3VPRA

Crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
189
Chain Sequence
VTTTRDRILEEAAKLFTEKGYEATSVQDLAQALGLSKAALYHHFGSKEEILYEISLLALKGLVAAGEKALEVADPKEALRRFMEAHARYFEENYPFFVTMLQGIKSLSPENRLKTIALRDRHEENLRAILRRGVEQGVFREVDVALAGRAVLSMLNWMIRWFRPDGPMRAEEVARAYHDLILRGLERGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcriptional regulator, TetR family
publication title Transcriptional repression mediated by a TetR family protein, PfmR, from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 71
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3vprA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vprA02
3CRJA 5F0CA 2DA4A 3CMYA 5FGLA 5JLXA 3LSPA 5C3EJ 2DA1A 3B81A 3E7LA 4JYKA 4JX6A 2LK2A 1ETQA 4W97A 3ZQIA 4IHXA 3RZOJ 2QIBA 2L7ZA 4DYRA 3HOYJ 2Y2ZA 2O8KA 2HOTA 1K83J 4JKZA 4X1EA 2WV1A 4FE7A 1AU7A 3PO3J 3BR0A 2R5YA 1TWGJ 3DPJA 4NELA 2H1KA 5K7ZA 3VW0A 3HTHA 4I6ZA 4GCKA 3JRDA 2B63J 3GBGA 2NS7A 2COBA 1MBFA 3D1NI 4A3IJ 1JT6A 3PASA 2E2JJ 1HOMA 3A02A 4J19A 3S2HJ 2IBDA 1FEXA 5FLMJ 4YZEA 3A03A 2M8GX 2G3BA 2XGDA 1W0UA 3AQSA 3ON4A 4GFLA 5DS9A 4FE4A 1BW5A 1U9OA 4GFBA 2H8RA 3GTOJ 1BJZA 5E3OA 3QBMA 2CJJA 1QVTA 1ETYA 2W53A 1ORKA 2RAEA 1IV6A 2DA7A 5M5XJ 4JNNA 2W48A 5HSZA 1PUFA 3S1RJ 2GLOA 3HE0A 2YS9A 1LFBA 3HEFA 2ID3A 4DZPA 4RBOA 3JRCA 4M3DA 2XGCA 3DEWA 3ZQHA 3A01A 3BG5A 2PZ9A 3K7AJ 3NRGA 2HI3A 1NK2P 2XPVA 1MH4A 3BJBA 5FKKA 5IYDJ 1RETA 5DTDA 2Y31A 4M3GA 4NDLA 2WUIA 5EGOB 5J3LA 2ECBA 1BW6A 1ETOA 4ABZA 5M3MJ 3LJLA 3SJMA 3FIWA 4XRMA 2O7OA 4QTRA 2EBIA 1MSEC 3V78A 2TCTA 3IH4A 4BBRJ 1TC3C 4IHWA 5F08A 1I6HJ 4JX5A 3Q3SA 5HODA 5IPAA 1U8BA 2DG7A 3RH2A 4GFKA 3G1MA 2M9HA 4DYCA 1Y1VJ 2MSYA 3HKZN 4HNVA 2UXHA 4XRSA 1VI0A 1JTXA 1GV5A 2TRTA 3I4MJ 5JLWA 2UXUA 3F1BA 3LWJA 3G1OA 3MVPA 1FIAA 5EYRA 2MW8A 2JN6A 1UI6A 3FRQA 2KT0A 5C4JJ 3L1PA 5K7HA 3JR9A 1B8IA 2NOGA 1VF9A 3SFIA 3EGQA 2YUSA 3WHBA 3FK7A 3BG9A 3TP0A 1HLVA 1LE8B 4CYCA 3BTJA 4DYQA 1E3OC 3S17J 2MG4A 3Q0VA 3NAUA 5F0HA 3OSGA 3BR3A 4A3BJ 1IDZA 3FK6A 1JKQC 3RQIA 2K9QA 2LP0A 1AKHB 4X6AJ 2QTQA 2VPRA 4M3EA 2M2EA 1H8AC 2VUMJ 2CQXA 1OFCX 3LOCA 3CQZJ 4M3BA 4B4CA 3CCYA 1YRNA 2NP3A 1A5JA 5IYCJ 5IOZA 3C07A 1RESA 4MK6A 2Q24A 2ME0A 2L0KA 5FKLA 3GTQJ 4ICHA 1MBKA 5DAJA 3ZOBA 1EF4A 4C3HJ 5C4YA 2DJNA 1JUPA 4DW6A 2DMUA 1RR7A 3OOUA 5M5WJ 3BNIA 1MBEA 2PMZN 1XG1A 4ME9A 2DMPA 5AQCA 2E19A 2JA6J 3NI7A 5CW8A 2NS8A 5HAWA 5EG0B 3MKLA 4PXIA 3KNWA 4B3AA 4CGRA 5FKNA 4UUSB 2UXPA 1SGMA 3VVYA 1P7IA 2LVSA 3LSJA 3ZQCA 5D1RA 1IDYA 4Y52J 2QKOA 2WGBA 2DMNA 2P81A 2K9SA 3BQZA 2NVYJ 3CDLA 3HTIA 3LHQA 2NP5A 2LY9A 2OF7A 2XB5A 2DN0A 2G7LA 1ETVA 3BQYA 3F0CA 1GDTA 3NPIA 4NN1A 2AO9A 2R5YB 3E7QA 4AF5A 1MBJA 5EEAA 4FCYA 1Z0XA 1MBHA 4MFDA 3C2BA 3BR2A 3I4NJ 5E3NA 2CRGA 4D5FA 1F36A 4C3IJ 5IP9J 4EEFG 1RKTA 3RKQA 1NK3P 2GBYA 2XGEA 3MNLA 2R0QC 4A3MJ 4XK4A 3M3YJ 1XS9A 3M4OJ 4ACIA 4IEJA 1ZR4A 4QIWN 4BXXJ 4A3EJ 3NNRA 4B1RA 2NVTJ 3IUVA 3BTIA 4C3JJ 3S1QJ 2XRLA 1ETXA 2FD5A 4MLOA 3S14J 3HOVJ 5C4XJ 1UMQA 3BTCA 5BNGA 3BR6A 1JJ6C 3PM1A 1ENHA 3GTLJ 4UUTA 1D5YA 1HF0A 2VI6A 2G0EA 1X2MA 2NVQJ 3S2DJ 4A3DJ 3H0GJ 5IYBJ 3TW6A 3BCGA 2XSDC 2ZB9A 4W1UA 5EZGA 4FTHA 2R5ZB 2LLKA 2LD5A 1B72B 4HKUA 4S0HB 1WI3A 3P9TA 5HBUA 1NTCA 1Y1WJ 3LSRA 2JA8J 1XC5A 2QF7A 1DU0A 2NX4A 2D6YA 2HQ5A 1G2HA 5GPCA 2GFNA 2HYJA 1WH7A 2ZCMA 1GT0C 4I76A 1Z77A 2GENA 3O8HA 3HOUJ 3HTJA 2O9LA 4C2MJ 2MGQA 3HDDA 2F07A 3BT9A 4G12A 4BBSJ 1FJLA 3HGYA 2JWTA 4A3KJ 4Y7NJ 3BG3A 3S1MJ 1H89C 3B6CA 1H88C 2R92J 3JRFA 1WH5A 2HXOA 1ITYA 5EFYA 1JKOC 5C44J 4M6VA 5CXIA 2FJ1A 5IP6A 3S1NJ 2REKA 5D18A 3HOZJ 5FKMA 3ZQFA 3V6GA 2DA6A 2L7MP 2ZCNA 2OPTA 1TWCJ 3OSFA 1GUUA 1JJ8C 1AHDP 4A93J 1SFOJ 5EDNA 4XIDA 2L7FP 1JT0A 2FBQA 2HDDA 1MSFC 1JUSA 2LTPA 1AKHA 1ZK8A 1DU6A 3WHCA 5GPAA 1I3QJ 1OCTC 4BY7J 3DCFA 2FQ4A 3RZDJ 2KDZA 5GP9A 3NXCA 2CU7A 2VKEA 3FISA 1IGNA 3G56A 2ZCXA 1FIPA 3HB9A 1ZKGA 2QCOA 2XPWA 1IJWC 5D19A 3PPBA 2HYTA 4V2GA 3VW1A 1APLC 2X48A 3QKXA 3QPSA 2QOPA 3HOXJ 4GCLA 3EUPA 2ECCA 3BHQA 1VNDA 3O60A 3COLA 3BRUA 1W0TA 1HDDC 5J1UA 1UG2A 1JKPC 5F04A 1I50J 1UHSA 1ZTRA 1ZQ3P 5E3MA 2FX0A 3BR1A 2DA2A 4JP0A 3T6NA 2HXIA 3IH2A 5EG0A 2LR8A 1POGA 3MN2A 2I10A 4UUSA 3HTAA 3HGGA 2N8GA 3OIOA 4A3FJ 2R7ZJ 1JTYA 3GTPJ 1RPWA 3FKIJ 2HKUA 5H9TA 4AC0A 3ZQLA 1WPKA 2LFBA 3S16J 1SANA 4XRSG 3VW2A 3GTKJ 2ID6A 3Q0WA 3JRIA 4QSHA 3NARA 1LFUP 3ON2A 5FMPA 2DA3A 3W6VA 2G7GA 2DMQA 1TWHJ 5IOYA 3HIMA 4L62A 2K40A 2JJ7A 5F1JA 3TP3A 3O8GA 3VPRA 1TWFJ 9ANTA 4BKXA 3VIBA 4A3JJ 2HOSA 3HOWJ 1GV2A 2XPUA 1MNMC 2RASA 2M34A 3KKDA 2CUFA 5E3LA 5FJ8J 3JRHA 2LKXA 3VUQA 4BY1J 2ZOYA 5K58A 5FKOA 2EZLA 3KKCA 4MFEA 3ANGA 4AYBN 3JSJA 5CXGA 2CUEA 4A3CJ 1ZR2A 4A3GJ 3S15J 2X9DA 1CQTA 1PUFB 3S5RA 1HCRA 3JRAA 3UKGA 5F27A 2CQQA 3ZQGA 2M0CA 2UXIA 2JA5J 3AQTA 3QPLA 4XICA 3A01B 3SDGA 1Q1VA 2VKVA 3PO2J 3JREA 4A3LJ 1T56A 2G7SA 1MBGA 3GTJJ 2OI8A 2IU5A 1IG7A 2O7TA 2EH3A 1F43A 5EGOA 1HDPA 5EF6A 2IEKA 2JA7J 1A6IA 3G7RA 3TEDA 1QPIA 3B6AA 3G1LA 3LSGA 4A69C 2Y9YA 2R5ZA 1B72A 1FTZA 3CWRA 3VVZA 5EZHA 5M3FJ 2AHQA 3K2AA 4IHYA 2OERA 2ELKA 2JK3A 5M5YJ 3JRBA 3JRGA 1U9NA 2DG8A 4JX4A 2ME6A 3LNQA 5FLVA 1BA5A 4AC6A 3HBLA 3TW7A 1RKWA 2EZIA 4GCTA 5IP7J 1O4XA 3H3VK 1TWAJ 2HOAA 2RHAA 1VFCA 3RD3A 2UXOA 3BTLA 4V2FA 1S7EA 5F0FA 1BL0A 2K9NA 2QWTA 1JGGA 5J1RA 3GTMJ 1R9TJ 4LOCA 2Y30A 2JMWA 4JL3A 4D7NA 1OCPA 4UDSA 4DZJA 1UI5A 2EZKA 3GTGJ 2EZHA 3IV5A 1X58A 3GZIA 5J1YA 1P7JA 1WGXA 2L9RA 4MXMA 2Y9ZA 2DA5A 4RDUA 1LE8A 3IH3A 1QVUA 2DTZA 1MH3A 4MO7A 4D5CA 5K7FA 1ZGWA 3CJDA 1IRZA 1B8IB 2EQRA 3HM5A 2E1OA 2E2HJ 2E2IJ 3BR5A 2DMTA 2IAIA 2D5VA 2YU9J 2YVEA 4CYCB 1IC8A 1FTTA 1IUFA 2X6OA 4MIMA 1K61A 3ANPA 2GUHA 1ETWA 2Y0SN 1JUMA 4M3FA 4FISA 4AUXA 1X2NA 2GM4A 2NVXJ 1OJLA 3GEUA 2PBXA 3QQAA 2ZOZA 3VOXA 1T33A 1WCMJ 3KZ9A 2R93J 5FHPA 1QRYA 1YRNB 4IHVA 2XDNA 3VVXA 1ETKA 2WB1N 1U78A 2XB0X 3VOKA 1JKRC 2V57A 2YVHA 4D7MA 2WAQN 3Q0UA 3VP5A 4KWAA 1GVDA 4L5EA
chains in the Genus database with same CATH superfamily
5B1BH 3CRJA 2HDCA 2JPCA 2R7TA 2HPMA 1X3ZB 2JRMA 1PP8F 3ASOH 3E7LA 5JFRA 1MNEA 2EILH 1QGPA 2CG4A 3EUHC 4IHXA 3V7CA 2R7XA 2L7ZA 5DM6F 4FHTA 2X6YA 2O8KA 3ML6A 4PSXA 1FT9A 1K83J 2FRHA 2L4MA 3M1EA 4R1HA 3MZYA 3GZ6A 4BE2A 3L7WA 2CW0F 2OZ6A 1IF1A 2W4SA 3KEYA 1Y0NA 4RAGA 4AIJA 3ECOA 4HBLA 3H5AA 1FWZA 3BZKA 3HTHA 4C2MA 3JRDA 2HNHA 2X4HA 4HLYA 4F7ZA 4LIVA 3HSEA 1MBFA 3D1NI 4A3IJ 1JT6A 2IBDA 1FEXA 2H6CA 5FLMJ 1YO5C 1X1AA 4ZYDA 1ZELA 3A03A 2V7FA 3GUDA 2V1NA 1FMVA 1P6RA 3ON4A 4BJ6C 2H1LA 5DS9A 5EJCA 4HPQA 3IP4B 2LKPA 1FZPB 2EIJH 2H8RA 5FFZA 3QBMA 5DEQA 1QVTA 3EDPA 5KAFC 4MQ9F 2V4JC 3KP5A 1CGPA 3OYFA 2K86A 2W48A 4OIRF 1IRXA 2YS9A 2ZXIA 4CZZA 1QBJA 4L0YB 1KONA 2ID3A 1KA8A 4M3DA 3A01A 3S32A 4ESBA 3NRGA 2KHMA 2HI3A 2PBIA 3ZMZA 4MNUA 1A35A 2JSPA 5FKKA 2EV5A 3N97A 1MMDA 4GXOA 4AD9A 2DBBA 4I0AA 4L9TA 4EGZA 4I0BA 2BW3B 3B02A 4BS9A 3DTIA 2L54A 2WUIA 3CUQC 5EGOB 3CCRI 2ECBA 1BW6A 1ETOA 2PMUA 2EINH 1FNNA 4ABZA 5M3MJ 3SJMA 4E4HA 1IXCA 2MLKA 4OD4A 2JUGA 2E60A 3CMEI 1MSEC 2CV0A 4BBRJ 1TC3C 4IHWA 5F08A 3OL3A 1VQKI 5ILUA 3HSRA 4JX5A 4A5MA 1IRFA 5HODA 4F3QA 4PJLA 1TW3A 3GFMA 2VT3A 2BHYA 3W6KB 3GFLA 3U1KA 1JTXA 1GV5A 3KYLA 1RNLA 1WJEA 3RDIA 2GXGA 1XB4A 3LMMA 2EIMH 5CVUA 5TISC 1VF9A 4I02A 1R7JA 1F4KA 2K9LA 3WHBA 2HDWA 3FK7A 2G7UA 3BG9A 5LHGA 2DDBA 3I71A 3K6GA 4HA8A 3KX2A 1W36D 2Z1DA 2PI0A 1W5CC 3F9KA 3Q0VA 3BG7A 3CCQI 1O3TA 2HQRA 1JHFA 3BR3A 2CQKA 1MJBA 1IDZA 3FK6A 1BIBA 3CJTB 1O57A 2QTQA 2KFDA 1XMAA 2R7OA 1SEUA 1UHWA 3HC7A 1XGNA 1UCRA 3LOCA 2EIKH 1YW7A 3CCYA 2NP3A 2EWNA 3P9CA 4RMNA 3D0SA 3DV8A 2X51A 3K2ZA 4P9FA 1I5ZA 3T8TA 1MBKA 5DAJA 1BR2A 2DMUA 1MJ9A 5CVVA 1WQ2A 4HYEA 4ME9A 3I59A 1R71A 1Z21A 2E19A 5CW8A 1VQOI 4IVNA 3DTEA 2IS1A 4B3AA 4CGRA 2KIFA 2UXPA 3P5JA 1P7IA 5D1RA 1DUXC 1TNTA 3KETA 1JI8A 2QKOA 2WGBA 2P81A 2K9SA 3BQZA 1BR4A 3OIQA 5HNHA 4HV5A 1XMXA 3FHZA 2OF7A 3HOSA 4C2TA 2G7LA 2FSWA 1P4XA 4NN1A 2AO9A 2R5YB 1T08B 3H3ZA 3IHUA 5LEJA 3WTUC 4OAYA 3RIRA 2QLZA 2DDAA 2ZC2A 4BAYA 1V3FA 3GYHX 4L9JA 4MFDA 3ELKA 3OYLA 1XCVA 1FYKA 3I4NJ 2RKHA 3FXRA 2I5UA 4I99C 4CCOA 1BC7C 1LVAA 1F36A 2OCCH 2QQAA 5CVIA 2VONA 4UB6C 3WTZA 4I09A 1WJCA 1RKTA 1HKSA 1W7PA 3CUOA 1VQ6I 2GBYA 5HS7A 4R79A 1E3PA 3MNLA 1PJRA 2CMPA 4A3MJ 3M3YJ 3OY9A 3H35A 4QIWN 3IWFA 4A3EJ 2V1UA 4BHCA 3QAHA 1ZAOA 2PJRA 5BS6A 1RC9A 3CJRB 3S1QJ 1TP4A 3S14J 4ESJA 5BNGA 3H0DA 1UHMA 3MMYB 3T1BA 3PSIA 3E6MA 1ERDA 1OQYA 3GTLJ 1SD5A 2RNGA 1UELB 1Z67A 1YIJI 1HF0A 3GVAA 3GZNB 3S2DJ 4M72A 1Y0UA 4O5VA 5JI6A 2XSDC 1L0OC 1EJ9A 5EZGA 3V7RA 3MWMA 2LD5A 2LLKA 4IXAA 3LSHA 3TKYA 1GHCA 1YIOA 2VOPA 4IKFA 4MGRA 1V54H 4MEYF 3SYTA 3BCAA 1OISA 2Z9OA 2Y0SA 1XC5A 3HIFA 3KCCA 2L3DA 1DPRA 2PN6A 3DWLE 1E3HA 4G7ZF 2GFNA 1WJDA 3I64A 3KYDB 4I76A 3VOEA 2Q2EA 3TMOA 3MEXA 3O8HA 4LMYA 1B9NA 2WA0A 4HOBA 1XGMA 3EETA 3J7ZI 2QKLB 4G12A 2DYSH 1FOXA 2QUFA 1ON2A 4OOIA 3ULQB 1FJLA 3GF2A 2JWTA 4A3KJ 2B1EA 4HF1A 1H88C 1ZRCA 3JRFA 1ITYA 1I3AA 1TZLA 2VJ5A 1BOBA 5DCMA 5C44J 5E17F 1R1TA 4LG0B 4YFNF 3K8PC 4IOCF 5HOOA 3SEZA 1QNTA 4BDYA 1DP3A 4C9YA 2OPTA 3OSFA 1K79A 1GUUA 3BJOA 3TDUC 1AHDP 3F72A 4XKBA 1OLTA 4CXFA 1TT0A 2L7FP 4UV9A 1JT0A 4NUBA 4QPOA 3RSNA 1JUSA 2DTRA 2LTPA 5E1ZB 1I3QJ 4HLXA 3DCFA 5A2QZ 4HSRA 3PNTA 1YJWI 3KP6A 1NH3A 3OIPA 3G56A 2LMDA 3KZZA 4HV6A 3HB9A 3GFIA 3DTKA 1APLC 2X48A 5TGTA 5D6EA 4XLCA 4OIQF 3DKYA 3H3UA 3U1DA 2P8TA 3O60A 1SFEA 1RR8C 3WG9A 1T39A 1W0TA 2M45A 1UG2A 1R58A 5FRMA 2CGPA 1I50J 4IRHA 2DFIA 5E3MA 2LF8A 4EVIA 4JP0A 3IH2A 5EG0A 2WADA 2VQGA 4U7BA 5ICGA 3MN2A 3HTAA 3B73A 3L00A 3BLYA 3MFKA 2HKUA 3GTPJ 1OCRH 1RPWA 3FKIJ 2IGOA 4AC0A 2CO5A 1FOWA 2HKXA 1WPKA 2BGCA 1UJ8A 4IF4A 2WV0A 5AIQA 5E8IA 5IT9Z 2J5PA 1B4AA 2K27A 3DEEA 3DKXA 4XN3A 4A0ZA 5J4YA 3ON2A 5FMPA 3L2VA 3DU5A 3K4JA 3W6VA 3RYRA 3HIMA 4A5NA 2DCEA 1T6SA 2NRAC 3TL4X 3ZN0A 3E6BA 2E1MC 3O8GA 2Q8KA 1MZBA 3WTWC 3NEUA 1EA3A 9ANTA 2VJIA 2HTJA 4U87A 1GV2A 1MNMC 1U2WA 4QWQA 1KYWA 4BY1J 2IRFG 2CWEA 4CCNA 3R0AA 2BVMA 1MIJA 2XROA 3S15J 1KYZA 2CQQA 1BI2A 2JA5J 4DGWB 1A6QA 3AL0B 3A01B 1OCCH 3SDGA 3JREA 1AA7A 4XR6A 4CDGA 4KISA 1T56A 2MH9A 4EV0A 2F5CA 2EH3A 2F5VA 5EGOA 3HPHA 4ZJZA 2JA7J 2STTA 1KU2A 3G1LA 3LSGA 4IRGA 2Y9YA 3VEPA 3CWRA 1DDNA 2R7DA 5DUKA 4IRVA 1TT5B 3K2AA 4LLLA 3JRBA 2E7XA 3LNQA 3PIOF 3OYHA 2A69F 2IGKA 3KZYA 4A6EA 1F1ZA 2ZKZA 2EZIA 1P92A 1FPQA 4BU2A 3H3VK 2DQRA 4ZYAA 2UXOA 4O3MA 1S7EA 4ENMA 1S7OA 3JSOA 2M8EA 3MKYB 2CFXA 1FBUA 4B09A 1HKQA 3R0JA 4H4KC 2DPUA 2Y30A 2B0LA 4JL3A 2XF7A 4AVPA 2AQEA 4UDSA 4DZJA 1UI5A 3EPZA 2FOKA 5K5RA 5J1YA 4RB1A 4J00A 5LGUA 2Y9ZA 4RDUA 5L3GA 1YX5A 2VQCA 1IRZA 4PFPA 2E2IJ 4F55A 2ZJ2A 2A61A 3LA3A 5HDNA 2X6OA 2JVHA 4OAZA 1JXSA 2O0YA 3ANPA 2GUHA 1ETWA 2E71A 1JUMA 4LJZF 4FISA 4HEA2 4M3FA 3MZHA 3GEUA 3E3VA 3I56I 3S3OA 4BE1A 2R93J 1UG0A 4CSWA 3D5RC 4IHVA 3PL8A 1ETKA 2WB1N 2HR3A 1U78A 2XB0X 4HQEA 1IN6A 2PFBA 2VKHA 3PFIA 3LA2A 4D7MA 5LEKA 4E7JA 4EM0B 1N78A 2XKPA 5DYMA 2KIUA 3VP5A 4PDKA 2H94A 1EH8A 5F0CA 3VODA 3I59B 4WXHA 1UAAA 3RZOJ 1QZZA 3TDZC 3MQ0A 4HF2A 4Z2YA 2WV1A 3FX3A 3JAMZ 2R5YA 4AM3A 1D0XA 1TWGJ 1QZEA 1N77A 5LRRA 5L3EA 2QZ8A 4CCKA 4LD5A 3I54A 2JQ7A 1LFPA 2H1KA 3KEQA 2RVCA 2FF4A 1R6RA 2LNBA 2PQ8A 4HDUA 1U8RA 4GCKA 3F8BA 1MD0A 3GZ5A 3EYYA 4IO9F 2GZWA 4BDZA 2E2JJ 1IO2A 4J19A 3A2KA 2LY2A 1TBXA 4YZEA 2G3BA 1IUYA 2XGDA 4G6DA 4BQQA 4JK1X 1LNWA 4FE4A 5J6XA 1BW5A 4RGUA 1ZREA 2O8XA 3ZQQA 3GTOJ 4ZTJA 1XX5A 1E0EA 2CJJA 2DOFA 2WBMA 1ETYA 2RAEA 2VBYA 2GXBA 2DT5A 2DJIA 2BBYA 1MJAA 1T95A 2DA7A 1ONVA 5B1AH 2ACJA 2PJRB 1DPUA 5HSZA 2FJI1 3S1RJ 1YG2A 2LREA 4ZC3A 4CH7A 5ED4A 3BZ6A 4RGRA 4RBOA 4U88A 2FUG2 3RTRA 4ZZLA 2OTLI 2XGCA 3DEWA 3ZQHA 2PZ9A 3BG5A 3ZP5A 2GA2A 3J7AO 1NK2P 2A05A 2IJLA 2OU2A 2OTJI 1EKEA 3KPHA 3OYCA 4KYWA 1BI1A 2DLLA 3BJBA 1Z1DA 2ZBKA 4XKCA 1X1DA 2ICWG 2B3WA 1U5TA 2OV7A 1RETA 4HAMA 4M3GA 1ZGAA 3L2CA 2CW8A 2ZSHB 3HRMA 1U3EM 3KLOA 4BACA 2A07F 3QOEA 2K9MA 2O7OA 4RS8A 3NRVA 5LHHA 3L2WA 3V78A 5LFAA 2TCTA 3IH4A 5JHFA 3CJQB 1I6HJ 2GIZA 4NQWA 2KIQA 4LFUA 5IPAA 2KJCA 1YJ9I 3RH2A 4GFKA 3G1MA 4I2OA 3HL2A 2RREA 2XV4S 5DCFA 3BWGA 4HNVA 2K3FA 1D1AA 2PMZA 2UXHA 1VI0A 3EUAA 3F23A 1SVLA 2P5LC 2UXUA 1FIAA 1KQ8A 3CDHA 2MABA 2JN6A 5DCMB 1TQIA 3FRQA 5C4JJ 3L1PA 3JR9A 5ILSA 4PK4A 2ZXHA 1YJNI 2NOGA 4LG3A 2ZSIB 2IXSA 1C0WA 3EGQA 2YUSA 2D45A 3TP0A 4ENKA 1LE8B 3BTJA 2Z3YA 2XAFA 3F6VA 3S17J 2MG4A 3ERMA 2KJBA 1F5TA 3RQIA 3GFJA 3J80K 2IA0A 4M3EA 2M2EA 4P96A 4IJAA 4CO8A 2CQXA 5KAIC 4M3BA 5CKTA 1WZ2A 2VN2A 2OQGA 4AIHA 1YRNA 3D5SC 1A5JA 2PEXA 5D4SA 3C07A 1MNDA 1RESA 1JGSA 2DU9A 2FBKA 3HYIA 4XLHA 5F6FA 2VKDA 3V8LA 4MK6A 1R00A 3GTQJ 2VC0A 4PFOA 1FBQA 4C3HJ 2EV6A 2LH9A 2DK8A 3NS4A 2L02A 4C2UA 5C4YA 4DW6A 2O6GE 1IW7F 1RR7A 4BEHA 3QYBA 5M5WJ 3BNIA 2QSGX 4AYBA 1K4TA 5HAWA 4CCMA 5EG0B 3KP2A 2WC2A 4PXIA 3S3MA 3CTAA 3ZMTA 2OCEA 2AS5F 2LVSA 2BXZA 1IDYA 2ZNYA 2DMNA 4GGGA 1V5FA 2Y69H 2A6HF 2NP5A 2LY9A 3QPHA 3S8PA 2MBFA 2OC6A 1RRJA 2DN0A 3LAPA 3F0CA 4GYGA 5ICCA 1YHQI 2V9VA 3QOPA 4Y4RA 1MBJA 3HRTA 4FCYA 2OA4A 3PUBA 4EJWA 3WU1B 1D5VA 3N4MA 4B8XA 1Z0XA 1MBHA 4L5JA 2KZVA 2DOEA 1S8NA 4Q4ZF 3WODF 3Q5FA 3SEQA 4C3IJ 2HOEA 4A0XA 3PQJA 4ZH4F 2XSJC 3W3CA 2DODA 5DM7F 1HBXG 2ETHA 2XGEA 4XK4A 4L0ZB 4KFCA 3M4OJ 4ACIA 1ZR4A 3SHFA 2KMUA 4ZDPA 2OAZA 2R7WA 2IPQX 1SAXA 1P4AA 4C3JJ 4MLOA 3E5XA 3K1NA 3OYAA 1P4WA 1WSUA 2PMHA 1JJ6C 3PM1A 3BG6A 4UUTA 2K4JA 1D5YA 2VI6A 2G0EA 5J4VA 5LRSA 1X2MA 2M1BA 1G3YA 3TOBA 5FROA 2KQRA 4NHJA 3BCGA 4KITB 4KJZA 2ZB9A 4W1UA 4DQ2A 2YVXA 1YW9A 3IL2A 2X0LA 2GA1A 3R61A 2Q1ZB 3L2RA 5FGMA 3IAM2 4R8HA 4S0HB 1WHUA 1YW8A 4F93B 5HBUA 2DT6A 2MC4A 4RAFA 5HLHA 2VLAA 1Y1WJ 2D1HA 1FSHA 4CUGA 1DU0A 2OZUA 2HQ5A 4ETSA 2XAQA 5ICFA 3VYRB 4II2A 5HLGA 2HYJA 3WTVC 4GCVA 1GT0C 2IS2A 5DUIA 2GWRA 3M07A 1J75A 2L4AA 2L2OA 3HOUJ 2HQAA 2O9LA 3HTJA 4QLCU 2ADUA 3HDDA 2ZXJA 1XDUA 1ZG3A 3WGGA 2ZJPF 2GOXB 2V9PA 3HGYA 3K4LA 1H9TA 3TOAA 2QSFX 1H89C 2BVLA 3B6CA 2R92J 2HU9A 3S1MJ 1WH5A 3C1DA 4A0YA 1W36C 5EFYA 4UVBA 1J09A 2X1CA 3WE3A 3X2QH 3D5LA 5CXIA 4L5IA 5E79C 4IHSA 5IP6A 5D18A 5GAEJ 1NG7A 3RQ4A 4M6YA 1OCZH 2DA6A 2ZCNA 3U2RA 1JJ8C 2ZY9A 4XQFA 3DEUA 4U0VA 5EDNA 2FBQA 2LF7A 1H0MA 3Q9SA 2W84A 3M1CA 1MSFC 1AKHA 5H6RA 3OWTA 2OJED 3QU6A 3RKYA 2PLYA 4WX9A 2FQ4A 3RZDJ 2UWMA 3V42A 1YLFA 5GP9A 2VKEA 3KEOA 1EV7A 1ZKGA 5FLXK 2FXAA 3PPBA 3CLOA 4V2GA 4HW0A 3VW1A 4B43A 1Q1HA 2L01A 4NNJA 3QKXA 2QOPA 4JQFA 2R3SA 1KQ0A 3ECHA 1SFXA 3SQNA 1WFXA 4U0YA 4XLFA 3VFZA 1ODDA 1JKPC 5D8LB 3AKZA 2R4GA 2VXZA 3QP5A 2H09A 2HXIA 5E8GA 2I10A 1J0RA 4G94A 3HGGA 4ENNA 3OIOA 2DPDA 4I01A 2VPLA 5H9TA 1PP7U 1V55H 2DFEA 4XSZF 1LDJA 1U5TC 2W1OA 3HPGA 3BOQA 3DXJF 1VQPI 3F22A 3IUOA 2VBWA 1SANA 3O6BB 2VIXA 4HNTA 1J5YA 5LLQA 3GTKJ 3DKWA 2ID6A 1I1GA 3VSKA 1G3SA 2VASA 3NARA 3KE2A 3JRIA 2CYYA 2DA3A 4LB6B 4BQNA 5BQTA 3ESWB 2JPBA 1ZLJA 1YX3A 3C2HA 3K4BA 4HZFA 1YITI 3VPRA 2YX4A 2K4BA 4CGZA 1ZG1A 1FSEA 1MMGA 5FD5A 3HOWJ 1LEAA 3LSTA 2CUFA 4OMZA 5E3LA 3JRHA 1IRGA 2ZOYA 2NS0A 1IN4A 2HTSA 3LL7A 3EUKL 3ANGA 4BJTA 3JSJA 5CXGA 2CUEA 4A3CJ 1HA8A 4KUMA 3P9KA 4LK0F 3S5RA 3LSMA 4UVAA 3JRAA 5F27A 3PFYA 2UXIA 1ON1A 1XD7A 4YRVA 2A5YB 2KRCA 1G3WA 5FB2A 4S04A 1BOAA 4A3LJ 5BPIA 3WTXC 3JTHA 2QQ8A 1YQAA 3GTJJ 4CICA 3HHHA 4ZZDA 5CVJA 2O7TA 1HDPA 3QP6A 2IEKA 3DBRB 2ZMEA 3DP7A 3LWFA 4L9VA 1U5TB 4GYIA 2LG4A 2R5ZA 4A69C 1FTZA 3J81K 1D1BA 5EZHA 2CSOA 2AHQA 5B3SH 3LQQA 5M3FJ 1WJ5A 4MTEA 1R5HA 1V5GA 3BY6A 1KGSA 3F8FA 3IC7A 5FLVA 2BZTA 5D4RA 2K02A 4IOAF 4UB8C 1I27A 5KVRA 2K7LA 2Q0OA 5EEGA 3S2WA 3OYEA 1O4XA 3SWHA 1TWAJ 2VODA 4XRFA 1VFCA 4NQWB 3OR1C 3H1CA 1FP2A 2WAQA 4FX4A 2XF5A 5F0FA 3H5RA 4RB3C 2VBXA 2QWTA 3AFHA 4RB2C 2ESNA 4LLGF 2HWVA 1MGTA 3DF8A 3LQRA 2EZHA 2XDVA 1X58A 3IRQA 1WGXA 4E7KA 1R23A 4MXMA 2DA5A 1LE8A 1MH3A 4MO7A 5K7FA 1Z3YA 1ZGWA 1X1BA 2FE3A 2E2HJ 3HM5A 4IZZA 4RLFA 3TQNA 2HQNA 2IAIA 1R5GA 2YU9J 4F92B 1FTTA 2CUZA 1IUFA 5FRNA 4MIMA 3DPTA 1U6GA 1K61A 4EATA 2M30A 2NAZA 4K2EA 3LFKA 1YOVB 1NHAA 3OYJA 2PBXA 2M5WA 1T33A 1WCMJ 3F8MA 1UB9A 3QODA 1FYLA 2EPFA 3GLXA 1K4SA 2K5CA 2Z99A 2CV2A 1YRNB 3RKXA 3E0JB 2BY1A 3K70C 4A2UA 3DPLC 1G3TA 2VOOA 3HUGA 1NG6A 1XN7A 5L3BA 4FETA 2V79A 2CH0A 3BZCA 3AL0C 1T0FA 2ZFUA 3CMYA 1D8JA 5JLXA 4BEHB 2MLGA 3HSFA 5C3EJ 2HYGD 2DA1A 2IGNA 4JYKA 4BQAA 2ISYA 1ETQA 2K85A 5ICEA 5D5UB 4KIBA 4BH9A 4KT5C 2QIBA 3OV8A 3HOYJ 2Y2ZA 4YEJA 2HOTA 4JKZA 3C18A 3RI4A 4GO1A 4X1EA 4FE7A 3LAJA 1AU7A 3BR0A 4HRIA 5HLTA 2A5WA 2QA4I 1Z3XA 3DPJA 1RI7A 2UUZA 3FDYA 5H20A 2B63J 3FZVA 3GBGA 2MC3A 2Z2SB 3HZJA 3K1MA 3WGIA 4KNYA 2A68F 1FX7A 1OPCA 4LB5A 1T38A 2ZO4A 1S29A 2M4KA 3A02A 4UXNA 2COMA 2NXNB 2PG4A 4G6TB 5D8KB 1XGOA 1E17A 3DU6A 3QRFF 1M1EB 2JUCA 2ZFWA 4XORA 2Y48A 3AQSA 2EA2A 2UV1A 4PGGA 1USSA 4GDFA 4XKWA 2V26A 2HFHA 5FD6A 2NYXA 1BJZA 1BJAA 1I6XA 1SMTA 5E3OA 1XDSA 2W85A 2W53A 1ORKA 5H2FC 3W2VA 1TL8A 2P7CB 3WE2A 1RIOH 2GLOA 1OR7A 3QU3A 1WRJA 3KZIC 3L9FA 4B48A 1T98A 3R4KA 4DZPA 3JRCA 2V1DA 1QPMA 4XOPA 4XN0A 3K7AJ 4U7DA 1BI3A 1IAWA 2LC2A 4ZDLA 2XPVA 3E6CC 2DW4A 1MH4A 5JVTA 1SD6A 1O3QA 4BNCA 4G7OF 2KZGA 2BOLA 1Z91A 3PSFA 4X0GA 3TBIA 2Y31A 1SVOA 4NDLA 1IN7A 2QWWA 2XVCA 2JZYA 3ZMDA 1SVMA 3CCLI 3OS1A 1B59A 5K5OA 4QTRA 1T8IA 3WU0A 1XGSA 3F8CA 4IQJA 5B5EC 1FY7A 4B44A 3FMRA 2QSHX 1D0YA 2MA3A 3Q3SA 1U8BA 2DG7A 5ILVA 4HG2A 4IL6C 5DD4A 2M9HA 1X1CA 3SZPA 2LDUA 2LRDA 4DYCA 5K5QA 4Y17A 2MSYA 3HKZN 2CFOA 4PJMA 3L2UA 1USTA 5CQEA 1IV8A 4XRSA 2TRTA 1IXRC 5JLWA 3F1BA 3LWJA 2YU3A 1R49A 3G1OA 2DFHA 2E34A 5EYRA 5BOXA 5KK1A 1K6OA 4XLAA 2EFPA 3QYEA 1UI6A 2BEOA 3WG7H 2KT0A 5E20A 2QVOA 4YFKF 3SFIA 4OD5A 1K6YA 1BR1A 1QU3A 4CYCA 1Y39A 4NB5A 2R7SA 2X1EA 1W5SA 3NAUA 3ERED 3CZ6A 4A3BJ 2O5RA 2LP0A 1AKHB 4X6AJ 2VPRA 3VWBA 4P1WA 1WJBA 3IKVA 3CQZJ 2Z16A 3CCSI 4B4CA 3H36A 3OYMA 4XSXF 1OYYA 3FBIB 5IYCJ 3CUQA 2HPIA 2V9KA 1IN8A 4L9NA 5CLSA 1UZCA 2A3SA 1G6NA 3PUFA 3DBLB 3OL4A 3MAJA 2L0KA 1SD7A 3ZOBA 1LB2A 1EF4A 5CVRA 1Z05A 3PJRA 4HX4A 2QGUA 3CJNA 4D0PA 1XCBA 1MBEA 2PMZN 1XG1A 2HS5A 2IS6A 2DMPA 5AQCA 2JA6J 3NI7A 2NS8A 4N9IA 3I53A 3PQKA 4AWXB 3KNWA 3HTSB 1XMKA 5FKNA 1T2KA 1SGMA 3HRSA 1LQ1A 3LSJA 3VYUB 4Y52J 2OD5A 3MKZA 2ZMEC 1J9IA 3SZTA 3CDLA 3HTIA 4V19K 2XASA 3FMSA 3CLQA 2DOAA 2F48A 2PFVA 1BN5A 2JTVA 1ETVA 3NPIA 2WWYA 4AU7A 1LKXA 3G2BA 4AF5A 3FM5A 4CCLA 1S6LA 2EA4A 3BR2A 5CYVA 3ZRGA 1XSXA 2L5QA 1VQ7I 6PAXA 2XKOA 4N4NB 5IP9J 4HSTA 2UXXA 5KHDA 2IA2A 4EEFG 2L7KA 1G59A 4TV7A 1KU3A 4G6QA 5AIPA 2DAOA 1Z6RA 2Y0MA 2DK5A 4XOTA 1PYVA 1NK3P 2KPMA 3J7YJ 1MDMA 2CS3A 4KN7X 4IEJA 4UHTA 2NVUB 3NNRA 2LKSA 4FASD 3BTIA 4B3XA 2XRLA 1ETXA 1EH7A 3ZMUA 1HC8A 3DLLF 3BR6A 2M7BA 4C30A 1S5LC 2L9NA 3ZMSA 1P9QC 4M74A 1OKRA 3FKJA 4WF2A 4A3DJ 3C3WA 5IYBJ 1BC8C 2ZMEB 2QQ9A 2F4IA 3R60A 4FTHA 2R5ZB 4HKUA 2DQLA 2QYOA 2VJJA 1GXPA 2QBYA 1W5TA 4KICA 1GLNA 4DBQA 2TDXA 1AWCA 2EFNA 2LOOA 3P9TA 2HVQA 1WI9A 4Y15A 5D5XB 4U9NA 4P55A 2QF7A 2E1CA 2NX4A 2D6YA 1G2HA 5GPCA 1TQPA 3HTUA 3FMQA 5TJJA 3ZXSA 2ZXWH 1WH7A 4UV8A 3KIOA 1P2FA 2ZCMA 2H8WA 4JOMA 1Z77A 2MYSA 2GENA 1IXSB 1LJ9A 2WB1A 2KISA 4E7IA 3OS0A 4XL9A 4C2MJ 2XAJA 5LD2C 2D2WA 2IS4A 2JSCA 2NNNA 4E7LA 2IP2A 3ONQA 1QQIA 3A1YA 3GXOA 1VQMI 3E5QA 3CC7I 2LBFB 4ZDOA 2M3AA 1XTAA 3BC8A 1I1SA 2HXOA 2F2EA 1JKOC 1ZG5A 2VE8A 2P5VA 4B47A 4EJUA 2FU4A 2FJ1A 2REKA 3ZQFA 2L9SA 3QPTA 4M9ZA 2L7MP 4UVCA 1TWCJ 2EB7A 4A93J 3J7AY 3F8NA 3RKWA 4XIDA 3ZGKA 2BY2A 1WVRA 5E1XA 1TNSA 5D5VB 1ZK8A 1Z6TA 1DU6A 3AG4H 3CMAI 5GPAA 2FNAA 3ZN1A 1OCTC 2KRFA 2KDZA 4FT8A 3N05A 3NXCA 3KFWX 2CU7A 3FISA 2ZCXA 1FIPA 1S7AA 2XPWA 1IJWC 5D19A 3Q9VA 2F5EA 2XIGA 1O3RA 2RQQA 1TW2A 2IW5A 2X6WA 5A2QK 1MMSA 4WCGA 3QPSA 1FMWA 1VQLI 3G3ZA 3HOXJ 2F5DA 1K78A 4G8XA 3JSPA 2RDPA 1VZ0A 3HUGB 3EUPA 1KZHA 4H0EA 1V5EA 3OYBA 4GCLA 1VNDA 2GOMA 2R7RA 1X3UA 1OR7C 4MTDA 4BHBA 2HZDA 1UHSA 1ZTRA 2IVMA 2FX0A 5J8FA 2DA2A 3ABMH 4OINF 2AXLA 1MKMA 1GXQA 3SFZA 4UUSA 2W7NA 4L18B 1W4MA 2ESHA 2N8GA 1QHGA 2R7ZJ 4N9HA 3P9IA 5L3CA 4AIKA 2A6EF 4N4OB 4J01A 3ZQLA 2LFBA 4DNCA 3H92A 3BP8A 1PUEE 3BROA 3S16J 1O7LA 1X4OA 2QKMB 5EEHA 1LFUP 1WJAA 5GTIC 2G7GA 1GVJA 5IT9K 2M7AA 3K4CA 2D1VA 3FWEA 3FXUA 5F1JA 1OMIA 3KP3A 2E36A 1OYWA 2VJ4A 4NC7A 4EM2A 4CYDA 4RB0A 1VTNC 3ABTA 4NBQA 4Z6YA 3VIBA 2HOSA 2HZTA 2XPUA 2RASA 3K1PA 4XLNF 5J47A 1B6AA 3KKDA 2CQNA 4E7SA 2E35A 4A6DA 5K58A 5FKOA 1K7AA 2CQ7A 3ABUA 3CF5F 2O3FA 4HF0A 2MD5A 3P7NA 5B66C 1CQTA 1H9GA 4WK8F 4BL0B 5BMZA 3GO5A 1HCRA 3REOA 2M0CA 2WTEA 3AQTA 4XICA 4G9YA 1KU9A 3DLAA 3CD6I 3PO2J 1SFKA 1LEBA 2E7WA 3BPXA 1B9MA 2G7SA 3CC2I 1MBGA 2OI8A 2GXAA 1HSJA 2FEZA 2QENA 2RV8A 2DO7A 4ENJA 1B72A 4KIFA 3AAFA 3T0YA 4RGXA 2OERA 3ZR8X 2ELKA 2JK3A 1EH6A 1DGWY 3JRGA 3A0HC 2DG8A 2ME6A 4GCTA 1RKWA 3CP2A 3VYTB 5IP7J 2YSRA 4Q48A 5FO5A 2HOAA 1TQMA 3GMEA 3CO7C 1WWXA 3GX4X 3WGHA 3FXOA 1VQNI 2RN7A 2R7VA 4P9UA 4V2FA 4S05A 2RNJA 4G7HF 4OMYA 2K9NA 1R5ID 1HW5A 2OUMA 1JGGA 3VDXA 1UFMA 3R6SA 1WJFA 3GTMJ 3A0BC 2ZJRF 1R1VA 2XAHA 2HKOA 1R9TJ 4UY8I 2JMWA 1CF7A 3BDDA 3SXYA 1OCPA 4RAYA 3KYCB 4OWRB 2RC4A 3E1SA 2JT1A 3IV5A 3GZIA 4LIUA 1P7JA 2L9RA 4LK1F 1ZYRF 3VYSB 5L3FA 2B9SA 1QVUA 2DTZA 4PZJA 4D5CA 4KMUX 3ZQ7A 2IA1A 2E1OA 2QQBA 1FLIA 3FXQA 3BR5A 4EJTA 4HX7A 2DMTA 2R7UA 3EYIA 2QEXI 4CYCB 1Z9CA 2A6TA 1YS7A 3C2GA 3IRRA 1Y8QB 2Y0SN 4AUXA 3MCZA 2FNPA 3FF5A 2NVXJ 1OJLA 4PJJA 3QQAA 4HNUA 3VOXA 2VL8A 1YE9A 4M73A 4AIDA 5LGNA 2IT0A 5H6QA 2P7VB 3KZ9A 3I0TA 2IGMA 5FHPA 4EQQA 2XDNA 3VVXA 4BGDA 3CUQB 2YR2A 3VOKA 4XONA 1JKRC 2XAGA 2V57A 2YVHA 2WAQN 3Q0UA 4BE0A 4HX8A 1MMAA 4OU0A 4KWAA 1GVDA 1ACIA 2DA4A 5FGLA 2FOWA 3LSPA 3B81A 4WWCA 4JX6A 2VQHA 2X6XA 2LK2A 3GWZA 4W97A 3CCJI 3ZQIA 2P5KA 3GCMA 4CHUA 4DYRA 3W2AA 2E5NA 2G7HA 3CDIA 4A12A 3PO3J 4KA4A 3VTIA 3I58A 1YI2I 5CQGA 4NELA 5K7ZA 3VW0A 2DT7B 3JAMK 4I6ZA 2FMLA 4RAZA 1G4DA 2EFQA 2H6BA 2NS7A 1X4PA 4XLEA 1Z7LA 2COBA 3ROUA 4FQGA 4WIBA 4EJOA 3PASA 1HOMA 4BYYA 3S2HJ 1J2XA 2M8GX 3M9AA 1LUJB 4BHPA 4BXFA 1W0UA 4GFLA 4I7HA 3RPUD 3H5NA 1U9OA 1ZARA 3S93A 3TGNA 2BE5F 2K3PA 4GFBA 3OOPA 3CMMA 2F6CA 1MDMB 2ISZA 1IV6A 1N25A 5M5XJ 3ASNH 4RM2A 4JNNA 4WXDA 2EFOA 3AG3H 1PUFA 5HLIA 1RZ4A 3HE0A 1LFBA 3WTSC 1RUNA 3HEFA 4U9LA 2JVGA 2BXYA 5DD8A 5CJ9A 2FBHA 3PNVA 3RCOA 5IYDJ 3OYIA 3LFUA 3G4SI 2XC7A 4IRIA 1SD4A 2EK5A 3FXLA 5DTDA 4ITVA 3M8EA 2GQQA 2LYCA 2QBYB 3NWTA 5J3LA 3BCBA 4KN4X 3LJLA 1QO0D 3FIWA 5CPRB 4XRMA 3WTYC 4PJNA 2EBIA 3KP4A 2W25A 2MFZA 3OMYA 4IX7A 3O3KA 3IAS2 5HVQC 3DPUA 4F52A 4F91B 2ZNZA 1XSDA 4O6JA 4II3A 2LBFA 2OBPA 2I8DA 2XAUA 2LSOA 1Y1VJ 3GEZA 2DFFA 5LGTA 3F21A 3I3LA 4BJ5C 4RLQA 1ULYA 3JTGA 2YPRA 3FXKA 3WU2C 3I4MJ 1DP7P 2Z33A 1U0JA 3MVPA 2MW8A 1A36A 3FM3A 4LGWA 1BBYA 2XHKA 4BQOA 3I4PA 5JHUA 2C6YA 5K7HA 2PX9A 1B8IA 1S3JA 4NC6A 1HLVA 3HHGA 3J80Z 4DYQA 2FA5A 1E3OC 2MH2A 5JVGF 4QPQA 5F0HA 3OSGA 4MHGA 5DV5A 1YFHA 2V6EA 4IPAA 1JKQC 5GAGJ 2HVRA 2K9QA 1OCOH 1D0ZA 3QYFA 3T5XA 3UR3C 4LITA 1HSTA 4CA0A 2BY0A 1H8AC 2VUMJ 2EFWA 1OFCX 3H9GA 3K4KA 1TTYA 3M8FA 3G6EI 4YIRX 3UNGC 2XF6A 2GIVA 1HXDA 3EQLF 2E5ZA 2VQLA 2ELJA 3AG1H 3PNYA 4PSWA 5IOZA 3OYNA 3OR2C 2P0WA 2VC1A 2WY7Q 5HNFA 1VQ9I 2Q24A 2ME0A 4I98B 5FKLA 4ICHA 1K78B 1MMNA 2JRTA 1IN5A 1BM9A 1FOYA 2M0MA 1IZ1A 2DJNA 1JUPA 3W6JB 3LSIA 2DI3A 1Y56A 3AG2H 3KLNA 3OOUA 2A2FX 1VQ8I 1B1BA 3CCEI 5JR3A 2F5FA 2UXNA 1VQ5I 2MD0A 3MKLA 4HDVA 4EMSA 1SMYF 2UZKA 4UUSB 3K70D 1KU7A 3VVYA 5IT3A 4E70A 4KDPA 3ZQCA 3E97A 2WAEA 1L3LA 2W57A 4IHTA 2NVYJ 3CESA 3LHQA 1PVEA 2P4WA 3H9QA 2X85A 2XB5A 3BQYA 1GDTA 3TO6A 3HJEA 3K0LA 5FFXA 2OQRA 4DOZA 3E7QA 1MW7A 2XGXA 4DVYP 1F9NA 1HW1A 5EEAA 2F4MB 1J59A 3WTTC 4E6KG 3OYKA 3C2BA 3V8JA 4DJAA 5TRDA 4MEXF 2E1NA 2EV0A 2B7EA 1AOYA 5E3NA 2CRGA 2GAUA 4D5FA 2Y75A 3V8KA 4EM1A 4JBAA 2XRNA 4WXCA 3U9GA 5LHIA 2HGCA 2FBIA 3K4NA 3RKQA 5IY5H 4UUVA 2VT2A 2R0QC 4YIIA 4Q5SF 1XS9A 1QA6A 3CF2A 4BXXJ 4RGSA 5DDGA 4B1RA 1YTYA 1Z7UA 2NVTJ 3IWZA 3IUVA 3JCUC 2FD5A 5C4XJ 3HOVJ 1HW2A 1KQ9A 1UMQA 3BTCA 5GTHC 2FQ3A 4M9XA 3EUHA 4PGHA 1ENHA 5GADJ 2WAFA 1YYVA 5BPDA 5D6FA 1FYMA 1X3WB 2NVQJ 2DYRH 3H0GJ 2O61A 3TW6A 1N75A 3HRUA 2BW3A 5L3DA 1B72B 2V1XA 4ASNA 4KT6A 5J8CA 5HDGA 4E7ZA 3G71I 5KNLA 1WI3A 1NTCA 2JA8J 3LSRA 1SAUA 3ABKH 5LBQA 2VE9A 2M87A 2VXDA 1S9HA 4E7HA 3LSKA 2ELHA 5E18F 3TO9A 5HDKA 4D1QA 4BXUA 5KCMA 1RUOA 3M7GA 3GLLA 5ERIA 1SC7A 1X19A 4ZYHA 1A04A 2E1MB 5GAHJ 2MGQA 2KDOA 4Q47A 2P6TA 2F07A 3BT9A 1FC3A 2V6CA 3I55I 4BBSJ 1CF7B 5D5WB 3M8JA 4YFXF 4Y7NJ 2QM3A 3BG3A 1TLHB 3NWSA 3VB2A 4OIPF 4ANJA 3O2PE 3ISPA 4M6VA 3CCVI 3G73A 1LPQA 3QWLA 3S1NJ 3HOZJ 4MQVA 5FKMA 1E2XA 3V6GA 3RJPA 4XNFA 1SFOJ 3U21A 1JE8A 1BI0A 1YS6A 2KP6A 2R7QA 2HDDA 3DFGA 1R4NB 4KIGA 3K10A 1J7KA 2LY1A 1BIAA 3WHCA 3HG9A 5FLXZ 4BY7J 1ZLKA 3OYDA 4XBFA 1ZRFA 4Y3OA 4U0WA 3NQOA 3RPQA 1IGNA 1Y8RB 1R36A 4YELA 2QCOA 4RA2A 4NC8A 5E1WA 1R1UA 2HYTA 4ZYEA 2W00A 5F1RA 2NNYA 2KRHA 3COAC 3HXLA 3I9V2 1S72I 1ZH5A 2KL4A 2ECCA 2VBZA 3BHQA 3BPVA 3COLA 3BRUA 1HDDC 3GW2A 2RQPA 3K69A 1W7PD 5J1UA 4XLPF 3A4CA 5F04A 3T8RA 4XKVA 1ZQ3P 4DBRA 3BR1A 3FBNB 4GRIA 3T6NA 2G9WA 4ESFA 3CC4I 1SFUA 2KIMA 2LR8A 1POGA 1VQ4I 2W24A 1ZHFA 4XMYA 1STZA 4A3FJ 1JTYA 3H9JA 3FHNA 3TO7A 2CV1A 4D9JA 2EJRA 5K1YA 2Z5UA 1HQCA 2YX7A 1WKMA 1XPXA 1DGRM 4XRSG 1FOKA 3VW2A 1D1CA 1ZN2A 3Q0WA 2ZCWA 2BV6A 3JW4A 4QSHA 4PJ0C 1R22A 4UNOA 2DMQA 1TWHJ 5IOYA 1V4RA 2H27A 4L62A 2K40A 2JJ7A 1DQUA 1XSVA 5AONA 3TP3A 4ON0A 4EJVA 2DXIA 4Y13A 3VSLA 1QZYA 1TWFJ 4BKXA 4A3JJ 1R4MB 3HOTA 2M34A 5FJ8J 3E5UA 4M71A 3W2WA 2LKXA 2PJPA 3VUQA 1PDNC 2EZLA 4YIFA 3KKCA 4MFEA 4AYBN 4Y33A 2FMYA 3BJAA 4PUSA 3V7SA 1ZR2A 1W7PB 3CCMI 4A3GJ 2NOJB 2VB6A 2O03A 2X9DA 4KMFA 1PUFB 3CO6C 3UKGA 3HKZA 3ZQGA 2X1DA 3QPLA 2J5OA 3MKWB 1Q1VA 2VKVA 3RYPA 1Y6IA 4OIOF 4ZYGA 3J81Z 2IU5A 3L2QA 1IG7A 3OS2A 1F43A 5EF6A 4FX0A 3CCUI 2WY8Q 3ZMVA 1A6IA 3G7RA 3TEDA 4N0BA 3S3NA 1QPIA 3B6AA 3VVZA 3F6OA 4HQMA 2KKOA 1HKTA 4AVZA 3F3XA 3PIPF 1O3SA 4IHYA 4M9SA 1FBSA 5M5YJ 1X1PA 1A31A 1U9NA 4AC6A 4JX4A 1BA5A 3ABLH 3K4MA 3FXJA 3HBLA 3TW7A 1JHHA 1G8XA 4DIQA 3RPUA 1T0FC 2RHAA 3RD3A 3KP7A 3BTLA 3ZPLA 3C7JA 1LDDA 3I5UA 1BL0A 1LDKB 4EGYA 2RGVA 2STWA 5J1RA 2XUBA 3IKTA 4LLNA 5F64A 4LOCA 1REPC 2CUJA 1D8KA 2Q2EB 3MZ8A 4P5OA 4D7NA 2AQFA 3CP8A 2EZKA 2F4OB 2M4GA 2BY3A 3GTGJ 1I39A 1D3YA 4YG2F 2R7FA 2AXTC 2BHZA 3IH3A 3CJDA 2JA2A 2EQRA 4LG0A 1B8IB 5J40A 2D5VA 2YVEA 4BUPA 1OYIA 1QHHD 3OYGA 1IC8A 4PCQA 2L9VA 4CZCA 2HEOA 2HVSA 3L09A 4RM3A 2ZJQF 4IQ4A 1O7FA 2GM4A 3V4GA 5HS8A 1X2NA 3E6DA 2ZOZA 2KLOA 1FP1D 4CCJA 3SZGA 2CW7A 3SDBA 4ZTFA 1W1WE 3DQVC 3K9TA 5HS9A 1QRYA 2W82A 3DBHB 3BJ6A 3MD2A 2P6SA 1ZGJA 1LVKA 3ZCOA 4M6XA 3LA7A 2HYFA 1ZRDA 4XM3A 2BYVE 3FXMA 4L5EA
chains in the Genus database with same CATH topology
3CRJA 5F0CA 2DA4A 3CMYA 5FGLA 5JLXA 3LSPA 5C3EJ 2DA1A 3B81A 3E7LA 4JYKA 4JX6A 2LK2A 1ETQA 4W97A 3ZQIA 4IHXA 3RZOJ 2QIBA 2L7ZA 4DYRA 3HOYJ 2Y2ZA 2O8KA 2HOTA 1K83J 4JKZA 4X1EA 2WV1A 4FE7A 1AU7A 3PO3J 3BR0A 2R5YA 1TWGJ 3DPJA 4NELA 2H1KA 5K7ZA 3VW0A 3HTHA 4I6ZA 4GCKA 3JRDA 2B63J 3GBGA 2NS7A 2COBA 1MBFA 3D1NI 4A3IJ 1JT6A 3PASA 2E2JJ 1HOMA 3A02A 4J19A 3S2HJ 2IBDA 1FEXA 5FLMJ 4YZEA 3A03A 2M8GX 2G3BA 2XGDA 1W0UA 3AQSA 3ON4A 4GFLA 5DS9A 4FE4A 1BW5A 1U9OA 4GFBA 2H8RA 3GTOJ 1BJZA 5E3OA 3QBMA 2CJJA 1QVTA 1ETYA 2W53A 1ORKA 2RAEA 1IV6A 2DA7A 5M5XJ 4JNNA 2W48A 5HSZA 1PUFA 3S1RJ 2GLOA 3HE0A 2YS9A 1LFBA 3HEFA 2ID3A 4DZPA 4RBOA 3JRCA 4M3DA 2XGCA 3DEWA 3ZQHA 3A01A 3BG5A 2PZ9A 3K7AJ 3NRGA 2HI3A 1NK2P 2XPVA 1MH4A 3BJBA 5FKKA 5IYDJ 1RETA 5DTDA 2Y31A 4M3GA 4NDLA 2WUIA 5EGOB 5J3LA 2ECBA 1BW6A 1ETOA 4ABZA 5M3MJ 3LJLA 3SJMA 3FIWA 4XRMA 2O7OA 4QTRA 2EBIA 1MSEC 3V78A 2TCTA 3IH4A 4BBRJ 1TC3C 4IHWA 5F08A 1I6HJ 4JX5A 3Q3SA 5HODA 5IPAA 1U8BA 2DG7A 3RH2A 4GFKA 3G1MA 2M9HA 4DYCA 1Y1VJ 2MSYA 3HKZN 4HNVA 2UXHA 4XRSA 1VI0A 1JTXA 1GV5A 2TRTA 3I4MJ 5JLWA 2UXUA 3F1BA 3LWJA 3G1OA 3MVPA 1FIAA 5EYRA 2MW8A 2JN6A 1UI6A 3FRQA 2KT0A 5C4JJ 3L1PA 5K7HA 3JR9A 1B8IA 2NOGA 1VF9A 3SFIA 3EGQA 2YUSA 3WHBA 3FK7A 3BG9A 3TP0A 1HLVA 1LE8B 4CYCA 3BTJA 4DYQA 1E3OC 3S17J 2MG4A 3Q0VA 3NAUA 5F0HA 3OSGA 3BR3A 4A3BJ 1IDZA 3FK6A 1JKQC 3RQIA 2K9QA 2LP0A 1AKHB 4X6AJ 2QTQA 2VPRA 4M3EA 2M2EA 1H8AC 2VUMJ 2CQXA 1OFCX 3LOCA 3CQZJ 4M3BA 4B4CA 3CCYA 1YRNA 2NP3A 1A5JA 5IYCJ 5IOZA 3C07A 1RESA 4MK6A 2Q24A 2ME0A 2L0KA 5FKLA 3GTQJ 4ICHA 1MBKA 5DAJA 3ZOBA 1EF4A 4C3HJ 5C4YA 2DJNA 1JUPA 4DW6A 2DMUA 1RR7A 3OOUA 5M5WJ 3BNIA 1MBEA 2PMZN 1XG1A 4ME9A 2DMPA 5AQCA 2E19A 2JA6J 3NI7A 5CW8A 2NS8A 5HAWA 5EG0B 3MKLA 4PXIA 3KNWA 4B3AA 4CGRA 5FKNA 4UUSB 2UXPA 1SGMA 3VVYA 1P7IA 2LVSA 3LSJA 3ZQCA 5D1RA 1IDYA 4Y52J 2QKOA 2WGBA 2DMNA 2P81A 2K9SA 3BQZA 2NVYJ 3CDLA 3HTIA 3LHQA 2NP5A 2LY9A 2OF7A 2XB5A 2DN0A 2G7LA 1ETVA 3BQYA 3F0CA 1GDTA 3NPIA 4NN1A 2AO9A 2R5YB 3E7QA 4AF5A 1MBJA 5EEAA 4FCYA 1Z0XA 1MBHA 4MFDA 3C2BA 3BR2A 3I4NJ 5E3NA 2CRGA 4D5FA 1F36A 4C3IJ 5IP9J 4EEFG 1RKTA 3RKQA 1NK3P 2GBYA 2XGEA 3MNLA 2R0QC 4A3MJ 4XK4A 3M3YJ 1XS9A 3M4OJ 4ACIA 4IEJA 1ZR4A 4QIWN 4BXXJ 4A3EJ 3NNRA 4B1RA 2NVTJ 3IUVA 3BTIA 4C3JJ 3S1QJ 2XRLA 1ETXA 2FD5A 4MLOA 3S14J 3HOVJ 5C4XJ 1UMQA 3BTCA 5BNGA 3BR6A 1JJ6C 3PM1A 1ENHA 3GTLJ 4UUTA 1D5YA 1HF0A 2VI6A 2G0EA 1X2MA 2NVQJ 3S2DJ 4A3DJ 3H0GJ 5IYBJ 3TW6A 3BCGA 2XSDC 2ZB9A 4W1UA 5EZGA 4FTHA 2R5ZB 2LLKA 2LD5A 1B72B 4HKUA 4S0HB 1WI3A 3P9TA 5HBUA 1NTCA 1Y1WJ 3LSRA 2JA8J 1XC5A 2QF7A 1DU0A 2NX4A 2D6YA 2HQ5A 1G2HA 5GPCA 2GFNA 2HYJA 1WH7A 2ZCMA 1GT0C 4I76A 1Z77A 2GENA 3O8HA 3HOUJ 3HTJA 2O9LA 4C2MJ 2MGQA 3HDDA 2F07A 3BT9A 4G12A 4BBSJ 1FJLA 3HGYA 2JWTA 4A3KJ 4Y7NJ 3BG3A 3S1MJ 1H89C 3B6CA 1H88C 2R92J 3JRFA 1WH5A 2HXOA 1ITYA 5EFYA 1JKOC 5C44J 4M6VA 5CXIA 2FJ1A 5IP6A 3S1NJ 2REKA 5D18A 3HOZJ 5FKMA 3ZQFA 3V6GA 2DA6A 2L7MP 2ZCNA 2OPTA 1TWCJ 3OSFA 1GUUA 1JJ8C 1AHDP 4A93J 1SFOJ 5EDNA 4XIDA 2L7FP 1JT0A 2FBQA 2HDDA 1MSFC 1JUSA 2LTPA 1AKHA 1ZK8A 1DU6A 3WHCA 5GPAA 1I3QJ 1OCTC 4BY7J 3DCFA 2FQ4A 3RZDJ 2KDZA 5GP9A 3NXCA 2CU7A 2VKEA 3FISA 1IGNA 3G56A 2ZCXA 1FIPA 3HB9A 1ZKGA 2QCOA 2XPWA 1IJWC 5D19A 3PPBA 2HYTA 4V2GA 3VW1A 1APLC 2X48A 3QKXA 3QPSA 2QOPA 3HOXJ 4GCLA 3EUPA 2ECCA 3BHQA 1VNDA 3O60A 3COLA 3BRUA 1W0TA 1HDDC 5J1UA 1UG2A 1JKPC 5F04A 1I50J 1UHSA 1ZTRA 1ZQ3P 5E3MA 2FX0A 3BR1A 2DA2A 4JP0A 3T6NA 2HXIA 3IH2A 5EG0A 2LR8A 1POGA 3MN2A 2I10A 4UUSA 3HTAA 3HGGA 2N8GA 3OIOA 4A3FJ 2R7ZJ 1JTYA 3GTPJ 1RPWA 3FKIJ 2HKUA 5H9TA 4AC0A 3ZQLA 1WPKA 2LFBA 3S16J 1SANA 4XRSG 3VW2A 3GTKJ 2ID6A 3Q0WA 3JRIA 4QSHA 3NARA 1LFUP 3ON2A 5FMPA 2DA3A 3W6VA 2G7GA 2DMQA 1TWHJ 5IOYA 3HIMA 4L62A 2K40A 2JJ7A 5F1JA 3TP3A 3O8GA 3VPRA 1TWFJ 9ANTA 4BKXA 3VIBA 4A3JJ 2HOSA 3HOWJ 1GV2A 2XPUA 1MNMC 2RASA 2M34A 3KKDA 2CUFA 5E3LA 5FJ8J 3JRHA 2LKXA 3VUQA 4BY1J 2ZOYA 5K58A 5FKOA 2EZLA 3KKCA 4MFEA 3ANGA 4AYBN 3JSJA 5CXGA 2CUEA 4A3CJ 1ZR2A 4A3GJ 3S15J 2X9DA 1CQTA 1PUFB 3S5RA 1HCRA 3JRAA 3UKGA 5F27A 2CQQA 3ZQGA 2M0CA 2UXIA 2JA5J 3AQTA 3QPLA 4XICA 3A01B 3SDGA 1Q1VA 2VKVA 3PO2J 3JREA 4A3LJ 1T56A 2G7SA 1MBGA 3GTJJ 2OI8A 2IU5A 1IG7A 2O7TA 2EH3A 1F43A 5EGOA 1HDPA 5EF6A 2IEKA 2JA7J 1A6IA 3G7RA 3TEDA 1QPIA 3B6AA 3G1LA 3LSGA 4A69C 2Y9YA 2R5ZA 1B72A 1FTZA 3CWRA 3VVZA 5EZHA 5M3FJ 2AHQA 3K2AA 4IHYA 2OERA 2ELKA 2JK3A 5M5YJ 3JRBA 3JRGA 1U9NA 2DG8A 4JX4A 2ME6A 3LNQA 5FLVA 1BA5A 4AC6A 3HBLA 3TW7A 1RKWA 2EZIA 4GCTA 5IP7J 1O4XA 3H3VK 1TWAJ 2HOAA 2RHAA 1VFCA 3RD3A 2UXOA 3BTLA 4V2FA 1S7EA 5F0FA 1BL0A 2K9NA 2QWTA 1JGGA 5J1RA 3GTMJ 1R9TJ 4LOCA 2Y30A 2JMWA 4JL3A 4D7NA 1OCPA 4UDSA 4DZJA 1UI5A 2EZKA 3GTGJ 2EZHA 3IV5A 1X58A 3GZIA 5J1YA 1P7JA 1WGXA 2L9RA 4MXMA 2Y9ZA 2DA5A 4RDUA 1LE8A 3IH3A 1QVUA 2DTZA 1MH3A 4MO7A 4D5CA 5K7FA 1ZGWA 3CJDA 1IRZA 1B8IB 2EQRA 3HM5A 2E1OA 2E2HJ 2E2IJ 3BR5A 2DMTA 2IAIA 2D5VA 2YU9J 2YVEA 4CYCB 1IC8A 1FTTA 1IUFA 2X6OA 4MIMA 1K61A 3ANPA 2GUHA 1ETWA 2Y0SN 1JUMA 4M3FA 4FISA 4AUXA 1X2NA 2GM4A 2NVXJ 1OJLA 3GEUA 2PBXA 3QQAA 2ZOZA 3VOXA 1T33A 1WCMJ 3KZ9A 2R93J 5FHPA 1QRYA 1YRNB 4IHVA 2XDNA 3VVXA 1ETKA 2WB1N 1U78A 2XB0X 3VOKA 1JKRC 2V57A 2YVHA 4D7MA 2WAQN 3Q0UA 3VP5A 4KWAA 1GVDA 4L5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRJ A;  5F0C A;  2DA4 A;  3CMY A;  5FGL A;  5JLX A;  3LSP A;  5C3E J;  2DA1 A;  3B81 A;  3E7L A;  4JYK A;  4JX6 A;  2LK2 A;  1ETQ A;  4W97 A;  3ZQI A;  4IHX A;  3RZO J;  2QIB A;  2L7Z A;  4DYR A;  3HOY J;  2Y2Z A;  2O8K A;  2HOT A;  1K83 J;  4JKZ A;  4X1E A;  2WV1 A;  4FE7 A;  1AU7 A;  3PO3 J;  3BR0 A;  2R5Y A;  1TWG J;  3DPJ A;  4NEL A;  2H1K A;  5K7Z A;  3VW0 A;  3HTH A;  4I6Z A;  4GCK A;  3JRD A;  2B63 J;  3GBG A;  2NS7 A;  2COB A;  1MBF A;  3D1N I;  4A3I J;  1JT6 A;  3PAS A;  2E2J J;  1HOM A;  3A02 A;  4J19 A;  3S2H J;  2IBD A;  1FEX A;  5FLM J;  4YZE A;  3A03 A;  2M8G X;  2G3B A;  2XGD A;  1W0U A;  3AQS A;  3ON4 A;  4GFL A;  5DS9 A;  4FE4 A;  1BW5 A;  1U9O A;  4GFB A;  2H8R A;  3GTO J;  1BJZ A;  5E3O A;  3QBM A;  2CJJ A;  1QVT A;  1ETY A;  2W53 A;  1ORK A;  2RAE A;  1IV6 A;  2DA7 A;  5M5X J;  4JNN A;  2W48 A;  5HSZ A;  1PUF A;  3S1R J;  2GLO A;  3HE0 A;  2YS9 A;  1LFB A;  3HEF A;  2ID3 A;  4DZP A;  4RBO A;  3JRC A;  4M3D A;  2XGC A;  3DEW A;  3ZQH A;  3A01 A;  3BG5 A;  2PZ9 A;  3K7A J;  3NRG A;  2HI3 A;  1NK2 P;  2XPV A;  1MH4 A;  3BJB A;  5FKK A;  5IYD J;  1RET A;  5DTD A;  2Y31 A;  4M3G A;  4NDL A;  2WUI A;  5EGO B;  5J3L A;  2ECB A;  1BW6 A;  1ETO A;  4ABZ A;  5M3M J;  3LJL A;  3SJM A;  3FIW A;  4XRM A;  2O7O A;  4QTR A;  2EBI A;  1MSE C;  3V78 A;  2TCT A;  3IH4 A;  4BBR J;  1TC3 C;  4IHW A;  5F08 A;  1I6H J;  4JX5 A;  3Q3S A;  5HOD A;  5IPA A;  1U8B A;  2DG7 A;  3RH2 A;  4GFK A;  3G1M A;  2M9H A;  4DYC A;  1Y1V J;  2MSY A;  3HKZ N;  4HNV A;  2UXH A;  4XRS A;  1VI0 A;  1JTX A;  1GV5 A;  2TRT A;  3I4M J;  5JLW A;  2UXU A;  3F1B A;  3LWJ A;  3G1O A;  3MVP A;  1FIA A;  5EYR A;  2MW8 A;  2JN6 A;  1UI6 A;  3FRQ A;  2KT0 A;  5C4J J;  3L1P A;  5K7H A;  3JR9 A;  1B8I A;  2NOG A;  1VF9 A;  3SFI A;  3EGQ A;  2YUS A;  3WHB A;  3FK7 A;  3BG9 A;  3TP0 A;  1HLV A;  1LE8 B;  4CYC A;  3BTJ A;  4DYQ A;  1E3O C;  3S17 J;  2MG4 A;  3Q0V A;  3NAU A;  5F0H A;  3OSG A;  3BR3 A;  4A3B J;  1IDZ A;  3FK6 A;  1JKQ C;  3RQI A;  2K9Q A;  2LP0 A;  1AKH B;  4X6A J;  2QTQ A;  2VPR A;  4M3E A;  2M2E A;  1H8A C;  2VUM J;  2CQX A;  1OFC X;  3LOC A;  3CQZ J;  4M3B A;  4B4C A;  3CCY A;  1YRN A;  2NP3 A;  1A5J A;  5IYC J;  5IOZ A;  3C07 A;  1RES A;  4MK6 A;  2Q24 A;  2ME0 A;  2L0K A;  5FKL A;  3GTQ J;  4ICH A;  1MBK A;  5DAJ A;  3ZOB A;  1EF4 A;  4C3H J;  5C4Y A;  2DJN A;  1JUP A;  4DW6 A;  2DMU A;  1RR7 A;  3OOU A;  5M5W J;  3BNI A;  1MBE A;  2PMZ N;  1XG1 A;  4ME9 A;  2DMP A;  5AQC A;  2E19 A;  2JA6 J;  3NI7 A;  5CW8 A;  2NS8 A;  5HAW A;  5EG0 B;  3MKL A;  4PXI A;  3KNW A;  4B3A A;  4CGR A;  5FKN A;  4UUS B;  2UXP A;  1SGM A;  3VVY A;  1P7I A;  2LVS A;  3LSJ A;  3ZQC A;  5D1R A;  1IDY A;  4Y52 J;  2QKO A;  2WGB A;  2DMN A;  2P81 A;  2K9S A;  3BQZ A;  2NVY J;  3CDL A;  3HTI A;  3LHQ A;  2NP5 A;  2LY9 A;  2OF7 A;  2XB5 A;  2DN0 A;  2G7L A;  1ETV A;  3BQY A;  3F0C A;  1GDT A;  3NPI A;  4NN1 A;  2AO9 A;  2R5Y B;  3E7Q A;  4AF5 A;  1MBJ A;  5EEA A;  4FCY A;  1Z0X A;  1MBH A;  4MFD A;  3C2B A;  3BR2 A;  3I4N J;  5E3N A;  2CRG A;  4D5F A;  1F36 A;  4C3I J;  5IP9 J;  4EEF G;  1RKT A;  3RKQ A;  1NK3 P;  2GBY A;  2XGE A;  3MNL A;  2R0Q C;  4A3M J;  4XK4 A;  3M3Y J;  1XS9 A;  3M4O J;  4ACI A;  4IEJ A;  1ZR4 A;  4QIW N;  4BXX J;  4A3E J;  3NNR A;  4B1R A;  2NVT J;  3IUV A;  3BTI A;  4C3J J;  3S1Q J;  2XRL A;  1ETX A;  2FD5 A;  4MLO A;  3S14 J;  3HOV J;  5C4X J;  1UMQ A;  3BTC A;  5BNG A;  3BR6 A;  1JJ6 C;  3PM1 A;  1ENH A;  3GTL J;  4UUT A;  1D5Y A;  1HF0 A;  2VI6 A;  2G0E A;  1X2M A;  2NVQ J;  3S2D J;  4A3D J;  3H0G J;  5IYB J;  3TW6 A;  3BCG A;  2XSD C;  2ZB9 A;  4W1U A;  5EZG A;  4FTH A;  2R5Z B;  2LLK A;  2LD5 A;  1B72 B;  4HKU A;  4S0H B;  1WI3 A;  3P9T A;  5HBU A;  1NTC A;  1Y1W J;  3LSR A;  2JA8 J;  1XC5 A;  2QF7 A;  1DU0 A;  2NX4 A;  2D6Y A;  2HQ5 A;  1G2H A;  5GPC A;  2GFN A;  2HYJ A;  1WH7 A;  2ZCM A;  1GT0 C;  4I76 A;  1Z77 A;  2GEN A;  3O8H A;  3HOU J;  3HTJ A;  2O9L A;  4C2M J;  2MGQ A;  3HDD A;  2F07 A;  3BT9 A;  4G12 A;  4BBS J;  1FJL A;  3HGY A;  2JWT A;  4A3K J;  4Y7N J;  3BG3 A;  3S1M J;  1H89 C;  3B6C A;  1H88 C;  2R92 J;  3JRF A;  1WH5 A;  2HXO A;  1ITY A;  5EFY A;  1JKO C;  5C44 J;  4M6V A;  5CXI A;  2FJ1 A;  5IP6 A;  3S1N J;  2REK A;  5D18 A;  3HOZ J;  5FKM A;  3ZQF A;  3V6G A;  2DA6 A;  2L7M P;  2ZCN A;  2OPT A;  1TWC J;  3OSF A;  1GUU A;  1JJ8 C;  1AHD P;  4A93 J;  1SFO J;  5EDN A;  4XID A;  2L7F P;  1JT0 A;  2FBQ A;  2HDD A;  1MSF C;  1JUS A;  2LTP A;  1AKH A;  1ZK8 A;  1DU6 A;  3WHC A;  5GPA A;  1I3Q J;  1OCT C;  4BY7 J;  3DCF A;  2FQ4 A;  3RZD J;  2KDZ A;  5GP9 A;  3NXC A;  2CU7 A;  2VKE A;  3FIS A;  1IGN A;  3G56 A;  2ZCX A;  1FIP A;  3HB9 A;  1ZKG A;  2QCO A;  2XPW A;  1IJW C;  5D19 A;  3PPB A;  2HYT A;  4V2G A;  3VW1 A;  1APL C;  2X48 A;  3QKX A;  3QPS A;  2QOP A;  3HOX J;  4GCL A;  3EUP A;  2ECC A;  3BHQ A;  1VND A;  3O60 A;  3COL A;  3BRU A;  1W0T A;  1HDD C;  5J1U A;  1UG2 A;  1JKP C;  5F04 A;  1I50 J;  1UHS A;  1ZTR A;  1ZQ3 P;  5E3M A;  2FX0 A;  3BR1 A;  2DA2 A;  4JP0 A;  3T6N A;  2HXI A;  3IH2 A;  5EG0 A;  2LR8 A;  1POG A;  3MN2 A;  2I10 A;  4UUS A;  3HTA A;  3HGG A;  2N8G A;  3OIO A;  4A3F J;  2R7Z J;  1JTY A;  3GTP J;  1RPW A;  3FKI J;  2HKU A;  5H9T A;  4AC0 A;  3ZQL A;  1WPK A;  2LFB A;  3S16 J;  1SAN A;  4XRS G;  3VW2 A;  3GTK J;  2ID6 A;  3Q0W A;  3JRI A;  4QSH A;  3NAR A;  1LFU P;  3ON2 A;  5FMP A;  2DA3 A;  3W6V A;  2G7G A;  2DMQ A;  1TWH J;  5IOY A;  3HIM A;  4L62 A;  2K40 A;  2JJ7 A;  5F1J A;  3TP3 A;  3O8G A;  3VPR A;  1TWF J;  9ANT A;  4BKX A;  3VIB A;  4A3J J;  2HOS A;  3HOW J;  1GV2 A;  2XPU A;  1MNM C;  2RAS A;  2M34 A;  3KKD A;  2CUF A;  5E3L A;  5FJ8 J;  3JRH A;  2LKX A;  3VUQ A;  4BY1 J;  2ZOY A;  5K58 A;  5FKO A;  2EZL A;  3KKC A;  4MFE A;  3ANG A;  4AYB N;  3JSJ A;  5CXG A;  2CUE A;  4A3C J;  1ZR2 A;  4A3G J;  3S15 J;  2X9D A;  1CQT A;  1PUF B;  3S5R A;  1HCR A;  3JRA A;  3UKG A;  5F27 A;  2CQQ A;  3ZQG A;  2M0C A;  2UXI A;  2JA5 J;  3AQT A;  3QPL A;  4XIC A;  3A01 B;  3SDG A;  1Q1V A;  2VKV A;  3PO2 J;  3JRE A;  4A3L J;  1T56 A;  2G7S A;  1MBG A;  3GTJ J;  2OI8 A;  2IU5 A;  1IG7 A;  2O7T A;  2EH3 A;  1F43 A;  5EGO A;  1HDP A;  5EF6 A;  2IEK A;  2JA7 J;  1A6I A;  3G7R A;  3TED A;  1QPI A;  3B6A A;  3G1L A;  3LSG A;  4A69 C;  2Y9Y A;  2R5Z A;  1B72 A;  1FTZ A;  3CWR A;  3VVZ A;  5EZH A;  5M3F J;  2AHQ A;  3K2A A;  4IHY A;  2OER A;  2ELK A;  2JK3 A;  5M5Y J;  3JRB A;  3JRG A;  1U9N A;  2DG8 A;  4JX4 A;  2ME6 A;  3LNQ A;  5FLV A;  1BA5 A;  4AC6 A;  3HBL A;  3TW7 A;  1RKW A;  2EZI A;  4GCT A;  5IP7 J;  1O4X A;  3H3V K;  1TWA J;  2HOA A;  2RHA A;  1VFC A;  3RD3 A;  2UXO A;  3BTL A;  4V2F A;  1S7E A;  5F0F A;  1BL0 A;  2K9N A;  2QWT A;  1JGG A;  5J1R A;  3GTM J;  1R9T J;  4LOC A;  2Y30 A;  2JMW A;  4JL3 A;  4D7N A;  1OCP A;  4UDS A;  4DZJ A;  1UI5 A;  2EZK A;  3GTG J;  2EZH A;  3IV5 A;  1X58 A;  3GZI A;  5J1Y A;  1P7J A;  1WGX A;  2L9R A;  4MXM A;  2Y9Z A;  2DA5 A;  4RDU A;  1LE8 A;  3IH3 A;  1QVU A;  2DTZ A;  1MH3 A;  4MO7 A;  4D5C A;  5K7F A;  1ZGW A;  3CJD A;  1IRZ A;  1B8I B;  2EQR A;  3HM5 A;  2E1O A;  2E2H J;  2E2I J;  3BR5 A;  2DMT A;  2IAI A;  2D5V A;  2YU9 J;  2YVE A;  4CYC B;  1IC8 A;  1FTT A;  1IUF A;  2X6O A;  4MIM A;  1K61 A;  3ANP A;  2GUH A;  1ETW A;  2Y0S N;  1JUM A;  4M3F A;  4FIS A;  4AUX A;  1X2N A;  2GM4 A;  2NVX J;  1OJL A;  3GEU A;  2PBX A;  3QQA A;  2ZOZ A;  3VOX A;  1T33 A;  1WCM J;  3KZ9 A;  2R93 J;  5FHP A;  1QRY A;  1YRN B;  4IHV A;  2XDN A;  3VVX A;  1ETK A;  2WB1 N;  1U78 A;  2XB0 X;  3VOK A;  1JKR C;  2V57 A;  2YVH A;  4D7M A;  2WAQ N;  3Q0U A;  3VP5 A;  4KWA A;  1GVD A;  4L5E A; 
#chains in the Genus database with same CATH topology
 5B1B H;  3CRJ A;  2HDC A;  2JPC A;  2R7T A;  2HPM A;  1X3Z B;  2JRM A;  1PP8 F;  3ASO H;  3E7L A;  5JFR A;  1MNE A;  2EIL H;  1QGP A;  2CG4 A;  3EUH C;  4IHX A;  3V7C A;  2R7X A;  2L7Z A;  5DM6 F;  4FHT A;  2X6Y A;  2O8K A;  3ML6 A;  4PSX A;  1FT9 A;  1K83 J;  2FRH A;  2L4M A;  3M1E A;  4R1H A;  3MZY A;  3GZ6 A;  4BE2 A;  3L7W A;  2CW0 F;  2OZ6 A;  1IF1 A;  2W4S A;  3KEY A;  1Y0N A;  4RAG A;  4AIJ A;  3ECO A;  4HBL A;  3H5A A;  1FWZ A;  3BZK A;  3HTH A;  4C2M A;  3JRD A;  2HNH A;  2X4H A;  4HLY A;  4F7Z A;  4LIV A;  3HSE A;  1MBF A;  3D1N I;  4A3I J;  1JT6 A;  2IBD A;  1FEX A;  2H6C A;  5FLM J;  1YO5 C;  1X1A A;  4ZYD A;  1ZEL A;  3A03 A;  2V7F A;  3GUD A;  2V1N A;  1FMV A;  1P6R A;  3ON4 A;  4BJ6 C;  2H1L A;  5DS9 A;  5EJC A;  4HPQ A;  3IP4 B;  2LKP A;  1FZP B;  2EIJ H;  2H8R A;  5FFZ A;  3QBM A;  5DEQ A;  1QVT A;  3EDP A;  5KAF C;  4MQ9 F;  2V4J C;  3KP5 A;  1CGP A;  3OYF A;  2K86 A;  2W48 A;  4OIR F;  1IRX A;  2YS9 A;  2ZXI A;  4CZZ A;  1QBJ A;  4L0Y B;  1KON A;  2ID3 A;  1KA8 A;  4M3D A;  3A01 A;  3S32 A;  4ESB A;  3NRG A;  2KHM A;  2HI3 A;  2PBI A;  3ZMZ A;  4MNU A;  1A35 A;  2JSP A;  5FKK A;  2EV5 A;  3N97 A;  1MMD A;  4GXO A;  4AD9 A;  2DBB A;  4I0A A;  4L9T A;  4EGZ A;  4I0B A;  2BW3 B;  3B02 A;  4BS9 A;  3DTI A;  2L54 A;  2WUI A;  3CUQ C;  5EGO B;  3CCR I;  2ECB A;  1BW6 A;  1ETO A;  2PMU A;  2EIN H;  1FNN A;  4ABZ A;  5M3M J;  3SJM A;  4E4H A;  1IXC A;  2MLK A;  4OD4 A;  2JUG A;  2E60 A;  3CME I;  1MSE C;  2CV0 A;  4BBR J;  1TC3 C;  4IHW A;  5F08 A;  3OL3 A;  1VQK I;  5ILU A;  3HSR A;  4JX5 A;  4A5M A;  1IRF A;  5HOD A;  4F3Q A;  4PJL A;  1TW3 A;  3GFM A;  2VT3 A;  2BHY A;  3W6K B;  3GFL A;  3U1K A;  1JTX A;  1GV5 A;  3KYL A;  1RNL A;  1WJE A;  3RDI A;  2GXG A;  1XB4 A;  3LMM A;  2EIM H;  5CVU A;  5TIS C;  1VF9 A;  4I02 A;  1R7J A;  1F4K A;  2K9L A;  3WHB A;  2HDW A;  3FK7 A;  2G7U A;  3BG9 A;  5LHG A;  2DDB A;  3I71 A;  3K6G A;  4HA8 A;  3KX2 A;  1W36 D;  2Z1D A;  2PI0 A;  1W5C C;  3F9K A;  3Q0V A;  3BG7 A;  3CCQ I;  1O3T A;  2HQR A;  1JHF A;  3BR3 A;  2CQK A;  1MJB A;  1IDZ A;  3FK6 A;  1BIB A;  3CJT B;  1O57 A;  2QTQ A;  2KFD A;  1XMA A;  2R7O A;  1SEU A;  1UHW A;  3HC7 A;  1XGN A;  1UCR A;  3LOC A;  2EIK H;  1YW7 A;  3CCY A;  2NP3 A;  2EWN A;  3P9C A;  4RMN A;  3D0S A;  3DV8 A;  2X51 A;  3K2Z A;  4P9F A;  1I5Z A;  3T8T A;  1MBK A;  5DAJ A;  1BR2 A;  2DMU A;  1MJ9 A;  5CVV A;  1WQ2 A;  4HYE A;  4ME9 A;  3I59 A;  1R71 A;  1Z21 A;  2E19 A;  5CW8 A;  1VQO I;  4IVN A;  3DTE A;  2IS1 A;  4B3A A;  4CGR A;  2KIF A;  2UXP A;  3P5J A;  1P7I A;  5D1R A;  1DUX C;  1TNT A;  3KET A;  1JI8 A;  2QKO A;  2WGB A;  2P81 A;  2K9S A;  3BQZ A;  1BR4 A;  3OIQ A;  5HNH A;  4HV5 A;  1XMX A;  3FHZ A;  2OF7 A;  3HOS A;  4C2T A;  2G7L A;  2FSW A;  1P4X A;  4NN1 A;  2AO9 A;  2R5Y B;  1T08 B;  3H3Z A;  3IHU A;  5LEJ A;  3WTU C;  4OAY A;  3RIR A;  2QLZ A;  2DDA A;  2ZC2 A;  4BAY A;  1V3F A;  3GYH X;  4L9J A;  4MFD A;  3ELK A;  3OYL A;  1XCV A;  1FYK A;  3I4N J;  2RKH A;  3FXR A;  2I5U A;  4I99 C;  4CCO A;  1BC7 C;  1LVA A;  1F36 A;  2OCC H;  2QQA A;  5CVI A;  2VON A;  4UB6 C;  3WTZ A;  4I09 A;  1WJC A;  1RKT A;  1HKS A;  1W7P A;  3CUO A;  1VQ6 I;  2GBY A;  5HS7 A;  4R79 A;  1E3P A;  3MNL A;  1PJR A;  2CMP A;  4A3M J;  3M3Y J;  3OY9 A;  3H35 A;  4QIW N;  3IWF A;  4A3E J;  2V1U A;  4BHC A;  3QAH A;  1ZAO A;  2PJR A;  5BS6 A;  1RC9 A;  3CJR B;  3S1Q J;  1TP4 A;  3S14 J;  4ESJ A;  5BNG A;  3H0D A;  1UHM A;  3MMY B;  3T1B A;  3PSI A;  3E6M A;  1ERD A;  1OQY A;  3GTL J;  1SD5 A;  2RNG A;  1UEL B;  1Z67 A;  1YIJ I;  1HF0 A;  3GVA A;  3GZN B;  3S2D J;  4M72 A;  1Y0U A;  4O5V A;  5JI6 A;  2XSD C;  1L0O C;  1EJ9 A;  5EZG A;  3V7R A;  3MWM A;  2LD5 A;  2LLK A;  4IXA A;  3LSH A;  3TKY A;  1GHC A;  1YIO A;  2VOP A;  4IKF A;  4MGR A;  1V54 H;  4MEY F;  3SYT A;  3BCA A;  1OIS A;  2Z9O A;  2Y0S A;  1XC5 A;  3HIF A;  3KCC A;  2L3D A;  1DPR A;  2PN6 A;  3DWL E;  1E3H A;  4G7Z F;  2GFN A;  1WJD A;  3I64 A;  3KYD B;  4I76 A;  3VOE A;  2Q2E A;  3TMO A;  3MEX A;  3O8H A;  4LMY A;  1B9N A;  2WA0 A;  4HOB A;  1XGM A;  3EET A;  3J7Z I;  2QKL B;  4G12 A;  2DYS H;  1FOX A;  2QUF A;  1ON2 A;  4OOI A;  3ULQ B;  1FJL A;  3GF2 A;  2JWT A;  4A3K J;  2B1E A;  4HF1 A;  1H88 C;  1ZRC A;  3JRF A;  1ITY A;  1I3A A;  1TZL A;  2VJ5 A;  1BOB A;  5DCM A;  5C44 J;  5E17 F;  1R1T A;  4LG0 B;  4YFN F;  3K8P C;  4IOC F;  5HOO A;  3SEZ A;  1QNT A;  4BDY A;  1DP3 A;  4C9Y A;  2OPT A;  3OSF A;  1K79 A;  1GUU A;  3BJO A;  3TDU C;  1AHD P;  3F72 A;  4XKB A;  1OLT A;  4CXF A;  1TT0 A;  2L7F P;  4UV9 A;  1JT0 A;  4NUB A;  4QPO A;  3RSN A;  1JUS A;  2DTR A;  2LTP A;  5E1Z B;  1I3Q J;  4HLX A;  3DCF A;  5A2Q Z;  4HSR A;  3PNT A;  1YJW I;  3KP6 A;  1NH3 A;  3OIP A;  3G56 A;  2LMD A;  3KZZ A;  4HV6 A;  3HB9 A;  3GFI A;  3DTK A;  1APL C;  2X48 A;  5TGT A;  5D6E A;  4XLC A;  4OIQ F;  3DKY A;  3H3U A;  3U1D A;  2P8T A;  3O60 A;  1SFE A;  1RR8 C;  3WG9 A;  1T39 A;  1W0T A;  2M45 A;  1UG2 A;  1R58 A;  5FRM A;  2CGP A;  1I50 J;  4IRH A;  2DFI A;  5E3M A;  2LF8 A;  4EVI A;  4JP0 A;  3IH2 A;  5EG0 A;  2WAD A;  2VQG A;  4U7B A;  5ICG A;  3MN2 A;  3HTA A;  3B73 A;  3L00 A;  3BLY A;  3MFK A;  2HKU A;  3GTP J;  1OCR H;  1RPW A;  3FKI J;  2IGO A;  4AC0 A;  2CO5 A;  1FOW A;  2HKX A;  1WPK A;  2BGC A;  1UJ8 A;  4IF4 A;  2WV0 A;  5AIQ A;  5E8I A;  5IT9 Z;  2J5P A;  1B4A A;  2K27 A;  3DEE A;  3DKX A;  4XN3 A;  4A0Z A;  5J4Y A;  3ON2 A;  5FMP A;  3L2V A;  3DU5 A;  3K4J A;  3W6V A;  3RYR A;  3HIM A;  4A5N A;  2DCE A;  1T6S A;  2NRA C;  3TL4 X;  3ZN0 A;  3E6B A;  2E1M C;  3O8G A;  2Q8K A;  1MZB A;  3WTW C;  3NEU A;  1EA3 A;  9ANT A;  2VJI A;  2HTJ A;  4U87 A;  1GV2 A;  1MNM C;  1U2W A;  4QWQ A;  1KYW A;  4BY1 J;  2IRF G;  2CWE A;  4CCN A;  3R0A A;  2BVM A;  1MIJ A;  2XRO A;  3S15 J;  1KYZ A;  2CQQ A;  1BI2 A;  2JA5 J;  4DGW B;  1A6Q A;  3AL0 B;  3A01 B;  1OCC H;  3SDG A;  3JRE A;  1AA7 A;  4XR6 A;  4CDG A;  4KIS A;  1T56 A;  2MH9 A;  4EV0 A;  2F5C A;  2EH3 A;  2F5V A;  5EGO A;  3HPH A;  4ZJZ A;  2JA7 J;  2STT A;  1KU2 A;  3G1L A;  3LSG A;  4IRG A;  2Y9Y A;  3VEP A;  3CWR A;  1DDN A;  2R7D A;  5DUK A;  4IRV A;  1TT5 B;  3K2A A;  4LLL A;  3JRB A;  2E7X A;  3LNQ A;  3PIO F;  3OYH A;  2A69 F;  2IGK A;  3KZY A;  4A6E A;  1F1Z A;  2ZKZ A;  2EZI A;  1P92 A;  1FPQ A;  4BU2 A;  3H3V K;  2DQR A;  4ZYA A;  2UXO A;  4O3M A;  1S7E A;  4ENM A;  1S7O A;  3JSO A;  2M8E A;  3MKY B;  2CFX A;  1FBU A;  4B09 A;  1HKQ A;  3R0J A;  4H4K C;  2DPU A;  2Y30 A;  2B0L A;  4JL3 A;  2XF7 A;  4AVP A;  2AQE A;  4UDS A;  4DZJ A;  1UI5 A;  3EPZ A;  2FOK A;  5K5R A;  5J1Y A;  4RB1 A;  4J00 A;  5LGU A;  2Y9Z A;  4RDU A;  5L3G A;  1YX5 A;  2VQC A;  1IRZ A;  4PFP A;  2E2I J;  4F55 A;  2ZJ2 A;  2A61 A;  3LA3 A;  5HDN A;  2X6O A;  2JVH A;  4OAZ A;  1JXS A;  2O0Y A;  3ANP A;  2GUH A;  1ETW A;  2E71 A;  1JUM A;  4LJZ F;  4FIS A;  4HEA 2;  4M3F A;  3MZH A;  3GEU A;  3E3V A;  3I56 I;  3S3O A;  4BE1 A;  2R93 J;  1UG0 A;  4CSW A;  3D5R C;  4IHV A;  3PL8 A;  1ETK A;  2WB1 N;  2HR3 A;  1U78 A;  2XB0 X;  4HQE A;  1IN6 A;  2PFB A;  2VKH A;  3PFI A;  3LA2 A;  4D7M A;  5LEK A;  4E7J A;  4EM0 B;  1N78 A;  2XKP A;  5DYM A;  2KIU A;  3VP5 A;  4PDK A;  2H94 A;  1EH8 A;  5F0C A;  3VOD A;  3I59 B;  4WXH A;  1UAA A;  3RZO J;  1QZZ A;  3TDZ C;  3MQ0 A;  4HF2 A;  4Z2Y A;  2WV1 A;  3FX3 A;  3JAM Z;  2R5Y A;  4AM3 A;  1D0X A;  1TWG J;  1QZE A;  1N77 A;  5LRR A;  5L3E A;  2QZ8 A;  4CCK A;  4LD5 A;  3I54 A;  2JQ7 A;  1LFP A;  2H1K A;  3KEQ A;  2RVC A;  2FF4 A;  1R6R A;  2LNB A;  2PQ8 A;  4HDU A;  1U8R A;  4GCK A;  3F8B A;  1MD0 A;  3GZ5 A;  3EYY A;  4IO9 F;  2GZW A;  4BDZ A;  2E2J J;  1IO2 A;  4J19 A;  3A2K A;  2LY2 A;  1TBX A;  4YZE A;  2G3B A;  1IUY A;  2XGD A;  4G6D A;  4BQQ A;  4JK1 X;  1LNW A;  4FE4 A;  5J6X A;  1BW5 A;  4RGU A;  1ZRE A;  2O8X A;  3ZQQ A;  3GTO J;  4ZTJ A;  1XX5 A;  1E0E A;  2CJJ A;  2DOF A;  2WBM A;  1ETY A;  2RAE A;  2VBY A;  2GXB A;  2DT5 A;  2DJI A;  2BBY A;  1MJA A;  1T95 A;  2DA7 A;  1ONV A;  5B1A H;  2ACJ A;  2PJR B;  1DPU A;  5HSZ A;  2FJI 1;  3S1R J;  1YG2 A;  2LRE A;  4ZC3 A;  4CH7 A;  5ED4 A;  3BZ6 A;  4RGR A;  4RBO A;  4U88 A;  2FUG 2;  3RTR A;  4ZZL A;  2OTL I;  2XGC A;  3DEW A;  3ZQH A;  2PZ9 A;  3BG5 A;  3ZP5 A;  2GA2 A;  3J7A O;  1NK2 P;  2A05 A;  2IJL A;  2OU2 A;  2OTJ I;  1EKE A;  3KPH A;  3OYC A;  4KYW A;  1BI1 A;  2DLL A;  3BJB A;  1Z1D A;  2ZBK A;  4XKC A;  1X1D A;  2ICW G;  2B3W A;  1U5T A;  2OV7 A;  1RET A;  4HAM A;  4M3G A;  1ZGA A;  3L2C A;  2CW8 A;  2ZSH B;  3HRM A;  1U3E M;  3KLO A;  4BAC A;  2A07 F;  3QOE A;  2K9M A;  2O7O A;  4RS8 A;  3NRV A;  5LHH A;  3L2W A;  3V78 A;  5LFA A;  2TCT A;  3IH4 A;  5JHF A;  3CJQ B;  1I6H J;  2GIZ A;  4NQW A;  2KIQ A;  4LFU A;  5IPA A;  2KJC A;  1YJ9 I;  3RH2 A;  4GFK A;  3G1M A;  4I2O A;  3HL2 A;  2RRE A;  2XV4 S;  5DCF A;  3BWG A;  4HNV A;  2K3F A;  1D1A A;  2PMZ A;  2UXH A;  1VI0 A;  3EUA A;  3F23 A;  1SVL A;  2P5L C;  2UXU A;  1FIA A;  1KQ8 A;  3CDH A;  2MAB A;  2JN6 A;  5DCM B;  1TQI A;  3FRQ A;  5C4J J;  3L1P A;  3JR9 A;  5ILS A;  4PK4 A;  2ZXH A;  1YJN I;  2NOG A;  4LG3 A;  2ZSI B;  2IXS A;  1C0W A;  3EGQ A;  2YUS A;  2D45 A;  3TP0 A;  4ENK A;  1LE8 B;  3BTJ A;  2Z3Y A;  2XAF A;  3F6V A;  3S17 J;  2MG4 A;  3ERM A;  2KJB A;  1F5T A;  3RQI A;  3GFJ A;  3J80 K;  2IA0 A;  4M3E A;  2M2E A;  4P96 A;  4IJA A;  4CO8 A;  2CQX A;  5KAI C;  4M3B A;  5CKT A;  1WZ2 A;  2VN2 A;  2OQG A;  4AIH A;  1YRN A;  3D5S C;  1A5J A;  2PEX A;  5D4S A;  3C07 A;  1MND A;  1RES A;  1JGS A;  2DU9 A;  2FBK A;  3HYI A;  4XLH A;  5F6F A;  2VKD A;  3V8L A;  4MK6 A;  1R00 A;  3GTQ J;  2VC0 A;  4PFO A;  1FBQ A;  4C3H J;  2EV6 A;  2LH9 A;  2DK8 A;  3NS4 A;  2L02 A;  4C2U A;  5C4Y A;  4DW6 A;  2O6G E;  1IW7 F;  1RR7 A;  4BEH A;  3QYB A;  5M5W J;  3BNI A;  2QSG X;  4AYB A;  1K4T A;  5HAW A;  4CCM A;  5EG0 B;  3KP2 A;  2WC2 A;  4PXI A;  3S3M A;  3CTA A;  3ZMT A;  2OCE A;  2AS5 F;  2LVS A;  2BXZ A;  1IDY A;  2ZNY A;  2DMN A;  4GGG A;  1V5F A;  2Y69 H;  2A6H F;  2NP5 A;  2LY9 A;  3QPH A;  3S8P A;  2MBF A;  2OC6 A;  1RRJ A;  2DN0 A;  3LAP A;  3F0C A;  4GYG A;  5ICC A;  1YHQ I;  2V9V A;  3QOP A;  4Y4R A;  1MBJ A;  3HRT A;  4FCY A;  2OA4 A;  3PUB A;  4EJW A;  3WU1 B;  1D5V A;  3N4M A;  4B8X A;  1Z0X A;  1MBH A;  4L5J A;  2KZV A;  2DOE A;  1S8N A;  4Q4Z F;  3WOD F;  3Q5F A;  3SEQ A;  4C3I J;  2HOE A;  4A0X A;  3PQJ A;  4ZH4 F;  2XSJ C;  3W3C A;  2DOD A;  5DM7 F;  1HBX G;  2ETH A;  2XGE A;  4XK4 A;  4L0Z B;  4KFC A;  3M4O J;  4ACI A;  1ZR4 A;  3SHF A;  2KMU A;  4ZDP A;  2OAZ A;  2R7W A;  2IPQ X;  1SAX A;  1P4A A;  4C3J J;  4MLO A;  3E5X A;  3K1N A;  3OYA A;  1P4W A;  1WSU A;  2PMH A;  1JJ6 C;  3PM1 A;  3BG6 A;  4UUT A;  2K4J A;  1D5Y A;  2VI6 A;  2G0E A;  5J4V A;  5LRS A;  1X2M A;  2M1B A;  1G3Y A;  3TOB A;  5FRO A;  2KQR A;  4NHJ A;  3BCG A;  4KIT B;  4KJZ A;  2ZB9 A;  4W1U A;  4DQ2 A;  2YVX A;  1YW9 A;  3IL2 A;  2X0L A;  2GA1 A;  3R61 A;  2Q1Z B;  3L2R A;  5FGM A;  3IAM 2;  4R8H A;  4S0H B;  1WHU A;  1YW8 A;  4F93 B;  5HBU A;  2DT6 A;  2MC4 A;  4RAF A;  5HLH A;  2VLA A;  1Y1W J;  2D1H A;  1FSH A;  4CUG A;  1DU0 A;  2OZU A;  2HQ5 A;  4ETS A;  2XAQ A;  5ICF A;  3VYR B;  4II2 A;  5HLG A;  2HYJ A;  3WTV C;  4GCV A;  1GT0 C;  2IS2 A;  5DUI A;  2GWR A;  3M07 A;  1J75 A;  2L4A A;  2L2O A;  3HOU J;  2HQA A;  2O9L A;  3HTJ A;  4QLC U;  2ADU A;  3HDD A;  2ZXJ A;  1XDU A;  1ZG3 A;  3WGG A;  2ZJP F;  2GOX B;  2V9P A;  3HGY A;  3K4L A;  1H9T A;  3TOA A;  2QSF X;  1H89 C;  2BVL A;  3B6C A;  2R92 J;  2HU9 A;  3S1M J;  1WH5 A;  3C1D A;  4A0Y A;  1W36 C;  5EFY A;  4UVB A;  1J09 A;  2X1C A;  3WE3 A;  3X2Q H;  3D5L A;  5CXI A;  4L5I A;  5E79 C;  4IHS A;  5IP6 A;  5D18 A;  5GAE J;  1NG7 A;  3RQ4 A;  4M6Y A;  1OCZ H;  2DA6 A;  2ZCN A;  3U2R A;  1JJ8 C;  2ZY9 A;  4XQF A;  3DEU A;  4U0V A;  5EDN A;  2FBQ A;  2LF7 A;  1H0M A;  3Q9S A;  2W84 A;  3M1C A;  1MSF C;  1AKH A;  5H6R A;  3OWT A;  2OJE D;  3QU6 A;  3RKY A;  2PLY A;  4WX9 A;  2FQ4 A;  3RZD J;  2UWM A;  3V42 A;  1YLF A;  5GP9 A;  2VKE A;  3KEO A;  1EV7 A;  1ZKG A;  5FLX K;  2FXA A;  3PPB A;  3CLO A;  4V2G A;  4HW0 A;  3VW1 A;  4B43 A;  1Q1H A;  2L01 A;  4NNJ A;  3QKX A;  2QOP A;  4JQF A;  2R3S A;  1KQ0 A;  3ECH A;  1SFX A;  3SQN A;  1WFX A;  4U0Y A;  4XLF A;  3VFZ A;  1ODD A;  1JKP C;  5D8L B;  3AKZ A;  2R4G A;  2VXZ A;  3QP5 A;  2H09 A;  2HXI A;  5E8G A;  2I10 A;  1J0R A;  4G94 A;  3HGG A;  4ENN A;  3OIO A;  2DPD A;  4I01 A;  2VPL A;  5H9T A;  1PP7 U;  1V55 H;  2DFE A;  4XSZ F;  1LDJ A;  1U5T C;  2W1O A;  3HPG A;  3BOQ A;  3DXJ F;  1VQP I;  3F22 A;  3IUO A;  2VBW A;  1SAN A;  3O6B B;  2VIX A;  4HNT A;  1J5Y A;  5LLQ A;  3GTK J;  3DKW A;  2ID6 A;  1I1G A;  3VSK A;  1G3S A;  2VAS A;  3NAR A;  3KE2 A;  3JRI A;  2CYY A;  2DA3 A;  4LB6 B;  4BQN A;  5BQT A;  3ESW B;  2JPB A;  1ZLJ A;  1YX3 A;  3C2H A;  3K4B A;  4HZF A;  1YIT I;  3VPR A;  2YX4 A;  2K4B A;  4CGZ A;  1ZG1 A;  1FSE A;  1MMG A;  5FD5 A;  3HOW J;  1LEA A;  3LST A;  2CUF A;  4OMZ A;  5E3L A;  3JRH A;  1IRG A;  2ZOY A;  2NS0 A;  1IN4 A;  2HTS A;  3LL7 A;  3EUK L;  3ANG A;  4BJT A;  3JSJ A;  5CXG A;  2CUE A;  4A3C J;  1HA8 A;  4KUM A;  3P9K A;  4LK0 F;  3S5R A;  3LSM A;  4UVA A;  3JRA A;  5F27 A;  3PFY A;  2UXI A;  1ON1 A;  1XD7 A;  4YRV A;  2A5Y B;  2KRC A;  1G3W A;  5FB2 A;  4S04 A;  1BOA A;  4A3L J;  5BPI A;  3WTX C;  3JTH A;  2QQ8 A;  1YQA A;  3GTJ J;  4CIC A;  3HHH A;  4ZZD A;  5CVJ A;  2O7T A;  1HDP A;  3QP6 A;  2IEK A;  3DBR B;  2ZME A;  3DP7 A;  3LWF A;  4L9V A;  1U5T B;  4GYI A;  2LG4 A;  2R5Z A;  4A69 C;  1FTZ A;  3J81 K;  1D1B A;  5EZH A;  2CSO A;  2AHQ A;  5B3S H;  3LQQ A;  5M3F J;  1WJ5 A;  4MTE A;  1R5H A;  1V5G A;  3BY6 A;  1KGS A;  3F8F A;  3IC7 A;  5FLV A;  2BZT A;  5D4R A;  2K02 A;  4IOA F;  4UB8 C;  1I27 A;  5KVR A;  2K7L A;  2Q0O A;  5EEG A;  3S2W A;  3OYE A;  1O4X A;  3SWH A;  1TWA J;  2VOD A;  4XRF A;  1VFC A;  4NQW B;  3OR1 C;  3H1C A;  1FP2 A;  2WAQ A;  4FX4 A;  2XF5 A;  5F0F A;  3H5R A;  4RB3 C;  2VBX A;  2QWT A;  3AFH A;  4RB2 C;  2ESN A;  4LLG F;  2HWV A;  1MGT A;  3DF8 A;  3LQR A;  2EZH A;  2XDV A;  1X58 A;  3IRQ A;  1WGX A;  4E7K A;  1R23 A;  4MXM A;  2DA5 A;  1LE8 A;  1MH3 A;  4MO7 A;  5K7F A;  1Z3Y A;  1ZGW A;  1X1B A;  2FE3 A;  2E2H J;  3HM5 A;  4IZZ A;  4RLF A;  3TQN A;  2HQN A;  2IAI A;  1R5G A;  2YU9 J;  4F92 B;  1FTT A;  2CUZ A;  1IUF A;  5FRN A;  4MIM A;  3DPT A;  1U6G A;  1K61 A;  4EAT A;  2M30 A;  2NAZ A;  4K2E A;  3LFK A;  1YOV B;  1NHA A;  3OYJ A;  2PBX A;  2M5W A;  1T33 A;  1WCM J;  3F8M A;  1UB9 A;  3QOD A;  1FYL A;  2EPF A;  3GLX A;  1K4S A;  2K5C A;  2Z99 A;  2CV2 A;  1YRN B;  3RKX A;  3E0J B;  2BY1 A;  3K70 C;  4A2U A;  3DPL C;  1G3T A;  2VOO A;  3HUG A;  1NG6 A;  1XN7 A;  5L3B A;  4FET A;  2V79 A;  2CH0 A;  3BZC A;  3AL0 C;  1T0F A;  2ZFU A;  3CMY A;  1D8J A;  5JLX A;  4BEH B;  2MLG A;  3HSF A;  5C3E J;  2HYG D;  2DA1 A;  2IGN A;  4JYK A;  4BQA A;  2ISY A;  1ETQ A;  2K85 A;  5ICE A;  5D5U B;  4KIB A;  4BH9 A;  4KT5 C;  2QIB A;  3OV8 A;  3HOY J;  2Y2Z A;  4YEJ A;  2HOT A;  4JKZ A;  3C18 A;  3RI4 A;  4GO1 A;  4X1E A;  4FE7 A;  3LAJ A;  1AU7 A;  3BR0 A;  4HRI A;  5HLT A;  2A5W A;  2QA4 I;  1Z3X A;  3DPJ A;  1RI7 A;  2UUZ A;  3FDY A;  5H20 A;  2B63 J;  3FZV A;  3GBG A;  2MC3 A;  2Z2S B;  3HZJ A;  3K1M A;  3WGI A;  4KNY A;  2A68 F;  1FX7 A;  1OPC A;  4LB5 A;  1T38 A;  2ZO4 A;  1S29 A;  2M4K A;  3A02 A;  4UXN A;  2COM A;  2NXN B;  2PG4 A;  4G6T B;  5D8K B;  1XGO A;  1E17 A;  3DU6 A;  3QRF F;  1M1E B;  2JUC A;  2ZFW A;  4XOR A;  2Y48 A;  3AQS A;  2EA2 A;  2UV1 A;  4PGG A;  1USS A;  4GDF A;  4XKW A;  2V26 A;  2HFH A;  5FD6 A;  2NYX A;  1BJZ A;  1BJA A;  1I6X A;  1SMT A;  5E3O A;  1XDS A;  2W85 A;  2W53 A;  1ORK A;  5H2F C;  3W2V A;  1TL8 A;  2P7C B;  3WE2 A;  1RIO H;  2GLO A;  1OR7 A;  3QU3 A;  1WRJ A;  3KZI C;  3L9F A;  4B48 A;  1T98 A;  3R4K A;  4DZP A;  3JRC A;  2V1D A;  1QPM A;  4XOP A;  4XN0 A;  3K7A J;  4U7D A;  1BI3 A;  1IAW A;  2LC2 A;  4ZDL A;  2XPV A;  3E6C C;  2DW4 A;  1MH4 A;  5JVT A;  1SD6 A;  1O3Q A;  4BNC A;  4G7O F;  2KZG A;  2BOL A;  1Z91 A;  3PSF A;  4X0G A;  3TBI A;  2Y31 A;  1SVO A;  4NDL A;  1IN7 A;  2QWW A;  2XVC A;  2JZY A;  3ZMD A;  1SVM A;  3CCL I;  3OS1 A;  1B59 A;  5K5O A;  4QTR A;  1T8I A;  3WU0 A;  1XGS A;  3F8C A;  4IQJ A;  5B5E C;  1FY7 A;  4B44 A;  3FMR A;  2QSH X;  1D0Y A;  2MA3 A;  3Q3S A;  1U8B A;  2DG7 A;  5ILV A;  4HG2 A;  4IL6 C;  5DD4 A;  2M9H A;  1X1C A;  3SZP A;  2LDU A;  2LRD A;  4DYC A;  5K5Q A;  4Y17 A;  2MSY A;  3HKZ N;  2CFO A;  4PJM A;  3L2U A;  1UST A;  5CQE A;  1IV8 A;  4XRS A;  2TRT A;  1IXR C;  5JLW A;  3F1B A;  3LWJ A;  2YU3 A;  1R49 A;  3G1O A;  2DFH A;  2E34 A;  5EYR A;  5BOX A;  5KK1 A;  1K6O A;  4XLA A;  2EFP A;  3QYE A;  1UI6 A;  2BEO A;  3WG7 H;  2KT0 A;  5E20 A;  2QVO A;  4YFK F;  3SFI A;  4OD5 A;  1K6Y A;  1BR1 A;  1QU3 A;  4CYC A;  1Y39 A;  4NB5 A;  2R7S A;  2X1E A;  1W5S A;  3NAU A;  3ERE D;  3CZ6 A;  4A3B J;  2O5R A;  2LP0 A;  1AKH B;  4X6A J;  2VPR A;  3VWB A;  4P1W A;  1WJB A;  3IKV A;  3CQZ J;  2Z16 A;  3CCS I;  4B4C A;  3H36 A;  3OYM A;  4XSX F;  1OYY A;  3FBI B;  5IYC J;  3CUQ A;  2HPI A;  2V9K A;  1IN8 A;  4L9N A;  5CLS A;  1UZC A;  2A3S A;  1G6N A;  3PUF A;  3DBL B;  3OL4 A;  3MAJ A;  2L0K A;  1SD7 A;  3ZOB A;  1LB2 A;  1EF4 A;  5CVR A;  1Z05 A;  3PJR A;  4HX4 A;  2QGU A;  3CJN A;  4D0P A;  1XCB A;  1MBE A;  2PMZ N;  1XG1 A;  2HS5 A;  2IS6 A;  2DMP A;  5AQC A;  2JA6 J;  3NI7 A;  2NS8 A;  4N9I A;  3I53 A;  3PQK A;  4AWX B;  3KNW A;  3HTS B;  1XMK A;  5FKN A;  1T2K A;  1SGM A;  3HRS A;  1LQ1 A;  3LSJ A;  3VYU B;  4Y52 J;  2OD5 A;  3MKZ A;  2ZME C;  1J9I A;  3SZT A;  3CDL A;  3HTI A;  4V19 K;  2XAS A;  3FMS A;  3CLQ A;  2DOA A;  2F48 A;  2PFV A;  1BN5 A;  2JTV A;  1ETV A;  3NPI A;  2WWY A;  4AU7 A;  1LKX A;  3G2B A;  4AF5 A;  3FM5 A;  4CCL A;  1S6L A;  2EA4 A;  3BR2 A;  5CYV A;  3ZRG A;  1XSX A;  2L5Q A;  1VQ7 I;  6PAX A;  2XKO A;  4N4N B;  5IP9 J;  4HST A;  2UXX A;  5KHD A;  2IA2 A;  4EEF G;  2L7K A;  1G59 A;  4TV7 A;  1KU3 A;  4G6Q A;  5AIP A;  2DAO A;  1Z6R A;  2Y0M A;  2DK5 A;  4XOT A;  1PYV A;  1NK3 P;  2KPM A;  3J7Y J;  1MDM A;  2CS3 A;  4KN7 X;  4IEJ A;  4UHT A;  2NVU B;  3NNR A;  2LKS A;  4FAS D;  3BTI A;  4B3X A;  2XRL A;  1ETX A;  1EH7 A;  3ZMU A;  1HC8 A;  3DLL F;  3BR6 A;  2M7B A;  4C30 A;  1S5L C;  2L9N A;  3ZMS A;  1P9Q C;  4M74 A;  1OKR A;  3FKJ A;  4WF2 A;  4A3D J;  3C3W A;  5IYB J;  1BC8 C;  2ZME B;  2QQ9 A;  2F4I A;  3R60 A;  4FTH A;  2R5Z B;  4HKU A;  2DQL A;  2QYO A;  2VJJ A;  1GXP A;  2QBY A;  1W5T A;  4KIC A;  1GLN A;  4DBQ A;  2TDX A;  1AWC A;  2EFN A;  2LOO A;  3P9T A;  2HVQ A;  1WI9 A;  4Y15 A;  5D5X B;  4U9N A;  4P55 A;  2QF7 A;  2E1C A;  2NX4 A;  2D6Y A;  1G2H A;  5GPC A;  1TQP A;  3HTU A;  3FMQ A;  5TJJ A;  3ZXS A;  2ZXW H;  1WH7 A;  4UV8 A;  3KIO A;  1P2F A;  2ZCM A;  2H8W A;  4JOM A;  1Z77 A;  2MYS A;  2GEN A;  1IXS B;  1LJ9 A;  2WB1 A;  2KIS A;  4E7I A;  3OS0 A;  4XL9 A;  4C2M J;  2XAJ A;  5LD2 C;  2D2W A;  2IS4 A;  2JSC A;  2NNN A;  4E7L A;  2IP2 A;  3ONQ A;  1QQI A;  3A1Y A;  3GXO A;  1VQM I;  3E5Q A;  3CC7 I;  2LBF B;  4ZDO A;  2M3A A;  1XTA A;  3BC8 A;  1I1S A;  2HXO A;  2F2E A;  1JKO C;  1ZG5 A;  2VE8 A;  2P5V A;  4B47 A;  4EJU A;  2FU4 A;  2FJ1 A;  2REK A;  3ZQF A;  2L9S A;  3QPT A;  4M9Z A;  2L7M P;  4UVC A;  1TWC J;  2EB7 A;  4A93 J;  3J7A Y;  3F8N A;  3RKW A;  4XID A;  3ZGK A;  2BY2 A;  1WVR A;  5E1X A;  1TNS A;  5D5V B;  1ZK8 A;  1Z6T A;  1DU6 A;  3AG4 H;  3CMA I;  5GPA A;  2FNA A;  3ZN1 A;  1OCT C;  2KRF A;  2KDZ A;  4FT8 A;  3N05 A;  3NXC A;  3KFW X;  2CU7 A;  3FIS A;  2ZCX A;  1FIP A;  1S7A A;  2XPW A;  1IJW C;  5D19 A;  3Q9V A;  2F5E A;  2XIG A;  1O3R A;  2RQQ A;  1TW2 A;  2IW5 A;  2X6W A;  5A2Q K;  1MMS A;  4WCG A;  3QPS A;  1FMW A;  1VQL I;  3G3Z A;  3HOX J;  2F5D A;  1K78 A;  4G8X A;  3JSP A;  2RDP A;  1VZ0 A;  3HUG B;  3EUP A;  1KZH A;  4H0E A;  1V5E A;  3OYB A;  4GCL A;  1VND A;  2GOM A;  2R7R A;  1X3U A;  1OR7 C;  4MTD A;  4BHB A;  2HZD A;  1UHS A;  1ZTR A;  2IVM A;  2FX0 A;  5J8F A;  2DA2 A;  3ABM H;  4OIN F;  2AXL A;  1MKM A;  1GXQ A;  3SFZ A;  4UUS A;  2W7N A;  4L18 B;  1W4M A;  2ESH A;  2N8G A;  1QHG A;  2R7Z J;  4N9H A;  3P9I A;  5L3C A;  4AIK A;  2A6E F;  4N4O B;  4J01 A;  3ZQL A;  2LFB A;  4DNC A;  3H92 A;  3BP8 A;  1PUE E;  3BRO A;  3S16 J;  1O7L A;  1X4O A;  2QKM B;  5EEH A;  1LFU P;  1WJA A;  5GTI C;  2G7G A;  1GVJ A;  5IT9 K;  2M7A A;  3K4C A;  2D1V A;  3FWE A;  3FXU A;  5F1J A;  1OMI A;  3KP3 A;  2E36 A;  1OYW A;  2VJ4 A;  4NC7 A;  4EM2 A;  4CYD A;  4RB0 A;  1VTN C;  3ABT A;  4NBQ A;  4Z6Y A;  3VIB A;  2HOS A;  2HZT A;  2XPU A;  2RAS A;  3K1P A;  4XLN F;  5J47 A;  1B6A A;  3KKD A;  2CQN A;  4E7S A;  2E35 A;  4A6D A;  5K58 A;  5FKO A;  1K7A A;  2CQ7 A;  3ABU A;  3CF5 F;  2O3F A;  4HF0 A;  2MD5 A;  3P7N A;  5B66 C;  1CQT A;  1H9G A;  4WK8 F;  4BL0 B;  5BMZ A;  3GO5 A;  1HCR A;  3REO A;  2M0C A;  2WTE A;  3AQT A;  4XIC A;  4G9Y A;  1KU9 A;  3DLA A;  3CD6 I;  3PO2 J;  1SFK A;  1LEB A;  2E7W A;  3BPX A;  1B9M A;  2G7S A;  3CC2 I;  1MBG A;  2OI8 A;  2GXA A;  1HSJ A;  2FEZ A;  2QEN A;  2RV8 A;  2DO7 A;  4ENJ A;  1B72 A;  4KIF A;  3AAF A;  3T0Y A;  4RGX A;  2OER A;  3ZR8 X;  2ELK A;  2JK3 A;  1EH6 A;  1DGW Y;  3JRG A;  3A0H C;  2DG8 A;  2ME6 A;  4GCT A;  1RKW A;  3CP2 A;  3VYT B;  5IP7 J;  2YSR A;  4Q48 A;  5FO5 A;  2HOA A;  1TQM A;  3GME A;  3CO7 C;  1WWX A;  3GX4 X;  3WGH A;  3FXO A;  1VQN I;  2RN7 A;  2R7V A;  4P9U A;  4V2F A;  4S05 A;  2RNJ A;  4G7H F;  4OMY A;  2K9N A;  1R5I D;  1HW5 A;  2OUM A;  1JGG A;  3VDX A;  1UFM A;  3R6S A;  1WJF A;  3GTM J;  3A0B C;  2ZJR F;  1R1V A;  2XAH A;  2HKO A;  1R9T J;  4UY8 I;  2JMW A;  1CF7 A;  3BDD A;  3SXY A;  1OCP A;  4RAY A;  3KYC B;  4OWR B;  2RC4 A;  3E1S A;  2JT1 A;  3IV5 A;  3GZI A;  4LIU A;  1P7J A;  2L9R A;  4LK1 F;  1ZYR F;  3VYS B;  5L3F A;  2B9S A;  1QVU A;  2DTZ A;  4PZJ A;  4D5C A;  4KMU X;  3ZQ7 A;  2IA1 A;  2E1O A;  2QQB A;  1FLI A;  3FXQ A;  3BR5 A;  4EJT A;  4HX7 A;  2DMT A;  2R7U A;  3EYI A;  2QEX I;  4CYC B;  1Z9C A;  2A6T A;  1YS7 A;  3C2G A;  3IRR A;  1Y8Q B;  2Y0S N;  4AUX A;  3MCZ A;  2FNP A;  3FF5 A;  2NVX J;  1OJL A;  4PJJ A;  3QQA A;  4HNU A;  3VOX A;  2VL8 A;  1YE9 A;  4M73 A;  4AID A;  5LGN A;  2IT0 A;  5H6Q A;  2P7V B;  3KZ9 A;  3I0T A;  2IGM A;  5FHP A;  4EQQ A;  2XDN A;  3VVX A;  4BGD A;  3CUQ B;  2YR2 A;  3VOK A;  4XON A;  1JKR C;  2XAG A;  2V57 A;  2YVH A;  2WAQ N;  3Q0U A;  4BE0 A;  4HX8 A;  1MMA A;  4OU0 A;  4KWA A;  1GVD A;  1ACI A;  2DA4 A;  5FGL A;  2FOW A;  3LSP A;  3B81 A;  4WWC A;  4JX6 A;  2VQH A;  2X6X A;  2LK2 A;  3GWZ A;  4W97 A;  3CCJ I;  3ZQI A;  2P5K A;  3GCM A;  4CHU A;  4DYR A;  3W2A A;  2E5N A;  2G7H A;  3CDI A;  4A12 A;  3PO3 J;  4KA4 A;  3VTI A;  3I58 A;  1YI2 I;  5CQG A;  4NEL A;  5K7Z A;  3VW0 A;  2DT7 B;  3JAM K;  4I6Z A;  2FML A;  4RAZ A;  1G4D A;  2EFQ A;  2H6B A;  2NS7 A;  1X4P A;  4XLE A;  1Z7L A;  2COB A;  3ROU A;  4FQG A;  4WIB A;  4EJO A;  3PAS A;  1HOM A;  4BYY A;  3S2H J;  1J2X A;  2M8G X;  3M9A A;  1LUJ B;  4BHP A;  4BXF A;  1W0U A;  4GFL A;  4I7H A;  3RPU D;  3H5N A;  1U9O A;  1ZAR A;  3S93 A;  3TGN A;  2BE5 F;  2K3P A;  4GFB A;  3OOP A;  3CMM A;  2F6C A;  1MDM B;  2ISZ A;  1IV6 A;  1N25 A;  5M5X J;  3ASN H;  4RM2 A;  4JNN A;  4WXD A;  2EFO A;  3AG3 H;  1PUF A;  5HLI A;  1RZ4 A;  3HE0 A;  1LFB A;  3WTS C;  1RUN A;  3HEF A;  4U9L A;  2JVG A;  2BXY A;  5DD8 A;  5CJ9 A;  2FBH A;  3PNV A;  3RCO A;  5IYD J;  3OYI A;  3LFU A;  3G4S I;  2XC7 A;  4IRI A;  1SD4 A;  2EK5 A;  3FXL A;  5DTD A;  4ITV A;  3M8E A;  2GQQ A;  2LYC A;  2QBY B;  3NWT A;  5J3L A;  3BCB A;  4KN4 X;  3LJL A;  1QO0 D;  3FIW A;  5CPR B;  4XRM A;  3WTY C;  4PJN A;  2EBI A;  3KP4 A;  2W25 A;  2MFZ A;  3OMY A;  4IX7 A;  3O3K A;  3IAS 2;  5HVQ C;  3DPU A;  4F52 A;  4F91 B;  2ZNZ A;  1XSD A;  4O6J A;  4II3 A;  2LBF A;  2OBP A;  2I8D A;  2XAU A;  2LSO A;  1Y1V J;  3GEZ A;  2DFF A;  5LGT A;  3F21 A;  3I3L A;  4BJ5 C;  4RLQ A;  1ULY A;  3JTG A;  2YPR A;  3FXK A;  3WU2 C;  3I4M J;  1DP7 P;  2Z33 A;  1U0J A;  3MVP A;  2MW8 A;  1A36 A;  3FM3 A;  4LGW A;  1BBY A;  2XHK A;  4BQO A;  3I4P A;  5JHU A;  2C6Y A;  5K7H A;  2PX9 A;  1B8I A;  1S3J A;  4NC6 A;  1HLV A;  3HHG A;  3J80 Z;  4DYQ A;  2FA5 A;  1E3O C;  2MH2 A;  5JVG F;  4QPQ A;  5F0H A;  3OSG A;  4MHG A;  5DV5 A;  1YFH A;  2V6E A;  4IPA A;  1JKQ C;  5GAG J;  2HVR A;  2K9Q A;  1OCO H;  1D0Z A;  3QYF A;  3T5X A;  3UR3 C;  4LIT A;  1HST A;  4CA0 A;  2BY0 A;  1H8A C;  2VUM J;  2EFW A;  1OFC X;  3H9G A;  3K4K A;  1TTY A;  3M8F A;  3G6E I;  4YIR X;  3UNG C;  2XF6 A;  2GIV A;  1HXD A;  3EQL F;  2E5Z A;  2VQL A;  2ELJ A;  3AG1 H;  3PNY A;  4PSW A;  5IOZ A;  3OYN A;  3OR2 C;  2P0W A;  2VC1 A;  2WY7 Q;  5HNF A;  1VQ9 I;  2Q24 A;  2ME0 A;  4I98 B;  5FKL A;  4ICH A;  1K78 B;  1MMN A;  2JRT A;  1IN5 A;  1BM9 A;  1FOY A;  2M0M A;  1IZ1 A;  2DJN A;  1JUP A;  3W6J B;  3LSI A;  2DI3 A;  1Y56 A;  3AG2 H;  3KLN A;  3OOU A;  2A2F X;  1VQ8 I;  1B1B A;  3CCE I;  5JR3 A;  2F5F A;  2UXN A;  1VQ5 I;  2MD0 A;  3MKL A;  4HDV A;  4EMS A;  1SMY F;  2UZK A;  4UUS B;  3K70 D;  1KU7 A;  3VVY A;  5IT3 A;  4E70 A;  4KDP A;  3ZQC A;  3E97 A;  2WAE A;  1L3L A;  2W57 A;  4IHT A;  2NVY J;  3CES A;  3LHQ A;  1PVE A;  2P4W A;  3H9Q A;  2X85 A;  2XB5 A;  3BQY A;  1GDT A;  3TO6 A;  3HJE A;  3K0L A;  5FFX A;  2OQR A;  4DOZ A;  3E7Q A;  1MW7 A;  2XGX A;  4DVY P;  1F9N A;  1HW1 A;  5EEA A;  2F4M B;  1J59 A;  3WTT C;  4E6K G;  3OYK A;  3C2B A;  3V8J A;  4DJA A;  5TRD A;  4MEX F;  2E1N A;  2EV0 A;  2B7E A;  1AOY A;  5E3N A;  2CRG A;  2GAU A;  4D5F A;  2Y75 A;  3V8K A;  4EM1 A;  4JBA A;  2XRN A;  4WXC A;  3U9G A;  5LHI A;  2HGC A;  2FBI A;  3K4N A;  3RKQ A;  5IY5 H;  4UUV A;  2VT2 A;  2R0Q C;  4YII A;  4Q5S F;  1XS9 A;  1QA6 A;  3CF2 A;  4BXX J;  4RGS A;  5DDG A;  4B1R A;  1YTY A;  1Z7U A;  2NVT J;  3IWZ A;  3IUV A;  3JCU C;  2FD5 A;  5C4X J;  3HOV J;  1HW2 A;  1KQ9 A;  1UMQ A;  3BTC A;  5GTH C;  2FQ3 A;  4M9X A;  3EUH A;  4PGH A;  1ENH A;  5GAD J;  2WAF A;  1YYV A;  5BPD A;  5D6F A;  1FYM A;  1X3W B;  2NVQ J;  2DYR H;  3H0G J;  2O61 A;  3TW6 A;  1N75 A;  3HRU A;  2BW3 A;  5L3D A;  1B72 B;  2V1X A;  4ASN A;  4KT6 A;  5J8C A;  5HDG A;  4E7Z A;  3G71 I;  5KNL A;  1WI3 A;  1NTC A;  2JA8 J;  3LSR A;  1SAU A;  3ABK H;  5LBQ A;  2VE9 A;  2M87 A;  2VXD A;  1S9H A;  4E7H A;  3LSK A;  2ELH A;  5E18 F;  3TO9 A;  5HDK A;  4D1Q A;  4BXU A;  5KCM A;  1RUO A;  3M7G A;  3GLL A;  5ERI A;  1SC7 A;  1X19 A;  4ZYH A;  1A04 A;  2E1M B;  5GAH J;  2MGQ A;  2KDO A;  4Q47 A;  2P6T A;  2F07 A;  3BT9 A;  1FC3 A;  2V6C A;  3I55 I;  4BBS J;  1CF7 B;  5D5W B;  3M8J A;  4YFX F;  4Y7N J;  2QM3 A;  3BG3 A;  1TLH B;  3NWS A;  3VB2 A;  4OIP F;  4ANJ A;  3O2P E;  3ISP A;  4M6V A;  3CCV I;  3G73 A;  1LPQ A;  3QWL A;  3S1N J;  3HOZ J;  4MQV A;  5FKM A;  1E2X A;  3V6G A;  3RJP A;  4XNF A;  1SFO J;  3U21 A;  1JE8 A;  1BI0 A;  1YS6 A;  2KP6 A;  2R7Q A;  2HDD A;  3DFG A;  1R4N B;  4KIG A;  3K10 A;  1J7K A;  2LY1 A;  1BIA A;  3WHC A;  3HG9 A;  5FLX Z;  4BY7 J;  1ZLK A;  3OYD A;  4XBF A;  1ZRF A;  4Y3O A;  4U0W A;  3NQO A;  3RPQ A;  1IGN A;  1Y8R B;  1R36 A;  4YEL A;  2QCO A;  4RA2 A;  4NC8 A;  5E1W A;  1R1U A;  2HYT A;  4ZYE A;  2W00 A;  5F1R A;  2NNY A;  2KRH A;  3COA C;  3HXL A;  3I9V 2;  1S72 I;  1ZH5 A;  2KL4 A;  2ECC A;  2VBZ A;  3BHQ A;  3BPV A;  3COL A;  3BRU A;  1HDD C;  3GW2 A;  2RQP A;  3K69 A;  1W7P D;  5J1U A;  4XLP F;  3A4C A;  5F04 A;  3T8R A;  4XKV A;  1ZQ3 P;  4DBR A;  3BR1 A;  3FBN B;  4GRI A;  3T6N A;  2G9W A;  4ESF A;  3CC4 I;  1SFU A;  2KIM A;  2LR8 A;  1POG A;  1VQ4 I;  2W24 A;  1ZHF A;  4XMY A;  1STZ A;  4A3F J;  1JTY A;  3H9J A;  3FHN A;  3TO7 A;  2CV1 A;  4D9J A;  2EJR A;  5K1Y A;  2Z5U A;  1HQC A;  2YX7 A;  1WKM A;  1XPX A;  1DGR M;  4XRS G;  1FOK A;  3VW2 A;  1D1C A;  1ZN2 A;  3Q0W A;  2ZCW A;  2BV6 A;  3JW4 A;  4QSH A;  4PJ0 C;  1R22 A;  4UNO A;  2DMQ A;  1TWH J;  5IOY A;  1V4R A;  2H27 A;  4L62 A;  2K40 A;  2JJ7 A;  1DQU A;  1XSV A;  5AON A;  3TP3 A;  4ON0 A;  4EJV A;  2DXI A;  4Y13 A;  3VSL A;  1QZY A;  1TWF J;  4BKX A;  4A3J J;  1R4M B;  3HOT A;  2M34 A;  5FJ8 J;  3E5U A;  4M71 A;  3W2W A;  2LKX A;  2PJP A;  3VUQ A;  1PDN C;  2EZL A;  4YIF A;  3KKC A;  4MFE A;  4AYB N;  4Y33 A;  2FMY A;  3BJA A;  4PUS A;  3V7S A;  1ZR2 A;  1W7P B;  3CCM I;  4A3G J;  2NOJ B;  2VB6 A;  2O03 A;  2X9D A;  4KMF A;  1PUF B;  3CO6 C;  3UKG A;  3HKZ A;  3ZQG A;  2X1D A;  3QPL A;  2J5O A;  3MKW B;  1Q1V A;  2VKV A;  3RYP A;  1Y6I A;  4OIO F;  4ZYG A;  3J81 Z;  2IU5 A;  3L2Q A;  1IG7 A;  3OS2 A;  1F43 A;  5EF6 A;  4FX0 A;  3CCU I;  2WY8 Q;  3ZMV A;  1A6I A;  3G7R A;  3TED A;  4N0B A;  3S3N A;  1QPI A;  3B6A A;  3VVZ A;  3F6O A;  4HQM A;  2KKO A;  1HKT A;  4AVZ A;  3F3X A;  3PIP F;  1O3S A;  4IHY A;  4M9S A;  1FBS A;  5M5Y J;  1X1P A;  1A31 A;  1U9N A;  4AC6 A;  4JX4 A;  1BA5 A;  3ABL H;  3K4M A;  3FXJ A;  3HBL A;  3TW7 A;  1JHH A;  1G8X A;  4DIQ A;  3RPU A;  1T0F C;  2RHA A;  3RD3 A;  3KP7 A;  3BTL A;  3ZPL A;  3C7J A;  1LDD A;  3I5U A;  1BL0 A;  1LDK B;  4EGY A;  2RGV A;  2STW A;  5J1R A;  2XUB A;  3IKT A;  4LLN A;  5F64 A;  4LOC A;  1REP C;  2CUJ A;  1D8K A;  2Q2E B;  3MZ8 A;  4P5O A;  4D7N A;  2AQF A;  3CP8 A;  2EZK A;  2F4O B;  2M4G A;  2BY3 A;  3GTG J;  1I39 A;  1D3Y A;  4YG2 F;  2R7F A;  2AXT C;  2BHZ A;  3IH3 A;  3CJD A;  2JA2 A;  2EQR A;  4LG0 A;  1B8I B;  5J40 A;  2D5V A;  2YVE A;  4BUP A;  1OYI A;  1QHH D;  3OYG A;  1IC8 A;  4PCQ A;  2L9V A;  4CZC A;  2HEO A;  2HVS A;  3L09 A;  4RM3 A;  2ZJQ F;  4IQ4 A;  1O7F A;  2GM4 A;  3V4G A;  5HS8 A;  1X2N A;  3E6D A;  2ZOZ A;  2KLO A;  1FP1 D;  4CCJ A;  3SZG A;  2CW7 A;  3SDB A;  4ZTF A;  1W1W E;  3DQV C;  3K9T A;  5HS9 A;  1QRY A;  2W82 A;  3DBH B;  3BJ6 A;  3MD2 A;  2P6S A;  1ZGJ A;  1LVK A;  3ZCO A;  4M6X A;  3LA7 A;  2HYF A;  1ZRD A;  4XM3 A;  2BYV E;  3FXM A;  4L5E A; 
#chains in the Genus database with same CATH homology
 3CRJ A;  5F0C A;  2DA4 A;  3CMY A;  5FGL A;  5JLX A;  3LSP A;  5C3E J;  2DA1 A;  3B81 A;  3E7L A;  4JYK A;  4JX6 A;  2LK2 A;  1ETQ A;  4W97 A;  3ZQI A;  4IHX A;  3RZO J;  2QIB A;  2L7Z A;  4DYR A;  3HOY J;  2Y2Z A;  2O8K A;  2HOT A;  1K83 J;  4JKZ A;  4X1E A;  2WV1 A;  4FE7 A;  1AU7 A;  3PO3 J;  3BR0 A;  2R5Y A;  1TWG J;  3DPJ A;  4NEL A;  2H1K A;  5K7Z A;  3VW0 A;  3HTH A;  4I6Z A;  4GCK A;  3JRD A;  2B63 J;  3GBG A;  2NS7 A;  2COB A;  1MBF A;  3D1N I;  4A3I J;  1JT6 A;  3PAS A;  2E2J J;  1HOM A;  3A02 A;  4J19 A;  3S2H J;  2IBD A;  1FEX A;  5FLM J;  4YZE A;  3A03 A;  2M8G X;  2G3B A;  2XGD A;  1W0U A;  3AQS A;  3ON4 A;  4GFL A;  5DS9 A;  4FE4 A;  1BW5 A;  1U9O A;  4GFB A;  2H8R A;  3GTO J;  1BJZ A;  5E3O A;  3QBM A;  2CJJ A;  1QVT A;  1ETY A;  2W53 A;  1ORK A;  2RAE A;  1IV6 A;  2DA7 A;  5M5X J;  4JNN A;  2W48 A;  5HSZ A;  1PUF A;  3S1R J;  2GLO A;  3HE0 A;  2YS9 A;  1LFB A;  3HEF A;  2ID3 A;  4DZP A;  4RBO A;  3JRC A;  4M3D A;  2XGC A;  3DEW A;  3ZQH A;  3A01 A;  3BG5 A;  2PZ9 A;  3K7A J;  3NRG A;  2HI3 A;  1NK2 P;  2XPV A;  1MH4 A;  3BJB A;  5FKK A;  5IYD J;  1RET A;  5DTD A;  2Y31 A;  4M3G A;  4NDL A;  2WUI A;  5EGO B;  5J3L A;  2ECB A;  1BW6 A;  1ETO A;  4ABZ A;  5M3M J;  3LJL A;  3SJM A;  3FIW A;  4XRM A;  2O7O A;  4QTR A;  2EBI A;  1MSE C;  3V78 A;  2TCT A;  3IH4 A;  4BBR J;  1TC3 C;  4IHW A;  5F08 A;  1I6H J;  4JX5 A;  3Q3S A;  5HOD A;  5IPA A;  1U8B A;  2DG7 A;  3RH2 A;  4GFK A;  3G1M A;  2M9H A;  4DYC A;  1Y1V J;  2MSY A;  3HKZ N;  4HNV A;  2UXH A;  4XRS A;  1VI0 A;  1JTX A;  1GV5 A;  2TRT A;  3I4M J;  5JLW A;  2UXU A;  3F1B A;  3LWJ A;  3G1O A;  3MVP A;  1FIA A;  5EYR A;  2MW8 A;  2JN6 A;  1UI6 A;  3FRQ A;  2KT0 A;  5C4J J;  3L1P A;  5K7H A;  3JR9 A;  1B8I A;  2NOG A;  1VF9 A;  3SFI A;  3EGQ A;  2YUS A;  3WHB A;  3FK7 A;  3BG9 A;  3TP0 A;  1HLV A;  1LE8 B;  4CYC A;  3BTJ A;  4DYQ A;  1E3O C;  3S17 J;  2MG4 A;  3Q0V A;  3NAU A;  5F0H A;  3OSG A;  3BR3 A;  4A3B J;  1IDZ A;  3FK6 A;  1JKQ C;  3RQI A;  2K9Q A;  2LP0 A;  1AKH B;  4X6A J;  2QTQ A;  2VPR A;  4M3E A;  2M2E A;  1H8A C;  2VUM J;  2CQX A;  1OFC X;  3LOC A;  3CQZ J;  4M3B A;  4B4C A;  3CCY A;  1YRN A;  2NP3 A;  1A5J A;  5IYC J;  5IOZ A;  3C07 A;  1RES A;  4MK6 A;  2Q24 A;  2ME0 A;  2L0K A;  5FKL A;  3GTQ J;  4ICH A;  1MBK A;  5DAJ A;  3ZOB A;  1EF4 A;  4C3H J;  5C4Y A;  2DJN A;  1JUP A;  4DW6 A;  2DMU A;  1RR7 A;  3OOU A;  5M5W J;  3BNI A;  1MBE A;  2PMZ N;  1XG1 A;  4ME9 A;  2DMP A;  5AQC A;  2E19 A;  2JA6 J;  3NI7 A;  5CW8 A;  2NS8 A;  5HAW A;  5EG0 B;  3MKL A;  4PXI A;  3KNW A;  4B3A A;  4CGR A;  5FKN A;  4UUS B;  2UXP A;  1SGM A;  3VVY A;  1P7I A;  2LVS A;  3LSJ A;  3ZQC A;  5D1R A;  1IDY A;  4Y52 J;  2QKO A;  2WGB A;  2DMN A;  2P81 A;  2K9S A;  3BQZ A;  2NVY J;  3CDL A;  3HTI A;  3LHQ A;  2NP5 A;  2LY9 A;  2OF7 A;  2XB5 A;  2DN0 A;  2G7L A;  1ETV A;  3BQY A;  3F0C A;  1GDT A;  3NPI A;  4NN1 A;  2AO9 A;  2R5Y B;  3E7Q A;  4AF5 A;  1MBJ A;  5EEA A;  4FCY A;  1Z0X A;  1MBH A;  4MFD A;  3C2B A;  3BR2 A;  3I4N J;  5E3N A;  2CRG A;  4D5F A;  1F36 A;  4C3I J;  5IP9 J;  4EEF G;  1RKT A;  3RKQ A;  1NK3 P;  2GBY A;  2XGE A;  3MNL A;  2R0Q C;  4A3M J;  4XK4 A;  3M3Y J;  1XS9 A;  3M4O J;  4ACI A;  4IEJ A;  1ZR4 A;  4QIW N;  4BXX J;  4A3E J;  3NNR A;  4B1R A;  2NVT J;  3IUV A;  3BTI A;  4C3J J;  3S1Q J;  2XRL A;  1ETX A;  2FD5 A;  4MLO A;  3S14 J;  3HOV J;  5C4X J;  1UMQ A;  3BTC A;  5BNG A;  3BR6 A;  1JJ6 C;  3PM1 A;  1ENH A;  3GTL J;  4UUT A;  1D5Y A;  1HF0 A;  2VI6 A;  2G0E A;  1X2M A;  2NVQ J;  3S2D J;  4A3D J;  3H0G J;  5IYB J;  3TW6 A;  3BCG A;  2XSD C;  2ZB9 A;  4W1U A;  5EZG A;  4FTH A;  2R5Z B;  2LLK A;  2LD5 A;  1B72 B;  4HKU A;  4S0H B;  1WI3 A;  3P9T A;  5HBU A;  1NTC A;  1Y1W J;  3LSR A;  2JA8 J;  1XC5 A;  2QF7 A;  1DU0 A;  2NX4 A;  2D6Y A;  2HQ5 A;  1G2H A;  5GPC A;  2GFN A;  2HYJ A;  1WH7 A;  2ZCM A;  1GT0 C;  4I76 A;  1Z77 A;  2GEN A;  3O8H A;  3HOU J;  3HTJ A;  2O9L A;  4C2M J;  2MGQ A;  3HDD A;  2F07 A;  3BT9 A;  4G12 A;  4BBS J;  1FJL A;  3HGY A;  2JWT A;  4A3K J;  4Y7N J;  3BG3 A;  3S1M J;  1H89 C;  3B6C A;  1H88 C;  2R92 J;  3JRF A;  1WH5 A;  2HXO A;  1ITY A;  5EFY A;  1JKO C;  5C44 J;  4M6V A;  5CXI A;  2FJ1 A;  5IP6 A;  3S1N J;  2REK A;  5D18 A;  3HOZ J;  5FKM A;  3ZQF A;  3V6G A;  2DA6 A;  2L7M P;  2ZCN A;  2OPT A;  1TWC J;  3OSF A;  1GUU A;  1JJ8 C;  1AHD P;  4A93 J;  1SFO J;  5EDN A;  4XID A;  2L7F P;  1JT0 A;  2FBQ A;  2HDD A;  1MSF C;  1JUS A;  2LTP A;  1AKH A;  1ZK8 A;  1DU6 A;  3WHC A;  5GPA A;  1I3Q J;  1OCT C;  4BY7 J;  3DCF A;  2FQ4 A;  3RZD J;  2KDZ A;  5GP9 A;  3NXC A;  2CU7 A;  2VKE A;  3FIS A;  1IGN A;  3G56 A;  2ZCX A;  1FIP A;  3HB9 A;  1ZKG A;  2QCO A;  2XPW A;  1IJW C;  5D19 A;  3PPB A;  2HYT A;  4V2G A;  3VW1 A;  1APL C;  2X48 A;  3QKX A;  3QPS A;  2QOP A;  3HOX J;  4GCL A;  3EUP A;  2ECC A;  3BHQ A;  1VND A;  3O60 A;  3COL A;  3BRU A;  1W0T A;  1HDD C;  5J1U A;  1UG2 A;  1JKP C;  5F04 A;  1I50 J;  1UHS A;  1ZTR A;  1ZQ3 P;  5E3M A;  2FX0 A;  3BR1 A;  2DA2 A;  4JP0 A;  3T6N A;  2HXI A;  3IH2 A;  5EG0 A;  2LR8 A;  1POG A;  3MN2 A;  2I10 A;  4UUS A;  3HTA A;  3HGG A;  2N8G A;  3OIO A;  4A3F J;  2R7Z J;  1JTY A;  3GTP J;  1RPW A;  3FKI J;  2HKU A;  5H9T A;  4AC0 A;  3ZQL A;  1WPK A;  2LFB A;  3S16 J;  1SAN A;  4XRS G;  3VW2 A;  3GTK J;  2ID6 A;  3Q0W A;  3JRI A;  4QSH A;  3NAR A;  1LFU P;  3ON2 A;  5FMP A;  2DA3 A;  3W6V A;  2G7G A;  2DMQ A;  1TWH J;  5IOY A;  3HIM A;  4L62 A;  2K40 A;  2JJ7 A;  5F1J A;  3TP3 A;  3O8G A;  3VPR A;  1TWF J;  9ANT A;  4BKX A;  3VIB A;  4A3J J;  2HOS A;  3HOW J;  1GV2 A;  2XPU A;  1MNM C;  2RAS A;  2M34 A;  3KKD A;  2CUF A;  5E3L A;  5FJ8 J;  3JRH A;  2LKX A;  3VUQ A;  4BY1 J;  2ZOY A;  5K58 A;  5FKO A;  2EZL A;  3KKC A;  4MFE A;  3ANG A;  4AYB N;  3JSJ A;  5CXG A;  2CUE A;  4A3C J;  1ZR2 A;  4A3G J;  3S15 J;  2X9D A;  1CQT A;  1PUF B;  3S5R A;  1HCR A;  3JRA A;  3UKG A;  5F27 A;  2CQQ A;  3ZQG A;  2M0C A;  2UXI A;  2JA5 J;  3AQT A;  3QPL A;  4XIC A;  3A01 B;  3SDG A;  1Q1V A;  2VKV A;  3PO2 J;  3JRE A;  4A3L J;  1T56 A;  2G7S A;  1MBG A;  3GTJ J;  2OI8 A;  2IU5 A;  1IG7 A;  2O7T A;  2EH3 A;  1F43 A;  5EGO A;  1HDP A;  5EF6 A;  2IEK A;  2JA7 J;  1A6I A;  3G7R A;  3TED A;  1QPI A;  3B6A A;  3G1L A;  3LSG A;  4A69 C;  2Y9Y A;  2R5Z A;  1B72 A;  1FTZ A;  3CWR A;  3VVZ A;  5EZH A;  5M3F J;  2AHQ A;  3K2A A;  4IHY A;  2OER A;  2ELK A;  2JK3 A;  5M5Y J;  3JRB A;  3JRG A;  1U9N A;  2DG8 A;  4JX4 A;  2ME6 A;  3LNQ A;  5FLV A;  1BA5 A;  4AC6 A;  3HBL A;  3TW7 A;  1RKW A;  2EZI A;  4GCT A;  5IP7 J;  1O4X A;  3H3V K;  1TWA J;  2HOA A;  2RHA A;  1VFC A;  3RD3 A;  2UXO A;  3BTL A;  4V2F A;  1S7E A;  5F0F A;  1BL0 A;  2K9N A;  2QWT A;  1JGG A;  5J1R A;  3GTM J;  1R9T J;  4LOC A;  2Y30 A;  2JMW A;  4JL3 A;  4D7N A;  1OCP A;  4UDS A;  4DZJ A;  1UI5 A;  2EZK A;  3GTG J;  2EZH A;  3IV5 A;  1X58 A;  3GZI A;  5J1Y A;  1P7J A;  1WGX A;  2L9R A;  4MXM A;  2Y9Z A;  2DA5 A;  4RDU A;  1LE8 A;  3IH3 A;  1QVU A;  2DTZ A;  1MH3 A;  4MO7 A;  4D5C A;  5K7F A;  1ZGW A;  3CJD A;  1IRZ A;  1B8I B;  2EQR A;  3HM5 A;  2E1O A;  2E2H J;  2E2I J;  3BR5 A;  2DMT A;  2IAI A;  2D5V A;  2YU9 J;  2YVE A;  4CYC B;  1IC8 A;  1FTT A;  1IUF A;  2X6O A;  4MIM A;  1K61 A;  3ANP A;  2GUH A;  1ETW A;  2Y0S N;  1JUM A;  4M3F A;  4FIS A;  4AUX A;  1X2N A;  2GM4 A;  2NVX J;  1OJL A;  3GEU A;  2PBX A;  3QQA A;  2ZOZ A;  3VOX A;  1T33 A;  1WCM J;  3KZ9 A;  2R93 J;  5FHP A;  1QRY A;  1YRN B;  4IHV A;  2XDN A;  3VVX A;  1ETK A;  2WB1 N;  1U78 A;  2XB0 X;  3VOK A;  1JKR C;  2V57 A;  2YVH A;  4D7M A;  2WAQ N;  3Q0U A;  3VP5 A;  4KWA A;  1GVD A;  4L5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...