4QIWN 2VUMJ 4XRMA 2HXOA 5FKMA 2JN6A 5FKLA 4A93J 3IUVA 4DYCA 5HBUA 2DA6A 5C44J 3BHQA 4GCTA 2NVTJ 2WV1A 4RDUA 3CCYA 1MBEA 1ENHA 5EDNA 4M3FA 1P7IA 3F1BA 2LVSA 3NPIA 4NN1A 2L0KA 1JGGA 1SANA 1A6IA 2IEKA 3FIWA 5F04A 3HOUJ 3CRJA 4XRSG 3S17J 4C3IJ 1X58A 1SFOJ 1RKTA 2O9LA 1WH5A 5BNGA 2H1KA 4XK4A 5C4YA 5FKNA 5FKKA 4MK6A 5IP6A 3JREA 3G1MA 3QQAA 4A69C 4AUXA 5EG0A 1MBKA 1Y1VJ 4GFBA 1B8IA 1BL0A 4DZPA 3ON2A 2VI6A 1GV5A 1ETYA 3VVXA 3ON4A 1QRYA 1MBJA 2LD5A 1Z77A 4B1RA 3FK7A 3BRUA 2JA7J 1AKHB 3CWRA 4YZEA 3UKGA 3HTAA 2W48A 3GTOJ 1I50J 3BQYA 4IHVA 3FKIJ 1JKQC 2DA4A 2JJ7A 5FJ8J 1PUFA 2ME0A 2OI8A 4MO7A 5EG0B 1GDTA 3NNRA 2O8KA 3LOCA 1RETA 2LKXA 1FIAA 4A3CJ 1X2MA 2B63J 3KZ9A 3ZQHA 3ZQGA 2K9SA 2V57A 4A3MJ 2M2EA 2D5VA 3HB9A 3NXCA 3G7RA 1JTXA 3BG9A 1LFBA 2TCTA 3CDLA 5CW8A 2NVYJ 2M34A 4J19A 3HGYA 3F0CA 1E3OC 2G3BA 4IHWA 5IP9J 2QKOA 3TP3A 2DMNA 1VF9A 3CQZJ 3BCGA 1JKRC 1XC5A 2M0CA 3BTJA 3HTJA 4XRSA 3KKDA 3HDDA 3BTIA 5FLVA 5FHPA 2DG8A 5D19A 3A03A 5K58A 4ME9A 4BY7J 3B81A 1TWGJ 3GTGJ 1W0UA 1JTYA 3O60A 4JKZA 1WH7A 2ZB9A 3RZOJ 3S2DJ 3SDGA 2QF7A 4Y52J 5CXIA 2DA3A 3PASA 3ZQFA 3VP5A 3HTIA 3K2AA 3VW2A 5JLWA 2KDZA 1ZQ3P 1TWFJ 2CUEA 1QVTA 1ZKGA 4M6VA 3S1QJ 3ZQLA 2NOGA 4FISA 3HIMA 3B6CA 2GENA 4A3GJ 5IOYA 2IAIA 1OCTC 2R92J 2HOTA 1K61A 1HF0A 1MBFA 1RPWA 3GTMJ 4M3BA 4M3GA 2M9HA 5FKOA 1UG2A 1VFCA 1AHDP 3HOWJ 2Y9ZA 1TWHJ 4FE4A 1IV6A 5EYRA 1RKWA 4D7MA 1HDDC 4GFLA 3WHCA 2OF7A 1JT6A 1HOMA 3O8GA 1B8IB 3VW0A 2QCOA 1F36A 2EBIA 3BT9A 2XSDC 4DYQA 2HQ5A 2O7OA 2EH3A 3L1PA 2LP0A 4D5FA 2EZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEX A;  1Q1V A;  2G7S A;  1LFU P;  3HBL A;  4C2M J;  1IUF A;  4XIC A;  1RES A;  4UUT A;  2YU9 J;  2ID3 A;  1DU6 A;  1P7J A;  2DMP A;  1NK3 P;  5IOZ A;  1WGX A;  2FD5 A;  3LSR A;  4GCK A;  4UUS A;  1O4X A;  2K40 A;  3SFI A;  4AC0 A;  3HGG A;  3LSG A;  4RBO A;  4JX4 A;  1ETW A;  2EZK A;  2UXH A;  5D18 A;  1ORK A;  3G56 A;  4L62 A;  3GTJ J;  2Y31 A;  4V2G A;  3S16 J;  5E3M A;  1FTZ A;  2ZCX A;  5FLM J;  1ETO A;  2EQR A;  1JKP C;  3BR5 A;  3OOU A;  4GCL A;  3Q0V A;  4I6Z A;  4A3E J;  3LJL A;  1CQT A;  3GEU A;  4MLO A;  2GBY A;  1MNM C;  3KNW A;  5EGO A;  5AQC A;  3JRB A;  5K7Z A;  2DA1 A;  4HNV A;  3P9T A;  4A3K J;  1UI6 A;  4A3B J;  3PO3 J;  3RZD J;  4QSH A;  1ITY A;  4JL3 A;  3GTP J;  3Q3S A;  2UXO A;  2IBD A;  3OSG A;  3EGQ A;  1S7E A;  1WCM J;  2ZCN A;  2KT0 A;  4AC6 A;  2LFB A;  5C3E J;  4I76 A;  3HOV J;  1VND A;  5F1J A;  2DA7 A;  2XRL A;  2R0Q C;  4UDS A;  2L7Z A;  5F0F A;  2NS8 A;  2G7L A;  4CGR A;  2DN0 A;  3ZQC A;  1I3Q J;  4CYC B;  3EUP A;  4D7N A;  2HYT A;  2E2J J;  3O8H A;  4X1E A;  5F08 A;  2HYJ A;  1ETV A;  4A3I J;  3V6G A;  3BR6 A;  1OFC X;  4NDL A;  3BG3 A;  1X2N A;  1IDZ A;  3JSJ A;  2WUI A;  2EZH A;  3G1L A;  3JRI A;  4C3H J;  3BTL A;  2ELK A;  1H8A C;  3QBM A;  3QKX A;  3JRH A;  4UUS B;  5DTD A;  3Q0W A;  2R5Z B;  4FE7 A;  4MIM A;  2HDD A;  1SGM A;  1ETQ A;  5M3M J;  2L9R A;  3BQZ A;  2G0E A;  1UMQ A;  3MKL A;  4IEJ A;  2NP3 A;  1BA5 A;  5FMP A;  2XB0 X;  2YVH A;  2X6O A;  1MSE C;  1AU7 A;  3MN2 A;  2XPV A;  2FJ1 A;  2XGC A;  4Y7N J;  1YRN B;  4ACI A;  1OCP A;  1TWA J;  2NS7 A;  1EF4 A;  3H3V K;  5HSZ A;  5F0C A;  3LWJ A;  3S15 J;  4CYC A;  4W97 A;  2ZCM A;  1JUM A;  3VPR A;  9ANT A;  1ZK8 A;  4G12 A;  4BXX J;  4C3J J;  1HDP A;  2TRT A;  1FJL A;  2RHA A;  3GBG A;  3TED A;  4DYR A;  2JMW A;  1U9O A;  2DA5 A;  1JJ8 C;  4B4C A;  1B72 B;  3CJD A;  3PO2 J;  3JRF A;  2LR8 A;  3IV5 A;  2FBQ A;  1MSF C;  3QPS A;  1GVD A;  5D1R A;  4HKU A;  3GZI A;  1JKO C;  3JR9 A;  2X48 A;  5EEA A;  2PMZ N;  5IYD J;  2PBX A;  3IH2 A;  1JUS A;  4AYB N;  2ECB A;  1YRN A;  4BKX A;  2F07 A;  2GUH A;  4MXM A;  4AF5 A;  1TWC J;  3BJB A;  3GTQ J;  2E1O A;  4QTR A;  4PXI A;  2LTP A;  1ETK A;  2XPW A;  5IYB J;  2R5Z A;  1Z0X A;  1IGN A;  3HEF A;  5IYC J;  2NVX J;  3OSF A;  2ID6 A;  3MNL A;  2Y30 A;  4JNN A;  1LE8 B;  4BY1 J;  2X9D A;  2CQQ A;  1LE8 A;  2K9Q A;  1H88 C;  3TW6 A;  1GT0 C;  5GPA A;  1B72 A;  1MBG A;  3VIB A;  1R9T J;  3AQS A;  2Y0S N;  1ZR4 A;  3A01 B;  2DG7 A;  5EF6 A;  2Y2Z A;  2OPT A;  5GP9 A;  5H9T A;  2GLO A;  1BJZ A;  3HM5 A;  2DTZ A;  3B6A A;  4S0H B;  2ME6 A;  5M5X J;  2JA5 J;  5M3F J;  2DMU A;  3TW7 A;  2QOP A;  2E19 A;  2Y9Y A;  2D6Y A;  4M3D A;  4XID A;  1W0T A;  3NI7 A;  5E3N A;  1HCR A;  2HOS A;  2CUF A;  2JK3 A;  2EZI A;  2WAQ N;  5J1U A;  2LY9 A;  1GUU A;  3BR1 A;  3FIS A;  2QTQ A;  2XGE A;  3DCF A;  4W1U A;  3NAU A;  4ICH A;  2ECC A;  2RAS A;  3S1M J;  1XS9 A;  1XG1 A;  2QWT A;  5JLX A;  4JYK A;  2ZOY A;  3CMY A;  3HOY J;  4V2F A;  2XB5 A;  3LHQ A;  2E2H J;  2FQ4 A;  3IH3 A;  2G7G A;  4LOC A;  2YS9 A;  2H8R A;  1ETX A;  3S2H J;  2P81 A;  2R7Z J;  1A5J A;  1T56 A;  2GFN A;  5C4J J;  1IC8 A;  2O7T A;  2NX4 A;  1JUP A;  2DA2 A;  2HXI A;  1GV2 A;  4A3D J;  1F43 A;  1G2H A;  1FIP A;  1QVU A;  2REK A;  3ZOB A;  3QPL A;  2VPR A;  4A3F J;  2XDN A;  1NK2 P;  2XGD A;  2HOA A;  1MH3 A;  5J1Y A;  2CJJ A;  2COB A;  3BR0 A;  3H0G J;  1AKH A;  1APL C;  1U8B A;  3A01 A;  4MFD A;  3W6V A;  1OJL A;  5EZG A;  3I4N J;  5K7H A;  5IPA A;  2AO9 A;  5CXG A;  5K7F A;  1I6H J;  5E3L A;  1HLV A;  2IU5 A;  3PPB A;  1BW6 A;  3M3Y J;  5M5Y J;  3ANP A;  3C07 A;  2DMT A;  3VUQ A;  1BW5 A;  2W53 A;  3C2B A;  2K9N A;  2HI3 A;  3PM1 A;  5M5W J;  2CRG A;  3JRA A;  2WB1 N;  5HOD A;  3BNI A;  3VOX A;  4BBS J;  2CU7 A;  3NAR A;  3BG5 A;  4NEL A;  1IJW C;  1WPK A;  5DAJ A;  3RH2 A;  3ANG A;  1IG7 A;  1RR7 A;  3FRQ A;  4BBR J;  3HE0 A;  1NTC A;  3RKQ A;  1FTT A;  3ZQI A;  2Q24 A;  3HOZ J;  1WI3 A;  4GFK A;  3E7Q A;  1D5Y A;  3LSJ A;  5F0H A;  2YUS A;  1IDY A;  3NRG A;  2FX0 A;  1UI5 A;  3SJM A;  5E3O A;  5J1R A;  1MBH A;  2DMQ A;  3JRG A;  1U78 A;  2WGB A;  1POG A;  5EGO B;  5EFY A;  1QPI A;  3FK6 A;  2MSY A;  2QIB A;  3RQI A;  3GTK J;  3S1N J;  3BTC A;  4ABZ A;  4L5E A;  3DEW A;  2R93 J;  2JA6 J;  2LK2 A;  3I4M J;  3HTH A;  3TP0 A;  2UXU A;  3VOK A;  4A3L J;  3OIO A;  4JX5 A;  2JWT A;  4IHY A;  3S14 J;  5FGL A;  1UHS A;  3MVP A;  3V78 A;  4IHX A;  3JRC A;  1Y1W J;  2M8G X;  3VVZ A;  2I10 A;  4B3A A;  2UXP A;  2MGQ A;  2RAE A;  2R5Y A;  4A3J J;  2GM4 A;  3RD3 A;  2HKU A;  4DW6 A;  3WHB A;  1DU0 A;  3S1R J;  1MH4 A;  5C4X J;  2YVE A;  3IH4 A;  5GPC A;  2N8G A;  2CQX A;  4FTH A;  3BR2 A;  2NVQ J;  3GTL J;  3VW1 A;  2PZ9 A;  5HAW A;  1TC3 C;  2JA8 J;  1JT0 A;  4FCY A;  1ZGW A;  2LLK A;  2L7M P;  2MG4 A;  3HOX J;  5F27 A;  3LNQ A;  3A02 A;  2L7F P;  1PUF B;  3M4O J;  3Q0U A;  4D5C A;  3S5R A;  5J3L A;  2XPU A;  2AHQ A;  1ZTR A;  3E7L A;  2DJN A;  2UXI A;  4MFE A;  1ZR2 A;  3AQT A;  5DS9 A;  3G1O A;  5EZH A;  2ZOZ A;  4JP0 A;  1VI0 A;  2E2I J;  1IRZ A;  4JX6 A;  1U9N A;  3COL A;  3LSP A;  3D1N I;  3DPJ A;  4M3E A;  1T33 A;  2NP5 A;  1K83 J;  3JRD A;  2VKE A;  2VKV A;  4DZJ A;  4EEF G;  2R5Y B;  3K7A J;  3KKC A;  4KWA A;  3T6N A;  3BR3 A;  1JJ6 C;  3HKZ N;  2MW8 A;  5IP7 J;  4X6A J;  3VVY A;  2OER A;  1H89 C;  4QIW N;  2VUM J;  4XRM A;  2HXO A;  5FKM A;  2JN6 A;  5FKL A;  4A93 J;  3IUV A;  4DYC A;  5HBU A;  2DA6 A;  5C44 J;  3BHQ A;  4GCT A;  2NVT J;  2WV1 A;  4RDU A;  3CCY A;  1MBE A;  1ENH A;  5EDN A;  4M3F A;  1P7I A;  3F1B A;  2LVS A;  3NPI A;  4NN1 A;  2L0K A;  1JGG A;  1SAN A;  1A6I A;  2IEK A;  3FIW A;  5F04 A;  3HOU J;  3CRJ A;  4XRS G;  3S17 J;  4C3I J;  1X58 A;  1SFO J;  1RKT A;  2O9L A;  1WH5 A;  5BNG A;  2H1K A;  4XK4 A;  5C4Y A;  5FKN A;  5FKK A;  4MK6 A;  5IP6 A;  3JRE A;  3G1M A;  3QQA A;  4A69 C;  4AUX A;  5EG0 A;  1MBK A;  1Y1V J;  4GFB A;  1B8I A;  1BL0 A;  4DZP A;  3ON2 A;  2VI6 A;  1GV5 A;  1ETY A;  3VVX A;  3ON4 A;  1QRY A;  1MBJ A;  2LD5 A;  1Z77 A;  4B1R A;  3FK7 A;  3BRU A;  2JA7 J;  1AKH B;  3CWR A;  4YZE A;  3UKG A;  3HTA A;  2W48 A;  3GTO J;  1I50 J;  3BQY A;  4IHV A;  3FKI J;  1JKQ C;  2DA4 A;  2JJ7 A;  5FJ8 J;  1PUF A;  2ME0 A;  2OI8 A;  4MO7 A;  5EG0 B;  1GDT A;  3NNR A;  2O8K A;  3LOC A;  1RET A;  2LKX A;  1FIA A;  4A3C J;  1X2M A;  2B63 J;  3KZ9 A;  3ZQH A;  3ZQG A;  2K9S A;  2V57 A;  4A3M J;  2M2E A;  2D5V A;  3HB9 A;  3NXC A;  3G7R A;  1JTX A;  3BG9 A;  1LFB A;  2TCT A;  3CDL A;  5CW8 A;  2NVY J;  2M34 A;  4J19 A;  3HGY A;  3F0C A;  1E3O C;  2G3B A;  4IHW A;  5IP9 J;  2QKO A;  3TP3 A;  2DMN A;  1VF9 A;  3CQZ J;  3BCG A;  1JKR C;  1XC5 A;  2M0C A;  3BTJ A;  3HTJ A;  4XRS A;  3KKD A;  3HDD A;  3BTI A;  5FLV A;  5FHP A;  2DG8 A;  5D19 A;  3A03 A;  5K58 A;  4ME9 A;  4BY7 J;  3B81 A;  1TWG J;  3GTG J;  1W0U A;  1JTY A;  3O60 A;  4JKZ A;  1WH7 A;  2ZB9 A;  3RZO J;  3S2D J;  3SDG A;  2QF7 A;  4Y52 J;  5CXI A;  2DA3 A;  3PAS A;  3ZQF A;  3VP5 A;  3HTI A;  3K2A A;  3VW2 A;  5JLW A;  2KDZ A;  1ZQ3 P;  1TWF J;  2CUE A;  1QVT A;  1ZKG A;  4M6V A;  3S1Q J;  3ZQL A;  2NOG A;  4FIS A;  3HIM A;  3B6C A;  2GEN A;  4A3G J;  5IOY A;  2IAI A;  1OCT C;  2R92 J;  2HOT A;  1K61 A;  1HF0 A;  1MBF A;  1RPW A;  3GTM J;  4M3B A;  4M3G A;  2M9H A;  5FKO A;  1UG2 A;  1VFC A;  1AHD P;  3HOW J;  2Y9Z A;  1TWH J;  4FE4 A;  1IV6 A;  5EYR A;  1RKW A;  4D7M A;  1HDD C;  4GFL A;  3WHC A;  2OF7 A;  1JT6 A;  1HOM A;  3O8G A;  1B8I B;  3VW0 A;  2QCO A;  1F36 A;  2EBI A;  3BT9 A;  2XSD C;  4DYQ A;  2HQ5 A;  2O7O A;  2EH3 A;  3L1P A;  2LP0 A;  4D5F A;  2EZL A; 
#chains in the Genus database with same CATH topology
 1Q1V A;  3FXK A;  3G2B A;  4KJZ A;  1IUF A;  3F9K A;  4UUT A;  1VQ7 I;  4BHB A;  4CSW A;  1F9N A;  4G8X A;  2FD5 A;  1BI0 A;  3M9A A;  1R5I D;  5BQT A;  2BGC A;  3DP7 A;  2K40 A;  3SFI A;  2R7V A;  2ADU A;  3HGG A;  4F92 B;  5DEQ A;  3ZMV A;  2XDV A;  1VQO I;  2Y31 A;  2K7L A;  4CGZ A;  1YW7 A;  2B1E A;  3FXL A;  4RAY A;  2IRF G;  4Q47 A;  4GCL A;  2GQQ A;  3Q0V A;  3ROU A;  3G71 I;  4I6Z A;  1PDN C;  1QGP A;  2KJB A;  5HDK A;  4P9F A;  5EGO A;  5GAD J;  2EPF A;  4HNV A;  1UI6 A;  1J75 A;  5L3B A;  1DPU A;  4Y3O A;  5B1A H;  2VXZ A;  3ZP5 A;  2V1D A;  5EEH A;  1E3P A;  1HQC A;  3Q3S A;  1JHH A;  3RJP A;  5ICE A;  4GGG A;  2A6T A;  3P9K A;  3X2Q H;  1SD4 A;  2RQP A;  2JRM A;  4LG3 A;  4OWR B;  2DK5 A;  3FBN B;  4NUB A;  2DA7 A;  2XVC A;  4CO8 A;  4YIR X;  3NEU A;  5F0F A;  2OZ6 A;  2NS8 A;  3L2V A;  1LKX A;  4XLH A;  2B9S A;  2G7L A;  5GAG J;  2Z5U A;  4EVI A;  2JSP A;  3O8H A;  1V5G A;  3BJA A;  4X1E A;  1ETV A;  1XDU A;  2DFI A;  4MHG A;  2IVM A;  1YFH A;  3VFZ A;  3JSJ A;  1P9Q C;  2VBX A;  2LBF A;  5K1Y A;  2W57 A;  1KU7 A;  2VC0 A;  2FF4 A;  5D5X B;  3QBM A;  5KNL A;  3SWH A;  1PP7 U;  4N4N B;  1R58 A;  3KP2 A;  3JRH A;  2DOE A;  3AG2 H;  5DTD A;  3ZMD A;  1XMK A;  2DLL A;  2QQB A;  2ESN A;  3BJ6 A;  4BYY A;  2OTJ I;  2ICW G;  1LUJ B;  3BQZ A;  2G0E A;  1UMQ A;  3K1N A;  3DV8 A;  2ZXJ A;  4IEJ A;  5FD5 A;  3QP5 A;  3Q9V A;  2KIQ A;  1MSE C;  3CLO A;  4XKV A;  1AU7 A;  4CDG A;  1TNS A;  4Y7N J;  2M1B A;  4I02 A;  4ACI A;  5HSZ A;  2B7E A;  2NS7 A;  1EF4 A;  2FOW A;  3FM5 A;  1OYW A;  3A2K A;  5DCF A;  1WJC A;  3SFZ A;  3OYK A;  2VC1 A;  3MMY B;  9ANT A;  5B3S H;  3S2W A;  1FJL A;  2KRH A;  2X6X A;  2CMP A;  3GBG A;  1S7O A;  4CYD A;  4II3 A;  4XOP A;  2E60 A;  2BXZ A;  3R60 A;  1TTY A;  1U9O A;  3GFJ A;  1JJ8 C;  3IV5 A;  2FUG 2;  1XGN A;  2UV1 A;  4J00 A;  4YRV A;  5EJC A;  1VQ6 I;  4HKU A;  4HST A;  4DQ2 A;  4BS9 A;  1CF7 A;  2X48 A;  3WGG A;  1OYI A;  1HW5 A;  2KMU A;  5EEA A;  2GUH A;  4BKX A;  4WXD A;  3PUB A;  4AF5 A;  3BJB A;  4G94 A;  3GTQ J;  3LSK A;  4QTR A;  3VSK A;  3F8N A;  2Q2E A;  2BY0 A;  2VJ4 A;  4KIG A;  2R5Z A;  1UJ8 A;  3E5Q A;  4UY8 I;  3M1C A;  4Y13 A;  2ID6 A;  3OSF A;  2H6B A;  4JNN A;  1KU2 A;  1LE8 B;  4A2U A;  2FML A;  3S3M A;  3DF8 A;  4BQA A;  2K9Q A;  1H88 C;  4YEJ A;  5HDN A;  1TL8 A;  3VOD A;  1T39 A;  4L18 B;  1GT0 C;  1MMN A;  3VIB A;  4PGH A;  1D1C A;  1AWC A;  3OYF A;  2Z1D A;  2VN2 A;  2O03 A;  3A01 B;  1V3F A;  3CO6 C;  3WTZ A;  1G4D A;  2DG7 A;  1OQY A;  4M6X A;  5GP9 A;  3OWT A;  1CF7 B;  2GLO A;  2BVM A;  4CXF A;  3HM5 A;  1TLH B;  2DTZ A;  4OOI A;  5M5X J;  2VLA A;  2H27 A;  2JA5 J;  5M3F J;  3TW7 A;  2Z3Y A;  3VYT B;  4DIQ A;  1SVM A;  5LBQ A;  1X19 A;  2HYF A;  3J7A O;  2D6Y A;  4U9N A;  2IJL A;  1UFM A;  1LPQ A;  1UCR A;  1T0F C;  1HCR A;  2HOS A;  2CUF A;  1YX3 A;  1B4A A;  2HZD A;  3K70 C;  4PK4 A;  3S1M J;  4G6Q A;  4PJN A;  5JLX A;  4B09 A;  2ZOY A;  3CMY A;  5D5W B;  4V2F A;  2XB5 A;  1IO2 A;  2RDP A;  2X51 A;  2FQ4 A;  3BJO A;  3IH3 A;  2X85 A;  3QP6 A;  1ETX A;  1IRG A;  1A5J A;  2V7F A;  2PMZ A;  2GFN A;  5C4J J;  1IC8 A;  2O7T A;  4YFK F;  1JUP A;  5FGM A;  4A3D J;  2UZK A;  1JGS A;  1FIP A;  3RYR A;  2D1V A;  1USS A;  3KP5 A;  1FT9 A;  1RI7 A;  2BV6 A;  3ABT A;  1A31 A;  2C6Y A;  2IGN A;  2A05 A;  5D6F A;  2XGD A;  2R7D A;  3CCR I;  3BPV A;  1SAU A;  2WA0 A;  2GOX B;  1XMA A;  3K70 D;  2A6E F;  2F5V A;  3JAM K;  2RN7 A;  2UUZ A;  5K7H A;  4L5J A;  4M72 A;  3FHZ A;  5K7F A;  5D8L B;  2CQ7 A;  4AVP A;  1VQ4 I;  3M3Y J;  3H9G A;  1X4O A;  4HX8 A;  3QYB A;  4YFN F;  3LFK A;  3ABU A;  1P2F A;  4XN3 A;  3ABK H;  3FXJ A;  3PM1 A;  5M5W J;  3M8E A;  4BE0 A;  4XON A;  3LSM A;  2CU7 A;  2DAO A;  5H6Q A;  3BG5 A;  2VB6 A;  4NEL A;  4B48 A;  3IP4 B;  3OYD A;  1MMD A;  5K5Q A;  1RR7 A;  2KRF A;  2WTE A;  4CZC A;  4HDV A;  3J81 K;  3PFI A;  3RDI A;  1SC7 A;  5F0H A;  4AIH A;  4A5N A;  1LNW A;  1YLF A;  1PVE A;  3L2C A;  3LMM A;  5DV5 A;  1RIO H;  1UI5 A;  2QKL B;  3SJM A;  3O6B B;  3K1M A;  4GCV A;  2ZY9 A;  2XAJ A;  2K27 A;  2VQH A;  3GTK J;  2E34 A;  3S3N A;  2GA2 A;  3BTC A;  1YW8 A;  2W00 A;  1ZEL A;  3DEW A;  4CA0 A;  3WE2 A;  2JA6 J;  3I4M J;  3HTH A;  3VOK A;  2W82 A;  4XR6 A;  1HC8 A;  3OIO A;  1O3T A;  3KCC A;  3S14 J;  3GEZ A;  1T95 A;  3V78 A;  2HOE A;  2QVO A;  3JRC A;  1WJE A;  3CP2 A;  3AKZ A;  1EH7 A;  1F5T A;  5FRO A;  3CUQ B;  2GM4 A;  1OPC A;  3MKY B;  4RAZ A;  3LFU A;  4DW6 A;  2EIN H;  5LHI A;  1ULY A;  2JVG A;  3MEX A;  5HS8 A;  1Y39 A;  3TO7 A;  3V42 A;  4JBA A;  2YVE A;  5GPC A;  3RKX A;  2EFP A;  2NYX A;  3BR2 A;  3SDB A;  4KIF A;  3OYB A;  4BU2 A;  5BPI A;  4PUS A;  3SXY A;  2JA8 J;  1ZGW A;  4BQN A;  2AQF A;  2OQG A;  4KMF A;  3HOX J;  3ECO A;  3A02 A;  3M4O J;  3DPU A;  2R4G A;  3R0J A;  2QBY A;  4Q4Z F;  5HS9 A;  5F64 A;  4BJT A;  4MFE A;  3BLY A;  1ZR2 A;  2HFH A;  1TW3 A;  2ZOZ A;  1BOA A;  3BDD A;  1R4N B;  3RSN A;  3E1S A;  3LAP A;  5TJJ A;  3SQN A;  4HNT A;  3D1N I;  2NP5 A;  4LLG F;  3D5R C;  3JRD A;  3U9G A;  4EEF G;  1Z7L A;  3PL8 A;  1IN4 A;  3L7W A;  1RUN A;  1SVL A;  3K7A J;  4MQ9 F;  3WOD F;  1UG0 A;  1V54 H;  3T6N A;  3BR3 A;  4BXU A;  2VUM J;  5FKM A;  4A93 J;  3GZ5 A;  3CMM A;  2WAF A;  3KZZ A;  3VTI A;  2D45 A;  2KIS A;  3IWF A;  2BVL A;  2DW4 A;  3FF5 A;  1MJ9 A;  2IGO A;  5KVR A;  5LD2 C;  3C3W A;  1PJR A;  2G9W A;  3PUF A;  3CCE I;  3H1C A;  5KK1 A;  3NPI A;  2ELJ A;  2XC7 A;  5HOO A;  3FIW A;  2O3F A;  3GZ6 A;  3EDP A;  4G7O F;  3IUO A;  2F4O B;  4ZYG A;  4C3I J;  1X58 A;  3KLN A;  2K3F A;  4IJA A;  2I5U A;  3QOP A;  1PYV A;  1J7K A;  2NAZ A;  2E35 A;  2B3W A;  3ZGK A;  3U21 A;  5IP6 A;  3JRE A;  3TL4 X;  4LK0 F;  4A69 C;  4AUX A;  2W7N A;  1X1B A;  4RB0 A;  3ON2 A;  2IGM A;  2QSH X;  2KIM A;  3W2V A;  1S72 I;  3ON4 A;  3K8P C;  1MBJ A;  2LSO A;  1HW2 A;  1E0E A;  3ZN1 A;  3SEQ A;  3BRU A;  3UKG A;  3ZQ7 A;  4U7D A;  3BCB A;  1I50 J;  2J5O A;  4EJO A;  1YI2 I;  2JT1 A;  2DA4 A;  1SD5 A;  1FSE A;  2A6H F;  1TZL A;  2O8K A;  1VQM I;  4P55 A;  4G7Z F;  4IRI A;  3CJT B;  2ETH A;  1QZZ A;  2DT5 A;  1IXS B;  2B63 J;  3GLL A;  3ZQG A;  4BQO A;  3KYC B;  4M9S A;  5LGU A;  3QPH A;  1TBX A;  2CS3 A;  2D5V A;  2Z9O A;  3G7R A;  2A61 A;  1LFB A;  2NVY J;  3F0C A;  3MKW B;  3L2Q A;  1E3O C;  3MKZ A;  4GO1 A;  4EJU A;  3E5U A;  2TDX A;  2V1X A;  1OYY A;  2ZJQ F;  5CVJ A;  1JKR C;  3F22 A;  3BTI A;  5FLV A;  5D19 A;  3U1K A;  3A03 A;  4Y4R A;  3B81 A;  4RGU A;  3WTW C;  2BEO A;  3SDG A;  3IC7 A;  1LFP A;  1J2X A;  5CXI A;  3BOQ A;  2DA3 A;  2VJI A;  4HOB A;  1W7P B;  4IOC F;  2DOD A;  3CCJ I;  1ZQ3 P;  3FXQ A;  2FE3 A;  5DUI A;  3KIO A;  2VBZ A;  1QVT A;  1Z9C A;  4NC7 A;  4HNU A;  1AOY A;  2VQG A;  2W25 A;  1WI9 A;  1IRX A;  2NOG A;  4FIS A;  4RB2 C;  1O3R A;  3KEO A;  4ZTJ A;  5J8C A;  4IZZ A;  1GLN A;  4A3G J;  3G3Z A;  2IAI A;  2R92 J;  4IPA A;  3EPZ A;  1HKS A;  3HHH A;  2HS5 A;  5E8G A;  3E6C C;  1LEB A;  4C2M A;  1U6G A;  4XLP F;  5FKO A;  3HOW J;  1L0O C;  3CTA A;  3LL7 A;  5EYR A;  1RKW A;  1BI2 A;  1IRF A;  2HWV A;  3EUH C;  1OKR A;  2IP2 A;  2OV7 A;  4A5M A;  4LIU A;  4QPQ A;  1MJB A;  3ERE D;  3PNV A;  3CJR B;  2QEN A;  1B8I B;  4OMY A;  1HOM A;  2Z33 A;  4BNC A;  2CUZ A;  2A68 F;  4E7L A;  1WZ2 A;  2O7O A;  3ZMZ A;  4HV5 A;  5CQE A;  1OCC H;  1FEX A;  4Z2Y A;  2G7S A;  1LFU P;  2NOJ B;  2VQC A;  2GIV A;  2NNY A;  3CD6 I;  4ZJZ A;  4KDP A;  3IAS 2;  2BXY A;  2YU9 J;  6PAX A;  2PMH A;  4I7H A;  3PIO F;  1W5T A;  2VKH A;  1P7J A;  4F52 A;  1NK3 P;  1MMG A;  1MZB A;  4LG0 A;  3IKV A;  4U0V A;  4OIN F;  5IT3 A;  3HTS B;  2O8X A;  1MW7 A;  2F5C A;  3D0S A;  3VEP A;  4GCK A;  3BZ6 A;  3FMR A;  3MWM A;  5L3C A;  2PG4 A;  4JX4 A;  1ETW A;  2LRD A;  4RBO A;  4ZYD A;  1DP7 P;  2UXH A;  4UB8 C;  3GTJ J;  4V2G A;  4EJW A;  4OMZ A;  3GO5 A;  4OD5 A;  5IT9 Z;  2ZCX A;  2EQR A;  2XAF A;  1OMI A;  2GA1 A;  3CF2 A;  5CKT A;  3HL2 A;  1JKP C;  1FMV A;  1WJA A;  1SFE A;  3BR5 A;  3OOU A;  2F5D A;  1A04 A;  4ETS A;  1O3Q A;  4A3E J;  1CQT A;  2X4H A;  3GYH X;  1QU3 A;  1MNM C;  4PFO A;  4DBQ A;  4QPO A;  1DPR A;  4UV9 A;  3LST A;  4HX4 A;  5GTI C;  5ILV A;  3GLX A;  3P9T A;  1S29 A;  4A3B J;  2K5C A;  3PO3 J;  3IWZ A;  3KEY A;  3HSR A;  4QSH A;  3G4S I;  3QOD A;  3BZK A;  4JL3 A;  5F1R A;  1BI1 A;  2IW5 A;  4C30 A;  1T38 A;  3P5J A;  1R4M B;  2H1L A;  2V9V A;  3DEU A;  2HR3 A;  2KL4 A;  1S7E A;  2FNP A;  1FP1 D;  5C3E J;  4I76 A;  2GXB A;  1NH3 A;  4WK8 F;  3HOV J;  4PDK A;  5F1J A;  2XRL A;  1G3Y A;  1WHU A;  1MGT A;  3DKX A;  4L0Z B;  4LK1 F;  1ZRE A;  3PNY A;  1Y0N A;  4BQQ A;  1XB4 A;  2HKX A;  2HTJ A;  4I98 B;  3I9V 2;  5FB2 A;  3EUP A;  2E2J J;  1X4P A;  3L2U A;  5F08 A;  2PJR A;  4A3I J;  3I4P A;  2RQQ A;  3BG3 A;  2ELH A;  1IDZ A;  4L9N A;  3SZG A;  1HW1 A;  3JRI A;  1R36 A;  4C3H J;  3FHN A;  2ELK A;  4PJL A;  3SEZ A;  1BR2 A;  2PBI A;  5LGN A;  2O6G E;  4Q5S F;  3I59 B;  3QKX A;  4RB3 C;  3RTR A;  1I27 A;  3CES A;  3WU1 B;  4ESB A;  2KZV A;  3Q0W A;  5EEG A;  2DPD A;  5HLG A;  1S5L C;  3VWB A;  5CLS A;  4MIM A;  2BW3 A;  5FFX A;  2HDD A;  1SGM A;  4BUP A;  2L02 A;  3MKL A;  2NP3 A;  1BA5 A;  1EV7 A;  4XLN F;  4HZF A;  2X6O A;  2FJ1 A;  4II2 A;  3LWF A;  2IA2 A;  2HPM A;  4JK1 X;  3LWJ A;  3S15 J;  4ZYH A;  1P4X A;  2HU9 A;  2ZCM A;  3K2Z A;  4LG0 B;  3VPR A;  1ZK8 A;  4ZZD A;  4BXX J;  1HDP A;  2TRT A;  3ZCO A;  3CF5 F;  3CCQ I;  4NC8 A;  1X1A A;  2F48 A;  2H6C A;  2DA5 A;  4BXF A;  1EA3 A;  1VQ5 I;  3OYN A;  5DYM A;  2FBQ A;  3UNG C;  2R7U A;  3QPS A;  1KQ9 A;  2RNG A;  3HRU A;  1GVD A;  1ZG1 A;  3GZI A;  3OYA A;  2PMZ N;  4U0W A;  5GAE J;  2ZJP F;  4FX4 A;  1U8R A;  5IYD J;  2PBX A;  2ECB A;  3VYR B;  2DU9 A;  2FJI 1;  4WX9 A;  3LSI A;  2X1C A;  3WTX C;  3MZ8 A;  4PXI A;  5FLX Z;  1TW2 A;  2LTP A;  2XPW A;  5JI6 A;  1IGN A;  5IYC J;  2NVX J;  4M74 A;  1K4S A;  4IRV A;  3H5A A;  3L2W A;  3QRF F;  1SEU A;  1LB2 A;  2VOD A;  1C0W A;  5GPA A;  1MBG A;  4NNJ A;  4QWQ A;  3CCL I;  1VQ8 I;  1H9T A;  4RGX A;  3F3X A;  4BAY A;  3F8M A;  2ME6 A;  1TQM A;  2DMU A;  3EUA A;  2QOP A;  2EJR A;  4XRF A;  1FYK A;  1T2K A;  4M3D A;  2H94 A;  5D5V B;  4XID A;  1W0T A;  1BM9 A;  2MD0 A;  2LY9 A;  1GUU A;  3BR1 A;  4L9V A;  2BZT A;  2QTQ A;  3DCF A;  2R7O A;  1Q1H A;  4ICH A;  1TT5 B;  2ECC A;  3DBL B;  1KQ8 A;  2RAS A;  4OIO F;  3AG1 H;  3AAF A;  3KX2 A;  2DQR A;  1FWZ A;  2XAU A;  3HOY J;  2K85 A;  3LA7 A;  2XAG A;  2ZME B;  1QHH D;  1XX5 A;  2YS9 A;  4DJA A;  3S2H J;  1SMT A;  1J09 A;  4L0Y B;  1UAA A;  2FBI A;  2IS6 A;  3PJR A;  3JTH A;  2NX4 A;  2DA2 A;  2KFD A;  2R7Q A;  2P0W A;  1KON A;  3V8J A;  1MMS A;  1HST A;  5FO5 A;  2QA4 I;  1Z05 A;  2V26 A;  2VPR A;  1A6Q A;  1Z91 A;  2HOA A;  3ZMS A;  5FRM A;  3AG3 H;  1MIJ A;  2CJJ A;  3BR0 A;  2CQK A;  3CUQ C;  3H0G J;  5J1Y A;  3GX4 X;  1U8B A;  2XKP A;  4NC6 A;  2ZSH B;  3W6V A;  2COM A;  3FXR A;  2VT2 A;  2EA2 A;  4HBL A;  2AO9 A;  1WSU A;  1I6H J;  5E3L A;  2GOM A;  1ZLJ A;  1HLV A;  3KZY A;  4P1W A;  4A6E A;  3KEQ A;  4F3Q A;  4Q48 A;  2CW8 A;  3RIR A;  3VUQ A;  2YU3 A;  2ESH A;  1XSX A;  4ENN A;  2W53 A;  1X1P A;  4IHS A;  1G59 A;  2WB1 N;  1LDD A;  2H8W A;  2P5K A;  2AXL A;  5HOD A;  1W5C C;  3F8F A;  3NAR A;  3QWL A;  2ISZ A;  1WPK A;  1Y8R B;  3GFM A;  1F1Z A;  3IRQ A;  4XN0 A;  3FRQ A;  3HE0 A;  3WG9 A;  1NTC A;  2X6Y A;  5ICC A;  2Q24 A;  3HOZ J;  1BR1 A;  2W84 A;  1WI3 A;  4GFK A;  1D8K A;  4A0Z A;  4O6J A;  1D5Y A;  4ZDO A;  2M4K A;  2YUS A;  1IDY A;  5H2F C;  3NRG A;  4MEY F;  3GW2 A;  2VT3 A;  5J1R A;  1MBH A;  2VXD A;  2GWR A;  2IA1 A;  2LF8 A;  3ZMT A;  3I64 A;  3PQJ A;  3FK6 A;  2MSY A;  4HV6 A;  3ZPL A;  1HXD A;  4XL9 A;  3EYY A;  4ABZ A;  1YQA A;  1FX7 A;  3CP8 A;  1O3S A;  2CW0 F;  2PFV A;  2GIZ A;  2LK2 A;  2FBH A;  2OBP A;  3GF2 A;  4JX5 A;  4IHY A;  1UHS A;  1YYV A;  2BW3 B;  3CME I;  2IGK A;  1YTY A;  4DBR A;  2M8G X;  2V6C A;  1Y1W J;  3H5R A;  4F93 B;  2FA5 A;  2I10 A;  2L9S A;  3I59 A;  4PZJ A;  2E1N A;  3IL2 A;  5JVG F;  1JXS A;  3RD3 A;  5JVT A;  3FXU A;  3WHB A;  4MNU A;  4E7J A;  1I1G A;  4XKW A;  5IT9 K;  1DP3 A;  2YSR A;  1MND A;  1X1D A;  3S1R J;  5C4X J;  2EK5 A;  2EV5 A;  3H3Z A;  2K3P A;  4Y15 A;  3J7Z I;  2PZ9 A;  4PJM A;  2X1E A;  1YJN I;  2LLK A;  4HX7 A;  3LNQ A;  1R1U A;  2P7V B;  1PUF B;  2ZME C;  3Q0U A;  5K5O A;  2ZXW H;  3N4M A;  4MQV A;  3W6J B;  3TKY A;  2WAD A;  3AQT A;  3G1O A;  3OYJ A;  4UVC A;  2LY2 A;  3J80 Z;  2E2I J;  1IRZ A;  3C2H A;  4JX6 A;  1WRJ A;  4ENJ A;  3HOS A;  5B1B H;  3GZN B;  5KCM A;  3GXO A;  1XSD A;  4HLY A;  2VKV A;  1FOY A;  3WU2 C;  2R5Y B;  1LQ1 A;  4EJT A;  3BG6 A;  3TO6 A;  5ED4 A;  2XAQ A;  2JSC A;  4MGR A;  3VVY A;  3HKZ N;  2MW8 A;  1SD6 A;  2OER A;  1E3H A;  4AID A;  4QIW N;  2HVQ A;  5D4R A;  2HXO A;  4L5I A;  2JN6 A;  2OD5 A;  3DBH B;  2LRE A;  5FKL A;  1R5H A;  5LEJ A;  5E1W A;  1H0M A;  3ONQ A;  2RVC A;  3BHQ A;  3AFH A;  1ONV A;  2DBB A;  4NBQ A;  3CCY A;  2DI3 A;  1ERD A;  4Z6Y A;  3QU3 A;  2RV8 A;  2IA0 A;  3FXM A;  3H9Q A;  1P92 A;  1A6I A;  2RC4 A;  5H20 A;  2IEK A;  3HOU J;  4JQF A;  3PQK A;  3OY9 A;  5HLH A;  3CRJ A;  2FQ3 A;  4EGZ A;  4RM2 A;  2KZG A;  3S17 J;  3R6S A;  2HVS A;  3CO7 C;  1RKT A;  2QQ8 A;  2E1C A;  2LYC A;  5BNG A;  5C4Y A;  4ENM A;  2W1O A;  3G1M A;  3F8C A;  5LHH A;  1MBK A;  1FOK A;  4EJV A;  4DZP A;  5CVI A;  3MD2 A;  3L2R A;  1QPM A;  3DBR B;  3TOB A;  2QYO A;  4ANJ A;  4CIC A;  2LD5 A;  4XBF A;  2MFZ A;  5DD4 A;  3CWR A;  1G3W A;  3OYE A;  3HTA A;  2IPQ X;  3TQN A;  4EMS A;  3BQY A;  3FKI J;  5BMZ A;  1QBJ A;  4RB1 A;  2OCC H;  4BE2 A;  2JJ7 A;  4FAS D;  2VON A;  4EM2 A;  4IKF A;  3OIQ A;  3B73 A;  2HDC A;  1MKM A;  1GDT A;  5EG0 B;  3NNR A;  2MC3 A;  2J5P A;  2LKX A;  1FIA A;  2HQN A;  1X2M A;  1J59 A;  5AIP A;  1K78 A;  3KZ9 A;  1H9G A;  2DFH A;  2HGC A;  2V57 A;  2PJR B;  1IXR C;  2A69 F;  1VQK I;  1ZRF A;  3HB9 A;  1G3T A;  2F6C A;  4KIB A;  2QGU A;  2WWY A;  3CDL A;  5CW8 A;  1EKE A;  2JA2 A;  4KNY A;  1KYW A;  2G3B A;  2IS4 A;  2Q0O A;  2R3S A;  5IP9 J;  4ZC3 A;  2QKO A;  3TP3 A;  2EV0 A;  1VF9 A;  2IXS A;  3CQZ J;  1LJ9 A;  2M0C A;  4KT5 C;  3G73 A;  4LIT A;  4XRS A;  2A5W A;  1ZGA A;  4HQM A;  2ZJR F;  3K0L A;  2DG8 A;  2QKM B;  4XSZ F;  2KKO A;  1Z3X A;  2XV4 S;  1TWG J;  4HAM A;  3O60 A;  4ME9 A;  5K58 A;  1WH7 A;  4Y52 J;  3OR2 C;  1IN8 A;  4YEL A;  5FRN A;  3PAS A;  3ZQF A;  1BN5 A;  3ZXS A;  3KP4 A;  2CUE A;  1D0Y A;  3ULQ B;  3V7C A;  1I5Z A;  1R1T A;  3JCU C;  3B6C A;  1MNE A;  1RZ4 A;  5FD6 A;  2GEN A;  2GXG A;  4FET A;  4U9L A;  4AD9 A;  4AYB A;  1ZG5 A;  2HOT A;  1MBF A;  1RPW A;  3GTM J;  5KAI C;  4IX7 A;  4OD4 A;  1FOW A;  4XKB A;  1AHD P;  1D3Y A;  4PGG A;  4GFL A;  3P9C A;  4D7M A;  3WHC A;  2OF7 A;  3EET A;  2VBW A;  3S93 A;  2M5W A;  3E3V A;  3BT9 A;  2WAE A;  1I1S A;  1Z6R A;  3L1P A;  2LMD A;  2A5Y B;  2EZL A;  3SYT A;  3OYH A;  1Y0U A;  4JOM A;  3HBL A;  2QWW A;  1K7A A;  2FBK A;  2FSW A;  2L7K A;  2M0M A;  1B1B A;  1IAW A;  2P8T A;  3E97 A;  1TQI A;  1ZAR A;  2JUC A;  1ACI A;  4FT8 A;  4WIB A;  5IOZ A;  2BYV E;  4N9I A;  1WGX A;  3A4C A;  3CUQ A;  4HYE A;  3O3K A;  3IKT A;  1WKM A;  1YO5 C;  2DOA A;  1CGP A;  4KN7 X;  2PMU A;  1O4X A;  2M4G A;  5JHU A;  1ORK A;  3G56 A;  4L62 A;  2V1N A;  1FTZ A;  2CV0 A;  2O5R A;  1BJA A;  1ETO A;  1N75 A;  2CGP A;  4V19 K;  2RGV A;  4KA4 A;  2M7A A;  3ABL H;  5K5R A;  3WE3 A;  3C1D A;  5JFR A;  5FLX K;  3G6E I;  3GEU A;  2GBY A;  1Z7U A;  4ZH4 F;  4DNC A;  1T6S A;  3OOP A;  3CCS I;  5K7Z A;  2DA1 A;  3I54 A;  3SHF A;  3QYE A;  1X3W B;  3HTU A;  4F7Z A;  1K6Y A;  3RZD J;  3HSE A;  1QZY A;  1ITY A;  4BDY A;  4OIP F;  4O5V A;  2UXO A;  4B8X A;  3E5X A;  2OAZ A;  4MEX F;  3EGQ A;  1X1C A;  3JW4 A;  1WCM J;  3EYI A;  3KPH A;  3UR3 C;  2ZCN A;  2KT0 A;  4AC6 A;  4FQG A;  2LFB A;  1NHA A;  2K9L A;  3ZMU A;  4UDS A;  2LY1 A;  2L4M A;  2OJE D;  4HW0 A;  3KLO A;  1FNN A;  2DN0 A;  3ZQC A;  2A2F X;  1FBQ A;  2YPR A;  3HKZ A;  3TGN A;  4CYC B;  1FC3 A;  4U87 A;  5AON A;  3MZH A;  2UXX A;  4EV0 A;  3V6G A;  1U5T C;  4TV7 A;  1WJ5 A;  3BR6 A;  2L9V A;  3MFK A;  4NDL A;  4HRI A;  1DGW Y;  3NWT A;  2WUI A;  2EZH A;  3G1L A;  1MMA A;  1IXC A;  2W4S A;  4X0G A;  3MAJ A;  4PCQ A;  2M8E A;  1H8A C;  3VYU B;  2PX9 A;  4E7H A;  2V6E A;  3I5U A;  4UUS B;  3RQ4 A;  2R5Z B;  4FE7 A;  2JQ7 A;  1VQL I;  2VL8 A;  3WG7 H;  4WF2 A;  4UXN A;  4IRG A;  4AU7 A;  5M3M J;  5HNF A;  5FMP A;  2M7B A;  3EUH A;  4XOR A;  2XB0 X;  3JAM Z;  2YVH A;  3KYD B;  5D4S A;  2XPV A;  1JI8 A;  2HQR A;  4UV8 A;  1XCV A;  2EIK H;  4RS8 A;  1IW7 F;  2O0Y A;  3H3V K;  3MZY A;  5ICG A;  4CYC A;  1WFX A;  4W97 A;  4UVA A;  4WWC A;  1R22 A;  3TDZ C;  4XLE A;  1ZG3 A;  4PFP A;  4G12 A;  4E7Z A;  4RAG A;  4GXO A;  3L9F A;  3WTU C;  1MJA A;  5B5E C;  2VOO A;  1XD7 A;  2CG4 A;  1XN7 A;  2UXN A;  4ZDP A;  1YG2 A;  4DYR A;  3CJD A;  1G3S A;  4B4C A;  3PO2 J;  5D6E A;  4ITV A;  3NQO A;  3M8J A;  1FMW A;  1MSF C;  5GTH C;  3I71 A;  3COA C;  2CFX A;  5D1R A;  4XNF A;  2DOF A;  5ICF A;  1RR8 C;  1JKO C;  3JR9 A;  4AYB N;  2F07 A;  2O61 A;  1STZ A;  4DGW B;  1BR4 A;  1ETK A;  3J7Y J;  4NHJ A;  1ZN2 A;  1Z0X A;  3MNL A;  2HVR A;  3ASN H;  2M30 A;  1U5T A;  2CQQ A;  3HPG A;  3TW6 A;  5TIS C;  2DJI A;  2LKS A;  1IN6 A;  3OIP A;  4PSW A;  1W36 D;  4K2E A;  1UEL B;  3F72 A;  4M9Z A;  1ZR4 A;  3E6M A;  5EF6 A;  2Y2Z A;  2VJ5 A;  3GME A;  3CJN A;  1QQI A;  2CH0 A;  1BJZ A;  3I0T A;  3B6A A;  3TOA A;  3E6D A;  1YHQ I;  2EB7 A;  1Z67 A;  2E19 A;  2Y9Y A;  5CVV A;  4S05 A;  3WTS C;  2RRE A;  3VB2 A;  3NI7 A;  1DUX C;  4UNO A;  4KIS A;  4O3M A;  2EZI A;  2WAQ N;  1ZGJ A;  1YJ9 I;  1S8N A;  2EV6 A;  1YIO A;  3FIS A;  1ODD A;  2XGE A;  2QZ8 A;  4W1U A;  4BGD A;  5AIQ A;  1J0R A;  3CJQ B;  1XG1 A;  2QWT A;  2KLO A;  5HDG A;  2R7X A;  1FBS A;  2Y0S A;  4I0B A;  2EFW A;  2AXT C;  3GCM A;  2DXI A;  1S6L A;  4DOZ A;  2E2H J;  2P4W A;  1S7A A;  1XGM A;  3FMS A;  3ML6 A;  1D1A A;  2R7Z J;  1T56 A;  2VAS A;  3PFY A;  2WY7 Q;  1G2H A;  1GV2 A;  1TT0 A;  3ZOB A;  4KFC A;  3QPL A;  3FXO A;  1EH8 A;  1OR7 A;  4I2O A;  1MH3 A;  2KIU A;  2COB A;  4HF2 A;  4CCO A;  2CQN A;  1AKH A;  3W2A A;  4UUV A;  4MFD A;  1SMY F;  1OJL A;  5EZG A;  5LGT A;  3I4N J;  2BOL A;  1ON1 A;  1EH6 A;  5IPA A;  5CXG A;  3W3C A;  3FKJ A;  4HSR A;  2IU5 A;  3PPB A;  2FNA A;  3HOT A;  3DKW A;  5M5Y J;  1SAX A;  2M45 A;  1B6A A;  3C2B A;  3DQV C;  2K9N A;  2KRC A;  4OAY A;  2ZFU A;  3V7S A;  2BBY A;  3Q5F A;  2CRG A;  2BY2 A;  5H6R A;  4LLL A;  2KP6 A;  5J40 A;  1SFU A;  3VOX A;  4D1Q A;  1B59 A;  2XF5 A;  4AVZ A;  4EQQ A;  5DAJ A;  3S8P A;  5B66 C;  3ANG A;  1T08 B;  2RNJ A;  5LHG A;  1IG7 A;  1D0Z A;  3GFL A;  4IF4 A;  2F5E A;  3V8K A;  1DDN A;  2E7X A;  1K78 B;  5L3F A;  1LVA A;  3CCM I;  1GVJ A;  1FYL A;  5TRD A;  3M7G A;  2VQL A;  3GVA A;  2EFQ A;  1HKT A;  1XMX A;  2VPL A;  2V4J C;  1U78 A;  2WGB A;  2Q8K A;  2Y69 H;  5CVR A;  1QPI A;  2QIB A;  4WXH A;  3RQI A;  3S1N J;  1IN7 A;  4L5E A;  2R93 J;  2EIM H;  3HRS A;  3TO9 A;  2EFO A;  3TP0 A;  3WGH A;  4EM0 B;  4A3L J;  1SFX A;  2FXA A;  5FGL A;  1GXQ A;  4GRI A;  3MVP A;  4IHX A;  3VVZ A;  1W7P A;  1W5S A;  4KMU X;  2Q1Z B;  1WJB A;  3I55 I;  4RGR A;  4B3A A;  4L9J A;  2RAE A;  2UXP A;  2DFE A;  3OV8 A;  4A3J J;  1VQN I;  1ZLK A;  4WXC A;  3DPL C;  3ESW B;  1OCR H;  2HPI A;  2KPM A;  1L3L A;  1FBU A;  5HLI A;  1MH4 A;  2MH2 A;  2HKO A;  2VKD A;  3IH4 A;  5ERI A;  2CQX A;  1NG6 A;  3GTL J;  2VJJ A;  5ILS A;  3VW1 A;  5HAW A;  1RC9 A;  4FCY A;  1JT0 A;  2XUB A;  1YE9 A;  5F27 A;  4IVN A;  4QLC U;  3V4G A;  1X3Z B;  3ABM H;  2CSO A;  3S5R A;  1FOX A;  5J3L A;  2XPU A;  2AHQ A;  1ZTR A;  2UXI A;  3HRM A;  2RKH A;  3PSF A;  5DS9 A;  5EZH A;  2WC2 A;  3T8T A;  4JP0 A;  1VI0 A;  3ASO H;  2D2W A;  2NVU B;  3CC4 I;  3KP7 A;  1UB9 A;  1U9N A;  3COL A;  3LSP A;  4BEH A;  3F6O A;  3DPJ A;  3D5S C;  2G7U A;  1BI3 A;  4M3E A;  5E1X A;  1K83 J;  1U2W A;  1OIS A;  2VKE A;  3KP3 A;  1UST A;  2QSG X;  4CZZ A;  5J8F A;  3HZJ A;  2MLK A;  1EJ9 A;  2DPU A;  3KKC A;  4KWA A;  5DCM B;  3T5X A;  2HYG D;  3TMO A;  2ZBK A;  3LQQ A;  4AM3 A;  4X6A J;  5IP7 J;  1FP2 A;  4XMY A;  1BBY A;  3K69 A;  3P9I A;  4XRM A;  1YIT I;  2L2O A;  1H89 C;  1ON2 A;  1U3E M;  3R0A A;  4DYC A;  4B44 A;  2L3D A;  5HBU A;  4HPQ A;  2YVX A;  1YS6 A;  5C44 J;  5LEK A;  1DQU A;  1IUY A;  3NWS A;  2WV1 A;  4XLF A;  4RDU A;  2E36 A;  4HF1 A;  5EDN A;  4M3F A;  1P7I A;  3F1B A;  1JE8 A;  3I58 A;  2M3A A;  3GFI A;  2L0K A;  1SAN A;  3S32 A;  3VOE A;  5F04 A;  4D0P A;  2KQR A;  2ACJ A;  2L9N A;  4XRS G;  1UHM A;  3FX3 A;  2V1U A;  4RGS A;  1LDJ A;  1YS7 A;  3N05 A;  3CDI A;  3I3L A;  5J47 A;  3HSF A;  5LLQ A;  5BOX A;  2O9L A;  2K86 A;  2K4J A;  2H1K A;  5FKN A;  1OR7 C;  3H9J A;  1SVO A;  3C18 A;  3CLQ A;  1P4W A;  1Y1V J;  4GFB A;  1B8I A;  1K6O A;  3KZI C;  2XRO A;  5E17 F;  3VVX A;  4IHT A;  4OAZ A;  4I09 A;  1SD7 A;  1T98 A;  1QRY A;  2JRT A;  1QA6 A;  1Z77 A;  4B1R A;  2E1M B;  2KHM A;  2V9K A;  4CCK A;  4NQW B;  3S3O A;  2JA7 J;  3K4J A;  1AKH B;  2R7S A;  2FEZ A;  4EAT A;  4YZE A;  2BY1 A;  2WAQ A;  3K1P A;  2KDO A;  4B43 A;  3FWE A;  3GTO J;  1KGS A;  3H35 A;  2X1D A;  5A2Q Z;  2DDA A;  5IY5 H;  2EIL H;  3DFG A;  2JPC A;  1YX5 A;  2ZXH A;  1PUF A;  2MYS A;  2ME0 A;  2OI8 A;  1IN5 A;  2LG4 A;  1M1E B;  2LBF B;  3SZP A;  2OQR A;  2R7F A;  2ZO4 A;  2P5L C;  4GDF A;  1RET A;  2X0L A;  2ZME A;  3B02 A;  4E70 A;  1A35 A;  5KHD A;  3ZN0 A;  3VDX A;  3F8B A;  2ZXI A;  3LA3 A;  3JTG A;  2CYY A;  2K9S A;  2YR2 A;  4LJZ F;  4RLQ A;  4A3M J;  3OS2 A;  2M2E A;  2ZNY A;  5E18 F;  4Y17 A;  3NXC A;  1JTX A;  4B47 A;  4HF0 A;  1D8J A;  1D1B A;  3OYG A;  2TCT A;  4BJ5 C;  3N97 A;  2PFB A;  3HGY A;  3M07 A;  2W85 A;  1XCB A;  1XTA A;  4IHW A;  4BE1 A;  2OTL I;  3FDY A;  3F23 A;  3BCG A;  2R7R A;  4U7B A;  3L00 A;  3BTJ A;  2HTS A;  3RCO A;  2P7C B;  3BZC A;  3HDD A;  2OU2 A;  3AL0 B;  2MC4 A;  1S9H A;  5LRS A;  1BIB A;  3GTG J;  1JTY A;  1E17 A;  3P7N A;  4JKZ A;  2XKO A;  3S2D J;  3LSH A;  1ZHF A;  2P5V A;  2ZC2 A;  2BHZ A;  4ZZL A;  5L3D A;  3VP5 A;  2STT A;  1G6N A;  5JLW A;  1TWF J;  2IT0 A;  3VSL A;  1ZKG A;  2LOO A;  4M6V A;  3OL3 A;  4BDZ A;  3ZQL A;  4YIF A;  1XPX A;  1A36 A;  3T0Y A;  3KET A;  3SZT A;  3BP8 A;  4RLF A;  4LFU A;  1E2X A;  4H0E A;  1OCT C;  1K61 A;  5J6X A;  1HF0 A;  1WVR A;  2I8D A;  2K02 A;  3R61 A;  4LB6 B;  1R1V A;  3JSP A;  2LNB A;  4LD5 A;  2M9H A;  3QPT A;  5TGT A;  1UG2 A;  4UHT A;  1HDD C;  1JHF A;  1JT6 A;  4E7I A;  3ZR8 X;  3RPU A;  2E5Z A;  1YIJ I;  3O8G A;  1XGS A;  2QCO A;  2L4A A;  2EBI A;  2XSD C;  4DYQ A;  2LP0 A;  4ZYA A;  2MBF A;  3K6G A;  3I56 I;  3RKY A;  2PQ8 A;  2MD5 A;  3EUK L;  4C2M J;  2GAU A;  2BE5 F;  4XIC A;  4IQJ A;  1RES A;  1D5V A;  4LIV A;  2ID3 A;  4S04 A;  1DU6 A;  2R7W A;  2DMP A;  4RMN A;  3HJE A;  1FSH A;  2HQA A;  1OCZ H;  1ZRD A;  3LSR A;  4UUS A;  1N77 A;  2CV2 A;  4AC0 A;  4R8H A;  3KE2 A;  3HC7 A;  3LSG A;  4KIC A;  2EZK A;  3K4L A;  1I39 A;  5D18 A;  2OUM A;  3K4B A;  3HIF A;  3S16 J;  4A12 A;  5E3M A;  2KIF A;  4BEH B;  3RPU D;  5FLM J;  4XSX F;  1I6X A;  3A0H C;  4XOT A;  3LJL A;  1KU3 A;  4MLO A;  1FYM A;  5DD8 A;  3KNW A;  5AQC A;  3CCU I;  3JRB A;  3H5N A;  2EWN A;  4A3K J;  2NNN A;  5LFA A;  3BC8 A;  1XSV A;  1Z3Y A;  3A0B C;  4KUM A;  3HRT A;  2LKP A;  1TP4 A;  4CCL A;  2XF6 A;  2CFO A;  3GTP J;  1F4K A;  2STW A;  2IBD A;  1GHC A;  3OSG A;  3K4K A;  1N78 A;  1Z21 A;  2PLY A;  4ON0 A;  3ERM A;  1QHG A;  1Y6I A;  4E7S A;  4GYI A;  1VND A;  2R0Q C;  4RM3 A;  2L7Z A;  3AL0 C;  2QQA A;  4N4O B;  4CGR A;  2XRN A;  4E6K G;  1B9N A;  1R23 A;  4GYG A;  1HSJ A;  3H36 A;  1I3Q J;  3H0D A;  3IAM 2;  4D7N A;  3WGI A;  1V55 H;  2HZT A;  2HYT A;  2FOK A;  3PIP F;  2HYJ A;  4NQW A;  5E1Z B;  4IL6 C;  4IXA A;  4LB5 A;  1OFC X;  3A1Y A;  1X2N A;  3DTE A;  3C2G A;  3BTL A;  2ZSI B;  2QEX I;  1U0J A;  2CWE A;  3MCZ A;  1I3A A;  2VE9 A;  1RRJ A;  1R7J A;  3GWZ A;  2HEO A;  4I99 C;  5J4Y A;  2ISY A;  2DTR A;  4KYW A;  3DEE A;  2R7T A;  4R79 A;  1YOV B;  2VOP A;  2BY3 A;  4KT6 A;  2XIG A;  1ETQ A;  3LAJ A;  2L9R A;  5DM7 F;  5A2Q K;  2DDB A;  4IRH A;  3CDH A;  5CJ9 A;  2YX7 A;  2AQE A;  3MN2 A;  1FY7 A;  2XGC A;  4CCN A;  2MA3 A;  1VZ0 A;  1YRN B;  1OCP A;  1TWA J;  4FX0 A;  4XQF A;  4G9Y A;  5F0C A;  3BCA A;  4EM1 A;  2VIX A;  5DDG A;  4YII A;  5CVU A;  1JUM A;  3DU6 A;  3OL4 A;  4IO9 F;  4C3J J;  3RI4 A;  2GZW A;  2CW7 A;  2RHA A;  3CMA I;  1N25 A;  1RUO A;  4FHT A;  3K4N A;  2DT7 B;  4IQ4 A;  3TED A;  2JMW A;  1B72 B;  3JRF A;  1REP C;  2LR8 A;  1WWX A;  1T8I A;  3TDU C;  3M8F A;  1O7F A;  3V7R A;  1WJF A;  3ISP A;  5JHF A;  4KIT B;  3IH2 A;  1JUS A;  1YRN A;  4MXM A;  1TWC J;  4UVB A;  4DVY P;  2E1O A;  2B0L A;  2QM3 A;  3DPT A;  3HHG A;  1AA7 A;  5IYB J;  1KU9 A;  2DYR H;  2F4I A;  4CH7 A;  3HEF A;  3O2P E;  4C9Y A;  5HVQ C;  3V8L A;  2Y30 A;  4BY1 J;  2X9D A;  1KA8 A;  2DQL A;  1LE8 A;  2PJP A;  1IF1 A;  2Y48 A;  3RPQ A;  1B72 A;  2XAS A;  3MQ0 A;  1HKQ A;  5BPD A;  1R9T J;  1V4R A;  3OMY A;  5J4V A;  3AQS A;  2Y0S N;  4RA2 A;  2OPT A;  5H9T A;  5D5U B;  3GUD A;  4S0H B;  3ELK A;  3WTT C;  1R5G A;  4I01 A;  2UWM A;  1Z6T A;  4C2T A;  1KYZ A;  1MD0 A;  4HEA 2;  1P4A A;  5E3N A;  3RKW A;  1OCO H;  2JK3 A;  3U2R A;  4YFX F;  5J1U A;  2HDW A;  3M1E A;  1MDM B;  1V5E A;  2MAB A;  2K9M A;  2E71 A;  3NAU A;  1QZE A;  4G6D A;  4ESF A;  5DUK A;  2DYS H;  4XM3 A;  1XS9 A;  4RAF A;  2F2E A;  2JPB A;  1BC8 C;  1UZC A;  4JYK A;  1Z1D A;  3WU0 A;  4WCG A;  3DKY A;  4M9X A;  2DFF A;  4B3X A;  4LLN A;  1YW9 A;  1BIA A;  3QAH A;  3LHQ A;  1R71 A;  2Z2S B;  4J01 A;  2G7G A;  4LOC A;  3BRO A;  1T0F A;  2H8R A;  1X3U A;  2P81 A;  1W4M A;  5E8I A;  1PP8 F;  4P96 A;  2HXI A;  2EFN A;  2Y75 A;  3WTY C;  1QO0 D;  3KFW X;  1F43 A;  2REK A;  1QVU A;  2JTV A;  4A3F J;  1V5F A;  1Y56 A;  2XDN A;  1NK2 P;  3OYC A;  2F4M B;  4BL0 B;  3TBI A;  2XF7 A;  1ZYR F;  2JUG A;  2PN6 A;  1APL C;  4AIJ A;  3K10 A;  4N9H A;  3A01 A;  1HA8 A;  4G7H F;  1KZH A;  2Q2E B;  4ZTF A;  2VE8 A;  2ZCW A;  2LC2 A;  3KP6 A;  1O57 A;  1BW6 A;  2FRH A;  3ANP A;  4OIR F;  4OU0 A;  4CCM A;  4A0Y A;  3C07 A;  1Y8Q B;  2DMT A;  1BW5 A;  2ZKZ A;  2HI3 A;  2CV1 A;  2EA4 A;  3JRA A;  1XDS A;  1O7L A;  2VBY A;  3BNI A;  4BBS J;  3VYS B;  5FFZ A;  1IJW C;  5L3G A;  3H3U A;  3RH2 A;  1VQP I;  5GAH J;  1K79 A;  3IHU A;  2XSJ C;  1BOB A;  3OYM A;  4BBR J;  3RKQ A;  1FTT A;  3ZQI A;  2WB1 A;  1KQ0 A;  2G7H A;  2IS2 A;  2DT6 A;  3NRV A;  4CHU A;  1W1W E;  3E7Q A;  3JSO A;  3LSJ A;  1SFK A;  2L01 A;  2M87 A;  2CO5 A;  4PJJ A;  1NG7 A;  2FX0 A;  2DK8 A;  5CQG A;  2WY8 Q;  4CUG A;  5E3O A;  3T8R A;  2DMQ A;  3JRG A;  2JVH A;  1POG A;  5EGO B;  5EFY A;  4HLX A;  3L09 A;  3RYP A;  2CUJ A;  1K4T A;  3ZRG A;  3WTV C;  1RNL A;  3W6K B;  2E7W A;  3HG9 A;  4ASN A;  1W36 C;  1R00 A;  2UXU A;  2PEX A;  4M71 A;  2JWT A;  1ZRC A;  5D8K B;  3OS1 A;  4N0B A;  3OR1 C;  4BHP A;  1VQ9 I;  2XGX A;  2BHY A;  4BHC A;  3I53 A;  2LF7 A;  2NRA C;  5DCM A;  1ZAO A;  4M6Y A;  1P6R A;  2H09 A;  2MGQ A;  3K4C A;  3U1D A;  2R5Y A;  2EIJ H;  2HKU A;  5HNH A;  1BC7 C;  1S3J A;  3CZ6 A;  3K4M A;  1DU0 A;  4F55 A;  2OC6 A;  3EQL F;  2QLZ A;  1DGR M;  4R1H A;  3T1B A;  3BWG A;  2N8G A;  4LMY A;  4FTH A;  3J7A Y;  2NVQ J;  3OS0 A;  1LEA A;  2HNH A;  3PNT A;  1TC3 C;  3F21 A;  4OIQ F;  2K4B A;  2L7M P;  2A3S A;  2MG4 A;  3DU5 A;  3QYF A;  2NXN B;  4PSX A;  3PSI A;  2IS1 A;  2L7F P;  2OA4 A;  4D5C A;  5HS7 A;  3E7L A;  2DJN A;  3K9T A;  4ENK A;  3CUO A;  4KN4 X;  2E1M C;  1TQP A;  4IOA F;  4UB6 C;  4LGW A;  1WQ2 A;  3CC2 I;  5L3E A;  1QNT A;  4L9T A;  2V79 A;  1T33 A;  4P9U A;  5KAF C;  3D5L A;  3LQR A;  3Q9S A;  4DZJ A;  3OYI A;  2KJC A;  4A0X A;  3HUG B;  3W2W A;  5F6F A;  1XGO A;  1G8X A;  1JJ6 C;  3OYL A;  2Y0M A;  4C2U A;  1YJW I;  4P5O A;  2FU4 A;  2A07 F;  3CC7 I;  4XKC A;  1IZ1 A;  2MLG A;  2QUF A;  5HLT A;  3IUV A;  1PUE E;  1FPQ A;  2DA6 A;  3BPX A;  3DWL E;  4GCT A;  2ZJ2 A;  3HPH A;  1HBX G;  2NVT J;  1MBE A;  3DLL F;  1ENH A;  3J81 Z;  4NN1 A;  2LVS A;  1B9M A;  3E0J B;  1JGG A;  4ZDL A;  4F91 B;  1J5Y A;  4BH9 A;  2QBY B;  1J9I A;  5DM6 F;  3LA2 A;  1SFO J;  1MDM A;  1WH5 A;  4XK4 A;  5FKK A;  4MK6 A;  4CCJ A;  5BS6 A;  2WV0 A;  2DCE A;  3QQA A;  1LVK A;  1IV8 A;  2D1H A;  2LDU A;  5E79 C;  5EG0 A;  3H92 A;  1BL0 A;  3HUG A;  2VI6 A;  1GV5 A;  1ETY A;  3F6V A;  3CCV I;  4MTE A;  3E6B A;  1D0X A;  2OZU A;  3QU6 A;  3FK7 A;  2X6W A;  1R6R A;  2YX4 A;  3J80 K;  3KYL A;  1UHW A;  2W48 A;  4XLC A;  3R4K A;  2F5F A;  2L54 A;  4IHV A;  4M73 A;  2P6T A;  2ZFW A;  4D9J A;  3HXL A;  1JKQ C;  4U0Y A;  4AWX B;  2E5N A;  2QSF X;  5FJ8 J;  1LDK B;  1TNT A;  3HYI A;  1FZP B;  1VTN C;  4MO7 A;  1WJD A;  3LOC A;  3ECH A;  2XHK A;  4HDU A;  4BJ6 C;  2AS5 F;  4A3C J;  2ZNZ A;  3ZQH A;  4AIK A;  2Z16 A;  3DXJ F;  2XAH A;  4I0A A;  3REO A;  2W24 A;  1W7P D;  2V9P A;  4PJ0 C;  3NS4 A;  2LH9 A;  3FMQ A;  2P6S A;  3FBI B;  3BG9 A;  4MTD A;  2JZY A;  2M34 A;  4ZYE A;  4J19 A;  2DMN A;  5E20 A;  1OLT A;  3DLA A;  1XC5 A;  4U88 A;  3HTJ A;  3KKD A;  3DTK A;  3QOE A;  2PI0 A;  5FHP A;  4BY7 J;  2WBM A;  4HG2 A;  1W0U A;  1R49 A;  2ZB9 A;  3RZO J;  2L5Q A;  2QF7 A;  3BG7 A;  4ESJ A;  4YG2 F;  4H4K C;  1U5T B;  3AG4 H;  3DTI A;  4NB5 A;  5JR3 A;  3FM3 A;  3HTI A;  2NS0 A;  3K2A A;  3VW2 A;  2KDZ A;  4G6T B;  4Y33 A;  2MH9 A;  4E7K A;  3S1Q J;  1ZH5 A;  3C7J A;  3HIM A;  2OCE A;  1GXP A;  5IOY A;  4E4H A;  4EGY A;  2QQ9 A;  2FMY A;  4A6D A;  4M3B A;  5CYV A;  3IRR A;  5ILU A;  4M3G A;  5LRR A;  1VFC A;  2GXA A;  2Y9Z A;  1TWH J;  4FE4 A;  1IV6 A;  1FLI A;  3FZV A;  4XLA A;  4HA8 A;  4BAC A;  2Z99 A;  3BY6 A;  3ZQQ A;  3VW0 A;  2DO7 A;  1F36 A;  2HQ5 A;  5CPR B;  2EH3 A;  4HQE A;  4D5F A; 
#chains in the Genus database with same CATH homology
 1FEX A;  1Q1V A;  2G7S A;  1LFU P;  3HBL A;  4C2M J;  1IUF A;  4XIC A;  1RES A;  4UUT A;  2YU9 J;  2ID3 A;  1DU6 A;  1P7J A;  2DMP A;  1NK3 P;  5IOZ A;  1WGX A;  2FD5 A;  3LSR A;  4GCK A;  4UUS A;  1O4X A;  2K40 A;  3SFI A;  4AC0 A;  3HGG A;  3LSG A;  4RBO A;  4JX4 A;  1ETW A;  2EZK A;  2UXH A;  5D18 A;  1ORK A;  3G56 A;  4L62 A;  3GTJ J;  2Y31 A;  4V2G A;  3S16 J;  5E3M A;  1FTZ A;  2ZCX A;  5FLM J;  1ETO A;  2EQR A;  1JKP C;  3BR5 A;  3OOU A;  4GCL A;  3Q0V A;  4I6Z A;  4A3E J;  3LJL A;  1CQT A;  3GEU A;  4MLO A;  2GBY A;  1MNM C;  3KNW A;  5EGO A;  5AQC A;  3JRB A;  5K7Z A;  2DA1 A;  4HNV A;  3P9T A;  4A3K J;  1UI6 A;  4A3B J;  3PO3 J;  3RZD J;  4QSH A;  1ITY A;  4JL3 A;  3GTP J;  3Q3S A;  2UXO A;  2IBD A;  3OSG A;  3EGQ A;  1S7E A;  1WCM J;  2ZCN A;  2KT0 A;  4AC6 A;  2LFB A;  5C3E J;  4I76 A;  3HOV J;  1VND A;  5F1J A;  2DA7 A;  2XRL A;  2R0Q C;  4UDS A;  2L7Z A;  5F0F A;  2NS8 A;  2G7L A;  4CGR A;  2DN0 A;  3ZQC A;  1I3Q J;  4CYC B;  3EUP A;  4D7N A;  2HYT A;  2E2J J;  3O8H A;  4X1E A;  5F08 A;  2HYJ A;  1ETV A;  4A3I J;  3V6G A;  3BR6 A;  1OFC X;  4NDL A;  3BG3 A;  1X2N A;  1IDZ A;  3JSJ A;  2WUI A;  2EZH A;  3G1L A;  3JRI A;  4C3H J;  3BTL A;  2ELK A;  1H8A C;  3QBM A;  3QKX A;  3JRH A;  4UUS B;  5DTD A;  3Q0W A;  2R5Z B;  4FE7 A;  4MIM A;  2HDD A;  1SGM A;  1ETQ A;  5M3M J;  2L9R A;  3BQZ A;  2G0E A;  1UMQ A;  3MKL A;  4IEJ A;  2NP3 A;  1BA5 A;  5FMP A;  2XB0 X;  2YVH A;  2X6O A;  1MSE C;  1AU7 A;  3MN2 A;  2XPV A;  2FJ1 A;  2XGC A;  4Y7N J;  1YRN B;  4ACI A;  1OCP A;  1TWA J;  2NS7 A;  1EF4 A;  3H3V K;  5HSZ A;  5F0C A;  3LWJ A;  3S15 J;  4CYC A;  4W97 A;  2ZCM A;  1JUM A;  3VPR A;  9ANT A;  1ZK8 A;  4G12 A;  4BXX J;  4C3J J;  1HDP A;  2TRT A;  1FJL A;  2RHA A;  3GBG A;  3TED A;  4DYR A;  2JMW A;  1U9O A;  2DA5 A;  1JJ8 C;  4B4C A;  1B72 B;  3CJD A;  3PO2 J;  3JRF A;  2LR8 A;  3IV5 A;  2FBQ A;  1MSF C;  3QPS A;  1GVD A;  5D1R A;  4HKU A;  3GZI A;  1JKO C;  3JR9 A;  2X48 A;  5EEA A;  2PMZ N;  5IYD J;  2PBX A;  3IH2 A;  1JUS A;  4AYB N;  2ECB A;  1YRN A;  4BKX A;  2F07 A;  2GUH A;  4MXM A;  4AF5 A;  1TWC J;  3BJB A;  3GTQ J;  2E1O A;  4QTR A;  4PXI A;  2LTP A;  1ETK A;  2XPW A;  5IYB J;  2R5Z A;  1Z0X A;  1IGN A;  3HEF A;  5IYC J;  2NVX J;  3OSF A;  2ID6 A;  3MNL A;  2Y30 A;  4JNN A;  1LE8 B;  4BY1 J;  2X9D A;  2CQQ A;  1LE8 A;  2K9Q A;  1H88 C;  3TW6 A;  1GT0 C;  5GPA A;  1B72 A;  1MBG A;  3VIB A;  1R9T J;  3AQS A;  2Y0S N;  1ZR4 A;  3A01 B;  2DG7 A;  5EF6 A;  2Y2Z A;  2OPT A;  5GP9 A;  5H9T A;  2GLO A;  1BJZ A;  3HM5 A;  2DTZ A;  3B6A A;  4S0H B;  2ME6 A;  5M5X J;  2JA5 J;  5M3F J;  2DMU A;  3TW7 A;  2QOP A;  2E19 A;  2Y9Y A;  2D6Y A;  4M3D A;  4XID A;  1W0T A;  3NI7 A;  5E3N A;  1HCR A;  2HOS A;  2CUF A;  2JK3 A;  2EZI A;  2WAQ N;  5J1U A;  2LY9 A;  1GUU A;  3BR1 A;  3FIS A;  2QTQ A;  2XGE A;  3DCF A;  4W1U A;  3NAU A;  4ICH A;  2ECC A;  2RAS A;  3S1M J;  1XS9 A;  1XG1 A;  2QWT A;  5JLX A;  4JYK A;  2ZOY A;  3CMY A;  3HOY J;  4V2F A;  2XB5 A;  3LHQ A;  2E2H J;  2FQ4 A;  3IH3 A;  2G7G A;  4LOC A;  2YS9 A;  2H8R A;  1ETX A;  3S2H J;  2P81 A;  2R7Z J;  1A5J A;  1T56 A;  2GFN A;  5C4J J;  1IC8 A;  2O7T A;  2NX4 A;  1JUP A;  2DA2 A;  2HXI A;  1GV2 A;  4A3D J;  1F43 A;  1G2H A;  1FIP A;  1QVU A;  2REK A;  3ZOB A;  3QPL A;  2VPR A;  4A3F J;  2XDN A;  1NK2 P;  2XGD A;  2HOA A;  1MH3 A;  5J1Y A;  2CJJ A;  2COB A;  3BR0 A;  3H0G J;  1AKH A;  1APL C;  1U8B A;  3A01 A;  4MFD A;  3W6V A;  1OJL A;  5EZG A;  3I4N J;  5K7H A;  5IPA A;  2AO9 A;  5CXG A;  5K7F A;  1I6H J;  5E3L A;  1HLV A;  2IU5 A;  3PPB A;  1BW6 A;  3M3Y J;  5M5Y J;  3ANP A;  3C07 A;  2DMT A;  3VUQ A;  1BW5 A;  2W53 A;  3C2B A;  2K9N A;  2HI3 A;  3PM1 A;  5M5W J;  2CRG A;  3JRA A;  2WB1 N;  5HOD A;  3BNI A;  3VOX A;  4BBS J;  2CU7 A;  3NAR A;  3BG5 A;  4NEL A;  1IJW C;  1WPK A;  5DAJ A;  3RH2 A;  3ANG A;  1IG7 A;  1RR7 A;  3FRQ A;  4BBR J;  3HE0 A;  1NTC A;  3RKQ A;  1FTT A;  3ZQI A;  2Q24 A;  3HOZ J;  1WI3 A;  4GFK A;  3E7Q A;  1D5Y A;  3LSJ A;  5F0H A;  2YUS A;  1IDY A;  3NRG A;  2FX0 A;  1UI5 A;  3SJM A;  5E3O A;  5J1R A;  1MBH A;  2DMQ A;  3JRG A;  1U78 A;  2WGB A;  1POG A;  5EGO B;  5EFY A;  1QPI A;  3FK6 A;  2MSY A;  2QIB A;  3RQI A;  3GTK J;  3S1N J;  3BTC A;  4ABZ A;  4L5E A;  3DEW A;  2R93 J;  2JA6 J;  2LK2 A;  3I4M J;  3HTH A;  3TP0 A;  2UXU A;  3VOK A;  4A3L J;  3OIO A;  4JX5 A;  2JWT A;  4IHY A;  3S14 J;  5FGL A;  1UHS A;  3MVP A;  3V78 A;  4IHX A;  3JRC A;  1Y1W J;  2M8G X;  3VVZ A;  2I10 A;  4B3A A;  2UXP A;  2MGQ A;  2RAE A;  2R5Y A;  4A3J J;  2GM4 A;  3RD3 A;  2HKU A;  4DW6 A;  3WHB A;  1DU0 A;  3S1R J;  1MH4 A;  5C4X J;  2YVE A;  3IH4 A;  5GPC A;  2N8G A;  2CQX A;  4FTH A;  3BR2 A;  2NVQ J;  3GTL J;  3VW1 A;  2PZ9 A;  5HAW A;  1TC3 C;  2JA8 J;  1JT0 A;  4FCY A;  1ZGW A;  2LLK A;  2L7M P;  2MG4 A;  3HOX J;  5F27 A;  3LNQ A;  3A02 A;  2L7F P;  1PUF B;  3M4O J;  3Q0U A;  4D5C A;  3S5R A;  5J3L A;  2XPU A;  2AHQ A;  1ZTR A;  3E7L A;  2DJN A;  2UXI A;  4MFE A;  1ZR2 A;  3AQT A;  5DS9 A;  3G1O A;  5EZH A;  2ZOZ A;  4JP0 A;  1VI0 A;  2E2I J;  1IRZ A;  4JX6 A;  1U9N A;  3COL A;  3LSP A;  3D1N I;  3DPJ A;  4M3E A;  1T33 A;  2NP5 A;  1K83 J;  3JRD A;  2VKE A;  2VKV A;  4DZJ A;  4EEF G;  2R5Y B;  3K7A J;  3KKC A;  4KWA A;  3T6N A;  3BR3 A;  1JJ6 C;  3HKZ N;  2MW8 A;  5IP7 J;  4X6A J;  3VVY A;  2OER A;  1H89 C;  4QIW N;  2VUM J;  4XRM A;  2HXO A;  5FKM A;  2JN6 A;  5FKL A;  4A93 J;  3IUV A;  4DYC A;  5HBU A;  2DA6 A;  5C44 J;  3BHQ A;  4GCT A;  2NVT J;  2WV1 A;  4RDU A;  3CCY A;  1MBE A;  1ENH A;  5EDN A;  4M3F A;  1P7I A;  3F1B A;  2LVS A;  3NPI A;  4NN1 A;  2L0K A;  1JGG A;  1SAN A;  1A6I A;  2IEK A;  3FIW A;  5F04 A;  3HOU J;  3CRJ A;  4XRS G;  3S17 J;  4C3I J;  1X58 A;  1SFO J;  1RKT A;  2O9L A;  1WH5 A;  5BNG A;  2H1K A;  4XK4 A;  5C4Y A;  5FKN A;  5FKK A;  4MK6 A;  5IP6 A;  3JRE A;  3G1M A;  3QQA A;  4A69 C;  4AUX A;  5EG0 A;  1MBK A;  1Y1V J;  4GFB A;  1B8I A;  1BL0 A;  4DZP A;  3ON2 A;  2VI6 A;  1GV5 A;  1ETY A;  3VVX A;  3ON4 A;  1QRY A;  1MBJ A;  2LD5 A;  1Z77 A;  4B1R A;  3FK7 A;  3BRU A;  2JA7 J;  1AKH B;  3CWR A;  4YZE A;  3UKG A;  3HTA A;  2W48 A;  3GTO J;  1I50 J;  3BQY A;  4IHV A;  3FKI J;  1JKQ C;  2DA4 A;  2JJ7 A;  5FJ8 J;  1PUF A;  2ME0 A;  2OI8 A;  4MO7 A;  5EG0 B;  1GDT A;  3NNR A;  2O8K A;  3LOC A;  1RET A;  2LKX A;  1FIA A;  4A3C J;  1X2M A;  2B63 J;  3KZ9 A;  3ZQH A;  3ZQG A;  2K9S A;  2V57 A;  4A3M J;  2M2E A;  2D5V A;  3HB9 A;  3NXC A;  3G7R A;  1JTX A;  3BG9 A;  1LFB A;  2TCT A;  3CDL A;  5CW8 A;  2NVY J;  2M34 A;  4J19 A;  3HGY A;  3F0C A;  1E3O C;  2G3B A;  4IHW A;  5IP9 J;  2QKO A;  3TP3 A;  2DMN A;  1VF9 A;  3CQZ J;  3BCG A;  1JKR C;  1XC5 A;  2M0C A;  3BTJ A;  3HTJ A;  4XRS A;  3KKD A;  3HDD A;  3BTI A;  5FLV A;  5FHP A;  2DG8 A;  5D19 A;  3A03 A;  5K58 A;  4ME9 A;  4BY7 J;  3B81 A;  1TWG J;  3GTG J;  1W0U A;  1JTY A;  3O60 A;  4JKZ A;  1WH7 A;  2ZB9 A;  3RZO J;  3S2D J;  3SDG A;  2QF7 A;  4Y52 J;  5CXI A;  2DA3 A;  3PAS A;  3ZQF A;  3VP5 A;  3HTI A;  3K2A A;  3VW2 A;  5JLW A;  2KDZ A;  1ZQ3 P;  1TWF J;  2CUE A;  1QVT A;  1ZKG A;  4M6V A;  3S1Q J;  3ZQL A;  2NOG A;  4FIS A;  3HIM A;  3B6C A;  2GEN A;  4A3G J;  5IOY A;  2IAI A;  1OCT C;  2R92 J;  2HOT A;  1K61 A;  1HF0 A;  1MBF A;  1RPW A;  3GTM J;  4M3B A;  4M3G A;  2M9H A;  5FKO A;  1UG2 A;  1VFC A;  1AHD P;  3HOW J;  2Y9Z A;  1TWH J;  4FE4 A;  1IV6 A;  5EYR A;  1RKW A;  4D7M A;  1HDD C;  4GFL A;  3WHC A;  2OF7 A;  1JT6 A;  1HOM A;  3O8G A;  1B8I B;  3VW0 A;  2QCO A;  1F36 A;  2EBI A;  3BT9 A;  2XSD C;  4DYQ A;  2HQ5 A;  2O7O A;  2EH3 A;  3L1P A;  2LP0 A;  4D5F A;  2EZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...