3VPRA

Crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
189
Chain Sequence
b'VTTTRDRILEEAAKLFTEKGYEATSVQDLAQALGLSKAALYHHFGSKEEILYEISLLALKGLVAAGEKALEVADPKEALRRFMEAHARYFEENYPFFVTMLQGIKSLSPENRLKTIALRDRHEENLRAILRRGVEQGVFREVDVALAGRAVLSMLNWMIRWFRPDGPMRAEEVARAYHDLILRGLERGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Transcriptional repression mediated by a TetR family protein, PfmR, from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Dna binding protein
total genus 71
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3vprA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vprA02
1H8AC 2KT0A 3BQZA 3E7QA 5F1JA 3JRAA 2VPRA 3QKXA 1JUPA 3BNIA 3TW6A 3HOYJ 4D7NA 3UKGA 2JA5J 1AU7A 4QTRA 3F0CA 5IYBJ 3G1MA 2HOAA 3O8HA 3ZQGA 3S1RJ 1ZTRA 5FKMA 1JTYA 1R9TJ 1TWCJ 2JK3A 2LTPA 1GV5A 1SFOJ 1ZR4A 3HTJA 5C44J 3VVYA 2YS9A 2AHQA 3GTLJ 1ETKA 1WCMJ 2K9QA 4AC0A 3RH2A 3F1BA 2O8KA 3RD3A 2EZIA 1I3QJ 2NOGA 2REKA 5FMPA 1ZR2A 4HKUA 3HIMA 2COBA 3CCYA 2ID3A 1FIAA 5F0HA 3LSGA 1GDTA 4IHXA 3HBLA 5HODA 3OOUA 2UXPA 4NELA 2G7SA 2DJNA 1CQTA 1JTXA 5IOZA 3COLA 3ZQFA 5IPAA 5HSZA 1F36A 2PMZN 3S1MJ 4M3GA 2EZLA 4AUXA 2TRTA 4XIDA 2CUEA 9ANTA 4X1EA 3IH3A 5C3EJ 4GCTA 3BTLA 1UMQA 2K9NA 4FCYA 4EEFG 3VW1A 1ENHA 2W53A 1Y1WJ 2L7ZA 1DU6A 3VOXA 2CRGA 2HYJA 2JA6J 2NVQJ 4I76A 2VI6A 5C4YA 3G1OA 2FD5A 1GV2A 2LY9A 2TCTA 4FE7A 5E3NA 3HTIA 1WPKA 2Y31A 2DG7A 1RPWA 4XICA 3GTGJ 3GZIA 3CQZJ 5F0CA 2Y30A 2OI8A 3CDLA 3A01B 2LR8A 3ON2A 4D5FA 3GEUA 2JWTA 3BR1A 2O7OA 3IH2A 1MBHA 2XGCA 3BTIA 2QTQA 1ZGWA 4QIWN 1D5YA 4JX4A 2R5YB 4RBOA 4NN1A 1MSFC 1U78A 1HF0A 3HKZN 2JA8J 1ETYA 2H1KA 2R92J 3BCGA 5DS9A 4G12A 5DTDA 3NNRA 5FHPA 1WGXA 2M0CA 4PXIA 2GUHA 3TP0A 4UUTA 1VFCA 3RQIA 3HGYA 1ZKGA 2CJJA 3WHBA 2LVSA 1LE8A 1IRZA 4MXMA 5JLWA 1TWHJ 1BL0A 1RESA 2QCOA 4QSHA 4A93J 3NPIA 2JMWA 2JN6A 4C3IJ 1TWFJ 1GT0C 3GTKJ 1G2HA 2NP3A 2WGBA 5AQCA 2LK2A 2ECBA 1Q1VA 3RZOJ 1APLC 4XRMA 4IHYA 5C4XJ 3JRIA 3BR0A 4MIMA 3TP3A 4MK6A 2LFBA 5M5YJ 2EBIA 1LFBA 2LKXA 1EF4A 2WAQN 5E3MA 4J19A 3HDDA 2FQ4A 4M3EA 4C3HJ 1JJ8C 3EGQA 3MNLA 3HOVJ 2LLKA 4BBRJ 4JP0A 4ABZA 3VOKA 4NDLA 3PM1A 3TW7A 2M9HA 3NAUA 2XGDA 2Y0SN 2NVYJ 5EGOA 1Y1VJ 5CXIA 1GVDA 4XRSA 3G56A 4AC6A 1MSEC 3FISA 3S16J 5FKLA 4C2MJ 2E1OA 3HOXJ 2DMQA 2E2IJ 2NVXJ 3LNQA 3VIBA 2ZCMA 2R93J 3HOUJ 3ANGA 3BTCA 4DW6A 1UI6A 3GTJJ 1IC8A 3ZOBA 1MBKA 3ZQCA 1FIPA 2JJ7A 3JRGA 2GLOA 4DZPA 3G1LA 3MN2A 3SFIA 1U8BA 5D19A 1QVUA 4BY7J 2KDZA 1GUUA 4BKXA 1JKQC 1IJWC 2G7LA 4AYBN 4MO7A 1UHSA 3PO2J 2UXOA 3GTPJ 3CRJA 4DYRA 2F07A 5GP9A 5DAJA 2HI3A 4A3BJ 3FK7A 3DEWA 2ME6A 1QRYA 2E2JJ 2YVEA 2V57A 3OSGA 3HM5A 5F08A 3KNWA 1HOMA 3VW0A 2L7FP 3A02A 5IOYA 2EZHA 2X9DA 2ZOYA 4B4CA 3LOCA 2HOTA 2DA1A 3DCFA 1NK2P 3HOWJ 2YUSA 1IGNA 2XGEA 5FLMJ 1WH5A 2HXOA 2L7MP 3K2AA 2DTZA 4A3JJ 2XPWA 2DA5A 3BR6A 2GM4A 1IDYA 2DA4A 1PUFA 3VVXA 1AKHA 4JNNA 1MH4A 3ZQHA 2P81A 1XS9A 2QKOA 1A6IA 1ORKA 1PUFB 3NXCA 1AKHB 5M3MJ 2CUFA 1O4XA 3M3YJ 2GENA 3V78A 2HQ5A 2D5VA 4MFEA 3C07A 5HAWA 1YRNA 2QOPA 4JL3A 2L0KA 4FISA 1JT0A 3SDGA 4A3EJ 3KKCA 4L62A 3MVPA 1JUSA 1YRNB 4YZEA 3H3VK 3VVZA 2R0QC 2VKEA 1RKWA 4A3CJ 2O7TA 2ZB9A 1IUFA 2QIBA 5EYRA 2ZOZA 3BG3A 1X2NA 4JKZA 5J1UA 2EH3A 2XRLA 3LSPA 3IV5A 1JKRC 4M6VA 5F04A 3ZQIA 4GFBA 2JA7J 2NVTJ 1TC3C 3S1NJ 4LOCA 1F43A 5EZGA 2XDNA 5FKNA 1U9OA 4W97A 1FTZA 4DYCA 2Y9ZA 1HDDC 3Q3SA 2M34A 3QPSA 2NS7A 1MBFA 2PBXA 3BG5A 2XPVA 2MGQA 3BTJA 1OJLA 4A69C 5CXGA 1X58A 3B6AA 2NP5A 2DA3A 2DMPA 2HYTA 3BJBA 1XC5A 3JRCA 3M4OJ 1JKOC 3GTOJ 2OERA 1H89C 3RKQA 2HKUA 3L1PA 1JJ6C 3W6VA 2VUMJ 1LE8B 1W0UA 1WH7A 5IP7J 2UXIA 3B6CA 3OIOA 3RZDJ 2B63J 1B72A 2MG4A 5EDNA 5K58A 2M2EA 2DA7A 2QWTA 2WUIA 3BT9A 2YU9J 5IP6A 3S14J 5FLVA 4Y52J 1B72B 5IYDJ 1Z77A 3K7AJ 3JSJA 4ACIA 2G0EA 2YVHA 1MBJA 3FRQA 4ICHA 4FTHA 2FBQA 1HCRA 4GFKA 3B81A 3A03A 2E19A 4JX6A 2LD5A 4D5CA 2FJ1A 3AQSA 1ETVA 1K61A 3C2BA 4MFDA 2Y9YA 3CMYA 3CJDA 3DPJA 3PO3J 2XPUA 3S17J 2UXUA 3EUPA 5EGOB 1OCTC 3S2DJ 1VF9A 5M3FJ 1FTTA 3H0GJ 3JRBA 5GPAA 5EG0A 3ANPA 3JR9A 2DA2A 3SJMA 2DMTA 2R7ZJ 3BQYA 5M5XJ 5F0FA 5C4JJ 2CU7A 4C3JJ 1XG1A 1IDZA 3V6GA 5EG0B 2DG8A 2N8GA 1MBEA 2Q24A 1S7EA 1LFUP 4UUSA 1RKTA 1P7JA 4BY1J 2K9SA 2DMUA 3LJLA 2GFNA 5F27A 2X6OA 1T33A 5IP9J 4UUSB 4A3FJ 3IUVA 5FGLA 4AF5A 3FKIJ 1JUMA 4RDUA 4A3GJ 3BR5A 1FJLA 5K7ZA 4DZJA 2WV1A 4JYKA 4UDSA 3IH4A 3BR3A 3O8GA 3QPLA 3NRGA 5J1YA 3G7RA 4CGRA 4A3IJ 1W0TA 2O9LA 3VUQA 4IHWA 4B1RA 1ZK8A 3VW2A 4JX5A 5BNGA 3I4NJ 2AO9A 3QQAA 1ETOA 1JT6A 2DA6A 2K40A 3FIWA 4Y7NJ 1U9NA 1FEXA 1ETQA 2DMNA 5EEAA 2HDDA 4M3FA 3JRFA 3ZQLA 4ME9A 4XK4A 5J1RA 3HEFA 3Q0VA 3PASA 4A3KJ 2HXIA 4V2GA 5E3LA 1JGGA 1HLVA 1BW5A 3QBMA 3WHCA 2UXHA 3KZ9A 2CQXA 2H8RA 3HTHA 2ELKA 3HTAA 1RETA 1ETWA 2LP0A 3HB9A 2G7GA 4IHVA 1MH3A 3S5RA 1X2MA 4BBSJ 1E3OC 1IV6A 2IEKA 1UG2A 5HBUA 3Q0UA 2NX4A 2XB0X 3CWRA 1QVTA 2RASA 1Z0XA 3MKLA 2WB1N 1BA5A 4KWAA 5K7FA 4FE4A 4A3LJ 3LHQA 1JKPC 1K83J 4XRSG 4X6AJ 2M8GX 3TEDA 4B3AA 5E3OA 5D1RA 4GCKA 3BHQA 1AHDP 5M5WJ 1WI3A 2PZ9A 2GBYA 3PPBA 1POGA 2OPTA 1T56A 4V2FA 5FJ8J 4D7MA 1UI5A 1NTCA 1HDPA 1ITYA 2EQRA 2FX0A 4GFLA 3JREA 3HOZJ 3A01A 3BRUA 1BW6A 1NK3P 3KKDA 2ID6A 1TWGJ 3JRHA 1RR7A 2XSDC 3D1NI 3JRDA 2R5YA 2CQQA 3P9TA 2E2HJ 3HGGA 3OSFA 4A3DJ 4DYQA 5FKOA 3VPRA 2I10A 1MBGA 2ECCA 3AQTA 3LWJA 3LSRA 5GPCA 1VI0A 3GTMJ 2VKVA 3HE0A 1ZQ3P 1DU0A 4S0HB 4W1UA 1A5JA 1OFCX 4HNVA 4A3MJ 2DN0A 3I4MJ 2W48A 2NS8A 3LSJA 3O60A 3Q0WA 3VP5A 2L9RA 5J3LA 1OCPA 1I6HJ 4GCLA 2Y2ZA 3BR2A 1H88C 2IU5A 1SGMA 2HOSA 1ETXA 3GTQJ 1BJZA 1P7IA 2QF7A 3NARA 5JLXA 4M3BA 4CYCA 3GBGA 3ON4A 2MSYA 1VNDA 1I50J 2ZCXA 3BG9A 1MNMC 5EFYA 2MW8A 1TWAJ 4MLOA 5FKKA 2ME0A 4CYCB 2OF7A 4IEJA 2RHAA 2EZKA 5D18A 2XB5A 3S15J 1IG7A 1SANA 2D6YA 2ZCNA 3NI7A 3S1QJ 2R5ZA 4L5EA 5H9TA 2IBDA 3FK6A 2RAEA 1B8IA 3T6NA 2IAIA 1QPIA 5CW8A 4BXXJ 3S2HJ 4M3DA 2R5ZB 2X48A 1B8IB 3E7LA 5EZHA 4I6ZA 5IYCJ 5EF6A 5K7HA 2G3BA
chains in the Genus database with same CATH superfamily
1H8AC 1I6XA 3CP2A 3PNYA 3E7QA 5F1JA 4HSTA 1JUPA 2IP2A 3TW6A 2Q8KA 3H1CA 3SXYA 4JK1X 3UKGA 4QTRA 5IYBJ 4XBFA 4I09A 3OS0A 3CJRB 5FKMA 1TT0A 3SWHA 5CKTA 3VSLA 1ZR4A 1DGRM 5GTIC 3HPGA 4XN0A 2YS9A 4J01A 3JTHA 3VVYA 4CDGA 1WCMJ 1Y8QB 2BY0A 2F4IA 3RD3A 3WODF 5FMPA 4HKUA 1MJAA 3J7AO 2COBA 2X1EA 3KX2A 1ZHFA 4XKVA 1T6SA 4ENNA 3LSGA 3HC7A 2VPLA 2K9MA 3OOUA 3ULQB 1DUXC 3K4CA 3WU2C 1G8XA 2Q1ZB 3SFZA 1D8JA 1JTXA 4KIBA 1D1AA 5IOZA 1VQ4I 2PLYA 1IRXA 2MH2A 1B59A 4G7ZF 3HIFA 1NG7A 4XSZF 1PVEA 5FD5A 3MKWB 3S1MJ 1PYVA 1TNTA 5CLSA 3BLYA 4UVAA 1ZG5A 5F6FA 2VJ4A 3FMSA 4YFXF 2GOMA 2O03A 2E1CA 2JVGA 4FCYA 3T8RA 5DEQA 2ELHA 3GFMA 2KFDA 1USSA 1R00A 2L7ZA 1YHQI 1LVAA 4F93B 2HWVA 2O3FA 3ZRGA 2FEZA 2PJRA 1OMIA 2BV6A 2FUG2 3DBRB 5DD4A 4BDZA 5JHFA 1MD0A 2LY9A 3LQRA 1LUJB 4A0XA 1R4NB 3HTIA 4IRGA 1MMDA 2Y31A 3CCUI 1YX3A 2NYXA 3HSEA 3FM3A 2V9PA 3GTGJ 4G7OF 4UVBA 1IO2A 1TT5B 5B1BH 3GFIA 3CDLA 5E8GA 1TW2A 4L0YB 2L7KA 1O57A 4LK1F 4Y4RA 3L2VA 1Z91A 2XGCA 3FMRA 5JVGF 4BQQA 1ZGWA 1YIJI 3W2AA 4OAYA 1FNNA 3GO5A 4NN1A 2MD0A 3K8PC 4PK4A 3HKZN 3PNTA 3CCRI 2H1KA 4HA8A 2X1CA 3CD6I 4G12A 3QYBA 2W7NA 3F23A 4PXIA 1R71A 3ZN1A 1YS6A 2A3SA 1HW2A 3RQIA 3WHBA 1ZKGA 3PJRA 2WADA 1MW7A 2LVSA 1AA7A 2QCOA 4QSHA 3IHUA 1IN5A 3BPVA 2JN6A 4C3IJ 1RIOH 1GT0C 3V42A 2WAFA 3OWTA 2LK2A 2ECBA 4FX4A 2LG4A 2V79A 1APLC 3I55I 4U0YA 4HW0A 2PMHA 4IX7A 2AXLA 2MH9A 3LMMA 4MK6A 2LFBA 5M5YJ 3CF5F 4R8HA 1LFBA 2LKXA 2R7XA 2WAQN 3HDDA 1EF4A 2IVMA 2J5OA 3FXJA 1F9NA 4M3EA 2BXYA 1LDKB 3C1DA 3EGQA 3MNLA 3E0JB 2LLKA 1QQIA 1IF1A 2VXDA 1T08B 4CCKA 2IS1A 4OIQF 2CO5A 4XM3A 4BQNA 2W1OA 4AC6A 2H1LA 3S16J 2E7XA 3O3KA 2DMQA 2NVXJ 1LPQA 4I7HA 2HQNA 1CGPA 1R1UA 2LYCA 3KP4A 3EYIA 1CF7A 1MBKA 2ZBKA 3LA2A 2VJJA 1X1AA 3VDXA 2CQKA 2Q0OA 3S2WA 1GUUA 4OOIA 2QA4I 2W57A 2Y75A 5E1XA 2F07A 1RR8C 5GP9A 4GRIA 4M9SA 1UJ8A 4AU7A 3FBIB 3OSGA 3KEYA 1Z3XA 2L7FP 4ESJA 2I5UA 2ZOYA 5FRMA 4B4CA 2HOTA 4ZTFA 3HOWJ 4IRHA 5FLMJ 2EILH 1T0FC 2L7MP 4HEA2 2I8DA 3H3UA 2XPWA 2XAJA 2E1MB 3WE3A 1IDYA 5GTHC 5TRDA 1PUFA 1FMVA 2FA5A 3ZQHA 2P81A 2KJBA 3G4SI 2CYYA 1A6IA 3BZ6A 1ORKA 2G9WA 2CUFA 3QODA 2HQ5A 1YRNA 1UZCA 1AWCA 3DPUA 4JL3A 2VQGA 4A3EJ 1A31A 3KKCA 1JUSA 3K10A 3H3VK 1MMGA 2EFNA 2IXSA 2VKEA 1X1CA 3MD2A 1E2XA 4HF1A 1IUFA 1M1EB 2VXZA 2RVCA 2M0MA 2KHMA 3BG3A 1S7OA 4IQ4A 3TBIA 2EH3A 4M6VA 3ZQIA 2IS6A 1B4AA 2KRCA 3RI4A 1ZREA 1TC3C 4M9ZA 4LLNA 3S1NJ 3JCUC 3CCLI 3GMEA 3GW2A 3BZKA 3OR1C 1U9OA 3A2KA 2CQ7A 1FTZA 1YS7A 2PMZA 3P7NA 5A2QK 2Y9ZA 4FQGA 2FOWA 4KMUX 4KT6A 1V5GA 4JBAA 5HS8A 4G6DA 5KAIC 1OKRA 2EIJH 5CQEA 3BTJA 5TJJA 2RN7A 5ICFA 2HYTA 1W4MA 1WQ2A 2F5VA 2MLGA 4CXFA 2OERA 2EWNA 4E7ZA 5LEKA 1LVKA 1HC8A 5IP7J 4A5NA 1K4TA 3B6CA 3K4BA 1MNEA 3BY6A 2R7UA 2EIMH 1B72A 1FOKA 1U6GA 1MDMB 2DA7A 3BT9A 2YU9J 1K6YA 4OINF 1N75A 3IKVA 5E1WA 1BIAA 3S14J 3ABLH 4Y52J 2DW4A 5IYDJ 1XMAA 3PUFA 1QHGA 2ZNZA 4ICHA 5E20A 4FTHA 1G3TA 4GFKA 1ZELA 2GIVA 3A03A 2E19A 1SD6A 2OA4A 3ASOH 4JX6A 3B81A 5IT9Z 1IV8A 1ETVA 3CMYA 2A61A 4OMYA 1S8NA 3V4GA 4CCJA 4HLXA 3S17J 1XX5A 2WBMA 3KE2A 1SC7A 1FBQA 1B6AA 4KISA 4NC6A 3JRBA 3ANPA 2PQ8A 1YJWI 2R7QA 1VZ0A 1BR4A 2R7ZJ 3V6GA 1J5YA 2QZ8A 4S04A 5DCMA 5BMZA 4NNJA 1ON2A 2E7WA 4P9FA 2A6EF 2EFWA 4HNUA 4Q5SF 4F92B 4ITVA 2VONA 2BVMA 2JSPA 4XONA 4E6KG 4UUSB 1SMTA 3PFIA 1HSTA 3FKIJ 2VOPA 1FJLA 3A1YA 3M1CA 1MNDA 1KU9A 3IH4A 3KP3A 5J1YA 2Z5UA 3BWGA 3KYDB 4M73A 4CGRA 2KLOA 4YEJA 4HF2A 3IL2A 3VUQA 2HFHA 4B1RA 1ZK8A 1Y56A 3GEZA 5BNGA 5L3FA 4YIFA 5B5EC 3TL4X 2DA6A 2YX4A 3FIWA 4Y7NJ 1XN7A 3F9KA 3K4MA 2RNGA 1X19A 1KQ8A 1OYWA 2H94A 4M3FA 3ZQLA 5HOOA 3E5UA 4ME9A 1N77A 1Z05A 3M7GA 3HEFA 3Q0VA 2DDAA 4DJAA 4A3KJ 3K9TA 1K4SA 2VKDA 3GCMA 2F2EA 3K4JA 4GGGA 1BW5A 2F4MB 3AG1H 2EV5A 3KP2A 1E3PA 3J7ZI 3HTAA 3AKZA 3P9CA 1RETA 2DYRH 4XKCA 1DPUA 4H0EA 1J59A 2VBZA 5J4VA 3PNVA 4KIGA 3GLXA 2RQPA 3DU5A 3S5RA 2DCEA 5FD6A 1X2MA 3REOA 2HYFA 4G8XA 2QQ9A 5IT3A 2QM3A 5LLQA 3E5QA 4G94A 4A2UA 3ZMSA 2B9SA 2RASA 4ZTJA 1F1ZA 5TGTA 2JT1A 1Z0XA 3NS4A 2WB1N 3L2CA 1BA5A 4KWAA 3U1DA 5K7FA 1D0XA 1XCVA 4FE4A 3LHQA 1ZRFA 3PSIA 4X6AJ 1K83J 2Z1DA 4XRSG 4EJOA 4IHSA 3K6GA 2JRMA 3TDUC 3RPUA 3HUGA 2HEOA 4ZDPA 5D8LB 3OYAA 5D1RA 1FZPB 3FM5A 2P8TA 4DGWB 1AHDP 3BHQA 2IA1A 3VSKA 4C2TA 3HG9A 4L9TA 1POGA 5B1AH 4ZYAA 3V8JA 3CMEI 5L3EA 1JI8A 3FMQA 3RCOA 1HDPA 5B3SH 3HOZJ 1BW6A 1NK3P 2ID6A 1TWGJ 2XAUA 2FBIA 3QWLA 2X51A 3QYEA 4DNCA 2RREA 4D0PA 2P6TA 3KZYA 5ILVA 2R5YA 2CQQA 2F5DA 1IN7A 2EJRA 3HGGA 2QLZA 1RZ4A 3W2WA 4K2EA 3VPRA 1W5TA 1X3ZB 2MBFA 4CYDA 1MBGA 3OY9A 2WTEA 1YX5A 2LMDA 2W25A 3HE0A 1W7PB 2W4SA 3BC8A 1ZQ3P 1IXSB 3DPLC 2PG4A 3QPHA 3ZPLA 3I9V2 2FJI1 4PGGA 3O60A 2LBFA 1O3QA 1UAAA 2L9RA 5CVRA 4WF2A 4BQOA 1I6HJ 2QBYB 4HG2A 4M9XA 4WXHA 4GCLA 2Y2ZA 4LG3A 5EEHA 4BHCA 2YPRA 5LGUA 3WU0A 1OCOH 1U5TB 2ETHA 1P7IA 4XLAA 1WJFA 4CYCA 5FB2A 3ON4A 2RC4A 1I50J 2E5ZA 3BG9A 1FSEA 2ZCXA 1USTA 1S9HA 2DTRA 2R7VA 1LB2A 3PUBA 3KIOA 2PBIA 2D2WA 3QYFA 2F5EA 3B73A 4CCOA 3LFUA 4L5EA 5H9TA 4I99C 3QOPA 3CO7C 3FK6A 4R1HA 4Y3OA 1ACIA 3T6NA 4ZH4F 3H9QA 4BXXJ 3S2HJ 5FLXK 1BJAA 2KIMA 4AVZA 1JHFA 2IA2A 3CCJI 3BQZA 5FLXZ 1FSHA 3JRAA 3CCVI 2K27A 3BNIA 3ZN0A 2ICWG 4D7NA 2IJLA 1AU7A 3F0CA 1HW5A 2K4JA 2Z2SB 3O8HA 1LDDA 4QPOA 4XRFA 1ZTRA 3HL2A 1JTYA 1R9TJ 1TWCJ 1MJ9A 1P2FA 2JK3A 2QQBA 3QOEA 1GV5A 4U88A 2FNAA 1TL8A 3KFWX 5C44J 3NQOA 2Y0SA 4PSWA 2DJIA 2HPIA 1ZLKA 4AC0A 3RH2A 3F1BA 4XR6A 5HVQC 2NOGA 3OYJA 4XOPA 5F0HA 3K70C 2DXIA 2K3PA 1YLFA 4IHXA 2H09A 1XB4A 1I1GA 3GZNB 3HBLA 3LL7A 2UXPA 2G7SA 1DP3A 2QEXI 3AAFA 1ULYA 2L02A 4OD4A 5IPAA 2FOKA 3DTIA 4A12A 4M3GA 2EZLA 2VLAA 2V4JC 1FP2A 5AIPA 2CV2A 1K7AA 2GIZA 3WTVC 9ANTA 4X1EA 2NXNB 2XUBA 3EUAA 3K1PA 4XORA 5C3EJ 2K9NA 3GWZA 3T1BA 4BACA 4EEFG 3VW1A 2CW0F 2QGUA 3WGGA 2PI0A 1BI1A 2W53A 1IXCA 2KQRA 3PFYA 3VOXA 3VYTB 1XSDA 3U21A 2CRGA 4L5IA 3HZJA 1V3FA 5CQGA 3ZP5A 2JA6J 4QPQA 4BHBA 4O5VA 3H9JA 4I76A 2VI6A 2X0LA 2O0YA 4RB1A 4JOMA 2DT6A 3BJ6A 4AWXB 1XMKA 4YFNF 2PJRB 1WPKA 4MQ9F 2DG7A 1XGOA 2H8WA 4XICA 2HR3A 3GZIA 4HV6A 2CFOA 3A01B 2LR8A 2B7EA 5ED4A 2O7OA 2NAZA 3IH2A 4F3QA 3AFHA 4IOCF 1RUOA 1P4WA 3UR3C 4UXNA 2QTQA 4EV0A 3LWFA 4RBOA 2L3DA 3DF8A 4A5MA 3WG9A 2UXNA 1D1BA 2JA8J 1ETYA 4X0GA 4A0ZA 4BGDA 2Y69H 5H6QA 4UY8I 3CO6C 5DCFA 2CJJA 1LE8A 1IRZA 3KCCA 1BL0A 4JQFA 3F8CA 5L3DA 3D0SA 3GTKJ 4A6DA 2ZMEC 1YO5C 4IHYA 3VOEA 3JRIA 1WRJA 1FOYA 2EBIA 4J19A 2MC3A 4U7DA 2LREA 1ZH5A 1HXDA 2IGMA 1Z3YA 3X2QH 2XIGA 3IC7A 3DFGA 1W36D 4YIRX 3HOVJ 5L3GA 3DLAA 4ABZA 3PM1A 5GAGJ 1LJ9A 3C3WA 4BQAA 2NVYJ 4EMSA 2XVCA 2KIFA 3DTKA 1FOXA 3U2RA 3K2ZA 2A05A 2DDBA 2IA0A 4C2MJ 1GLNA 2VB6A 3FXOA 2ZCMA 2R93J 3ANGA 3HSRA 4DW6A 2EV6A 1UI6A 4NUBA 5LEJA 2ELJA 1N78A 3ZQCA 1LNWA 4IKFA 1FIPA 3RKYA 3ZQQA 4CCMA 3SFIA 3OYLA 3WTWC 1CF7B 1Q1HA 5D19A 4BY7J 1JKQC 1D1CA 1IJWC 1I1SA 2CMPA 2L5QA 1TZLA 4AYBN 2UXOA 3GTPJ 3CRJA 3M8JA 3QPTA 4OIPF 3KEOA 2M30A 4P9UA 4A3BJ 3FK7A 3H5AA 4GCVA 3F22A 1J09A 2D1HA 2E2JJ 5BPDA 3JAMK 2ZSIB 3G6EI 3TO7A 1I3AA 3R0JA 1L0OC 2DA1A 2V1XA 3IRQA 1ZN2A 2XV4S 1SVOA 2XGEA 1WH5A 2H6CA 2HKOA 5CVVA 2R7DA 3OYBA 4CH7A 3K2AA 5LBQA 3CDHA 4Y17A 3BR6A 3FHNA 3DKWA 1R5HA 2DA4A 4ZJZA 4HQEA 1AKHA 3ISPA 3WU1B 4ZDLA 2HQRA 3S32A 3NEUA 1T95A 1XS9A 4KICA 1WJDA 2K3FA 1PUFB 3VYRB 1OCCH 2ZO4A 2K86A 3V78A 5EJCA 1MMSA 1BBYA 3OYKA 3C18A 2X6WA 4FISA 3ZMZA 2BXZA 1WJ5A 3E1SA 3HSFA 3MVPA 1YRNB 5K5OA 3V8LA 1HQCA 2PFBA 4OMZA 1DQUA 2XC7A 2R0QC 3PL8A 2HNHA 2O7TA 3BJOA 2ZB9A 5BS6A 2ZOZA 4HBLA 1E17A 4PFOA 1X4PA 2KZVA 2MABA 5J1UA 2PN6A 3IV5A 3E6BA 1X3UA 2IGNA 1SFEA 2NVTJ 3BPXA 4GXOA 2XDNA 3E6MA 1S72I 1DPRA 4KNYA 2ZXHA 1D8KA 3F8MA 2CG4A 3S3MA 1FYMA 3S93A 2DQRA 2XAQA 2YVXA 2PBXA 3BG5A 3FZVA 4ESFA 2DOAA 2DA3A 3BJBA 4RAGA 1KQ9A 4KN7X 1JKOC 1SEUA 2DAOA 2P0WA 1H89C 3GTOJ 3RKQA 2HKUA 2A6HF 3M9AA 3L1PA 1JJ6C 5ERIA 3I56I 2VUMJ 1E3HA 2ZC2A 3OYIA 4IO9F 3RZDJ 3IP4B 4RB3C 1PUEE 2P7CB 1JGSA 2BW3A 4Q48A 2MG4A 2GWRA 3CMAI 1SFUA 2Y48A 4CCNA 2QWTA 2WUIA 4KIFA 3WTUC 1Z6RA 1YIOA 2XKPA 1B72B 4EJVA 3JSJA 2L9NA 1BR2A 3I64A 2G0EA 1WZ2A 2A2FX 4HPQA 3N4MA 1QO0D 2HTSA 3FRQA 4D1QA 4CO8A 1IRFA 4HX4A 1TW3A 4BJ6C 3ELKA 2Y9YA 3K69A 4ANJA 3H36A 2WV0A 1TBXA 3LSKA 3EUPA 5EGOB 4NQWA 5ICEA 1OCTC 5M3FJ 1REPC 4LG0B 2MFZA 1C0WA 2VQCA 2FE3A 2Q2EA 3HKZA 5GPAA 5EG0A 2FXAA 4YFKF 5L3CA 3HTSB 2WY8Q 4EGYA 5M5XJ 1FT9A 1T38A 2V6CA 5F0FA 2GQQA 2XSJC 4C3JJ 1R7JA 4HV5A 1YI2I 2Q24A 1TP4A 1S7EA 3V7RA 3L2UA 4LIVA 4IRIA 3KP7A 1RKTA 2K85A 2IT0A 1P7JA 4BY1J 2K9SA 1V5FA 2PX9A 5DCMB 4EJWA 3FHZA 1T33A 3OL4A 2PJPA 4WXDA 1GHCA 5FGLA 3CUQC 3IKTA 3BR5A 3OYFA 5JR3A 1U8RA 3O8GA 3SDBA 4M72A 1ZARA 1W0TA 2LRDA 2BOLA 3WTYC 1DGWY 1LDJA 3LFKA 4IZZA 3D5LA 3ZQ7A 2JUCA 2F5FA 2K40A 2B1EA 1SAUA 1U9NA 2NRAC 1WJCA 1QGPA 5EEAA 2HDDA 1BIBA 3L00A 3M8EA 4MEYF 5CPRB 2K5CA 1TTYA 2LF8A 2UV1A 4XK4A 1ZGJA 2DBBA 4OIRF 4TV7A 4F52A 1BM9A 4HOBA 1YG2A 1YITI 3WHCA 2R7SA 2UXHA 2CQXA 1VQ9I 1W1WE 1ETWA 5J6XA 2GZWA 2LP0A 1FLIA 1P92A 1R1VA 4AIHA 2G7GA 4M74A 4BBSJ 2XAHA 1IV6A 1OPCA 5HBUA 1L3LA 1S3JA 2XB0X 4EVIA 3PIPF 4KN4X 2OZ6A 3VB2A 4M6YA 3EDPA 4CGZA 1VTNC 1FYKA 5BQTA 2ZMEA 3QP6A 5DUIA 1XSVA 4I01A 1J0RA 1PP7U 3TEDA 2R7RA 3KLOA 5GAEJ 5LHHA 1P6RA 5E3OA 2QSHX 4HDUA 4NC8A 1XDUA 5HLHA 1H0MA 1R58A 2ZJQF 3HUGB 2PZ9A 2EIKH 3H35A 1U2WA 5FJ8J 2Z33A 4D7MA 1STZA 3BROA 4II2A 4KJZA 1VQKI 3JREA 3BRUA 3MMYB 5A2QZ 2HDWA 2VJ5A 4XMYA 2IRFG 5ILSA 1VQ7I 3JRHA 3LSIA 1VQLI 4PZJA 3FX3A 4XOTA 4KUMA 4E7JA 3P9TA 4C9YA 3NWSA 4O6JA 4LMYA 1S6LA 4M71A 3OSFA 5LHGA 2BY1A 4LK0F 5FKOA 2I10A 3V7SA 5BPIA 3S3OA 3E5XA 3MCZA 3AQTA 2F48A 1R23A 1UFMA 1XD7A 3HRTA 2DO7A 3GTMJ 2VKVA 4LJZF 4N9IA 2AQEA 3Q9SA 4MTDA 1T39A 1NG6A 3UNGC 3OYDA 1OQYA 5IY5H 4HNVA 2NS8A 3K4NA 3QRFF 5ICCA 4PSXA 4HQMA 3HRSA 4ZC3A 1FOWA 1UHMA 1R49A 1SGMA 1IN4A 2CW7A 3QU3A 2O8XA 4LB5A 1BJZA 4U7BA 5JLXA 4YG2F 3J7AY 2IGOA 3RQ4A 4CYCB 2OF7A 3CJTB 1WSUA 2EZKA 1W5SA 3IUOA 2O6GE 1WHUA 3S15J 2NOJB 3S1QJ 3COAC 2VBXA 2RAEA 2KISA 1QNTA 5LRRA 3E3VA 2WAEA 5CW8A 2EINH 3R6SA 1YE9A 5TISC 2X48A 4XL9A 5EZHA 4I6ZA 4RA2A 5EF6A 5HNHA 2VBWA 1KQ0A 2VN2A 4XLHA 5K7HA 2BY3A 2KT0A 4KITB 4CCLA 1YJNI 2RV8A 2VQHA 3OYEA 3SYTA 5HLGA 4XLNF 2JA5J 3S1RJ 3G1MA 4HAMA 3ZQGA 1ZG3A 1RRJA 4RGSA 3WTZA 4RGXA 4N0BA 3ABTA 1TQMA 2KKOA 3WE2A 1IRGA 1QPMA 5KAFC 3GTLJ 1ETKA 2LC2A 2NVUB 1I3QJ 2QSGX 3DBLB 2L2OA 3CCYA 2ID3A 2RDPA 1FIAA 3PSFA 5HS9A 5HODA 4NELA 2E5NA 4MNUA 3MZYA 4HX8A 3TOAA 2ISYA 3HJEA 3MZHA 1CQTA 3HPHA 3ZQFA 1BN5A 4BEHB 2XRNA 5HSZA 2DQLA 3BOQA 1SVLA 1Y6IA 1WJBA 2VC1A 3E97A 3G71I 1WKMA 4AUXA 2V9VA 2HTJA 2TRTA 3T5XA 4XIDA 2XDVA 5DD8A 5CVJA 3IH3A 4GCTA 1ZG1A 1IUYA 1N25A 4I02A 4DQ2A 2K02A 3VYSB 4IHTA 4XKBA 4YELA 1ENHA 2ZFWA 4DIQA 5D5WB 3ERED 3H5NA 1Y1WJ 4KFCA 3T0YA 3DBHB 3OS2A 1DU6A 4HX7A 1K78B 2HYJA 5FFZA 5LD2C 1SFKA 2DOEA 1OCZH 3I71A 2NVQJ 4BYYA 5C4YA 3G1OA 2AS5F 2R7WA 2FD5A 2TCTA 4NHJA 1IN8A 4OAZA 4U0VA 5E3NA 3OIPA 2FBHA 3I54A 2XF5A 3HHGA 3ERMA 3CQZJ 1WWXA 5F0CA 3CCQI 4CSWA 1FYLA 4EM2A 2IS2A 4P5OA 4WWCA 2DPDA 4D5FA 3CC4I 3BR1A 4G7HF 3KETA 5AIQA 2CUJA 3MKYB 2DPUA 2IW5A 2FU4A 1MSFC 1OYYA 2E34A 3J7YJ 1U78A 4I98B 4EQQA 1HF0A 2ZXWH 3K0LA 1YW8A 3BCGA 5FHPA 4HRIA 1WGXA 4I0AA 4PFPA 4XLFA 4BHPA 3TP0A 4UUTA 1VFCA 2X4HA 2WB1A 3WGHA 4MXMA 3MKZA 3CUQA 4PDKA 2IGKA 4RM2A 2D1VA 2EFQA 1P4XA 4MEXF 1RESA 2FSWA 4A93J 2OJED 3CCMI 3CC2I 4F7ZA 2OAZA 1ZLJA 4RMNA 5AQCA 2M4GA 1J2XA 2A69F 2CW8A 2V7FA 3EPZA 1ON1A 2MC4A 4PJLA 3CCSI 4XRMA 1MDMA 2BEOA 3H92A 2HPMA 2STWA 3BR0A 1S5LC 4MIMA 4RLFA 3SEQA 4D9JA 4HZFA 1FBSA 2FQ4A 5DM7F 3LSMA 1EA3A 4C3HJ 3ONQA 3L7WA 3VOKA 2M1BA 2W84A 4JP0A 3TO6A 4HDVA 3RSNA 3NAUA 2Y0SN 1FMWA 2FMLA 2HZTA 3JW4A 1Y1VJ 2CWEA 2YR2A 1MSEC 3OL3A 1D0YA 3TKYA 2HYGD 3F8FA 3VIBA 1R22A 2TDXA 3LNQA 3MAJA 3QAHA 3WTTC 3GZ6A 3HOUJ 4Z6YA 2EB7A 3DV8A 4IOAF 2R3SA 3GTJJ 2VT3A 3N97A 3BG6A 2JJ7A 3MN2A 3IAM2 2A68F 1QVUA 2KDZA 4BKXA 1LFPA 4KA4A 2G7LA 3E6CC 2DK5A 4MO7A 3PO2J 1QZYA 4EJTA 2QENA 4DYRA 5DAJA 1FY7A 2YVEA 2VC0A 4LLGF 3VW0A 3HM5A 5F08A 1I39A 1ODDA 2KRFA 3A02A 2EZHA 5IOYA 2ACJA 2X9DA 2EA4A 3RYPA 1XGNA 4E7IA 1XTAA 4AD9A 3LOCA 1O7LA 3I53A 3DKXA 2KJCA 4BL0B 4EM1A 3JSPA 1O3SA 3Q5FA 1IGNA 2HXOA 4LGWA 1HW1A 1R5GA 2QKLB 5DDGA 3ZMUA 2DTZA 3P9IA 4U9LA 2QVOA 4A3JJ 2DA5A 2XHKA 3OOPA 1KA8A 2NNNA 3FBNB 3VVXA 1S7AA 2L4MA 3NXCA 2L4AA 1AKHB 5M3MJ 1O4XA 3A0HC 2ZCWA 2GENA 3TO9A 2OUMA 4IL6C 3Q9VA 2D5VA 3WTSC 1V54H 4LB6B 2L0KA 1JT0A 3LQQA 3SDGA 1QA6A 3QP5A 2D45A 2R4GA 4L62A 3MZ8A 3D5RC 1T2KA 2R7FA 2B3WA 4YZEA 2FBKA 2K4BA 2G7UA 3VVZA 2L9VA 1AOYA 4UVCA 2QIBA 5EYRA 2P5VA 2Z16A 4GO1A 1X2NA 3DXJF 4WXCA 3F6OA 1KU3A 3W6JB 3ABUA 2YX7A 3PQJA 2WY7Q 4L18B 5HDGA 2IS4A 4Y13A 2JA7J 4ENKA 2M8EA 4LOCA 3GFJA 3L9FA 1F43A 1A35A 5FKNA 4R79A 3AL0C 3GFLA 4W97A 1OLTA 1XGMA 4DYCA 1VQPI 4WIBA 3I58A 2M34A 4Q4ZF 1V5EA 3CLOA 2F6CA 2NS7A 1MBFA 4G9YA 1NH3A 2XPVA 2MGQA 1OJLA 2EV0A 3ZXSA 4GDFA 2WC2A 4LFUA 3M4OJ 1D5VA 3DLLF 4P96A 3CESA 2V1UA 3RKXA 2VKHA 1VQNI 1UELB 1WH7A 3OIQA 2LNBA 2LOOA 2UXIA 4KDPA 1PP8F 2BHYA 2B63J 1XPXA 2A07F 2HDCA 5EDNA 5K58A 2LDUA 4EATA 5LRSA 1QZEA 2LH9A 1PDNC 3AL0B 1KONA 5FLVA 3L2WA 3C7JA 3K7AJ 3VFZA 1O3TA 4ACIA 1LEAA 2YVHA 5H6RA 3G3ZA 2V1DA 4ON0A 1BOAA 5EEGA 4D5CA 1H9TA 3I59A 3DKYA 2COMA 2ESNA 3CMMA 2KDOA 4ETSA 3CJDA 3PO3J 4MTEA 2HVQA 3FXKA 4XLPF 3JSOA 2UXUA 4RM3A 3S2DJ 4N9HA 1VF9A 3WTXC 2LY1A 3P9KA 4XKWA 3V8KA 3JR9A 2DA2A 3SJMA 1EV7A 3AG4H 3BQYA 1SD7A 2CU7A 2Q2EB 1XG1A 1KU7A 4ENMA 4S05A 5EG0B 1MBEA 4YIIA 2M87A 2BZTA 3TMOA 4OD5A 4B8XA 3W3CA 2DMUA 5HLIA 3SZTA 1RUNA 1TNSA 3LJLA 4E4HA 5IP9J 3D5SC 1YTYA 3G73A 1LQ1A 4AF5A 4RDUA 5K7ZA 2Z3YA 1VQOI 2WV1A 4JYKA 3GX4X 3LA7A 3BR3A 3QPLA 2FRHA 3NRGA 5FO5A 1OISA 2O9LA 4BE2A 2H6BA 1UCRA 2NS0A 2K7LA 3JAMZ 2KRHA 1KU2A 1R6RA 4GYIA 3CCEI 4XN3A 3FDYA 2AO9A 2X6XA 5K5QA 4IXAA 1EH6A 3L09A 4FASD 2VQLA 1FEXA 2K9LA 2M5WA 2C6YA 2DMNA 4BDYA 2VJIA 4DVYP 4V19K 2JRTA 4L9NA 2KL4A 5J1RA 4FX0A 2W85A 1VQ6I 1W36C 4C30A 3PASA 3OYMA 2DFEA 1BI3A 3NWTA 2M3AA 2BBYA 4BUPA 2XAFA 3KP6A 3LAPA 4E7LA 2P7VB 1HLVA 3KZ9A 3RIRA 1KYWA 2ELKA 5DUKA 5J8CA 3HTHA 1LKXA 3FXQA 1X3WB 2ZFUA 1XDSA 2A5WA 3HB9A 1R1TA 1WI9A 5HNFA 4IHVA 3NRVA 3L2RA 4O3MA 4AYBA 3RTRA 3W6KB 2IEKA 3A4CA 3HTUA 3Q0UA 3C2GA 5F1RA 2ZJPF 3CWRA 4U0WA 1W5CC 2BYVE 4UNOA 3RPUD 4A3LJ 2M8GX 1BC7C 4E7SA 3B02A 4I2OA 2CQNA 5D6EA 2ZMEB 2JQ7A 1D0ZA 2HOEA 2LF7A 2W00A 4ZZLA 2VODA 2R7TA 3U1KA 3VTIA 2CGPA 5M5WJ 1DP7P 4BU2A 2Z9OA 4KMFA 2OC6A 2HQAA 2E1NA 2GBYA 3FKJA 3OMYA 2B0LA 2RNJA 3LAJA 1ZRCA 3PPBA 4V2FA 1IXRC 2QSFX 2VE8A 1NTCA 3H0DA 1ITYA 3EYYA 3M8FA 2E1MC 4PJ0C 1T98A 2P5KA 5CVUA 3SZPA 4B3XA 3I0TA 3A01A 3GYHX 3LA3A 5F64A 1Y0NA 2XSDC 4BE1A 3JRDA 4HNTA 1ZAOA 2DOFA 3F8BA 2E2HJ 4IPAA 4C2MA 3MFKA 3I5UA 1TLHB 4DYQA 2X6YA 2R7OA 1WJEA 2M45A 4OIOF 3K4LA 1IZ1A 3LWJA 1A36A 3LSRA 5GPCA 1VI0A 2HS5A 4PUSA 2DFFA 1YYVA 3MWMA 5KHDA 3GF2A 3J80K 4RS8A 4AM3A 2DN0A 3ASNH 1HKTA 4M6XA 1R4MB 4U9NA 4FHTA 1G4DA 2P6SA 4B43A 5J3LA 3VP5A 1OCPA 4RAYA 4P1WA 4ZYEA 3J80Z 2DU9A 3BR2A 2OZUA 2ZJ2A 4HF0A 1H88C 2IU5A 1Z67A 5D5XB 1XCBA 2BVLA 3IWFA 4Z2YA 1ETXA 3GTQJ 3NARA 4M3BA 3GBGA 4YRVA 1QU3A 2DI3A 3BG7A 5K5RA 2XKOA 1MNMC 1B1BA 2E60A 2MW8A 1TWAJ 3F72A 2ME0A 4IEJA 2HZDA 3FXRA 2XB5A 1I27A 5E18F 4EJUA 2D6YA 2VL8A 3DPTA 4RGUA 4A6EA 3NI7A 5LGTA 3ABKH 4FT8A 2R5ZA 3GLLA 1B8IA 1MJBA 2EA2A 2IAIA 3H5RA 4DBRA 4M3DA 1BI2A 5L3BA 1HKSA 3DU6A 1A04A 1FP1D 1GXQA 2QWWA 2UXXA 3TOBA 2HKXA 3U9GA 3IRRA 2W24A 3FF5A 3QU6A 2VPRA 2WAQA 3QKXA 2LSOA 5FFXA 3K1NA 5FROA 3HOYJ 3GUDA 1LEBA 2OTLI 2HOAA 2A5YB 1B9MA 2OCCH 2ISZA 2LTPA 1SFOJ 4BE0A 3KYCB 3HTJA 1Z7LA 1YW9A 2HVSA 2AHQA 2K9QA 2EFOA 2UUZA 3O6BB 2H27A 4L0ZB 4IRVA 2O8KA 2EZIA 2REKA 1ZR2A 1V4RA 3GXOA 3HIMA 1A6QA 5CJ9A 2DFHA 2GA2A 4J00A 1GDTA 1HA8A 3OYGA 1FBUA 2X85A 2YSRA 3R61A 3CTAA 2A6TA 2DJNA 2PMUA 3SHFA 4L5JA 4B47A 2O61A 4N4NB 3COLA 3F8NA 2WWYA 1HSJA 1SD4A 3HYIA 1F36A 2PMZN 2AXTC 2CUZA 3ZR8X 4EM0B 1T8IA 1U3EM 1QBJA 3A0BC 3AG3H 2CUEA 1MIJA 4AIDA 4N4OB 4BS9A 1X1BA 3CF2A 3BTLA 1UMQA 2JA2A 1U0JA 3TDZC 1J7KA 3HRMA 1G6NA 2MYSA 3EUHC 4BXFA 1F5TA 3WG7H 2PFVA 1YOVB 1RC9A 5HS7A 5J4YA 5CVIA 5GAHJ 3CDIA 1MKMA 2KZGA 4IVNA 4NB5A 1JE8A 3HXLA 2DFIA 2NNYA 4DBQA 3R0AA 1GV2A 2UZKA 4XQFA 4FE7A 4BXUA 1OR7C 4LITA 1RPWA 2KIQA 4B09A 3F3XA 2Y30A 2OI8A 2XF7A 2VBYA 3F21A 1H9GA 3CLQA 5CYVA 4ZDOA 3ON2A 3GEUA 2VE9A 1SVMA 2RQQA 4WCGA 2JWTA 4UB8C 3EETA 5HDKA 4EGZA 1MBHA 4NC7A 3BTIA 1W7PD 4UB6C 4QIWN 1D5YA 4JX4A 2R5YB 2EK5A 3BZCA 4KYWA 4L9JA 3ESWB 1FC3A 1UG0A 4XNFA 2HVRA 4PJJA 2R92J 3ML6A 5DS9A 5DTDA 3NNRA 2M0CA 1KYZA 2GUHA 2O5RA 2M7AA 4BNCA 5HLTA 3HGYA 3HRUA 3L2QA 3BCAA 5JLWA 1TWHJ 4UUVA 3NPIA 4CZZA 1TQPA 2JMWA 5E79C 1TWFJ 3CUQB 2WGBA 1G2HA 2NP3A 4HYEA 2LBFB 2MLKA 1Q1VA 4ZYDA 3RZOJ 5C4XJ 3OV8A 2XAGA 1IAWA 3ZMDA 5E17F 1Y0UA 3TP3A 4RGRA 2XGXA 4DOZA 5E3MA 4MHGA 5IT9K 1JJ8C 4CZCA 2JSCA 4A0YA 2P4WA 4MQVA 5ICGA 2J5PA 4BBRJ 5J8FA 1FPQA 4NDLA 3TW7A 2JVHA 2HU9A 2M9HA 3BCBA 4L9VA 2XGDA 3PQKA 5EGOA 1MMNA 5CXIA 3E6DA 1GVDA 4LG0A 4XRSA 3G56A 1YQAA 3FISA 3IWZA 5FKLA 1Y8RB 2E1OA 3HOXJ 1QHHD 3GZ5A 2E2IJ 2ZSHB 3BTCA 3R4KA 4UHTA 5DM6F 3KPHA 3VEPA 2E36A 1TQIA 2JZYA 2KP6A 5JI6A 1IC8A 3ZOBA 2DODA 4B48A 2KPMA 3JRGA 2GLOA 4DZPA 3G1LA 1U8BA 1V55H 3AG2H 1UHSA 2GXGA 4RLQA 4CICA 3EQLF 3S3NA 4IJAA 3LSHA 1YJ9I 4P55A 2HI3A 3KZZA 4RAFA 3DEWA 2ME6A 3TQNA 4ENJA 1QRYA 2DLLA 2V57A 1U5TC 2VT2A 5JFRA 1HOMA 3KNWA 2EFPA 1I5ZA 3DTEA 4BJ5C 2OCEA 2QYOA 3HOTA 3DCFA 1Z7UA 1NK2P 2YUSA 3T8TA 5J40A 2DT7B 3VYUB 3H3ZA 1D3YA 4E70A 4HLYA 1YFHA 2BHZA 1ONVA 5E8IA 2GM4A 1YW7A 1Z21A 4CUGA 2FMYA 4JNNA 1MH4A 1E0EA 4RB0A 3CJNA 4LLLA 5GADJ 2WA0A 5LGNA 2OU2A 2QKOA 2F5CA 4AIKA 5D8KB 2GOXB 3M3YJ 2JTVA 5ILUA 6PAXA 3ECOA 4MGRA 4G6QA 1GXPA 4MFEA 3C07A 5HAWA 2QOPA 3OS1A 1G59A 2RGVA 4C2UA 1XGSA 3H9GA 4ASNA 1R36A 1RKWA 4A3CJ 4KT5C 5JHUA 2BY2A 4OWRB 3DWLE 5KCMA 3ZMVA 2ZKZA 2V26A 1ZYRF 5D6FA 4JKZA 1VQ5I 3BJAA 1K6OA 2MA3A 2XRLA 3LSPA 2V6EA 4F91B 1FWZA 1JKRC 1OYIA 5F04A 4GFBA 3K1MA 3DQVC 2V9KA 2IPQX 5EZGA 2XROA 3HOSA 5J47A 2OTJI 4H4KC 1HDDC 3Q3SA 4PGHA 3F6VA 3W2VA 1MMAA 2HGCA 4QLCU 3ECHA 3QPSA 2VASA 1O3RA 3EUKL 4LD5A 3MQ0A 1O7FA 4A69C 5CXGA 3HHHA 5D5UB 1X58A 3B6AA 2NP5A 2M4KA 2DMPA 2CFXA 1XC5A 1JHHA 2ESHA 1PJRA 3JRCA 5D4RA 2OBPA 1SD5A 2ZNYA 4XLEA 1NHAA 3TGNA 2VIXA 3OYCA 1MZBA 3W6VA 1LE8B 1W0UA 2QKMB 4CHUA 1X4OA 5AONA 2DT5A 1RI7A 1G3YA 3OIOA 4UV9A 5B66C 2ZY9A 4UV8A 4NBQA 2YU3A 4LIUA 1VQ8I 2M2EA 4RAZA 3M07A 1MGTA 5IP6A 2LKSA 2Z99A 1KZHA 2AQFA 1Z77A 3R60A 5HDNA 2QUFA 2CV0A 3ZMTA 1MBJA 4BAYA 2FBQA 2DK8A 3K70D 1HCRA 3ZGKA 3RJPA 2LD5A 2JPBA 2FJ1A 3AQSA 1K61A 4ZZDA 3C2BA 4MFDA 1HKQA 1X1PA 4PCQA 3DPJA 2XPUA 1R5ID 3DP7A 1OCRH 2RKHA 3I59B 1FTTA 4HSRA 2GXBA 2ADUA 1T0FA 3H0GJ 2CV1A 1ZGAA 3V7CA 4ZYGA 2GAUA 1XSXA 2DMTA 4FETA 4BJTA 5LHIA 3WGIA 1HBXG 5C4JJ 4WK8F 1RNLA 1IDZA 2DG8A 2N8GA 4I0BA 1IN6A 3OYNA 5D5VB 1LFUP 4UUSA 2KIUA 2XF6A 3FXUA 1P9QC 5KNLA 2P5LC 3EUHA 2GFNA 5F27A 2X6OA 5DYMA 3IUVA 4A3FJ 1B9NA 1BR1A 3BDDA 3VWBA 1JUMA 5FRNA 2MD5A 4A3GJ 4DZJA 4UDSA 3MEXA 3OYHA 1ZRDA 2VOOA 3G7RA 4A3IJ 4XLCA 4OU0A 2QQAA 5FGMA 1KGSA 5KK1A 2JPCA 1WFXA 4IHWA 4PJMA 3CC7I 3VW2A 4JX5A 2GA1A 3I4NJ 3PIOF 1OR7A 3QQAA 1ERDA 1ETOA 1JT6A 2STTA 1EKEA 1VQMI 1DDNA 1ETQA 2ZXJA 3RPQA 1BOBA 2OD5A 3JRFA 3K4KA 3S8PA 4IF4A 4E7KA 4WX9A 2FF4A 2HXIA 2M7BA 1SFXA 4V2GA 5E3LA 1JGGA 2OV7A 3QBMA 1WJAA 4BEHA 2H8RA 2QQ8A 2LKPA 1J75A 1SMYF 3C2HA 2FQ3A 3CP8A 1MH3A 1Z6TA 1E3OC 3N05A 2W82A 2L01A 1UG2A 4ZYHA 5LFAA 2NX4A 4GYGA 2CH0A 1QVTA 5H2FC 1JXSA 4PJNA 3MKLA 5E1ZB 2XASA 4Q47A 2ZXIA 1K79A 5H20A 3BP8A 3FXLA 1GVJA 1K78A 1JKPC 5K1YA 2V1NA 1EJ9A 4BH9A 2L9SA 3CJQB 4B3AA 4GCKA 2X1DA 4XSXF 1EH7A 2JUGA 5JVTA 4CA0A 4Y33A 3GVAA 4AIJA 3G2BA 1WI3A 2OPTA 1T56A 1G3SA 2DYSH 1UI5A 1IW7F 2EQRA 2FX0A 3O2PE 4GFLA 3VODA 3KKDA 2CSOA 5BOXA 2BE5F 2F4OB 5DV5A 4E7HA 3SEZA 3DEUA 1RR7A 2UWMA 1UHWA 3D1NI 3J81K 1G3WA 2G7HA 2E35A 3KP5A 2LY2A 3CUOA 4A3DJ 3J81Z 1W7PA 4II3A 1J9IA 2CS3A 2ECCA 3RYRA 2PEXA 3M1EA 1WVRA 3KEQA 3I3LA 3KZIC 1DU0A 1S29A 2L54A 3FWEA 2BW3B 4G6TB 4W1UA 4S0HB 1A5JA 3ROUA 1OFCX 1F4KA 4A3MJ 2QBYA 4IQJA 3I4MJ 2W48A 3ZCOA 3LSJA 3KYLA 3FXMA 1SAXA 3ABMH 3Q0WA 2EPFA 1EH8A 1U5TA 3SZGA 1BI0A 5D4SA 2OQGA 1X1DA 3CZ6A 2GXAA 2HOSA 3SQNA 3JTGA 4B44A 3DEEA 2FNPA 2QF7A 4Y15A 2MSYA 1Y39A 2Y0MA 1VNDA 2E71A 2OQRA 4U87A 2KMUA 4ESBA 1QZZA 5EFYA 4MLOA 5FKKA 4NQWB 3IAS2 2RHAA 1Z9CA 2BGCA 3RKWA 5D18A 1UB9A 1SANA 1IG7A 2ZCNA 3LSTA 4RB2C 3OR2C 1FX7A 3P5JA 5KVRA 2ZJRF 2IBDA 1XMXA 4AVPA 4F55A 1QPIA 1Z1DA 1BC8C 2R5ZB 3RDIA 3KLNA 3E7LA 1P4AA 1B8IB 5IYCJ 4QWQA 3I4PA 2G3BA
chains in the Genus database with same CATH topology
1H8AC 2KT0A 3BQZA 3E7QA 5F1JA 3JRAA 2VPRA 3QKXA 1JUPA 3BNIA 3TW6A 3HOYJ 4D7NA 3UKGA 2JA5J 1AU7A 4QTRA 3F0CA 5IYBJ 3G1MA 2HOAA 3O8HA 3ZQGA 3S1RJ 1ZTRA 5FKMA 1JTYA 1R9TJ 1TWCJ 2JK3A 2LTPA 1GV5A 1SFOJ 1ZR4A 3HTJA 5C44J 3VVYA 2YS9A 2AHQA 3GTLJ 1ETKA 1WCMJ 2K9QA 4AC0A 3RH2A 3F1BA 2O8KA 3RD3A 2EZIA 1I3QJ 2NOGA 2REKA 5FMPA 1ZR2A 4HKUA 3HIMA 2COBA 3CCYA 2ID3A 1FIAA 5F0HA 3LSGA 1GDTA 4IHXA 3HBLA 5HODA 3OOUA 2UXPA 4NELA 2G7SA 2DJNA 1CQTA 1JTXA 5IOZA 3COLA 3ZQFA 5IPAA 5HSZA 1F36A 2PMZN 3S1MJ 4M3GA 2EZLA 4AUXA 2TRTA 4XIDA 2CUEA 9ANTA 4X1EA 3IH3A 5C3EJ 4GCTA 3BTLA 1UMQA 2K9NA 4FCYA 4EEFG 3VW1A 1ENHA 2W53A 1Y1WJ 2L7ZA 1DU6A 3VOXA 2CRGA 2HYJA 2JA6J 2NVQJ 4I76A 2VI6A 5C4YA 3G1OA 2FD5A 1GV2A 2LY9A 2TCTA 4FE7A 5E3NA 3HTIA 1WPKA 2Y31A 2DG7A 1RPWA 4XICA 3GTGJ 3GZIA 3CQZJ 5F0CA 2Y30A 2OI8A 3CDLA 3A01B 2LR8A 3ON2A 4D5FA 3GEUA 2JWTA 3BR1A 2O7OA 3IH2A 1MBHA 2XGCA 3BTIA 2QTQA 1ZGWA 4QIWN 1D5YA 4JX4A 2R5YB 4RBOA 4NN1A 1MSFC 1U78A 1HF0A 3HKZN 2JA8J 1ETYA 2H1KA 2R92J 3BCGA 5DS9A 4G12A 5DTDA 3NNRA 5FHPA 1WGXA 2M0CA 4PXIA 2GUHA 3TP0A 4UUTA 1VFCA 3RQIA 3HGYA 1ZKGA 2CJJA 3WHBA 2LVSA 1LE8A 1IRZA 4MXMA 5JLWA 1TWHJ 1BL0A 1RESA 2QCOA 4QSHA 4A93J 3NPIA 2JMWA 2JN6A 4C3IJ 1TWFJ 1GT0C 3GTKJ 1G2HA 2NP3A 2WGBA 5AQCA 2LK2A 2ECBA 1Q1VA 3RZOJ 1APLC 4XRMA 4IHYA 5C4XJ 3JRIA 3BR0A 4MIMA 3TP3A 4MK6A 2LFBA 5M5YJ 2EBIA 1LFBA 2LKXA 1EF4A 2WAQN 5E3MA 4J19A 3HDDA 2FQ4A 4M3EA 4C3HJ 1JJ8C 3EGQA 3MNLA 3HOVJ 2LLKA 4BBRJ 4JP0A 4ABZA 3VOKA 4NDLA 3PM1A 3TW7A 2M9HA 3NAUA 2XGDA 2Y0SN 2NVYJ 5EGOA 1Y1VJ 5CXIA 1GVDA 4XRSA 3G56A 4AC6A 1MSEC 3FISA 3S16J 5FKLA 4C2MJ 2E1OA 3HOXJ 2DMQA 2E2IJ 2NVXJ 3LNQA 3VIBA 2ZCMA 2R93J 3HOUJ 3ANGA 3BTCA 4DW6A 1UI6A 3GTJJ 1IC8A 3ZOBA 1MBKA 3ZQCA 1FIPA 2JJ7A 3JRGA 2GLOA 4DZPA 3G1LA 3MN2A 3SFIA 1U8BA 5D19A 1QVUA 4BY7J 2KDZA 1GUUA 4BKXA 1JKQC 1IJWC 2G7LA 4AYBN 4MO7A 1UHSA 3PO2J 2UXOA 3GTPJ 3CRJA 4DYRA 2F07A 5GP9A 5DAJA 2HI3A 4A3BJ 3FK7A 3DEWA 2ME6A 1QRYA 2E2JJ 2YVEA 2V57A 3OSGA 3HM5A 5F08A 3KNWA 1HOMA 3VW0A 2L7FP 3A02A 5IOYA 2EZHA 2X9DA 2ZOYA 4B4CA 3LOCA 2HOTA 2DA1A 3DCFA 1NK2P 3HOWJ 2YUSA 1IGNA 2XGEA 5FLMJ 1WH5A 2HXOA 2L7MP 3K2AA 2DTZA 4A3JJ 2XPWA 2DA5A 3BR6A 2GM4A 1IDYA 2DA4A 1PUFA 3VVXA 1AKHA 4JNNA 1MH4A 3ZQHA 2P81A 1XS9A 2QKOA 1A6IA 1ORKA 1PUFB 3NXCA 1AKHB 5M3MJ 2CUFA 1O4XA 3M3YJ 2GENA 3V78A 2HQ5A 2D5VA 4MFEA 3C07A 5HAWA 1YRNA 2QOPA 4JL3A 2L0KA 4FISA 1JT0A 3SDGA 4A3EJ 3KKCA 4L62A 3MVPA 1JUSA 1YRNB 4YZEA 3H3VK 3VVZA 2R0QC 2VKEA 1RKWA 4A3CJ 2O7TA 2ZB9A 1IUFA 2QIBA 5EYRA 2ZOZA 3BG3A 1X2NA 4JKZA 5J1UA 2EH3A 2XRLA 3LSPA 3IV5A 1JKRC 4M6VA 5F04A 3ZQIA 4GFBA 2JA7J 2NVTJ 1TC3C 3S1NJ 4LOCA 1F43A 5EZGA 2XDNA 5FKNA 1U9OA 4W97A 1FTZA 4DYCA 2Y9ZA 1HDDC 3Q3SA 2M34A 3QPSA 2NS7A 1MBFA 2PBXA 3BG5A 2XPVA 2MGQA 3BTJA 1OJLA 4A69C 5CXGA 1X58A 3B6AA 2NP5A 2DA3A 2DMPA 2HYTA 3BJBA 1XC5A 3JRCA 3M4OJ 1JKOC 3GTOJ 2OERA 1H89C 3RKQA 2HKUA 3L1PA 1JJ6C 3W6VA 2VUMJ 1LE8B 1W0UA 1WH7A 5IP7J 2UXIA 3B6CA 3OIOA 3RZDJ 2B63J 1B72A 2MG4A 5EDNA 5K58A 2M2EA 2DA7A 2QWTA 2WUIA 3BT9A 2YU9J 5IP6A 3S14J 5FLVA 4Y52J 1B72B 5IYDJ 1Z77A 3K7AJ 3JSJA 4ACIA 2G0EA 2YVHA 1MBJA 3FRQA 4ICHA 4FTHA 2FBQA 1HCRA 4GFKA 3B81A 3A03A 2E19A 4JX6A 2LD5A 4D5CA 2FJ1A 3AQSA 1ETVA 1K61A 3C2BA 4MFDA 2Y9YA 3CMYA 3CJDA 3DPJA 3PO3J 2XPUA 3S17J 2UXUA 3EUPA 5EGOB 1OCTC 3S2DJ 1VF9A 5M3FJ 1FTTA 3H0GJ 3JRBA 5GPAA 5EG0A 3ANPA 3JR9A 2DA2A 3SJMA 2DMTA 2R7ZJ 3BQYA 5M5XJ 5F0FA 5C4JJ 2CU7A 4C3JJ 1XG1A 1IDZA 3V6GA 5EG0B 2DG8A 2N8GA 1MBEA 2Q24A 1S7EA 1LFUP 4UUSA 1RKTA 1P7JA 4BY1J 2K9SA 2DMUA 3LJLA 2GFNA 5F27A 2X6OA 1T33A 5IP9J 4UUSB 4A3FJ 3IUVA 5FGLA 4AF5A 3FKIJ 1JUMA 4RDUA 4A3GJ 3BR5A 1FJLA 5K7ZA 4DZJA 2WV1A 4JYKA 4UDSA 3IH4A 3BR3A 3O8GA 3QPLA 3NRGA 5J1YA 3G7RA 4CGRA 4A3IJ 1W0TA 2O9LA 3VUQA 4IHWA 4B1RA 1ZK8A 3VW2A 4JX5A 5BNGA 3I4NJ 2AO9A 3QQAA 1ETOA 1JT6A 2DA6A 2K40A 3FIWA 4Y7NJ 1U9NA 1FEXA 1ETQA 2DMNA 5EEAA 2HDDA 4M3FA 3JRFA 3ZQLA 4ME9A 4XK4A 5J1RA 3HEFA 3Q0VA 3PASA 4A3KJ 2HXIA 4V2GA 5E3LA 1JGGA 1HLVA 1BW5A 3QBMA 3WHCA 2UXHA 3KZ9A 2CQXA 2H8RA 3HTHA 2ELKA 3HTAA 1RETA 1ETWA 2LP0A 3HB9A 2G7GA 4IHVA 1MH3A 3S5RA 1X2MA 4BBSJ 1E3OC 1IV6A 2IEKA 1UG2A 5HBUA 3Q0UA 2NX4A 2XB0X 3CWRA 1QVTA 2RASA 1Z0XA 3MKLA 2WB1N 1BA5A 4KWAA 5K7FA 4FE4A 4A3LJ 3LHQA 1JKPC 1K83J 4XRSG 4X6AJ 2M8GX 3TEDA 4B3AA 5E3OA 5D1RA 4GCKA 3BHQA 1AHDP 5M5WJ 1WI3A 2PZ9A 2GBYA 3PPBA 1POGA 2OPTA 1T56A 4V2FA 5FJ8J 4D7MA 1UI5A 1NTCA 1HDPA 1ITYA 2EQRA 2FX0A 4GFLA 3JREA 3HOZJ 3A01A 3BRUA 1BW6A 1NK3P 3KKDA 2ID6A 1TWGJ 3JRHA 1RR7A 2XSDC 3D1NI 3JRDA 2R5YA 2CQQA 3P9TA 2E2HJ 3HGGA 3OSFA 4A3DJ 4DYQA 5FKOA 3VPRA 2I10A 1MBGA 2ECCA 3AQTA 3LWJA 3LSRA 5GPCA 1VI0A 3GTMJ 2VKVA 3HE0A 1ZQ3P 1DU0A 4S0HB 4W1UA 1A5JA 1OFCX 4HNVA 4A3MJ 2DN0A 3I4MJ 2W48A 2NS8A 3LSJA 3O60A 3Q0WA 3VP5A 2L9RA 5J3LA 1OCPA 1I6HJ 4GCLA 2Y2ZA 3BR2A 1H88C 2IU5A 1SGMA 2HOSA 1ETXA 3GTQJ 1BJZA 1P7IA 2QF7A 3NARA 5JLXA 4M3BA 4CYCA 3GBGA 3ON4A 2MSYA 1VNDA 1I50J 2ZCXA 3BG9A 1MNMC 5EFYA 2MW8A 1TWAJ 4MLOA 5FKKA 2ME0A 4CYCB 2OF7A 4IEJA 2RHAA 2EZKA 5D18A 2XB5A 3S15J 1IG7A 1SANA 2D6YA 2ZCNA 3NI7A 3S1QJ 2R5ZA 4L5EA 5H9TA 2IBDA 3FK6A 2RAEA 1B8IA 3T6NA 2IAIA 1QPIA 5CW8A 4BXXJ 3S2HJ 4M3DA 2R5ZB 2X48A 1B8IB 3E7LA 5EZHA 4I6ZA 5IYCJ 5EF6A 5K7HA 2G3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8A C;  2KT0 A;  3BQZ A;  3E7Q A;  5F1J A;  3JRA A;  2VPR A;  3QKX A;  1JUP A;  3BNI A;  3TW6 A;  3HOY J;  4D7N A;  3UKG A;  2JA5 J;  1AU7 A;  4QTR A;  3F0C A;  5IYB J;  3G1M A;  2HOA A;  3O8H A;  3ZQG A;  3S1R J;  1ZTR A;  5FKM A;  1JTY A;  1R9T J;  1TWC J;  2JK3 A;  2LTP A;  1GV5 A;  1SFO J;  1ZR4 A;  3HTJ A;  5C44 J;  3VVY A;  2YS9 A;  2AHQ A;  3GTL J;  1ETK A;  1WCM J;  2K9Q A;  4AC0 A;  3RH2 A;  3F1B A;  2O8K A;  3RD3 A;  2EZI A;  1I3Q J;  2NOG A;  2REK A;  5FMP A;  1ZR2 A;  4HKU A;  3HIM A;  2COB A;  3CCY A;  2ID3 A;  1FIA A;  5F0H A;  3LSG A;  1GDT A;  4IHX A;  3HBL A;  5HOD A;  3OOU A;  2UXP A;  4NEL A;  2G7S A;  2DJN A;  1CQT A;  1JTX A;  5IOZ A;  3COL A;  3ZQF A;  5IPA A;  5HSZ A;  1F36 A;  2PMZ N;  3S1M J;  4M3G A;  2EZL A;  4AUX A;  2TRT A;  4XID A;  2CUE A;  9ANT A;  4X1E A;  3IH3 A;  5C3E J;  4GCT A;  3BTL A;  1UMQ A;  2K9N A;  4FCY A;  4EEF G;  3VW1 A;  1ENH A;  2W53 A;  1Y1W J;  2L7Z A;  1DU6 A;  3VOX A;  2CRG A;  2HYJ A;  2JA6 J;  2NVQ J;  4I76 A;  2VI6 A;  5C4Y A;  3G1O A;  2FD5 A;  1GV2 A;  2LY9 A;  2TCT A;  4FE7 A;  5E3N A;  3HTI A;  1WPK A;  2Y31 A;  2DG7 A;  1RPW A;  4XIC A;  3GTG J;  3GZI A;  3CQZ J;  5F0C A;  2Y30 A;  2OI8 A;  3CDL A;  3A01 B;  2LR8 A;  3ON2 A;  4D5F A;  3GEU A;  2JWT A;  3BR1 A;  2O7O A;  3IH2 A;  1MBH A;  2XGC A;  3BTI A;  2QTQ A;  1ZGW A;  4QIW N;  1D5Y A;  4JX4 A;  2R5Y B;  4RBO A;  4NN1 A;  1MSF C;  1U78 A;  1HF0 A;  3HKZ N;  2JA8 J;  1ETY A;  2H1K A;  2R92 J;  3BCG A;  5DS9 A;  4G12 A;  5DTD A;  3NNR A;  5FHP A;  1WGX A;  2M0C A;  4PXI A;  2GUH A;  3TP0 A;  4UUT A;  1VFC A;  3RQI A;  3HGY A;  1ZKG A;  2CJJ A;  3WHB A;  2LVS A;  1LE8 A;  1IRZ A;  4MXM A;  5JLW A;  1TWH J;  1BL0 A;  1RES A;  2QCO A;  4QSH A;  4A93 J;  3NPI A;  2JMW A;  2JN6 A;  4C3I J;  1TWF J;  1GT0 C;  3GTK J;  1G2H A;  2NP3 A;  2WGB A;  5AQC A;  2LK2 A;  2ECB A;  1Q1V A;  3RZO J;  1APL C;  4XRM A;  4IHY A;  5C4X J;  3JRI A;  3BR0 A;  4MIM A;  3TP3 A;  4MK6 A;  2LFB A;  5M5Y J;  2EBI A;  1LFB A;  2LKX A;  1EF4 A;  2WAQ N;  5E3M A;  4J19 A;  3HDD A;  2FQ4 A;  4M3E A;  4C3H J;  1JJ8 C;  3EGQ A;  3MNL A;  3HOV J;  2LLK A;  4BBR J;  4JP0 A;  4ABZ A;  3VOK A;  4NDL A;  3PM1 A;  3TW7 A;  2M9H A;  3NAU A;  2XGD A;  2Y0S N;  2NVY J;  5EGO A;  1Y1V J;  5CXI A;  1GVD A;  4XRS A;  3G56 A;  4AC6 A;  1MSE C;  3FIS A;  3S16 J;  5FKL A;  4C2M J;  2E1O A;  3HOX J;  2DMQ A;  2E2I J;  2NVX J;  3LNQ A;  3VIB A;  2ZCM A;  2R93 J;  3HOU J;  3ANG A;  3BTC A;  4DW6 A;  1UI6 A;  3GTJ J;  1IC8 A;  3ZOB A;  1MBK A;  3ZQC A;  1FIP A;  2JJ7 A;  3JRG A;  2GLO A;  4DZP A;  3G1L A;  3MN2 A;  3SFI A;  1U8B A;  5D19 A;  1QVU A;  4BY7 J;  2KDZ A;  1GUU A;  4BKX A;  1JKQ C;  1IJW C;  2G7L A;  4AYB N;  4MO7 A;  1UHS A;  3PO2 J;  2UXO A;  3GTP J;  3CRJ A;  4DYR A;  2F07 A;  5GP9 A;  5DAJ A;  2HI3 A;  4A3B J;  3FK7 A;  3DEW A;  2ME6 A;  1QRY A;  2E2J J;  2YVE A;  2V57 A;  3OSG A;  3HM5 A;  5F08 A;  3KNW A;  1HOM A;  3VW0 A;  2L7F P;  3A02 A;  5IOY A;  2EZH A;  2X9D A;  2ZOY A;  4B4C A;  3LOC A;  2HOT A;  2DA1 A;  3DCF A;  1NK2 P;  3HOW J;  2YUS A;  1IGN A;  2XGE A;  5FLM J;  1WH5 A;  2HXO A;  2L7M P;  3K2A A;  2DTZ A;  4A3J J;  2XPW A;  2DA5 A;  3BR6 A;  2GM4 A;  1IDY A;  2DA4 A;  1PUF A;  3VVX A;  1AKH A;  4JNN A;  1MH4 A;  3ZQH A;  2P81 A;  1XS9 A;  2QKO A;  1A6I A;  1ORK A;  1PUF B;  3NXC A;  1AKH B;  5M3M J;  2CUF A;  1O4X A;  3M3Y J;  2GEN A;  3V78 A;  2HQ5 A;  2D5V A;  4MFE A;  3C07 A;  5HAW A;  1YRN A;  2QOP A;  4JL3 A;  2L0K A;  4FIS A;  1JT0 A;  3SDG A;  4A3E J;  3KKC A;  4L62 A;  3MVP A;  1JUS A;  1YRN B;  4YZE A;  3H3V K;  3VVZ A;  2R0Q C;  2VKE A;  1RKW A;  4A3C J;  2O7T A;  2ZB9 A;  1IUF A;  2QIB A;  5EYR A;  2ZOZ A;  3BG3 A;  1X2N A;  4JKZ A;  5J1U A;  2EH3 A;  2XRL A;  3LSP A;  3IV5 A;  1JKR C;  4M6V A;  5F04 A;  3ZQI A;  4GFB A;  2JA7 J;  2NVT J;  1TC3 C;  3S1N J;  4LOC A;  1F43 A;  5EZG A;  2XDN A;  5FKN A;  1U9O A;  4W97 A;  1FTZ A;  4DYC A;  2Y9Z A;  1HDD C;  3Q3S A;  2M34 A;  3QPS A;  2NS7 A;  1MBF A;  2PBX A;  3BG5 A;  2XPV A;  2MGQ A;  3BTJ A;  1OJL A;  4A69 C;  5CXG A;  1X58 A;  3B6A A;  2NP5 A;  2DA3 A;  2DMP A;  2HYT A;  3BJB A;  1XC5 A;  3JRC A;  3M4O J;  1JKO C;  3GTO J;  2OER A;  1H89 C;  3RKQ A;  2HKU A;  3L1P A;  1JJ6 C;  3W6V A;  2VUM J;  1LE8 B;  1W0U A;  1WH7 A;  5IP7 J;  2UXI A;  3B6C A;  3OIO A;  3RZD J;  2B63 J;  1B72 A;  2MG4 A;  5EDN A;  5K58 A;  2M2E A;  2DA7 A;  2QWT A;  2WUI A;  3BT9 A;  2YU9 J;  5IP6 A;  3S14 J;  5FLV A;  4Y52 J;  1B72 B;  5IYD J;  1Z77 A;  3K7A J;  3JSJ A;  4ACI A;  2G0E A;  2YVH A;  1MBJ A;  3FRQ A;  4ICH A;  4FTH A;  2FBQ A;  1HCR A;  4GFK A;  3B81 A;  3A03 A;  2E19 A;  4JX6 A;  2LD5 A;  4D5C A;  2FJ1 A;  3AQS A;  1ETV A;  1K61 A;  3C2B A;  4MFD A;  2Y9Y A;  3CMY A;  3CJD A;  3DPJ A;  3PO3 J;  2XPU A;  3S17 J;  2UXU A;  3EUP A;  5EGO B;  1OCT C;  3S2D J;  1VF9 A;  5M3F J;  1FTT A;  3H0G J;  3JRB A;  5GPA A;  5EG0 A;  3ANP A;  3JR9 A;  2DA2 A;  3SJM A;  2DMT A;  2R7Z J;  3BQY A;  5M5X J;  5F0F A;  5C4J J;  2CU7 A;  4C3J J;  1XG1 A;  1IDZ A;  3V6G A;  5EG0 B;  2DG8 A;  2N8G A;  1MBE A;  2Q24 A;  1S7E A;  1LFU P;  4UUS A;  1RKT A;  1P7J A;  4BY1 J;  2K9S A;  2DMU A;  3LJL A;  2GFN A;  5F27 A;  2X6O A;  1T33 A;  5IP9 J;  4UUS B;  4A3F J;  3IUV A;  5FGL A;  4AF5 A;  3FKI J;  1JUM A;  4RDU A;  4A3G J;  3BR5 A;  1FJL A;  5K7Z A;  4DZJ A;  2WV1 A;  4JYK A;  4UDS A;  3IH4 A;  3BR3 A;  3O8G A;  3QPL A;  3NRG A;  5J1Y A;  3G7R A;  4CGR A;  4A3I J;  1W0T A;  2O9L A;  3VUQ A;  4IHW A;  4B1R A;  1ZK8 A;  3VW2 A;  4JX5 A;  5BNG A;  3I4N J;  2AO9 A;  3QQA A;  1ETO A;  1JT6 A;  2DA6 A;  2K40 A;  3FIW A;  4Y7N J;  1U9N A;  1FEX A;  1ETQ A;  2DMN A;  5EEA A;  2HDD A;  4M3F A;  3JRF A;  3ZQL A;  4ME9 A;  4XK4 A;  5J1R A;  3HEF A;  3Q0V A;  3PAS A;  4A3K J;  2HXI A;  4V2G A;  5E3L A;  1JGG A;  1HLV A;  1BW5 A;  3QBM A;  3WHC A;  2UXH A;  3KZ9 A;  2CQX A;  2H8R A;  3HTH A;  2ELK A;  3HTA A;  1RET A;  1ETW A;  2LP0 A;  3HB9 A;  2G7G A;  4IHV A;  1MH3 A;  3S5R A;  1X2M A;  4BBS J;  1E3O C;  1IV6 A;  2IEK A;  1UG2 A;  5HBU A;  3Q0U A;  2NX4 A;  2XB0 X;  3CWR A;  1QVT A;  2RAS A;  1Z0X A;  3MKL A;  2WB1 N;  1BA5 A;  4KWA A;  5K7F A;  4FE4 A;  4A3L J;  3LHQ A;  1JKP C;  1K83 J;  4XRS G;  4X6A J;  2M8G X;  3TED A;  4B3A A;  5E3O A;  5D1R A;  4GCK A;  3BHQ A;  1AHD P;  5M5W J;  1WI3 A;  2PZ9 A;  2GBY A;  3PPB A;  1POG A;  2OPT A;  1T56 A;  4V2F A;  5FJ8 J;  4D7M A;  1UI5 A;  1NTC A;  1HDP A;  1ITY A;  2EQR A;  2FX0 A;  4GFL A;  3JRE A;  3HOZ J;  3A01 A;  3BRU A;  1BW6 A;  1NK3 P;  3KKD A;  2ID6 A;  1TWG J;  3JRH A;  1RR7 A;  2XSD C;  3D1N I;  3JRD A;  2R5Y A;  2CQQ A;  3P9T A;  2E2H J;  3HGG A;  3OSF A;  4A3D J;  4DYQ A;  5FKO A;  3VPR A;  2I10 A;  1MBG A;  2ECC A;  3AQT A;  3LWJ A;  3LSR A;  5GPC A;  1VI0 A;  3GTM J;  2VKV A;  3HE0 A;  1ZQ3 P;  1DU0 A;  4S0H B;  4W1U A;  1A5J A;  1OFC X;  4HNV A;  4A3M J;  2DN0 A;  3I4M J;  2W48 A;  2NS8 A;  3LSJ A;  3O60 A;  3Q0W A;  3VP5 A;  2L9R A;  5J3L A;  1OCP A;  1I6H J;  4GCL A;  2Y2Z A;  3BR2 A;  1H88 C;  2IU5 A;  1SGM A;  2HOS A;  1ETX A;  3GTQ J;  1BJZ A;  1P7I A;  2QF7 A;  3NAR A;  5JLX A;  4M3B A;  4CYC A;  3GBG A;  3ON4 A;  2MSY A;  1VND A;  1I50 J;  2ZCX A;  3BG9 A;  1MNM C;  5EFY A;  2MW8 A;  1TWA J;  4MLO A;  5FKK A;  2ME0 A;  4CYC B;  2OF7 A;  4IEJ A;  2RHA A;  2EZK A;  5D18 A;  2XB5 A;  3S15 J;  1IG7 A;  1SAN A;  2D6Y A;  2ZCN A;  3NI7 A;  3S1Q J;  2R5Z A;  4L5E A;  5H9T A;  2IBD A;  3FK6 A;  2RAE A;  1B8I A;  3T6N A;  2IAI A;  1QPI A;  5CW8 A;  4BXX J;  3S2H J;  4M3D A;  2R5Z B;  2X48 A;  1B8I B;  3E7L A;  5EZH A;  4I6Z A;  5IYC J;  5EF6 A;  5K7H A;  2G3B A; 
#chains in the Genus database with same CATH topology
 1H8A C;  1I6X A;  3CP2 A;  3PNY A;  3E7Q A;  5F1J A;  4HST A;  1JUP A;  2IP2 A;  3TW6 A;  2Q8K A;  3H1C A;  3SXY A;  4JK1 X;  3UKG A;  4QTR A;  5IYB J;  4XBF A;  4I09 A;  3OS0 A;  3CJR B;  5FKM A;  1TT0 A;  3SWH A;  5CKT A;  3VSL A;  1ZR4 A;  1DGR M;  5GTI C;  3HPG A;  4XN0 A;  2YS9 A;  4J01 A;  3JTH A;  3VVY A;  4CDG A;  1WCM J;  1Y8Q B;  2BY0 A;  2F4I A;  3RD3 A;  3WOD F;  5FMP A;  4HKU A;  1MJA A;  3J7A O;  2COB A;  2X1E A;  3KX2 A;  1ZHF A;  4XKV A;  1T6S A;  4ENN A;  3LSG A;  3HC7 A;  2VPL A;  2K9M A;  3OOU A;  3ULQ B;  1DUX C;  3K4C A;  3WU2 C;  1G8X A;  2Q1Z B;  3SFZ A;  1D8J A;  1JTX A;  4KIB A;  1D1A A;  5IOZ A;  1VQ4 I;  2PLY A;  1IRX A;  2MH2 A;  1B59 A;  4G7Z F;  3HIF A;  1NG7 A;  4XSZ F;  1PVE A;  5FD5 A;  3MKW B;  3S1M J;  1PYV A;  1TNT A;  5CLS A;  3BLY A;  4UVA A;  1ZG5 A;  5F6F A;  2VJ4 A;  3FMS A;  4YFX F;  2GOM A;  2O03 A;  2E1C A;  2JVG A;  4FCY A;  3T8R A;  5DEQ A;  2ELH A;  3GFM A;  2KFD A;  1USS A;  1R00 A;  2L7Z A;  1YHQ I;  1LVA A;  4F93 B;  2HWV A;  2O3F A;  3ZRG A;  2FEZ A;  2PJR A;  1OMI A;  2BV6 A;  2FUG 2;  3DBR B;  5DD4 A;  4BDZ A;  5JHF A;  1MD0 A;  2LY9 A;  3LQR A;  1LUJ B;  4A0X A;  1R4N B;  3HTI A;  4IRG A;  1MMD A;  2Y31 A;  3CCU I;  1YX3 A;  2NYX A;  3HSE A;  3FM3 A;  2V9P A;  3GTG J;  4G7O F;  4UVB A;  1IO2 A;  1TT5 B;  5B1B H;  3GFI A;  3CDL A;  5E8G A;  1TW2 A;  4L0Y B;  2L7K A;  1O57 A;  4LK1 F;  4Y4R A;  3L2V A;  1Z91 A;  2XGC A;  3FMR A;  5JVG F;  4BQQ A;  1ZGW A;  1YIJ I;  3W2A A;  4OAY A;  1FNN A;  3GO5 A;  4NN1 A;  2MD0 A;  3K8P C;  4PK4 A;  3HKZ N;  3PNT A;  3CCR I;  2H1K A;  4HA8 A;  2X1C A;  3CD6 I;  4G12 A;  3QYB A;  2W7N A;  3F23 A;  4PXI A;  1R71 A;  3ZN1 A;  1YS6 A;  2A3S A;  1HW2 A;  3RQI A;  3WHB A;  1ZKG A;  3PJR A;  2WAD A;  1MW7 A;  2LVS A;  1AA7 A;  2QCO A;  4QSH A;  3IHU A;  1IN5 A;  3BPV A;  2JN6 A;  4C3I J;  1RIO H;  1GT0 C;  3V42 A;  2WAF A;  3OWT A;  2LK2 A;  2ECB A;  4FX4 A;  2LG4 A;  2V79 A;  1APL C;  3I55 I;  4U0Y A;  4HW0 A;  2PMH A;  4IX7 A;  2AXL A;  2MH9 A;  3LMM A;  4MK6 A;  2LFB A;  5M5Y J;  3CF5 F;  4R8H A;  1LFB A;  2LKX A;  2R7X A;  2WAQ N;  3HDD A;  1EF4 A;  2IVM A;  2J5O A;  3FXJ A;  1F9N A;  4M3E A;  2BXY A;  1LDK B;  3C1D A;  3EGQ A;  3MNL A;  3E0J B;  2LLK A;  1QQI A;  1IF1 A;  2VXD A;  1T08 B;  4CCK A;  2IS1 A;  4OIQ F;  2CO5 A;  4XM3 A;  4BQN A;  2W1O A;  4AC6 A;  2H1L A;  3S16 J;  2E7X A;  3O3K A;  2DMQ A;  2NVX J;  1LPQ A;  4I7H A;  2HQN A;  1CGP A;  1R1U A;  2LYC A;  3KP4 A;  3EYI A;  1CF7 A;  1MBK A;  2ZBK A;  3LA2 A;  2VJJ A;  1X1A A;  3VDX A;  2CQK A;  2Q0O A;  3S2W A;  1GUU A;  4OOI A;  2QA4 I;  2W57 A;  2Y75 A;  5E1X A;  2F07 A;  1RR8 C;  5GP9 A;  4GRI A;  4M9S A;  1UJ8 A;  4AU7 A;  3FBI B;  3OSG A;  3KEY A;  1Z3X A;  2L7F P;  4ESJ A;  2I5U A;  2ZOY A;  5FRM A;  4B4C A;  2HOT A;  4ZTF A;  3HOW J;  4IRH A;  5FLM J;  2EIL H;  1T0F C;  2L7M P;  4HEA 2;  2I8D A;  3H3U A;  2XPW A;  2XAJ A;  2E1M B;  3WE3 A;  1IDY A;  5GTH C;  5TRD A;  1PUF A;  1FMV A;  2FA5 A;  3ZQH A;  2P81 A;  2KJB A;  3G4S I;  2CYY A;  1A6I A;  3BZ6 A;  1ORK A;  2G9W A;  2CUF A;  3QOD A;  2HQ5 A;  1YRN A;  1UZC A;  1AWC A;  3DPU A;  4JL3 A;  2VQG A;  4A3E J;  1A31 A;  3KKC A;  1JUS A;  3K10 A;  3H3V K;  1MMG A;  2EFN A;  2IXS A;  2VKE A;  1X1C A;  3MD2 A;  1E2X A;  4HF1 A;  1IUF A;  1M1E B;  2VXZ A;  2RVC A;  2M0M A;  2KHM A;  3BG3 A;  1S7O A;  4IQ4 A;  3TBI A;  2EH3 A;  4M6V A;  3ZQI A;  2IS6 A;  1B4A A;  2KRC A;  3RI4 A;  1ZRE A;  1TC3 C;  4M9Z A;  4LLN A;  3S1N J;  3JCU C;  3CCL I;  3GME A;  3GW2 A;  3BZK A;  3OR1 C;  1U9O A;  3A2K A;  2CQ7 A;  1FTZ A;  1YS7 A;  2PMZ A;  3P7N A;  5A2Q K;  2Y9Z A;  4FQG A;  2FOW A;  4KMU X;  4KT6 A;  1V5G A;  4JBA A;  5HS8 A;  4G6D A;  5KAI C;  1OKR A;  2EIJ H;  5CQE A;  3BTJ A;  5TJJ A;  2RN7 A;  5ICF A;  2HYT A;  1W4M A;  1WQ2 A;  2F5V A;  2MLG A;  4CXF A;  2OER A;  2EWN A;  4E7Z A;  5LEK A;  1LVK A;  1HC8 A;  5IP7 J;  4A5N A;  1K4T A;  3B6C A;  3K4B A;  1MNE A;  3BY6 A;  2R7U A;  2EIM H;  1B72 A;  1FOK A;  1U6G A;  1MDM B;  2DA7 A;  3BT9 A;  2YU9 J;  1K6Y A;  4OIN F;  1N75 A;  3IKV A;  5E1W A;  1BIA A;  3S14 J;  3ABL H;  4Y52 J;  2DW4 A;  5IYD J;  1XMA A;  3PUF A;  1QHG A;  2ZNZ A;  4ICH A;  5E20 A;  4FTH A;  1G3T A;  4GFK A;  1ZEL A;  2GIV A;  3A03 A;  2E19 A;  1SD6 A;  2OA4 A;  3ASO H;  4JX6 A;  3B81 A;  5IT9 Z;  1IV8 A;  1ETV A;  3CMY A;  2A61 A;  4OMY A;  1S8N A;  3V4G A;  4CCJ A;  4HLX A;  3S17 J;  1XX5 A;  2WBM A;  3KE2 A;  1SC7 A;  1FBQ A;  1B6A A;  4KIS A;  4NC6 A;  3JRB A;  3ANP A;  2PQ8 A;  1YJW I;  2R7Q A;  1VZ0 A;  1BR4 A;  2R7Z J;  3V6G A;  1J5Y A;  2QZ8 A;  4S04 A;  5DCM A;  5BMZ A;  4NNJ A;  1ON2 A;  2E7W A;  4P9F A;  2A6E F;  2EFW A;  4HNU A;  4Q5S F;  4F92 B;  4ITV A;  2VON A;  2BVM A;  2JSP A;  4XON A;  4E6K G;  4UUS B;  1SMT A;  3PFI A;  1HST A;  3FKI J;  2VOP A;  1FJL A;  3A1Y A;  3M1C A;  1MND A;  1KU9 A;  3IH4 A;  3KP3 A;  5J1Y A;  2Z5U A;  3BWG A;  3KYD B;  4M73 A;  4CGR A;  2KLO A;  4YEJ A;  4HF2 A;  3IL2 A;  3VUQ A;  2HFH A;  4B1R A;  1ZK8 A;  1Y56 A;  3GEZ A;  5BNG A;  5L3F A;  4YIF A;  5B5E C;  3TL4 X;  2DA6 A;  2YX4 A;  3FIW A;  4Y7N J;  1XN7 A;  3F9K A;  3K4M A;  2RNG A;  1X19 A;  1KQ8 A;  1OYW A;  2H94 A;  4M3F A;  3ZQL A;  5HOO A;  3E5U A;  4ME9 A;  1N77 A;  1Z05 A;  3M7G A;  3HEF A;  3Q0V A;  2DDA A;  4DJA A;  4A3K J;  3K9T A;  1K4S A;  2VKD A;  3GCM A;  2F2E A;  3K4J A;  4GGG A;  1BW5 A;  2F4M B;  3AG1 H;  2EV5 A;  3KP2 A;  1E3P A;  3J7Z I;  3HTA A;  3AKZ A;  3P9C A;  1RET A;  2DYR H;  4XKC A;  1DPU A;  4H0E A;  1J59 A;  2VBZ A;  5J4V A;  3PNV A;  4KIG A;  3GLX A;  2RQP A;  3DU5 A;  3S5R A;  2DCE A;  5FD6 A;  1X2M A;  3REO A;  2HYF A;  4G8X A;  2QQ9 A;  5IT3 A;  2QM3 A;  5LLQ A;  3E5Q A;  4G94 A;  4A2U A;  3ZMS A;  2B9S A;  2RAS A;  4ZTJ A;  1F1Z A;  5TGT A;  2JT1 A;  1Z0X A;  3NS4 A;  2WB1 N;  3L2C A;  1BA5 A;  4KWA A;  3U1D A;  5K7F A;  1D0X A;  1XCV A;  4FE4 A;  3LHQ A;  1ZRF A;  3PSI A;  4X6A J;  1K83 J;  2Z1D A;  4XRS G;  4EJO A;  4IHS A;  3K6G A;  2JRM A;  3TDU C;  3RPU A;  3HUG A;  2HEO A;  4ZDP A;  5D8L B;  3OYA A;  5D1R A;  1FZP B;  3FM5 A;  2P8T A;  4DGW B;  1AHD P;  3BHQ A;  2IA1 A;  3VSK A;  4C2T A;  3HG9 A;  4L9T A;  1POG A;  5B1A H;  4ZYA A;  3V8J A;  3CME I;  5L3E A;  1JI8 A;  3FMQ A;  3RCO A;  1HDP A;  5B3S H;  3HOZ J;  1BW6 A;  1NK3 P;  2ID6 A;  1TWG J;  2XAU A;  2FBI A;  3QWL A;  2X51 A;  3QYE A;  4DNC A;  2RRE A;  4D0P A;  2P6T A;  3KZY A;  5ILV A;  2R5Y A;  2CQQ A;  2F5D A;  1IN7 A;  2EJR A;  3HGG A;  2QLZ A;  1RZ4 A;  3W2W A;  4K2E A;  3VPR A;  1W5T A;  1X3Z B;  2MBF A;  4CYD A;  1MBG A;  3OY9 A;  2WTE A;  1YX5 A;  2LMD A;  2W25 A;  3HE0 A;  1W7P B;  2W4S A;  3BC8 A;  1ZQ3 P;  1IXS B;  3DPL C;  2PG4 A;  3QPH A;  3ZPL A;  3I9V 2;  2FJI 1;  4PGG A;  3O60 A;  2LBF A;  1O3Q A;  1UAA A;  2L9R A;  5CVR A;  4WF2 A;  4BQO A;  1I6H J;  2QBY B;  4HG2 A;  4M9X A;  4WXH A;  4GCL A;  2Y2Z A;  4LG3 A;  5EEH A;  4BHC A;  2YPR A;  5LGU A;  3WU0 A;  1OCO H;  1U5T B;  2ETH A;  1P7I A;  4XLA A;  1WJF A;  4CYC A;  5FB2 A;  3ON4 A;  2RC4 A;  1I50 J;  2E5Z A;  3BG9 A;  1FSE A;  2ZCX A;  1UST A;  1S9H A;  2DTR A;  2R7V A;  1LB2 A;  3PUB A;  3KIO A;  2PBI A;  2D2W A;  3QYF A;  2F5E A;  3B73 A;  4CCO A;  3LFU A;  4L5E A;  5H9T A;  4I99 C;  3QOP A;  3CO7 C;  3FK6 A;  4R1H A;  4Y3O A;  1ACI A;  3T6N A;  4ZH4 F;  3H9Q A;  4BXX J;  3S2H J;  5FLX K;  1BJA A;  2KIM A;  4AVZ A;  1JHF A;  2IA2 A;  3CCJ I;  3BQZ A;  5FLX Z;  1FSH A;  3JRA A;  3CCV I;  2K27 A;  3BNI A;  3ZN0 A;  2ICW G;  4D7N A;  2IJL A;  1AU7 A;  3F0C A;  1HW5 A;  2K4J A;  2Z2S B;  3O8H A;  1LDD A;  4QPO A;  4XRF A;  1ZTR A;  3HL2 A;  1JTY A;  1R9T J;  1TWC J;  1MJ9 A;  1P2F A;  2JK3 A;  2QQB A;  3QOE A;  1GV5 A;  4U88 A;  2FNA A;  1TL8 A;  3KFW X;  5C44 J;  3NQO A;  2Y0S A;  4PSW A;  2DJI A;  2HPI A;  1ZLK A;  4AC0 A;  3RH2 A;  3F1B A;  4XR6 A;  5HVQ C;  2NOG A;  3OYJ A;  4XOP A;  5F0H A;  3K70 C;  2DXI A;  2K3P A;  1YLF A;  4IHX A;  2H09 A;  1XB4 A;  1I1G A;  3GZN B;  3HBL A;  3LL7 A;  2UXP A;  2G7S A;  1DP3 A;  2QEX I;  3AAF A;  1ULY A;  2L02 A;  4OD4 A;  5IPA A;  2FOK A;  3DTI A;  4A12 A;  4M3G A;  2EZL A;  2VLA A;  2V4J C;  1FP2 A;  5AIP A;  2CV2 A;  1K7A A;  2GIZ A;  3WTV C;  9ANT A;  4X1E A;  2NXN B;  2XUB A;  3EUA A;  3K1P A;  4XOR A;  5C3E J;  2K9N A;  3GWZ A;  3T1B A;  4BAC A;  4EEF G;  3VW1 A;  2CW0 F;  2QGU A;  3WGG A;  2PI0 A;  1BI1 A;  2W53 A;  1IXC A;  2KQR A;  3PFY A;  3VOX A;  3VYT B;  1XSD A;  3U21 A;  2CRG A;  4L5I A;  3HZJ A;  1V3F A;  5CQG A;  3ZP5 A;  2JA6 J;  4QPQ A;  4BHB A;  4O5V A;  3H9J A;  4I76 A;  2VI6 A;  2X0L A;  2O0Y A;  4RB1 A;  4JOM A;  2DT6 A;  3BJ6 A;  4AWX B;  1XMK A;  4YFN F;  2PJR B;  1WPK A;  4MQ9 F;  2DG7 A;  1XGO A;  2H8W A;  4XIC A;  2HR3 A;  3GZI A;  4HV6 A;  2CFO A;  3A01 B;  2LR8 A;  2B7E A;  5ED4 A;  2O7O A;  2NAZ A;  3IH2 A;  4F3Q A;  3AFH A;  4IOC F;  1RUO A;  1P4W A;  3UR3 C;  4UXN A;  2QTQ A;  4EV0 A;  3LWF A;  4RBO A;  2L3D A;  3DF8 A;  4A5M A;  3WG9 A;  2UXN A;  1D1B A;  2JA8 J;  1ETY A;  4X0G A;  4A0Z A;  4BGD A;  2Y69 H;  5H6Q A;  4UY8 I;  3CO6 C;  5DCF A;  2CJJ A;  1LE8 A;  1IRZ A;  3KCC A;  1BL0 A;  4JQF A;  3F8C A;  5L3D A;  3D0S A;  3GTK J;  4A6D A;  2ZME C;  1YO5 C;  4IHY A;  3VOE A;  3JRI A;  1WRJ A;  1FOY A;  2EBI A;  4J19 A;  2MC3 A;  4U7D A;  2LRE A;  1ZH5 A;  1HXD A;  2IGM A;  1Z3Y A;  3X2Q H;  2XIG A;  3IC7 A;  3DFG A;  1W36 D;  4YIR X;  3HOV J;  5L3G A;  3DLA A;  4ABZ A;  3PM1 A;  5GAG J;  1LJ9 A;  3C3W A;  4BQA A;  2NVY J;  4EMS A;  2XVC A;  2KIF A;  3DTK A;  1FOX A;  3U2R A;  3K2Z A;  2A05 A;  2DDB A;  2IA0 A;  4C2M J;  1GLN A;  2VB6 A;  3FXO A;  2ZCM A;  2R93 J;  3ANG A;  3HSR A;  4DW6 A;  2EV6 A;  1UI6 A;  4NUB A;  5LEJ A;  2ELJ A;  1N78 A;  3ZQC A;  1LNW A;  4IKF A;  1FIP A;  3RKY A;  3ZQQ A;  4CCM A;  3SFI A;  3OYL A;  3WTW C;  1CF7 B;  1Q1H A;  5D19 A;  4BY7 J;  1JKQ C;  1D1C A;  1IJW C;  1I1S A;  2CMP A;  2L5Q A;  1TZL A;  4AYB N;  2UXO A;  3GTP J;  3CRJ A;  3M8J A;  3QPT A;  4OIP F;  3KEO A;  2M30 A;  4P9U A;  4A3B J;  3FK7 A;  3H5A A;  4GCV A;  3F22 A;  1J09 A;  2D1H A;  2E2J J;  5BPD A;  3JAM K;  2ZSI B;  3G6E I;  3TO7 A;  1I3A A;  3R0J A;  1L0O C;  2DA1 A;  2V1X A;  3IRQ A;  1ZN2 A;  2XV4 S;  1SVO A;  2XGE A;  1WH5 A;  2H6C A;  2HKO A;  5CVV A;  2R7D A;  3OYB A;  4CH7 A;  3K2A A;  5LBQ A;  3CDH A;  4Y17 A;  3BR6 A;  3FHN A;  3DKW A;  1R5H A;  2DA4 A;  4ZJZ A;  4HQE A;  1AKH A;  3ISP A;  3WU1 B;  4ZDL A;  2HQR A;  3S32 A;  3NEU A;  1T95 A;  1XS9 A;  4KIC A;  1WJD A;  2K3F A;  1PUF B;  3VYR B;  1OCC H;  2ZO4 A;  2K86 A;  3V78 A;  5EJC A;  1MMS A;  1BBY A;  3OYK A;  3C18 A;  2X6W A;  4FIS A;  3ZMZ A;  2BXZ A;  1WJ5 A;  3E1S A;  3HSF A;  3MVP A;  1YRN B;  5K5O A;  3V8L A;  1HQC A;  2PFB A;  4OMZ A;  1DQU A;  2XC7 A;  2R0Q C;  3PL8 A;  2HNH A;  2O7T A;  3BJO A;  2ZB9 A;  5BS6 A;  2ZOZ A;  4HBL A;  1E17 A;  4PFO A;  1X4P A;  2KZV A;  2MAB A;  5J1U A;  2PN6 A;  3IV5 A;  3E6B A;  1X3U A;  2IGN A;  1SFE A;  2NVT J;  3BPX A;  4GXO A;  2XDN A;  3E6M A;  1S72 I;  1DPR A;  4KNY A;  2ZXH A;  1D8K A;  3F8M A;  2CG4 A;  3S3M A;  1FYM A;  3S93 A;  2DQR A;  2XAQ A;  2YVX A;  2PBX A;  3BG5 A;  3FZV A;  4ESF A;  2DOA A;  2DA3 A;  3BJB A;  4RAG A;  1KQ9 A;  4KN7 X;  1JKO C;  1SEU A;  2DAO A;  2P0W A;  1H89 C;  3GTO J;  3RKQ A;  2HKU A;  2A6H F;  3M9A A;  3L1P A;  1JJ6 C;  5ERI A;  3I56 I;  2VUM J;  1E3H A;  2ZC2 A;  3OYI A;  4IO9 F;  3RZD J;  3IP4 B;  4RB3 C;  1PUE E;  2P7C B;  1JGS A;  2BW3 A;  4Q48 A;  2MG4 A;  2GWR A;  3CMA I;  1SFU A;  2Y48 A;  4CCN A;  2QWT A;  2WUI A;  4KIF A;  3WTU C;  1Z6R A;  1YIO A;  2XKP A;  1B72 B;  4EJV A;  3JSJ A;  2L9N A;  1BR2 A;  3I64 A;  2G0E A;  1WZ2 A;  2A2F X;  4HPQ A;  3N4M A;  1QO0 D;  2HTS A;  3FRQ A;  4D1Q A;  4CO8 A;  1IRF A;  4HX4 A;  1TW3 A;  4BJ6 C;  3ELK A;  2Y9Y A;  3K69 A;  4ANJ A;  3H36 A;  2WV0 A;  1TBX A;  3LSK A;  3EUP A;  5EGO B;  4NQW A;  5ICE A;  1OCT C;  5M3F J;  1REP C;  4LG0 B;  2MFZ A;  1C0W A;  2VQC A;  2FE3 A;  2Q2E A;  3HKZ A;  5GPA A;  5EG0 A;  2FXA A;  4YFK F;  5L3C A;  3HTS B;  2WY8 Q;  4EGY A;  5M5X J;  1FT9 A;  1T38 A;  2V6C A;  5F0F A;  2GQQ A;  2XSJ C;  4C3J J;  1R7J A;  4HV5 A;  1YI2 I;  2Q24 A;  1TP4 A;  1S7E A;  3V7R A;  3L2U A;  4LIV A;  4IRI A;  3KP7 A;  1RKT A;  2K85 A;  2IT0 A;  1P7J A;  4BY1 J;  2K9S A;  1V5F A;  2PX9 A;  5DCM B;  4EJW A;  3FHZ A;  1T33 A;  3OL4 A;  2PJP A;  4WXD A;  1GHC A;  5FGL A;  3CUQ C;  3IKT A;  3BR5 A;  3OYF A;  5JR3 A;  1U8R A;  3O8G A;  3SDB A;  4M72 A;  1ZAR A;  1W0T A;  2LRD A;  2BOL A;  3WTY C;  1DGW Y;  1LDJ A;  3LFK A;  4IZZ A;  3D5L A;  3ZQ7 A;  2JUC A;  2F5F A;  2K40 A;  2B1E A;  1SAU A;  1U9N A;  2NRA C;  1WJC A;  1QGP A;  5EEA A;  2HDD A;  1BIB A;  3L00 A;  3M8E A;  4MEY F;  5CPR B;  2K5C A;  1TTY A;  2LF8 A;  2UV1 A;  4XK4 A;  1ZGJ A;  2DBB A;  4OIR F;  4TV7 A;  4F52 A;  1BM9 A;  4HOB A;  1YG2 A;  1YIT I;  3WHC A;  2R7S A;  2UXH A;  2CQX A;  1VQ9 I;  1W1W E;  1ETW A;  5J6X A;  2GZW A;  2LP0 A;  1FLI A;  1P92 A;  1R1V A;  4AIH A;  2G7G A;  4M74 A;  4BBS J;  2XAH A;  1IV6 A;  1OPC A;  5HBU A;  1L3L A;  1S3J A;  2XB0 X;  4EVI A;  3PIP F;  4KN4 X;  2OZ6 A;  3VB2 A;  4M6Y A;  3EDP A;  4CGZ A;  1VTN C;  1FYK A;  5BQT A;  2ZME A;  3QP6 A;  5DUI A;  1XSV A;  4I01 A;  1J0R A;  1PP7 U;  3TED A;  2R7R A;  3KLO A;  5GAE J;  5LHH A;  1P6R A;  5E3O A;  2QSH X;  4HDU A;  4NC8 A;  1XDU A;  5HLH A;  1H0M A;  1R58 A;  2ZJQ F;  3HUG B;  2PZ9 A;  2EIK H;  3H35 A;  1U2W A;  5FJ8 J;  2Z33 A;  4D7M A;  1STZ A;  3BRO A;  4II2 A;  4KJZ A;  1VQK I;  3JRE A;  3BRU A;  3MMY B;  5A2Q Z;  2HDW A;  2VJ5 A;  4XMY A;  2IRF G;  5ILS A;  1VQ7 I;  3JRH A;  3LSI A;  1VQL I;  4PZJ A;  3FX3 A;  4XOT A;  4KUM A;  4E7J A;  3P9T A;  4C9Y A;  3NWS A;  4O6J A;  4LMY A;  1S6L A;  4M71 A;  3OSF A;  5LHG A;  2BY1 A;  4LK0 F;  5FKO A;  2I10 A;  3V7S A;  5BPI A;  3S3O A;  3E5X A;  3MCZ A;  3AQT A;  2F48 A;  1R23 A;  1UFM A;  1XD7 A;  3HRT A;  2DO7 A;  3GTM J;  2VKV A;  4LJZ F;  4N9I A;  2AQE A;  3Q9S A;  4MTD A;  1T39 A;  1NG6 A;  3UNG C;  3OYD A;  1OQY A;  5IY5 H;  4HNV A;  2NS8 A;  3K4N A;  3QRF F;  5ICC A;  4PSX A;  4HQM A;  3HRS A;  4ZC3 A;  1FOW A;  1UHM A;  1R49 A;  1SGM A;  1IN4 A;  2CW7 A;  3QU3 A;  2O8X A;  4LB5 A;  1BJZ A;  4U7B A;  5JLX A;  4YG2 F;  3J7A Y;  2IGO A;  3RQ4 A;  4CYC B;  2OF7 A;  3CJT B;  1WSU A;  2EZK A;  1W5S A;  3IUO A;  2O6G E;  1WHU A;  3S15 J;  2NOJ B;  3S1Q J;  3COA C;  2VBX A;  2RAE A;  2KIS A;  1QNT A;  5LRR A;  3E3V A;  2WAE A;  5CW8 A;  2EIN H;  3R6S A;  1YE9 A;  5TIS C;  2X48 A;  4XL9 A;  5EZH A;  4I6Z A;  4RA2 A;  5EF6 A;  5HNH A;  2VBW A;  1KQ0 A;  2VN2 A;  4XLH A;  5K7H A;  2BY3 A;  2KT0 A;  4KIT B;  4CCL A;  1YJN I;  2RV8 A;  2VQH A;  3OYE A;  3SYT A;  5HLG A;  4XLN F;  2JA5 J;  3S1R J;  3G1M A;  4HAM A;  3ZQG A;  1ZG3 A;  1RRJ A;  4RGS A;  3WTZ A;  4RGX A;  4N0B A;  3ABT A;  1TQM A;  2KKO A;  3WE2 A;  1IRG A;  1QPM A;  5KAF C;  3GTL J;  1ETK A;  2LC2 A;  2NVU B;  1I3Q J;  2QSG X;  3DBL B;  2L2O A;  3CCY A;  2ID3 A;  2RDP A;  1FIA A;  3PSF A;  5HS9 A;  5HOD A;  4NEL A;  2E5N A;  4MNU A;  3MZY A;  4HX8 A;  3TOA A;  2ISY A;  3HJE A;  3MZH A;  1CQT A;  3HPH A;  3ZQF A;  1BN5 A;  4BEH B;  2XRN A;  5HSZ A;  2DQL A;  3BOQ A;  1SVL A;  1Y6I A;  1WJB A;  2VC1 A;  3E97 A;  3G71 I;  1WKM A;  4AUX A;  2V9V A;  2HTJ A;  2TRT A;  3T5X A;  4XID A;  2XDV A;  5DD8 A;  5CVJ A;  3IH3 A;  4GCT A;  1ZG1 A;  1IUY A;  1N25 A;  4I02 A;  4DQ2 A;  2K02 A;  3VYS B;  4IHT A;  4XKB A;  4YEL A;  1ENH A;  2ZFW A;  4DIQ A;  5D5W B;  3ERE D;  3H5N A;  1Y1W J;  4KFC A;  3T0Y A;  3DBH B;  3OS2 A;  1DU6 A;  4HX7 A;  1K78 B;  2HYJ A;  5FFZ A;  5LD2 C;  1SFK A;  2DOE A;  1OCZ H;  3I71 A;  2NVQ J;  4BYY A;  5C4Y A;  3G1O A;  2AS5 F;  2R7W A;  2FD5 A;  2TCT A;  4NHJ A;  1IN8 A;  4OAZ A;  4U0V A;  5E3N A;  3OIP A;  2FBH A;  3I54 A;  2XF5 A;  3HHG A;  3ERM A;  3CQZ J;  1WWX A;  5F0C A;  3CCQ I;  4CSW A;  1FYL A;  4EM2 A;  2IS2 A;  4P5O A;  4WWC A;  2DPD A;  4D5F A;  3CC4 I;  3BR1 A;  4G7H F;  3KET A;  5AIQ A;  2CUJ A;  3MKY B;  2DPU A;  2IW5 A;  2FU4 A;  1MSF C;  1OYY A;  2E34 A;  3J7Y J;  1U78 A;  4I98 B;  4EQQ A;  1HF0 A;  2ZXW H;  3K0L A;  1YW8 A;  3BCG A;  5FHP A;  4HRI A;  1WGX A;  4I0A A;  4PFP A;  4XLF A;  4BHP A;  3TP0 A;  4UUT A;  1VFC A;  2X4H A;  2WB1 A;  3WGH A;  4MXM A;  3MKZ A;  3CUQ A;  4PDK A;  2IGK A;  4RM2 A;  2D1V A;  2EFQ A;  1P4X A;  4MEX F;  1RES A;  2FSW A;  4A93 J;  2OJE D;  3CCM I;  3CC2 I;  4F7Z A;  2OAZ A;  1ZLJ A;  4RMN A;  5AQC A;  2M4G A;  1J2X A;  2A69 F;  2CW8 A;  2V7F A;  3EPZ A;  1ON1 A;  2MC4 A;  4PJL A;  3CCS I;  4XRM A;  1MDM A;  2BEO A;  3H92 A;  2HPM A;  2STW A;  3BR0 A;  1S5L C;  4MIM A;  4RLF A;  3SEQ A;  4D9J A;  4HZF A;  1FBS A;  2FQ4 A;  5DM7 F;  3LSM A;  1EA3 A;  4C3H J;  3ONQ A;  3L7W A;  3VOK A;  2M1B A;  2W84 A;  4JP0 A;  3TO6 A;  4HDV A;  3RSN A;  3NAU A;  2Y0S N;  1FMW A;  2FML A;  2HZT A;  3JW4 A;  1Y1V J;  2CWE A;  2YR2 A;  1MSE C;  3OL3 A;  1D0Y A;  3TKY A;  2HYG D;  3F8F A;  3VIB A;  1R22 A;  2TDX A;  3LNQ A;  3MAJ A;  3QAH A;  3WTT C;  3GZ6 A;  3HOU J;  4Z6Y A;  2EB7 A;  3DV8 A;  4IOA F;  2R3S A;  3GTJ J;  2VT3 A;  3N97 A;  3BG6 A;  2JJ7 A;  3MN2 A;  3IAM 2;  2A68 F;  1QVU A;  2KDZ A;  4BKX A;  1LFP A;  4KA4 A;  2G7L A;  3E6C C;  2DK5 A;  4MO7 A;  3PO2 J;  1QZY A;  4EJT A;  2QEN A;  4DYR A;  5DAJ A;  1FY7 A;  2YVE A;  2VC0 A;  4LLG F;  3VW0 A;  3HM5 A;  5F08 A;  1I39 A;  1ODD A;  2KRF A;  3A02 A;  2EZH A;  5IOY A;  2ACJ A;  2X9D A;  2EA4 A;  3RYP A;  1XGN A;  4E7I A;  1XTA A;  4AD9 A;  3LOC A;  1O7L A;  3I53 A;  3DKX A;  2KJC A;  4BL0 B;  4EM1 A;  3JSP A;  1O3S A;  3Q5F A;  1IGN A;  2HXO A;  4LGW A;  1HW1 A;  1R5G A;  2QKL B;  5DDG A;  3ZMU A;  2DTZ A;  3P9I A;  4U9L A;  2QVO A;  4A3J J;  2DA5 A;  2XHK A;  3OOP A;  1KA8 A;  2NNN A;  3FBN B;  3VVX A;  1S7A A;  2L4M A;  3NXC A;  2L4A A;  1AKH B;  5M3M J;  1O4X A;  3A0H C;  2ZCW A;  2GEN A;  3TO9 A;  2OUM A;  4IL6 C;  3Q9V A;  2D5V A;  3WTS C;  1V54 H;  4LB6 B;  2L0K A;  1JT0 A;  3LQQ A;  3SDG A;  1QA6 A;  3QP5 A;  2D45 A;  2R4G A;  4L62 A;  3MZ8 A;  3D5R C;  1T2K A;  2R7F A;  2B3W A;  4YZE A;  2FBK A;  2K4B A;  2G7U A;  3VVZ A;  2L9V A;  1AOY A;  4UVC A;  2QIB A;  5EYR A;  2P5V A;  2Z16 A;  4GO1 A;  1X2N A;  3DXJ F;  4WXC A;  3F6O A;  1KU3 A;  3W6J B;  3ABU A;  2YX7 A;  3PQJ A;  2WY7 Q;  4L18 B;  5HDG A;  2IS4 A;  4Y13 A;  2JA7 J;  4ENK A;  2M8E A;  4LOC A;  3GFJ A;  3L9F A;  1F43 A;  1A35 A;  5FKN A;  4R79 A;  3AL0 C;  3GFL A;  4W97 A;  1OLT A;  1XGM A;  4DYC A;  1VQP I;  4WIB A;  3I58 A;  2M34 A;  4Q4Z F;  1V5E A;  3CLO A;  2F6C A;  2NS7 A;  1MBF A;  4G9Y A;  1NH3 A;  2XPV A;  2MGQ A;  1OJL A;  2EV0 A;  3ZXS A;  4GDF A;  2WC2 A;  4LFU A;  3M4O J;  1D5V A;  3DLL F;  4P96 A;  3CES A;  2V1U A;  3RKX A;  2VKH A;  1VQN I;  1UEL B;  1WH7 A;  3OIQ A;  2LNB A;  2LOO A;  2UXI A;  4KDP A;  1PP8 F;  2BHY A;  2B63 J;  1XPX A;  2A07 F;  2HDC A;  5EDN A;  5K58 A;  2LDU A;  4EAT A;  5LRS A;  1QZE A;  2LH9 A;  1PDN C;  3AL0 B;  1KON A;  5FLV A;  3L2W A;  3C7J A;  3K7A J;  3VFZ A;  1O3T A;  4ACI A;  1LEA A;  2YVH A;  5H6R A;  3G3Z A;  2V1D A;  4ON0 A;  1BOA A;  5EEG A;  4D5C A;  1H9T A;  3I59 A;  3DKY A;  2COM A;  2ESN A;  3CMM A;  2KDO A;  4ETS A;  3CJD A;  3PO3 J;  4MTE A;  2HVQ A;  3FXK A;  4XLP F;  3JSO A;  2UXU A;  4RM3 A;  3S2D J;  4N9H A;  1VF9 A;  3WTX C;  2LY1 A;  3P9K A;  4XKW A;  3V8K A;  3JR9 A;  2DA2 A;  3SJM A;  1EV7 A;  3AG4 H;  3BQY A;  1SD7 A;  2CU7 A;  2Q2E B;  1XG1 A;  1KU7 A;  4ENM A;  4S05 A;  5EG0 B;  1MBE A;  4YII A;  2M87 A;  2BZT A;  3TMO A;  4OD5 A;  4B8X A;  3W3C A;  2DMU A;  5HLI A;  3SZT A;  1RUN A;  1TNS A;  3LJL A;  4E4H A;  5IP9 J;  3D5S C;  1YTY A;  3G73 A;  1LQ1 A;  4AF5 A;  4RDU A;  5K7Z A;  2Z3Y A;  1VQO I;  2WV1 A;  4JYK A;  3GX4 X;  3LA7 A;  3BR3 A;  3QPL A;  2FRH A;  3NRG A;  5FO5 A;  1OIS A;  2O9L A;  4BE2 A;  2H6B A;  1UCR A;  2NS0 A;  2K7L A;  3JAM Z;  2KRH A;  1KU2 A;  1R6R A;  4GYI A;  3CCE I;  4XN3 A;  3FDY A;  2AO9 A;  2X6X A;  5K5Q A;  4IXA A;  1EH6 A;  3L09 A;  4FAS D;  2VQL A;  1FEX A;  2K9L A;  2M5W A;  2C6Y A;  2DMN A;  4BDY A;  2VJI A;  4DVY P;  4V19 K;  2JRT A;  4L9N A;  2KL4 A;  5J1R A;  4FX0 A;  2W85 A;  1VQ6 I;  1W36 C;  4C30 A;  3PAS A;  3OYM A;  2DFE A;  1BI3 A;  3NWT A;  2M3A A;  2BBY A;  4BUP A;  2XAF A;  3KP6 A;  3LAP A;  4E7L A;  2P7V B;  1HLV A;  3KZ9 A;  3RIR A;  1KYW A;  2ELK A;  5DUK A;  5J8C A;  3HTH A;  1LKX A;  3FXQ A;  1X3W B;  2ZFU A;  1XDS A;  2A5W A;  3HB9 A;  1R1T A;  1WI9 A;  5HNF A;  4IHV A;  3NRV A;  3L2R A;  4O3M A;  4AYB A;  3RTR A;  3W6K B;  2IEK A;  3A4C A;  3HTU A;  3Q0U A;  3C2G A;  5F1R A;  2ZJP F;  3CWR A;  4U0W A;  1W5C C;  2BYV E;  4UNO A;  3RPU D;  4A3L J;  2M8G X;  1BC7 C;  4E7S A;  3B02 A;  4I2O A;  2CQN A;  5D6E A;  2ZME B;  2JQ7 A;  1D0Z A;  2HOE A;  2LF7 A;  2W00 A;  4ZZL A;  2VOD A;  2R7T A;  3U1K A;  3VTI A;  2CGP A;  5M5W J;  1DP7 P;  4BU2 A;  2Z9O A;  4KMF A;  2OC6 A;  2HQA A;  2E1N A;  2GBY A;  3FKJ A;  3OMY A;  2B0L A;  2RNJ A;  3LAJ A;  1ZRC A;  3PPB A;  4V2F A;  1IXR C;  2QSF X;  2VE8 A;  1NTC A;  3H0D A;  1ITY A;  3EYY A;  3M8F A;  2E1M C;  4PJ0 C;  1T98 A;  2P5K A;  5CVU A;  3SZP A;  4B3X A;  3I0T A;  3A01 A;  3GYH X;  3LA3 A;  5F64 A;  1Y0N A;  2XSD C;  4BE1 A;  3JRD A;  4HNT A;  1ZAO A;  2DOF A;  3F8B A;  2E2H J;  4IPA A;  4C2M A;  3MFK A;  3I5U A;  1TLH B;  4DYQ A;  2X6Y A;  2R7O A;  1WJE A;  2M45 A;  4OIO F;  3K4L A;  1IZ1 A;  3LWJ A;  1A36 A;  3LSR A;  5GPC A;  1VI0 A;  2HS5 A;  4PUS A;  2DFF A;  1YYV A;  3MWM A;  5KHD A;  3GF2 A;  3J80 K;  4RS8 A;  4AM3 A;  2DN0 A;  3ASN H;  1HKT A;  4M6X A;  1R4M B;  4U9N A;  4FHT A;  1G4D A;  2P6S A;  4B43 A;  5J3L A;  3VP5 A;  1OCP A;  4RAY A;  4P1W A;  4ZYE A;  3J80 Z;  2DU9 A;  3BR2 A;  2OZU A;  2ZJ2 A;  4HF0 A;  1H88 C;  2IU5 A;  1Z67 A;  5D5X B;  1XCB A;  2BVL A;  3IWF A;  4Z2Y A;  1ETX A;  3GTQ J;  3NAR A;  4M3B A;  3GBG A;  4YRV A;  1QU3 A;  2DI3 A;  3BG7 A;  5K5R A;  2XKO A;  1MNM C;  1B1B A;  2E60 A;  2MW8 A;  1TWA J;  3F72 A;  2ME0 A;  4IEJ A;  2HZD A;  3FXR A;  2XB5 A;  1I27 A;  5E18 F;  4EJU A;  2D6Y A;  2VL8 A;  3DPT A;  4RGU A;  4A6E A;  3NI7 A;  5LGT A;  3ABK H;  4FT8 A;  2R5Z A;  3GLL A;  1B8I A;  1MJB A;  2EA2 A;  2IAI A;  3H5R A;  4DBR A;  4M3D A;  1BI2 A;  5L3B A;  1HKS A;  3DU6 A;  1A04 A;  1FP1 D;  1GXQ A;  2QWW A;  2UXX A;  3TOB A;  2HKX A;  3U9G A;  3IRR A;  2W24 A;  3FF5 A;  3QU6 A;  2VPR A;  2WAQ A;  3QKX A;  2LSO A;  5FFX A;  3K1N A;  5FRO A;  3HOY J;  3GUD A;  1LEB A;  2OTL I;  2HOA A;  2A5Y B;  1B9M A;  2OCC H;  2ISZ A;  2LTP A;  1SFO J;  4BE0 A;  3KYC B;  3HTJ A;  1Z7L A;  1YW9 A;  2HVS A;  2AHQ A;  2K9Q A;  2EFO A;  2UUZ A;  3O6B B;  2H27 A;  4L0Z B;  4IRV A;  2O8K A;  2EZI A;  2REK A;  1ZR2 A;  1V4R A;  3GXO A;  3HIM A;  1A6Q A;  5CJ9 A;  2DFH A;  2GA2 A;  4J00 A;  1GDT A;  1HA8 A;  3OYG A;  1FBU A;  2X85 A;  2YSR A;  3R61 A;  3CTA A;  2A6T A;  2DJN A;  2PMU A;  3SHF A;  4L5J A;  4B47 A;  2O61 A;  4N4N B;  3COL A;  3F8N A;  2WWY A;  1HSJ A;  1SD4 A;  3HYI A;  1F36 A;  2PMZ N;  2AXT C;  2CUZ A;  3ZR8 X;  4EM0 B;  1T8I A;  1U3E M;  1QBJ A;  3A0B C;  3AG3 H;  2CUE A;  1MIJ A;  4AID A;  4N4O B;  4BS9 A;  1X1B A;  3CF2 A;  3BTL A;  1UMQ A;  2JA2 A;  1U0J A;  3TDZ C;  1J7K A;  3HRM A;  1G6N A;  2MYS A;  3EUH C;  4BXF A;  1F5T A;  3WG7 H;  2PFV A;  1YOV B;  1RC9 A;  5HS7 A;  5J4Y A;  5CVI A;  5GAH J;  3CDI A;  1MKM A;  2KZG A;  4IVN A;  4NB5 A;  1JE8 A;  3HXL A;  2DFI A;  2NNY A;  4DBQ A;  3R0A A;  1GV2 A;  2UZK A;  4XQF A;  4FE7 A;  4BXU A;  1OR7 C;  4LIT A;  1RPW A;  2KIQ A;  4B09 A;  3F3X A;  2Y30 A;  2OI8 A;  2XF7 A;  2VBY A;  3F21 A;  1H9G A;  3CLQ A;  5CYV A;  4ZDO A;  3ON2 A;  3GEU A;  2VE9 A;  1SVM A;  2RQQ A;  4WCG A;  2JWT A;  4UB8 C;  3EET A;  5HDK A;  4EGZ A;  1MBH A;  4NC7 A;  3BTI A;  1W7P D;  4UB6 C;  4QIW N;  1D5Y A;  4JX4 A;  2R5Y B;  2EK5 A;  3BZC A;  4KYW A;  4L9J A;  3ESW B;  1FC3 A;  1UG0 A;  4XNF A;  2HVR A;  4PJJ A;  2R92 J;  3ML6 A;  5DS9 A;  5DTD A;  3NNR A;  2M0C A;  1KYZ A;  2GUH A;  2O5R A;  2M7A A;  4BNC A;  5HLT A;  3HGY A;  3HRU A;  3L2Q A;  3BCA A;  5JLW A;  1TWH J;  4UUV A;  3NPI A;  4CZZ A;  1TQP A;  2JMW A;  5E79 C;  1TWF J;  3CUQ B;  2WGB A;  1G2H A;  2NP3 A;  4HYE A;  2LBF B;  2MLK A;  1Q1V A;  4ZYD A;  3RZO J;  5C4X J;  3OV8 A;  2XAG A;  1IAW A;  3ZMD A;  5E17 F;  1Y0U A;  3TP3 A;  4RGR A;  2XGX A;  4DOZ A;  5E3M A;  4MHG A;  5IT9 K;  1JJ8 C;  4CZC A;  2JSC A;  4A0Y A;  2P4W A;  4MQV A;  5ICG A;  2J5P A;  4BBR J;  5J8F A;  1FPQ A;  4NDL A;  3TW7 A;  2JVH A;  2HU9 A;  2M9H A;  3BCB A;  4L9V A;  2XGD A;  3PQK A;  5EGO A;  1MMN A;  5CXI A;  3E6D A;  1GVD A;  4LG0 A;  4XRS A;  3G56 A;  1YQA A;  3FIS A;  3IWZ A;  5FKL A;  1Y8R B;  2E1O A;  3HOX J;  1QHH D;  3GZ5 A;  2E2I J;  2ZSH B;  3BTC A;  3R4K A;  4UHT A;  5DM6 F;  3KPH A;  3VEP A;  2E36 A;  1TQI A;  2JZY A;  2KP6 A;  5JI6 A;  1IC8 A;  3ZOB A;  2DOD A;  4B48 A;  2KPM A;  3JRG A;  2GLO A;  4DZP A;  3G1L A;  1U8B A;  1V55 H;  3AG2 H;  1UHS A;  2GXG A;  4RLQ A;  4CIC A;  3EQL F;  3S3N A;  4IJA A;  3LSH A;  1YJ9 I;  4P55 A;  2HI3 A;  3KZZ A;  4RAF A;  3DEW A;  2ME6 A;  3TQN A;  4ENJ A;  1QRY A;  2DLL A;  2V57 A;  1U5T C;  2VT2 A;  5JFR A;  1HOM A;  3KNW A;  2EFP A;  1I5Z A;  3DTE A;  4BJ5 C;  2OCE A;  2QYO A;  3HOT A;  3DCF A;  1Z7U A;  1NK2 P;  2YUS A;  3T8T A;  5J40 A;  2DT7 B;  3VYU B;  3H3Z A;  1D3Y A;  4E70 A;  4HLY A;  1YFH A;  2BHZ A;  1ONV A;  5E8I A;  2GM4 A;  1YW7 A;  1Z21 A;  4CUG A;  2FMY A;  4JNN A;  1MH4 A;  1E0E A;  4RB0 A;  3CJN A;  4LLL A;  5GAD J;  2WA0 A;  5LGN A;  2OU2 A;  2QKO A;  2F5C A;  4AIK A;  5D8K B;  2GOX B;  3M3Y J;  2JTV A;  5ILU A;  6PAX A;  3ECO A;  4MGR A;  4G6Q A;  1GXP A;  4MFE A;  3C07 A;  5HAW A;  2QOP A;  3OS1 A;  1G59 A;  2RGV A;  4C2U A;  1XGS A;  3H9G A;  4ASN A;  1R36 A;  1RKW A;  4A3C J;  4KT5 C;  5JHU A;  2BY2 A;  4OWR B;  3DWL E;  5KCM A;  3ZMV A;  2ZKZ A;  2V26 A;  1ZYR F;  5D6F A;  4JKZ A;  1VQ5 I;  3BJA A;  1K6O A;  2MA3 A;  2XRL A;  3LSP A;  2V6E A;  4F91 B;  1FWZ A;  1JKR C;  1OYI A;  5F04 A;  4GFB A;  3K1M A;  3DQV C;  2V9K A;  2IPQ X;  5EZG A;  2XRO A;  3HOS A;  5J47 A;  2OTJ I;  4H4K C;  1HDD C;  3Q3S A;  4PGH A;  3F6V A;  3W2V A;  1MMA A;  2HGC A;  4QLC U;  3ECH A;  3QPS A;  2VAS A;  1O3R A;  3EUK L;  4LD5 A;  3MQ0 A;  1O7F A;  4A69 C;  5CXG A;  3HHH A;  5D5U B;  1X58 A;  3B6A A;  2NP5 A;  2M4K A;  2DMP A;  2CFX A;  1XC5 A;  1JHH A;  2ESH A;  1PJR A;  3JRC A;  5D4R A;  2OBP A;  1SD5 A;  2ZNY A;  4XLE A;  1NHA A;  3TGN A;  2VIX A;  3OYC A;  1MZB A;  3W6V A;  1LE8 B;  1W0U A;  2QKM B;  4CHU A;  1X4O A;  5AON A;  2DT5 A;  1RI7 A;  1G3Y A;  3OIO A;  4UV9 A;  5B66 C;  2ZY9 A;  4UV8 A;  4NBQ A;  2YU3 A;  4LIU A;  1VQ8 I;  2M2E A;  4RAZ A;  3M07 A;  1MGT A;  5IP6 A;  2LKS A;  2Z99 A;  1KZH A;  2AQF A;  1Z77 A;  3R60 A;  5HDN A;  2QUF A;  2CV0 A;  3ZMT A;  1MBJ A;  4BAY A;  2FBQ A;  2DK8 A;  3K70 D;  1HCR A;  3ZGK A;  3RJP A;  2LD5 A;  2JPB A;  2FJ1 A;  3AQS A;  1K61 A;  4ZZD A;  3C2B A;  4MFD A;  1HKQ A;  1X1P A;  4PCQ A;  3DPJ A;  2XPU A;  1R5I D;  3DP7 A;  1OCR H;  2RKH A;  3I59 B;  1FTT A;  4HSR A;  2GXB A;  2ADU A;  1T0F A;  3H0G J;  2CV1 A;  1ZGA A;  3V7C A;  4ZYG A;  2GAU A;  1XSX A;  2DMT A;  4FET A;  4BJT A;  5LHI A;  3WGI A;  1HBX G;  5C4J J;  4WK8 F;  1RNL A;  1IDZ A;  2DG8 A;  2N8G A;  4I0B A;  1IN6 A;  3OYN A;  5D5V B;  1LFU P;  4UUS A;  2KIU A;  2XF6 A;  3FXU A;  1P9Q C;  5KNL A;  2P5L C;  3EUH A;  2GFN A;  5F27 A;  2X6O A;  5DYM A;  3IUV A;  4A3F J;  1B9N A;  1BR1 A;  3BDD A;  3VWB A;  1JUM A;  5FRN A;  2MD5 A;  4A3G J;  4DZJ A;  4UDS A;  3MEX A;  3OYH A;  1ZRD A;  2VOO A;  3G7R A;  4A3I J;  4XLC A;  4OU0 A;  2QQA A;  5FGM A;  1KGS A;  5KK1 A;  2JPC A;  1WFX A;  4IHW A;  4PJM A;  3CC7 I;  3VW2 A;  4JX5 A;  2GA1 A;  3I4N J;  3PIO F;  1OR7 A;  3QQA A;  1ERD A;  1ETO A;  1JT6 A;  2STT A;  1EKE A;  1VQM I;  1DDN A;  1ETQ A;  2ZXJ A;  3RPQ A;  1BOB A;  2OD5 A;  3JRF A;  3K4K A;  3S8P A;  4IF4 A;  4E7K A;  4WX9 A;  2FF4 A;  2HXI A;  2M7B A;  1SFX A;  4V2G A;  5E3L A;  1JGG A;  2OV7 A;  3QBM A;  1WJA A;  4BEH A;  2H8R A;  2QQ8 A;  2LKP A;  1J75 A;  1SMY F;  3C2H A;  2FQ3 A;  3CP8 A;  1MH3 A;  1Z6T A;  1E3O C;  3N05 A;  2W82 A;  2L01 A;  1UG2 A;  4ZYH A;  5LFA A;  2NX4 A;  4GYG A;  2CH0 A;  1QVT A;  5H2F C;  1JXS A;  4PJN A;  3MKL A;  5E1Z B;  2XAS A;  4Q47 A;  2ZXI A;  1K79 A;  5H20 A;  3BP8 A;  3FXL A;  1GVJ A;  1K78 A;  1JKP C;  5K1Y A;  2V1N A;  1EJ9 A;  4BH9 A;  2L9S A;  3CJQ B;  4B3A A;  4GCK A;  2X1D A;  4XSX F;  1EH7 A;  2JUG A;  5JVT A;  4CA0 A;  4Y33 A;  3GVA A;  4AIJ A;  3G2B A;  1WI3 A;  2OPT A;  1T56 A;  1G3S A;  2DYS H;  1UI5 A;  1IW7 F;  2EQR A;  2FX0 A;  3O2P E;  4GFL A;  3VOD A;  3KKD A;  2CSO A;  5BOX A;  2BE5 F;  2F4O B;  5DV5 A;  4E7H A;  3SEZ A;  3DEU A;  1RR7 A;  2UWM A;  1UHW A;  3D1N I;  3J81 K;  1G3W A;  2G7H A;  2E35 A;  3KP5 A;  2LY2 A;  3CUO A;  4A3D J;  3J81 Z;  1W7P A;  4II3 A;  1J9I A;  2CS3 A;  2ECC A;  3RYR A;  2PEX A;  3M1E A;  1WVR A;  3KEQ A;  3I3L A;  3KZI C;  1DU0 A;  1S29 A;  2L54 A;  3FWE A;  2BW3 B;  4G6T B;  4W1U A;  4S0H B;  1A5J A;  3ROU A;  1OFC X;  1F4K A;  4A3M J;  2QBY A;  4IQJ A;  3I4M J;  2W48 A;  3ZCO A;  3LSJ A;  3KYL A;  3FXM A;  1SAX A;  3ABM H;  3Q0W A;  2EPF A;  1EH8 A;  1U5T A;  3SZG A;  1BI0 A;  5D4S A;  2OQG A;  1X1D A;  3CZ6 A;  2GXA A;  2HOS A;  3SQN A;  3JTG A;  4B44 A;  3DEE A;  2FNP A;  2QF7 A;  4Y15 A;  2MSY A;  1Y39 A;  2Y0M A;  1VND A;  2E71 A;  2OQR A;  4U87 A;  2KMU A;  4ESB A;  1QZZ A;  5EFY A;  4MLO A;  5FKK A;  4NQW B;  3IAS 2;  2RHA A;  1Z9C A;  2BGC A;  3RKW A;  5D18 A;  1UB9 A;  1SAN A;  1IG7 A;  2ZCN A;  3LST A;  4RB2 C;  3OR2 C;  1FX7 A;  3P5J A;  5KVR A;  2ZJR F;  2IBD A;  1XMX A;  4AVP A;  4F55 A;  1QPI A;  1Z1D A;  1BC8 C;  2R5Z B;  3RDI A;  3KLN A;  3E7L A;  1P4A A;  1B8I B;  5IYC J;  4QWQ A;  3I4P A;  2G3B A; 
#chains in the Genus database with same CATH homology
 1H8A C;  2KT0 A;  3BQZ A;  3E7Q A;  5F1J A;  3JRA A;  2VPR A;  3QKX A;  1JUP A;  3BNI A;  3TW6 A;  3HOY J;  4D7N A;  3UKG A;  2JA5 J;  1AU7 A;  4QTR A;  3F0C A;  5IYB J;  3G1M A;  2HOA A;  3O8H A;  3ZQG A;  3S1R J;  1ZTR A;  5FKM A;  1JTY A;  1R9T J;  1TWC J;  2JK3 A;  2LTP A;  1GV5 A;  1SFO J;  1ZR4 A;  3HTJ A;  5C44 J;  3VVY A;  2YS9 A;  2AHQ A;  3GTL J;  1ETK A;  1WCM J;  2K9Q A;  4AC0 A;  3RH2 A;  3F1B A;  2O8K A;  3RD3 A;  2EZI A;  1I3Q J;  2NOG A;  2REK A;  5FMP A;  1ZR2 A;  4HKU A;  3HIM A;  2COB A;  3CCY A;  2ID3 A;  1FIA A;  5F0H A;  3LSG A;  1GDT A;  4IHX A;  3HBL A;  5HOD A;  3OOU A;  2UXP A;  4NEL A;  2G7S A;  2DJN A;  1CQT A;  1JTX A;  5IOZ A;  3COL A;  3ZQF A;  5IPA A;  5HSZ A;  1F36 A;  2PMZ N;  3S1M J;  4M3G A;  2EZL A;  4AUX A;  2TRT A;  4XID A;  2CUE A;  9ANT A;  4X1E A;  3IH3 A;  5C3E J;  4GCT A;  3BTL A;  1UMQ A;  2K9N A;  4FCY A;  4EEF G;  3VW1 A;  1ENH A;  2W53 A;  1Y1W J;  2L7Z A;  1DU6 A;  3VOX A;  2CRG A;  2HYJ A;  2JA6 J;  2NVQ J;  4I76 A;  2VI6 A;  5C4Y A;  3G1O A;  2FD5 A;  1GV2 A;  2LY9 A;  2TCT A;  4FE7 A;  5E3N A;  3HTI A;  1WPK A;  2Y31 A;  2DG7 A;  1RPW A;  4XIC A;  3GTG J;  3GZI A;  3CQZ J;  5F0C A;  2Y30 A;  2OI8 A;  3CDL A;  3A01 B;  2LR8 A;  3ON2 A;  4D5F A;  3GEU A;  2JWT A;  3BR1 A;  2O7O A;  3IH2 A;  1MBH A;  2XGC A;  3BTI A;  2QTQ A;  1ZGW A;  4QIW N;  1D5Y A;  4JX4 A;  2R5Y B;  4RBO A;  4NN1 A;  1MSF C;  1U78 A;  1HF0 A;  3HKZ N;  2JA8 J;  1ETY A;  2H1K A;  2R92 J;  3BCG A;  5DS9 A;  4G12 A;  5DTD A;  3NNR A;  5FHP A;  1WGX A;  2M0C A;  4PXI A;  2GUH A;  3TP0 A;  4UUT A;  1VFC A;  3RQI A;  3HGY A;  1ZKG A;  2CJJ A;  3WHB A;  2LVS A;  1LE8 A;  1IRZ A;  4MXM A;  5JLW A;  1TWH J;  1BL0 A;  1RES A;  2QCO A;  4QSH A;  4A93 J;  3NPI A;  2JMW A;  2JN6 A;  4C3I J;  1TWF J;  1GT0 C;  3GTK J;  1G2H A;  2NP3 A;  2WGB A;  5AQC A;  2LK2 A;  2ECB A;  1Q1V A;  3RZO J;  1APL C;  4XRM A;  4IHY A;  5C4X J;  3JRI A;  3BR0 A;  4MIM A;  3TP3 A;  4MK6 A;  2LFB A;  5M5Y J;  2EBI A;  1LFB A;  2LKX A;  1EF4 A;  2WAQ N;  5E3M A;  4J19 A;  3HDD A;  2FQ4 A;  4M3E A;  4C3H J;  1JJ8 C;  3EGQ A;  3MNL A;  3HOV J;  2LLK A;  4BBR J;  4JP0 A;  4ABZ A;  3VOK A;  4NDL A;  3PM1 A;  3TW7 A;  2M9H A;  3NAU A;  2XGD A;  2Y0S N;  2NVY J;  5EGO A;  1Y1V J;  5CXI A;  1GVD A;  4XRS A;  3G56 A;  4AC6 A;  1MSE C;  3FIS A;  3S16 J;  5FKL A;  4C2M J;  2E1O A;  3HOX J;  2DMQ A;  2E2I J;  2NVX J;  3LNQ A;  3VIB A;  2ZCM A;  2R93 J;  3HOU J;  3ANG A;  3BTC A;  4DW6 A;  1UI6 A;  3GTJ J;  1IC8 A;  3ZOB A;  1MBK A;  3ZQC A;  1FIP A;  2JJ7 A;  3JRG A;  2GLO A;  4DZP A;  3G1L A;  3MN2 A;  3SFI A;  1U8B A;  5D19 A;  1QVU A;  4BY7 J;  2KDZ A;  1GUU A;  4BKX A;  1JKQ C;  1IJW C;  2G7L A;  4AYB N;  4MO7 A;  1UHS A;  3PO2 J;  2UXO A;  3GTP J;  3CRJ A;  4DYR A;  2F07 A;  5GP9 A;  5DAJ A;  2HI3 A;  4A3B J;  3FK7 A;  3DEW A;  2ME6 A;  1QRY A;  2E2J J;  2YVE A;  2V57 A;  3OSG A;  3HM5 A;  5F08 A;  3KNW A;  1HOM A;  3VW0 A;  2L7F P;  3A02 A;  5IOY A;  2EZH A;  2X9D A;  2ZOY A;  4B4C A;  3LOC A;  2HOT A;  2DA1 A;  3DCF A;  1NK2 P;  3HOW J;  2YUS A;  1IGN A;  2XGE A;  5FLM J;  1WH5 A;  2HXO A;  2L7M P;  3K2A A;  2DTZ A;  4A3J J;  2XPW A;  2DA5 A;  3BR6 A;  2GM4 A;  1IDY A;  2DA4 A;  1PUF A;  3VVX A;  1AKH A;  4JNN A;  1MH4 A;  3ZQH A;  2P81 A;  1XS9 A;  2QKO A;  1A6I A;  1ORK A;  1PUF B;  3NXC A;  1AKH B;  5M3M J;  2CUF A;  1O4X A;  3M3Y J;  2GEN A;  3V78 A;  2HQ5 A;  2D5V A;  4MFE A;  3C07 A;  5HAW A;  1YRN A;  2QOP A;  4JL3 A;  2L0K A;  4FIS A;  1JT0 A;  3SDG A;  4A3E J;  3KKC A;  4L62 A;  3MVP A;  1JUS A;  1YRN B;  4YZE A;  3H3V K;  3VVZ A;  2R0Q C;  2VKE A;  1RKW A;  4A3C J;  2O7T A;  2ZB9 A;  1IUF A;  2QIB A;  5EYR A;  2ZOZ A;  3BG3 A;  1X2N A;  4JKZ A;  5J1U A;  2EH3 A;  2XRL A;  3LSP A;  3IV5 A;  1JKR C;  4M6V A;  5F04 A;  3ZQI A;  4GFB A;  2JA7 J;  2NVT J;  1TC3 C;  3S1N J;  4LOC A;  1F43 A;  5EZG A;  2XDN A;  5FKN A;  1U9O A;  4W97 A;  1FTZ A;  4DYC A;  2Y9Z A;  1HDD C;  3Q3S A;  2M34 A;  3QPS A;  2NS7 A;  1MBF A;  2PBX A;  3BG5 A;  2XPV A;  2MGQ A;  3BTJ A;  1OJL A;  4A69 C;  5CXG A;  1X58 A;  3B6A A;  2NP5 A;  2DA3 A;  2DMP A;  2HYT A;  3BJB A;  1XC5 A;  3JRC A;  3M4O J;  1JKO C;  3GTO J;  2OER A;  1H89 C;  3RKQ A;  2HKU A;  3L1P A;  1JJ6 C;  3W6V A;  2VUM J;  1LE8 B;  1W0U A;  1WH7 A;  5IP7 J;  2UXI A;  3B6C A;  3OIO A;  3RZD J;  2B63 J;  1B72 A;  2MG4 A;  5EDN A;  5K58 A;  2M2E A;  2DA7 A;  2QWT A;  2WUI A;  3BT9 A;  2YU9 J;  5IP6 A;  3S14 J;  5FLV A;  4Y52 J;  1B72 B;  5IYD J;  1Z77 A;  3K7A J;  3JSJ A;  4ACI A;  2G0E A;  2YVH A;  1MBJ A;  3FRQ A;  4ICH A;  4FTH A;  2FBQ A;  1HCR A;  4GFK A;  3B81 A;  3A03 A;  2E19 A;  4JX6 A;  2LD5 A;  4D5C A;  2FJ1 A;  3AQS A;  1ETV A;  1K61 A;  3C2B A;  4MFD A;  2Y9Y A;  3CMY A;  3CJD A;  3DPJ A;  3PO3 J;  2XPU A;  3S17 J;  2UXU A;  3EUP A;  5EGO B;  1OCT C;  3S2D J;  1VF9 A;  5M3F J;  1FTT A;  3H0G J;  3JRB A;  5GPA A;  5EG0 A;  3ANP A;  3JR9 A;  2DA2 A;  3SJM A;  2DMT A;  2R7Z J;  3BQY A;  5M5X J;  5F0F A;  5C4J J;  2CU7 A;  4C3J J;  1XG1 A;  1IDZ A;  3V6G A;  5EG0 B;  2DG8 A;  2N8G A;  1MBE A;  2Q24 A;  1S7E A;  1LFU P;  4UUS A;  1RKT A;  1P7J A;  4BY1 J;  2K9S A;  2DMU A;  3LJL A;  2GFN A;  5F27 A;  2X6O A;  1T33 A;  5IP9 J;  4UUS B;  4A3F J;  3IUV A;  5FGL A;  4AF5 A;  3FKI J;  1JUM A;  4RDU A;  4A3G J;  3BR5 A;  1FJL A;  5K7Z A;  4DZJ A;  2WV1 A;  4JYK A;  4UDS A;  3IH4 A;  3BR3 A;  3O8G A;  3QPL A;  3NRG A;  5J1Y A;  3G7R A;  4CGR A;  4A3I J;  1W0T A;  2O9L A;  3VUQ A;  4IHW A;  4B1R A;  1ZK8 A;  3VW2 A;  4JX5 A;  5BNG A;  3I4N J;  2AO9 A;  3QQA A;  1ETO A;  1JT6 A;  2DA6 A;  2K40 A;  3FIW A;  4Y7N J;  1U9N A;  1FEX A;  1ETQ A;  2DMN A;  5EEA A;  2HDD A;  4M3F A;  3JRF A;  3ZQL A;  4ME9 A;  4XK4 A;  5J1R A;  3HEF A;  3Q0V A;  3PAS A;  4A3K J;  2HXI A;  4V2G A;  5E3L A;  1JGG A;  1HLV A;  1BW5 A;  3QBM A;  3WHC A;  2UXH A;  3KZ9 A;  2CQX A;  2H8R A;  3HTH A;  2ELK A;  3HTA A;  1RET A;  1ETW A;  2LP0 A;  3HB9 A;  2G7G A;  4IHV A;  1MH3 A;  3S5R A;  1X2M A;  4BBS J;  1E3O C;  1IV6 A;  2IEK A;  1UG2 A;  5HBU A;  3Q0U A;  2NX4 A;  2XB0 X;  3CWR A;  1QVT A;  2RAS A;  1Z0X A;  3MKL A;  2WB1 N;  1BA5 A;  4KWA A;  5K7F A;  4FE4 A;  4A3L J;  3LHQ A;  1JKP C;  1K83 J;  4XRS G;  4X6A J;  2M8G X;  3TED A;  4B3A A;  5E3O A;  5D1R A;  4GCK A;  3BHQ A;  1AHD P;  5M5W J;  1WI3 A;  2PZ9 A;  2GBY A;  3PPB A;  1POG A;  2OPT A;  1T56 A;  4V2F A;  5FJ8 J;  4D7M A;  1UI5 A;  1NTC A;  1HDP A;  1ITY A;  2EQR A;  2FX0 A;  4GFL A;  3JRE A;  3HOZ J;  3A01 A;  3BRU A;  1BW6 A;  1NK3 P;  3KKD A;  2ID6 A;  1TWG J;  3JRH A;  1RR7 A;  2XSD C;  3D1N I;  3JRD A;  2R5Y A;  2CQQ A;  3P9T A;  2E2H J;  3HGG A;  3OSF A;  4A3D J;  4DYQ A;  5FKO A;  3VPR A;  2I10 A;  1MBG A;  2ECC A;  3AQT A;  3LWJ A;  3LSR A;  5GPC A;  1VI0 A;  3GTM J;  2VKV A;  3HE0 A;  1ZQ3 P;  1DU0 A;  4S0H B;  4W1U A;  1A5J A;  1OFC X;  4HNV A;  4A3M J;  2DN0 A;  3I4M J;  2W48 A;  2NS8 A;  3LSJ A;  3O60 A;  3Q0W A;  3VP5 A;  2L9R A;  5J3L A;  1OCP A;  1I6H J;  4GCL A;  2Y2Z A;  3BR2 A;  1H88 C;  2IU5 A;  1SGM A;  2HOS A;  1ETX A;  3GTQ J;  1BJZ A;  1P7I A;  2QF7 A;  3NAR A;  5JLX A;  4M3B A;  4CYC A;  3GBG A;  3ON4 A;  2MSY A;  1VND A;  1I50 J;  2ZCX A;  3BG9 A;  1MNM C;  5EFY A;  2MW8 A;  1TWA J;  4MLO A;  5FKK A;  2ME0 A;  4CYC B;  2OF7 A;  4IEJ A;  2RHA A;  2EZK A;  5D18 A;  2XB5 A;  3S15 J;  1IG7 A;  1SAN A;  2D6Y A;  2ZCN A;  3NI7 A;  3S1Q J;  2R5Z A;  4L5E A;  5H9T A;  2IBD A;  3FK6 A;  2RAE A;  1B8I A;  3T6N A;  2IAI A;  1QPI A;  5CW8 A;  4BXX J;  3S2H J;  4M3D A;  2R5Z B;  2X48 A;  1B8I B;  3E7L A;  5EZH A;  4I6Z A;  5IYC J;  5EF6 A;  5K7H A;  2G3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...