5GP9A

Structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
193
structure length
193
Chain Sequence
KKKGPKYDQIIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDVLISLFQEKMGRFVDKIRSQMNEATDVEEKLKILVNMHFKQLAADHKLAIVTQLELRQSNTELRLKINEVLKGYLNLLDELLMEGKEKGYFFQELDTRLARQMIFGTLDEVVTNWVMKDCKYDLTALVKPVHQLLLGGLRHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of operator sites recognition and effector binding in the TetR family transcription regulator FadR.
pubmed doi rcsb
source organism Bacillus halodurans (strain atcc baa-125 / dsm 18197 / ferm 7344 / jcm 9153 / c-
molecule tags Transcription, dna binding protein
molecule keywords Transcriptional regulator (TetR/AcrR family)
total genus 81
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5gp9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5gp9A02
5IP9J 3BR2A 2MGQA 1F43A 2DA4A 1OFCX 1X2NA 2DMQA 2B63J 1W0TA 1MBEA 4GCKA 5IYDJ 1B72B 3GZIA 3ZQFA 1H89C 5FLVA 1GDTA 1MSEC 4XICA 2CRGA 3BG5A 1IUFA 2QKOA 1NTCA 4DW6A 3A02A 1RESA 1WH7A 1ZKGA 3Q0WA 3BTCA 2LP0A 2VPRA 5IYCJ 1ZGWA 3JRGA 1MBGA 2GUHA 3HTJA 3B6CA 3I4NJ 2RHAA 5IOZA 3Q3SA 2OERA 3NI7A 3CMYA 1E3OC 2NVQJ 3BCGA 3ZOBA 2JA8J 1O4XA 5D1RA 1BW6A 1Y1WJ 5E3MA 3O60A 3JRAA 3PASA 1RPWA 3BR3A 1JJ8C 1BW5A 4L5EA 1SFOJ 1XC5A 1GV2A 2H1KA 1FTZA 3IH3A 4D7NA 3BTLA 3CDLA 2N8GA 1VF9A 3JRHA 5EEAA 5IP6A 2QF7A 2W53A 2DMPA 4NN1A 3KKDA 2QCOA 3S17J 2WUIA 1AKHB 1WI3A 4D7MA 3RQIA 3PO2J 3HTAA 4UUTA 2QTQA 3DEWA 2XGCA 5J1YA 4D5CA 5EZGA 2XB5A 1ZQ3P 1SANA 4B3AA 3BRUA 4IEJA 1BL0A 1B72A 4ABZA 5CW8A 5E3OA 2DA6A 3H3VK 3HOUJ 3SDGA 4HNVA 5EDNA 1JKQC 3CWRA 2HI3A 4DYRA 1JKRC 1A6IA 3TP3A 2R92J 5JLWA 2ZCMA 1FIAA 1QVTA 4MK6A 3VIBA 2VKEA 3HEFA 4AC0A 2E2JJ 3HIMA 9ANTA 3P9TA 3OSFA 1XS9A 2X9DA 2KDZA 3AQSA 5DAJA 2DA3A 3TW7A 2LY9A 2Y2ZA 1RKWA 1X2MA 3FIWA 1T33A 3G1OA 4W1UA 1DU0A 3IUVA 2JWTA 3BG9A 1TWFJ 2FJ1A 1JTYA 4XRSG 2GLOA 5FLMJ 3EUPA 1ENHA 1RETA 2UXOA 3G7RA 4A3MJ 2ZCXA 4X1EA 3GTQJ 4Y52J 3L1PA 1JUSA 3JRFA 2DTZA 3S1MJ 5D19A 2LD5A 3S5RA 2L7ZA 5FMPA 2JA7J 1FJLA 2QIBA 3LHQA 2HYJA 5F1JA 1TWHJ 2M8GX 5GP9A 3LSPA 3CRJA 2HXOA 4NELA 4C3JJ 3PO3J 5HBUA 5M5YJ 2K9QA 3S1NJ 5J1UA 5E3NA 1YRNA 3RH2A 1UHSA 3B6AA 1JJ6C 2CJJA 3GTKJ 3ON2A 2CQXA 3MKLA 3QBMA 5IYBJ 3BJBA 3BG3A 1GV5A 2FD5A 4Y7NJ 4MXMA 3ZQIA 3C2BA 3HM5A 3JR9A 2K9NA 1TWAJ 3A01A 3OSGA 1W0UA 2FBQA 3HBLA 3TEDA 3CCYA 3M3YJ 1Z0XA 4L62A 2QWTA 3LJLA 3JRCA 3BQZA 3VVZA 3BTJA 1APLC 1Y1VJ 3M4OJ 2LTPA 3MVPA 2L9RA 3LSGA 4RBOA 5HSZA 1K61A 2LVSA 1TWGJ 5EFYA 1Q1VA 2CQQA 3COLA 3ON4A 4FE4A 2R93J 1ETWA 3BR6A 5EYRA 4C3HJ 5FHPA 3FISA 3K7AJ 4ACIA 3VW0A 2HOTA 1QPIA 4A3FJ 1U78A 1H88C 4JYKA 5C4YA 1JKOC 1SGMA 4JL3A 1GVDA 4FCYA 2OPTA 2XGDA 5EG0A 5AQCA 4GCTA 3HOZJ 2CUEA 3GTMJ 3A03A 1HDPA 1CQTA 3VOXA 1ETOA 2EQRA 2IU5A 2EZIA 3BR0A 5M5WJ 3HB9A 1NK2P 1IGNA 5K58A 5K7HA 3Q0VA 4XK4A 1UMQA 1IRZA 4FISA 3JSJA 1GUUA 2HOSA 5D18A 3FKIJ 3RD3A 2AO9A 4LOCA 4BBRJ 4QSHA 4MIMA 3RKQA 2Y0SN 1JUPA 3ZQGA 3FK6A 1FIPA 1MH4A 1ZR4A 1VI0A 5DS9A 1U9OA 4NDLA 2AHQA 2KT0A 5M3MJ 1PUFA 1JTXA 2FX0A 4GFBA 1H8AC 1AKHA 1VFCA 2GBYA 1UI5A 1MBKA 2LLKA 4YZEA 2JN6A 4A3EJ 3PM1A 1IJWC 3BHQA 1U8BA 1DU6A 3LSRA 5C4XJ 1HCRA 1T56A 3NXCA 4AC6A 1WCMJ 2M9HA 2UXHA 3E7QA 1POGA 2ID6A 1ETXA 1IDYA 2ME6A 2VI6A 2R5ZB 4B1RA 2E2HJ 3HGYA 2IEKA 3G1MA 3SJMA 4FE7A 2CUFA 3QPSA 2DA2A 5F0HA 5K7ZA 2ZCNA 4I6ZA 2DA7A 1FEXA 2NX4A 2L0KA 3BQYA 2K9SA 4RDUA 4M3BA 1TC3C 2O7TA 5FJ8J 2NVTJ 2E1OA 4JX4A 3HKZN 4A93J 1U9NA 5M5XJ 2EBIA 2HOAA 4AF5A 2IBDA 4UDSA 2DG8A 2MW8A 4A3CJ 2ECCA 3IH2A 4MLOA 5DTDA 1JKPC 1HF0A 2HDDA 2D6YA 1MBJA 1ZTRA 1AHDP 5HAWA 3NNRA 3LNQA 2YS9A 3K2AA 2GENA 4DYQA 3GTLJ 3RZOJ 1R9TJ 3G1LA 1JT6A 5GPAA 1IG7A 3NRGA 4PXIA 3W6VA 2E19A 3OOUA 5BNGA 2G7LA 3VW1A 1LFBA 4DZPA 3LWJA 4MFEA 4XIDA 5H9TA 2G7SA 2Y9YA 3DCFA 1P7JA 5C44J 4MFDA 3KNWA 4MO7A 2OI8A 2XRLA 2HKUA 2RAEA 2WB1N 2NOGA 2JMWA 3TP0A 5C3EJ 1JGGA 3LSJA 1LFUP 3FK7A 1D5YA 2WV1A 2P81A 2LKXA 3BTIA 3KKCA 3T6NA 4GCLA 2YVEA 5F08A 1XG1A 4I76A 1MBHA 2NVYJ 4BY1J 2UXUA 3JREA 2R7ZJ 2ZOYA 4C2MJ 2G3BA 4IHWA 5M3FJ 2DMUA 1MNMC 3S1QJ 4ME9A 5F27A 1MH3A 4M3GA 2GFNA 4M3DA 4M3EA 2YUSA 1ETKA 3HTIA 2EZLA 4JKZA 4A3BJ 1OJLA 5EGOB 1K83J 1ETVA 4UUSA 1FTTA 1F36A 2HXIA 2EH3A 3AQTA 5FGLA 2YU9J 1QVUA 5E3LA 3OIOA 2V57A 2LFBA 2G0EA 2DN0A 3HOVJ 5EZHA 4A3LJ 1I6HJ 1WH5A 2DMTA 2PMZN 4A3JJ 4A3IJ 4X6AJ 3QKXA 2XSDC 1YRNB 1ETQA 3GBGA 3S16J 3VOKA 3BR1A 5IPAA 3HOXJ 3S15J 4M3FA 1G2HA 1OCTC 4DZJA 2ME0A 3DPJA 2DMNA 3IH4A 2R5ZA 3S2DJ 3Q0UA 2XPWA 1A5JA 2JK3A 1RKTA 5FKNA 2M34A 5F0FA 2G7GA 1HLVA 1VNDA 2I10A 2XPVA 5EF6A 2O9LA 2UXIA 3VP5A 4V2FA 5FKMA 1UG2A 2HYTA 4G12A 3NPIA 2EZHA 4XRSA 2W48A 1MSFC 3HE0A 1JUMA 2COBA 1MBFA 1ORKA 3LOCA 3V78A 2L7FP 2REKA 3F1BA 3VW2A 5HODA 2M0CA 1HDDC 2DJNA 5EG0B 2Y9ZA 2QOPA 2ECBA 1ETYA 3VUQA 5CXGA 4A3KJ 2CU7A 4IHYA 2K40A 1GT0C 3I4MJ 1TWCJ 2O8KA 4JNNA 1X58A 3G56A 3ZQHA 3ZQCA 2Q24A 5FKOA 1I50J 2MSYA 2TRTA 1IV6A 2VUMJ 5JLXA 3V6GA 4B4CA 4GFLA 5CXIA 3IV5A 3ANGA 1JT0A 1WGXA 3F0CA 2MG4A 3HDDA 1BJZA 3WHCA 3QQAA 1S7EA 4IHXA 2X48A 2JA6J 3O8GA 1ITYA 4KWAA 3GTOJ 3SFIA 2UXPA 4D5FA 3BR5A 4M6VA 1WPKA 2Y30A 3H0GJ 5F04A 3A01B 1IC8A 2NS7A 5K7FA 4FTHA 5IOYA 3D1NI 4XRMA 1P7IA 2PBXA 3CJDA 1B8IA 4A3DJ 4BBSJ 3C07A 1NK3P 4GFKA 2E2IJ 3QPLA 3JRDA 5F0CA 2XPUA 4BXXJ 3BT9A 3HGGA 4ICHA 4J19A 1PUFB 4EEFG 2O7OA 2LR8A 4CYCB 5C4JJ 3GTGJ 3JRBA 4BKXA 2R0QC 2WGBA 1RR7A 2EZKA 4A69C 3ANPA 2LK2A 4UUSB 2X6OA 3EGQA 4IHVA 2D5VA 1BA5A 3B81A 2Y31A 3FRQA 3VVYA 3GTPJ 1EF4A 2XGEA 2TCTA 3HOWJ 4DYCA 3BNIA 4S0HB 3VPRA 1Z77A 1B8IB 1ZK8A 3TW6A 5GPCA 3JRIA 1LE8B 2XDNA 3S2HJ 2ZOZA 3E7LA 2HQ5A 3S14J 2PZ9A 4JP0A 2IAIA 4W97A 3RZDJ 2NP3A 2JJ7A 2VKVA 2XB0X 2GM4A 2F07A 4A3GJ 3O8HA 5FKKA 1QRYA 2JA5J 2M2EA 3NAUA 4AUXA 3KZ9A 5J1RA 3HOYJ 4JX6A 5EGOA 4JX5A 2OF7A 2ZB9A 5FKLA 1HOMA 3HTHA 3MNLA 4QTRA 4V2GA 3WHBA 3MN2A 2YVHA 3VVXA 1IDZA 4CYCA 4CGRA 5J3LA 2R5YA 2DA1A 1I3QJ 3GTJJ 2NS8A 1ZR2A 2FQ4A 2L7MP 4BY7J 4AYBN 2R5YB 2DA5A 3S1RJ 1LE8A 2RASA 2NVXJ 4QIWN 1AU7A 2H8RA 1UI6A 5IP7J 2NP5A 3PPBA 3GEUA 2DG7A 2WAQN 4HKUA 2ID3A 3NARA 1OCPA 3CQZJ 4C3IJ 3UKGA 3ZQLA 2ELKA
chains in the Genus database with same CATH superfamily
3BCBA 1J5YA 3BR2A 1UZCA 2EV0A 2OQGA 2QGUA 3TO7A 3FM5A 1RIOH 2EV5A 4XORA 2BVLA 1MD0A 5FLVA 3J7AY 3JAMZ 1RZ4A 3V4GA 4EATA 2QKOA 1KQ8A 2A69F 2P6TA 4HRIA 3RIRA 1OMIA 1X19A 3C3WA 3Q0WA 2LKSA 4GYGA 1ZGWA 3AFHA 5CJ9A 2E71A 2HU9A 4PDKA 1IN8A 1ZRDA 5IOZA 3QYEA 3NI7A 2AXTC 3F6OA 4ZC3A 3CMYA 2HPMA 4AM3A 5ICEA 2VODA 1OISA 3BCGA 2KPMA 4CZZA 2QQ8A 1HC8A 5E3MA 2CYYA 2HVSA 3O60A 4WIBA 2BY1A 4EM2A 3RTRA 4N4OB 1SC7A 3E3VA 3BTLA 3K70C 3VSLA 3JRHA 2VLAA 2VJIA 2A5YB 3OS2A 3ESWB 3ZR8X 1CGPA 2LY1A 5FB2A 3RKYA 4ZZDA 2X4HA 2UZKA 4M6YA 1WI3A 3FMQA 1A31A 4MGRA 4B43A 4XLFA 2QTQA 1OCRH 2XGCA 3BRUA 1ZQ3P 2IS6A 2F5EA 1U5TB 2M5WA 2KFDA 3RJPA 1BC8C 4ABZA 3BC8A 2X1DA 2LC2A 2RNJA 4XKBA 4UB6C 4HNVA 5EDNA 3OS0A 3SDBA 4E7ZA 1I1GA 1V55H 2K27A 4DYRA 3D5LA 5FFZA 1QQIA 2R92J 3OL4A 2YU3A 5K5QA 3G3ZA 3A0HC 3M8EA 3VIBA 4B09A 5D5WB 4UVAA 3KLNA 1H0MA 2UXNA 2NNYA 2E2JJ 2JQ7A 3HIMA 3P9TA 3OSFA 1ZG5A 1XS9A 2X9DA 4P1WA 4WX9A 2C6YA 4I2OA 2KDZA 4LG0B 1B59A 3HPGA 4KMUX 3SZTA 4JBAA 3CJQB 2QEXI 4UUVA 2A6HF 3CC4I 1RKWA 1X2MA 5A2QZ 3V7RA 3FIWA 1S8NA 4HX4A 2XAJA 1K4SA 2V26A 4ZYGA 1OYYA 1TWFJ 2HS5A 3S3MA 3K4BA 1E17A 3KZYA 3DP7A 3VSKA 2EV6A 2GLOA 4IHTA 2OTLI 2A6TA 3L2WA 4EJVA 3K70D 1CF7B 4Y15A 4D0PA 3PIOF 3KEOA 1LUJB 4DIQA 2JA7J 2JTVA 1T98A 4EVIA 4IOAF 5J4VA 1QA6A 5DUIA 1TWHJ 2M8GX 1TL8A 5HBUA 1USTA 5M5YJ 3S1NJ 3SHFA 2MABA 1V4RA 4NQWA 1JJ6C 3HUGB 2V1NA 3RCOA 3F22A 2CQXA 2IGMA 2OV7A 3ECHA 3WGGA 3TO9A 1GV5A 1ZYRF 1MNDA 3HM5A 2V9PA 2P5KA 3H36A 1Y39A 4CDGA 3H5RA 1W0UA 2RNGA 1QGPA 5B5EC 3CCRI 2QWTA 3LJLA 3FKJA 3GEZA 3OL3A 4TV7A 2O03A 3BTJA 4WXHA 3GFMA 2LTPA 1XTAA 1R5HA 2LVSA 3IRRA 4E7KA 2YSRA 2OCCH 2KZGA 1BN5A 3ZN0A 4FE4A 2R93J 2MLGA 3BR6A 2FSWA 5EYRA 4C3HJ 2DYSH 1W1WE 1ZAOA 3ISPA 1D3YA 4JYKA 2K86A 4IRGA 5AONA 4FCYA 2HDCA 2XGDA 2HVRA 1PVEA 2CUEA 1CQTA 1HDPA 2M4KA 3GTMJ 1ETOA 4E6KG 1YW9A 3R60A 4L18B 5GADJ 2EZIA 3BR0A 3RSNA 2A5WA 3J81K 3CCQI 1R5ID 3W6JB 3HB9A 3L09A 4OAZA 1YLFA 5E1WA 1NK2P 3PNVA 1BI1A 3P9CA 5K58A 5K7HA 5ICCA 4XK4A 4FISA 4WCGA 1G8XA 4LFUA 2E36A 3QOPA 5D18A 1RC9A 2AO9A 3HG9A 3FXQA 4LOCA 4BBRJ 1BM9A 2H6BA 1G3WA 2KHMA 1JUPA 3ASOH 4ETSA 3GZ6A 1S6LA 2ZJRF 2K3FA 3NWTA 1I3AA 1ZR4A 2XRNA 2R7WA 2AHQA 1C0WA 5KK1A 5M3MJ 1OQYA 2LNBA 3REOA 3CCEI 3W6KB 2GBYA 2PMZA 5AIPA 3CMAI 1ZRFA 2X6WA 3T8RA 1XGNA 2WTEA 3CO6C 2PMUA 5L3BA 4P5OA 4YZEA 2JN6A 1IJWC 3PSIA 1U8BA 3LSRA 5C4XJ 4E7SA 4AC6A 1FY7A 1WCMJ 2G7HA 1N77A 4MEXF 1M1EB 2ID6A 1ETXA 1OKRA 2ELHA 2LMDA 2VI6A 3JCUC 2ME6A 4Z6YA 2H8WA 1TQPA 1D8KA 4ZTFA 2CUFA 2ZCWA 3QPSA 2GA1A 5F0HA 1BBYA 4H0EA 1S29A 4U7BA 1H9GA 2FBHA 3V8JA 2DA7A 3K4JA 1VQLI 4M3BA 2JRTA 2XKPA 2NVTJ 3HKZN 4AF5A 5DD8A 3ZMZA 2DG8A 3CD6I 3ASNH 2ECCA 2AQEA 4KJZA 2EB7A 2D6YA 1HF0A 1XCBA 5E18F 5CKTA 2HDDA 1AHDP 3CC2I 3KP7A 3H9QA 3P7NA 2YS9A 1RR8C 3MEXA 1K78A 1QBJA 1R36A 3GWZA 4DYQA 4OWRB 4UVCA 1R9TJ 4BJ6C 3CP8A 4BUPA 5GPAA 4FASD 5JVTA 2E19A 3WE3A 2G7LA 3VW1A 4Y13A 2W85A 1U5TA 2QLZA 3CJTB 1IUYA 3VTIA 2G7SA 3J7AO 2CMPA 5C44J 4Q48A 1W7PD 2IA0A 4MFDA 2A2FX 4KDPA 1FBSA 3KNWA 3DPTA 2YVXA 2NOGA 1D1CA 2JMWA 1YFHA 2HPIA 4I02A 3FK7A 1FC3A 3CLQA 2B7EA 2P81A 3SZPA 4BQQA 4HPQA 3GFLA 4UV9A 4BDYA 3FF5A 3S93A 4XL9A 4AIHA 2ZOYA 2MA3A 4LG0A 4C2MJ 1DDNA 5M3FJ 4IHWA 2G3BA 1MNMC 3S1QJ 2FMYA 5F27A 1MH3A 2YUSA 3IUOA 5A2QK 3DBRB 1YO5C 4NHJA 3NWSA 4A0YA 1R49A 1ETVA 1FTTA 2B0LA 2HYFA 2QSHX 1FMVA 3AQTA 2CUJA 1U3EM 4LLNA 2VKHA 1ZGJA 1IV8A 3OIOA 4IRHA 1MKMA 2ISYA 2AS5F 2G0EA 3QAHA 3ABTA 3HOVJ 3HC7A 2Y0MA 1YW8A 1UJ8A 2JVGA 4A3LJ 4A3IJ 2K5CA 2O8XA 5HLGA 2DU9A 3F21A 2E7WA 3S16J 3DLAA 3BR1A 4HYEA 2F5FA 3S15J 1G2HA 2ME0A 4YFXF 4RB0A 5CVVA 3FMRA 3Q0UA 4NC8A 5FKNA 5CQEA 3W2VA 4L5JA 3KYDB 2VJ4A 1HLVA 4AVPA 2AXLA 4M74A 4LB6B 1VNDA 2Q0OA 4CGZA 2ZJQF 4E7HA 4CYDA 3ZMVA 3F8FA 2COMA 2DT7B 4FT8A 2KDOA 5KNLA 1VQMI 3SFZA 3HE0A 3ABMH 3HSFA 2COBA 3AG4H 3UNGC 2L7FP 3M1CA 1D5VA 3C2HA 4BE1A 2Y9ZA 2ECBA 1SEUA 4ZJZA 4ANJA 1YE9A 5FRMA 3VYRB 3PL8A 3G56A 3ZQCA 3S2WA 4UHTA 4A6EA 2TRTA 2DCEA 4C2TA 1N75A 4HF1A 2OJED 2V79A 3CUOA 2EA2A 3F0CA 2B63J 4RGRA 1YTYA 2JA6J 4BYYA 5E1ZB 1MJ9A 1FWZA 4D5FA 1MW7A 1ODDA 4FTHA 4DBQA 1O7LA 2DOFA 3K4MA 1P7IA 2DQLA 3E5QA 4BBSJ 1Y8QB 3BLYA 4IHSA 2E2IJ 1KYWA 4UY8I 2CS3A 3T8TA 2IRFG 3HGGA 3ROUA 1MMAA 3RQ4A 3BOQA 5DYMA 2GOMA 3H5AA 1PUFB 4B48A 5C4JJ 2K4JA 4CYCB 4NC6A 1YITI 1O3QA 2LY2A 2R7XA 2BY3A 4II3A 2VC0A 3MKYB 1YX3A 2XSJC 4DVYP 2M30A 3CDIA 1MNEA 2VL8A 1SFUA 3I4PA 1ZHFA 2D5VA 2Y31A 3JSPA 5FD6A 1SVMA 4YIRX 2ZC2A 4L9TA 1WFXA 3OYKA 3ZRGA 3VPRA 4PJLA 1ZK8A 3TW6A 5GPCA 1YX5A 5IT3A 3HZJA 3S2HJ 1D0XA 3L00A 2Q24A 3C1DA 2CWEA 3G71I 2VC1A 2PZ9A 2GZWA 2IAIA 2DPDA 3JW4A 4W97A 2XF6A 2VKVA 2HVQA 2GM4A 5DCMA 4BH9A 3M9AA 2K9LA 2O0YA 2O6GE 3IP4B 1QRYA 2JA5J 2M2EA 2VE8A 3M1EA 3I71A 3ZMUA 4QLCU 3WTWC 3BJ6A 1W36C 3HTHA 4QTRA 3F8BA 4O5VA 1J2XA 2JPCA 1B1BA 2WA0A 3PNTA 5HNHA 2R7UA 1B6AA 4CYCA 5J3LA 2DA1A 4XKWA 4CCMA 2WY8Q 2HYGD 1ZR2A 4AYBN 1J59A 2RASA 3NRVA 1E3PA 2K3PA 3FBIB 4QWQA 2NP5A 3S3NA 2WAQN 4RLFA 3V8KA 2FMLA 3ZQLA 1ZTRA 3ELKA 2V1DA 2MGQA 3KPHA 1F43A 4XN0A 1V5FA 3QWLA 4E7LA 3MAJA 4IKFA 1X2NA 2QBYA 2DMQA 3OYIA 4OMZA 3ONQA 2XDVA 3IHUA 1W0TA 2K85A 1MBEA 2OTJI 2WC2A 3ZQFA 2R7VA 4YRVA 4KIGA 3CF5F 3KYLA 1K6YA 2QUFA 1DPUA 4ESBA 1IXRC 2IGOA 1R00A 2CO5A 1ZELA 2MD0A 1U8RA 1ZH5A 2BW3A 2LG4A 3A02A 3A2KA 3QRFF 2LP0A 2JSCA 2WWYA 1HA8A 3IWFA 1ZREA 3B6CA 3HIFA 3U1DA 1L3LA 4BQNA 1U5TC 2VQCA 1YIJI 3JSOA 2Y69H 1A6QA 1JE8A 3TMOA 1E3OC 2F5DA 5LRSA 3JRAA 1RPWA 3F23A 4ZH4F 2QKMB 3IH3A 1FTZA 1T6SA 2O5RA 2CQ7A 2MBFA 3CDLA 4ZTJA 3GZ5A 1VZ0A 2XKOA 5EEAA 5IP6A 2UXXA 3OIPA 3FXLA 2Z1DA 2W53A 2HOEA 1XMKA 2DMPA 5H2FC 5IY5H 3KKDA 3AAFA 2WUIA 4RGUA 2RV8A 3KP2A 4RAZA 2JA2A 3KZZA 4D7MA 3HTAA 4UUTA 3DKYA 2XB5A 3H1CA 1ZRCA 4B3AA 2VT3A 4IEJA 3H3ZA 5FROA 3ZMTA 4BXFA 1IN7A 1IRFA 2QWWA 3DKXA 4I7HA 5E3OA 2DA6A 1RUOA 2HEOA 3H3VK 1J9IA 3SDGA 4QPOA 2HI3A 1JKRC 3TP3A 3QOEA 3CZ6A 2ZCMA 3X2QH 5CPRB 1R58A 1QVTA 3IRQA 5CVUA 1TLHB 2VKEA 3HEFA 2HKXA 1USSA 2VIXA 2PG4A 1O57A 3AQSA 1WJ5A 4CSWA 2WV0A 4MTEA 5DAJA 2DA3A 4XBFA 3TW7A 3B02A 4HOBA 5J8CA 3WTUC 4XOPA 4ZYDA 2OUMA 3P9KA 2JWTA 1J0RA 1LDJA 3DBHB 3K0LA 4XLNF 2JUGA 4XN3A 1KU2A 1ENHA 2DT5A 2B3WA 5ILUA 1RETA 1D8JA 4KIFA 1QU3A 5E8GA 3S1MJ 2XAGA 2BY2A 4M73A 3HSRA 1N25A 2W4SA 4BQAA 1FJLA 2QIBA 3TOBA 3LHQA 2EK5A 4EJUA 3TDUC 1FSHA 1QPMA 3CMMA 3L2RA 2KISA 2HXOA 4C3JJ 1XDSA 4HV5A 4FQGA 5J1UA 1LPQA 5E3NA 1UHSA 3B6AA 2Z99A 3H5NA 4KMFA 2EFPA 2KIMA 1Z21A 1PP7U 3QBMA 2CFXA 5IYBJ 3TQNA 3BG3A 4MXMA 3C2BA 3GLLA 3OOPA 5FRNA 4A0XA 2FBQA 1I39A 3RKXA 4L62A 2VQLA 3BQZA 3LMMA 3VVZA 2D1HA 1KQ9A 2FOWA 5J47A 3CMEI 1KONA 1APLC 2ZMEC 4G94A 1D0ZA 1GHCA 4A5NA 1TWGJ 2ZFUA 4HSRA 2OD5A 4ENMA 3F8CA 3COLA 5EFYA 1ETWA 5FHPA 3HYIA 2IS4A 3TL4X 5DM7F 1B4AA 3RDIA 4DOZA 1V54H 2HOTA 1O3RA 2ETHA 3RPQA 2E35A 4MQVA 1SGMA 1GVDA 2K9MA 2OPTA 3VOEA 5EG0A 2R7SA 1SD4A 1G59A 4GCTA 1U2WA 1ZN2A 3R0AA 6PAXA 4X0GA 3C7JA 3I9V2 1R1UA 3CDHA 1FBQA 2H09A 3AG3H 3P5JA 3PQKA 4BHCA 3JSJA 1Y0NA 4OIPF 5B1BH 4HLXA 5DCFA 5FGMA 1X1DA 3W3CA 1ZG1A 4BHBA 1GUUA 4LLLA 5HDNA 4CCJA 2Q8KA 1K4TA 4MIMA 4QSHA 2Y0SN 3PUBA 1QHHD 4L9VA 2TDXA 2EJRA 4KN4X 1VI0A 4JOMA 1S72I 2CUZA 4RM3A 2DI3A 2LBFB 2DPUA 2FX0A 2OZUA 5TJJA 1AKHA 1K7AA 4RGSA 3BCAA 1UI5A 2H94A 1MBKA 4ESFA 3QPTA 3HL2A 4E7JA 1EA3A 2BY0A 3PM1A 4A3EJ 1IRXA 5CVJA 4BEHB 2STTA 5BPDA 3HRMA 2PX9A 4B1RA 2CG4A 3HGYA 2IEKA 2DBBA 3E1SA 3G1MA 1R22A 1OR7A 4IPAA 2JZYA 3SJMA 4FE7A 2KRCA 3BJAA 3ZGKA 2ZCNA 1SVOA 1LFPA 2NX4A 3BQYA 4RDUA 3EUKL 1RRJA 2O7TA 2V9KA 3ZP5A 1U9NA 1WJFA 5M5XJ 4IRVA 4LJZF 3NEUA 3TOAA 2BW3B 2MW8A 4JQFA 5CQGA 4A3CJ 4MLOA 1JKPC 1O7FA 3HOTA 3NNRA 3HTSB 3K2AA 2FNPA 5D6EA 1LVAA 2WY7Q 3G1LA 1LNWA 3K4CA 2GA2A 2JVHA 3DU5A 3BZKA 2Q2EA 3DXJF 3CJNA 3MKWB 3FHNA 5BNGA 5BMZA 2BOLA 2ZMEB 3FMSA 4HAMA 3M8JA 4OD4A 4XIDA 5H9TA 2Y9YA 3SEZA 3LAPA 3ABUA 3EUHA 4MO7A 1TNTA 1SAXA 2F6CA 2OCEA 3TP0A 3LSJA 1X4OA 2LKXA 2R7DA 1BR4A 4CZCA 3KKCA 1Y8RB 4GCLA 2V1XA 2OAZA 3TKYA 2CQKA 2Z3YA 1I1SA 2NVYJ 2RDPA 4BY1J 3QP6A 5HOOA 3DFGA 4M3GA 1OYIA 3HTIA 3DBLB 4S04A 3OYMA 4MNUA 1S7AA 3OYNA 2PJRA 1DQUA 5D8KB 1F36A 1MGTA 2DW4A 3E5XA 3I59A 2HXIA 2JPBA 4G6DA 5FGLA 2YU9J 1QVUA 3CESA 3I5UA 4LMYA 2V57A 1Z7UA 3A4CA 3COAC 1YJ9I 4Y3OA 1I6HJ 4HSTA 1SMYF 4PSXA 2DYRH 1TTYA 2IA2A 2KQRA 2QVOA 1VQ9I 3GBGA 3MZ8A 1LJ9A 2KRFA 2Z5UA 3VYSB 4M3FA 4P55A 2ZMEA 2CFOA 2YX4A 3DPJA 4BHPA 3S2DJ 2Y0SA 2JK3A 1KU9A 5J40A 2M34A 5F0FA 2L9NA 3O2PE 4BQOA 3U1KA 2XPVA 3HXLA 2HYTA 3NPIA 5L3FA 1VQ8I 4RLQA 4B8XA 2GIVA 3KYCB 2EFQA 2W48A 2Y75A 4PJ0C 2DT6A 5HLIA 5KVRA 3LOCA 4KN7X 4OAYA 3I0TA 5HODA 2M0CA 2O3FA 3VUQA 3GO5A 3TGNA 3TO6A 4A3KJ 5FLXK 5CXGA 2GQQA 1GT0C 3I4MJ 2CW0F 3L2VA 5ERIA 3VYUB 4B47A 2MSYA 1XPXA 3OY9A 1IV6A 1F5TA 4OD5A 5JLXA 3I59B 5HS8A 1GLNA 2KL4A 5FFXA 1WVRA 1WGXA 2MG4A 4Y17A 1BJZA 3HDDA 1S7EA 3H92A 1WJDA 3SFIA 1QZYA 1FPQA 1BOAA 5F04A 2STWA 2NS7A 5F1RA 2MFZA 1S9HA 4RB3C 3RPUD 1B8IA 1W36D 3QPLA 2KIUA 2L2OA 3LSKA 5F0CA 2XPUA 3OYLA 1V5GA 3BT9A 1RNLA 3L2CA 3KP6A 2OA4A 3IAM2 2M45A 3GF2A 2J5PA 4XR6A 1OPCA 3R6SA 2ESHA 3HHGA 2CV1A 1ZLJA 2ZXHA 2W57A 2WADA 3GTGJ 1TP4A 2DLLA 3JRBA 2JUCA 4HQMA 2R0QC 2WGBA 1RR7A 3JTGA 2ESNA 4UUSB 4UXNA 2X6OA 4NB5A 5FD5A 1DP7P 4IHVA 5DUKA 1LDKB 3B81A 2WAEA 3DTEA 5EEHA 1D0YA 3J7ZI 2HQNA 1EV7A 2IVMA 2WAFA 4EJTA 3MD2A 3GTPJ 3KCCA 3EQLF 3SEQA 4WF2A 4L5IA 1WJBA 3N97A 1Z77A 2LH9A 2XDNA 1LE8B 1MDMA 3E7LA 2VE9A 5CVIA 4JP0A 4PJNA 2KMUA 1TZLA 2VPLA 2FUG2 3RZDJ 4YFNF 2JJ7A 3DTIA 4RMNA 5HDKA 4HF0A 2XB0X 4O3MA 2G9WA 2V9VA 4A3GJ 2O61A 1W7PA 1XB4A 4A5MA 4LGWA 4G9YA 1UB9A 3ERMA 5BPIA 2HFHA 2JRMA 4M9XA 1ZLKA 2ZFWA 5EGOA 3DKWA 4JX5A 2OF7A 4PZJA 5FKLA 3MNLA 4C2UA 1OCZH 1PDNC 1IDZA 2LDUA 5L3CA 4DGWB 4HNTA 1YOVB 2UUZA 4NQWB 1I3QJ 2HTJA 3W2AA 2FQ4A 2NYXA 3GXOA 2DA5A 2R5YB 2QQAA 2R7OA 4I09A 1PP8F 4U88A 2A05A 1AOYA 2P0WA 4AVZA 1P4XA 5IP7J 4PFPA 3GEUA 1IXSB 4NBQA 4RB1A 4L0YB 2ID3A 3NARA 1YYVA 1OCPA 2XAFA 4BJ5C 4HV6A 5IP9J 4G8XA 1T38A 2DA4A 2P7CB 3ZMDA 1OFCX 1FX7A 2WBMA 4KISA 5DCMB 2Q2EB 3F8NA 4Q47A 2VQHA 3EPZA 4UB8C 2R7RA 4V19K 2AQFA 2BV6A 4A2UA 4GCKA 2NRAC 3WTSC 4E70A 2RREA 1B72B 5IYDJ 3GZIA 2FBKA 4KA4A 3O3KA 1MSEC 2RKHA 2R7FA 4ENNA 2CRGA 3I54A 1IUFA 5LHIA 1NTCA 1OLTA 5B3SH 1WRJA 2W1OA 1RESA 3VWBA 1WH7A 5IYCJ 2VPRA 2EPFA 4XKCA 1MBGA 2GUHA 1TQIA 3I4NJ 2RHAA 3DPLC 2OERA 2FEZA 4NUBA 2IGNA 3LWFA 3LFKA 1QO0D 1EH8A 2RVCA 4Y4RA 3SQNA 2OBPA 2P4WA 2JA8J 5D1RA 3FBNB 1BW6A 2M7BA 3F72A 4HA8A 5F6FA 4E4HA 5BS6A 1R71A 1BW5A 2UWMA 1JJ8C 3BG6A 1JXSA 4L5EA 5CVRA 1SFOJ 1T0FA 1XC5A 1GV2A 2H1KA 4P96A 2X6XA 4I01A 4D7NA 3T1BA 3MCZA 1IF1A 2RQQA 3OYDA 2MH9A 1U0JA 4U0VA 4NN1A 2QCOA 1ONVA 1SD7A 2JT1A 3PO2J 3RI4A 4C30A 3DEWA 5J1YA 5EZGA 1G3SA 3NS4A 3HRSA 3OR1C 2KJCA 1NG7A 4EV0A 4F91B 2P5LC 1B72A 3LSTA 2DQRA 2FNAA 2X51A 1R1TA 3CUQA 5CW8A 1R4MB 3HOUJ 5ILVA 1JKQC 3CWRA 2FU4A 4R8HA 3FDYA 5JLWA 3H3UA 1FIAA 2E60A 2PN6A 2OC6A 4AC0A 2P7VB 1T08B 1X3ZB 2DO7A 2XF7A 4I98B 4EGYA 4AIDA 4HX7A 2LY9A 3CCLI 4HG2A 1P4AA 5H6QA 3IUVA 4F3QA 3R0JA 5DDGA 2ADUA 4IRIA 2FJ1A 1JTYA 3ERED 2KRHA 3GCMA 3EUPA 2Z9OA 2HZDA 4GXOA 3G7RA 3E6BA 4A3MJ 4X1EA 3GTQJ 4Y52J 4KITB 3L1PA 2B1EA 1ZG3A 2PBIA 3JRFA 1MMSA 5D19A 5FMPA 3Q9VA 2LD5A 2L7ZA 1BR1A 2MH2A 1STZA 4C9YA 2XHKA 4CCOA 3LSPA 2ISZA 5D6FA 4M71A 2PI0A 4NELA 3WTVC 3SZGA 5TRDA 4LB5A 4AD9A 3PO3J 1YRNA 2P6SA 4KIBA 2HGCA 3CC7I 3RH2A 1P2FA 2CJJA 2VKDA 3GTKJ 2IPQX 3MKLA 1XGMA 2M87A 4K2EA 1HKSA 2L54A 3HUGA 4BXUA 3BJBA 4IL6C 4Y7NJ 4XSZF 3PFYA 3ZQIA 3OYAA 4U0YA 3JR9A 1TWAJ 3A01A 5BOXA 4RGXA 1VQ7I 2A6EF 1ERDA 2E5ZA 1UHWA 3FXRA 3JRCA 1YHQI 3K4LA 2DOAA 2L01A 1HXDA 3ZN1A 2X1CA 4AWXB 1FBUA 3S3OA 3M4OJ 2F4IA 1FOWA 2I8DA 2H1LA 2XAQA 3TDZC 2L9RA 3KZIC 4RBOA 5HSZA 1K61A 2CQQA 3RKWA 3WGIA 5L3GA 5KCMA 2L02A 5FO5A 3MFKA 3K7AJ 1QPIA 5H6RA 4A3FJ 3KEQA 1JGSA 1FMWA 1X3WB 2PFBA 4KNYA 5C4YA 4XOTA 4JL3A 3ABKH 3BZ6A 4Q5SF 4Q4ZF 2XUBA 5AQCA 1BI3A 2DDBA 1VQ5I 3HOZJ 2R7TA 3VOXA 3EYIA 2HDWA 2LOOA 4XQFA 3BG7A 2IU5A 1UG0A 2LF8A 1MJAA 2BHZA 3GZNB 1TT5B 4BE0A 1NH3A 1IGNA 3OS1A 1MMDA 2BVMA 3Q0VA 1IRZA 3I3LA 1QNTA 4IQ4A 3GLXA 4YELA 3FKIJ 4A6DA 2NXNB 2FA5A 2HZTA 3LFUA 5LBQA 3G73A 3RKQA 1IN6A 3EYYA 3FK6A 2PLYA 1FIPA 2V6EA 1UELB 3AG1H 1R4NB 1Y56A 4CH7A 2IGKA 3IKTA 1WJEA 3FXMA 5JFRA 1JTXA 4HW0A 4XSXF 4GFBA 2L5QA 1VFCA 3IWZA 5KAFC 1XN7A 2EFOA 1WJAA 4GRIA 2L4MA 3HSEA 4IO9F 3QYFA 2FRHA 2LLKA 1ON2A 1DU6A 3IAS2 1HCRA 1T56A 5LGUA 5ILSA 2M9HA 3E7QA 2RQPA 2GAUA 2NOJB 3U21A 1IDYA 4XLAA 5E17F 3BZCA 4HNUA 4ENJA 1YQAA 5HLTA 2V1UA 2D1VA 2LSOA 1TNSA 5JI6A 4I6ZA 4CHUA 4PUSA 3ULQB 1FEXA 2L0KA 2K9SA 5FJ8J 3ECOA 5CYVA 3WODF 4RM2A 2DXIA 2HOAA 2IBDA 1Z05A 2H6CA 5AIQA 5L3EA 5IT9Z 4AYBA 1XMAA 5LEJA 3IH2A 3LSHA 5LHGA 5HAWA 4RA2A 2XV4S 3DPUA 1V5EA 3LNQA 3BY6A 1KGSA 2GENA 3FWEA 3OYCA 4EGZA 3GTLJ 2DAOA 3FHZA 1JT6A 1ULYA 1IG7A 3NRGA 1CF7A 1QZEA 3W6VA 3OOUA 4LITA 4PGGA 1LFBA 4GCVA 3WG7H 4DZPA 3LWJA 4MFEA 1P7JA 1IN5A 1LEAA 5LGTA 4IX7A 2XRLA 2HKUA 2RAEA 2VQGA 1HW5A 4AIJA 1YS7A 1DP3A 4BU2A 5C3EJ 3OR2C 3HRUA 1D5YA 2WV1A 4IVNA 1X1BA 4Z2YA 2FXAA 3T6NA 2VBWA 1W5CC 4HZFA 2YVEA 2CW8A 4I76A 3AKZA 1MBHA 1SFEA 2QZ8A 3LAJA 2K02A 3M07A 1LDDA 2UXUA 3JREA 3VDXA 2FJI1 1FT9A 4PGHA 3DU6A 4M3DA 4M3EA 1FYMA 2DK8A 1WZ2A 4A3BJ 1GXQA 3K69A 2ELJA 3E97A 4G6QA 4UUSA 4KT6A 2EH3A 2G7UA 3J80Z 1G3YA 2LFBA 2DN0A 4M9SA 5EZHA 1S7OA 3CUQC 2WB1A 1WH5A 2PMZN 2BYVE 2E1MB 4ASNA 2H27A 5TISC 2RC4A 4KUMA 3QKXA 1ETQA 4KT5C 1OR7C 3AL0C 5IPAA 4ZDPA 4PSWA 4BAYA 4DQ2A 1OCTC 3CLOA 4DZJA 3H0DA 3FZVA 1X1PA 2Z2SB 2R5ZA 4OIOF 3E6MA 2XPWA 1A5JA 2EFWA 1BOBA 5E20A 3T0YA 5KHDA 2DJIA 1P92A 2EIJH 2DODA 3W2WA 1OCOH 2I10A 5EF6A 2VBYA 1VTNC 3K4KA 3IL2A 3M7GA 2FOKA 4V2FA 4PK4A 2EZHA 4LK0F 2VN2A 1JUMA 1X3UA 2BXZA 4OOIA 3V78A 5LD2C 3VW2A 3DWLE 1X1AA 5EG0B 2QOPA 3KETA 1T0FC 2LYCA 4RAYA 5IT9K 4IHYA 3VB2A 1TWCJ 1YW7A 2E34A 1TBXA 3VYTB 4BL0B 3RYRA 1G3TA 3MZHA 2P5VA 4CA0A 3V6GA 4B4CA 3ZQ7A 2LRDA 3ZPLA 4MTDA 5CXIA 2F5CA 3ANGA 1JT0A 4U9NA 2Y48A 3A0BC 5HNFA 3WHCA 3G4SI 3QQAA 4IHXA 1ITYA 5LHHA 2V4JC 1YS6A 3O8GA 4RB2C 1LQ1A 3GTOJ 2UXPA 2J5OA 3CJRB 2IW5A 2ZNYA 3BR5A 4M6VA 1BI0A 1WPKA 2Y30A 5HVQC 3A01B 4BACA 2GXAA 1Z7LA 3HJEA 1K79A 2LREA 3EETA 4F52A 5IOYA 4QPQA 4XRMA 3D1NI 5LGNA 1R1VA 2RGVA 3CJDA 4U87A 3C07A 2R7QA 4GFKA 2LBFA 5D5VB 2F4MB 3DQVC 1I5ZA 4Y33A 3LA3A 2IA1A 4NC7A 2OU2A 4J19A 4UVBA 3CTAA 4HEA2 4EEFG 1Z67A 2LR8A 4YIFA 4BKXA 3N4MA 2XASA 2PJPA 3K10A 1J09A 4A69C 2E1MC 3ANPA 3HTUA 2ZXWH 1JI8A 1XX5A 4XLCA 4FHTA 3EGQA 2XF5A 1R6RA 1BIBA 1BA5A 3WU1B 1JHFA 3S32A 2DK5A 3WU2C 2MYSA 2F2EA 2XGEA 4JNNA 4KICA 3HOWJ 3KEYA 4HBLA 4A0ZA 4PFOA 2BGCA 4DYCA 1NHAA 4S05A 3PSFA 3I64A 1B8IB 2NNNA 1XSDA 1ACIA 2L4AA 2V6CA 2L9SA 2HQ5A 1HW2A 4DBRA 3WTYC 3U2RA 1SAUA 3GFJA 4G7ZF 5BQTA 3ABLH 3ZQQA 2LF7A 4XM3A 2F07A 3QU3A 1Q1HA 3BP8A 4ZZLA 5FKKA 4XMYA 3NAUA 1TT0A 1FSEA 2ZSHB 5J1RA 3HOYJ 2R3SA 3KLOA 4PJJA 2ZKZA 4JK1X 2KZVA 4XLEA 3PUFA 3BWGA 2EINH 5DM6F 1Z3YA 3MN2A 2YVHA 1UAAA 4IQJA 3L2QA 4DJAA 3FXOA 1AA7A 3BROA 1F9NA 2XC7A 3PIPF 2KKOA 4KWAA 3S8PA 2NS0A 5B66C 3GTJJ 3ML6A 4BY7J 3VFZA 1HBXG 2X85A 1LE8A 3E6DA 3QP5A 3CF2A 1F4KA 3HKZA 4QIWN 2H8RA 2ZNZA 2GXBA 2M4GA 4IJAA 4HKUA 5ED4A 4BDZA 1VQNI 2KJBA 2FF4A 3CQZJ 4PCQA 3HRTA 3A1YA 4OINF 2ELKA 3LSMA 1R5GA 4M6XA 4CCLA 5F64A 3Q5FA 2F4OB 1PUEE 3J7YJ 3F6VA 1XGSA 2DFFA 4IOCF 3F8MA 3GUDA 4WK8F 1E3HA 1AWCA 2IJLA 3WTXC 1H89C 3V8LA 3O6BB 5GAGJ 1GDTA 3D5SC 2M0MA 3D0SA 4O6JA 3CCMI 4XICA 3BG5A 4UV8A 3VODA 3V7CA 4DW6A 4EJOA 1GVJA 1HQCA 1XSVA 1ZKGA 4M9ZA 4J00A 3BTCA 4D9JA 3LSIA 3BJOA 3N05A 3JRGA 4XLHA 3HTJA 2IT0A 3Q3SA 1IZ1A 5D5XB 3DF8A 2W82A 2NVQJ 2PEXA 1W4MA 3ZOBA 1Z6TA 1O4XA 1FYKA 2M1BA 2P8TA 2MD5A 1Y1WJ 1G4DA 1IN4A 5E1XA 3BPVA 3PASA 2XIGA 3EDPA 3BR3A 3K9TA 1D1AA 1HSTA 4EJWA 2W25A 2EIMH 1MMGA 3L7WA 2N8GA 3JTHA 1VF9A 3I58A 2QA4I 2QF7A 4FETA 4CXFA 3CP2A 5B1AH 1LKXA 3S17J 1AKHB 4CUGA 1Z6RA 1WSUA 5L3DA 3RQIA 4HF2A 2W84A 3QYBA 2QENA 4G6TB 3OIQA 4D5CA 5CLSA 1SANA 3D5RC 1HW1A 2MC3A 3MZYA 2W00A 5DV5A 1HSJA 4KYWA 2DFIA 1BL0A 3K1PA 2ZSIB 1Y0UA 4CCNA 3SYTA 1K78B 4L9JA 1PJRA 3BDDA 1A6IA 5ICGA 2FBIA 3H9GA 2HKOA 2E1CA 3I55I 4MK6A 2A3SA 2ZXJA 4NNJA 9ANTA 1WKMA 2I5UA 1O3TA 3VEPA 4LK1F 3LA7A 1HKTA 4WXCA 3KIOA 1WI9A 3K2ZA 3NQOA 5E8IA 3OYEA 2QKLB 4CCKA 1SFKA 2Y2ZA 4I0AA 2K4BA 2ZXIA 4R1HA 3G1OA 1ON1A 1T33A 2XVCA 4W1UA 2A68F 4EM1A 1DU0A 1K6OA 3BG9A 4F55A 2E5NA 1U6GA 3SWHA 4XRSG 5FLMJ 5HS7A 1B9MA 2DFHA 2UXOA 2B9SA 2ZCXA 3ZMSA 3R4KA 5J8FA 2GXGA 1VQPI 1JUSA 2X0LA 2DTZA 3S5RA 3WU0A 1EH7A 2VXDA 4IZZA 2HYJA 5F1JA 1TW3A 2D2WA 5GP9A 3U9GA 5GAHJ 3CRJA 1UHMA 1FYLA 3DV8A 5EJCA 2K9QA 2BZTA 4F93B 4RS8A 3SXYA 2KP6A 4DNCA 5JR3A 1BIAA 3ON2A 5K5OA 2KIQA 4XNFA 1RUNA 1SMTA 1SVLA 1MDMB 3WE2A 4EM0B 2FD5A 1QZZA 1V3FA 2K9NA 2M8EA 3EUAA 1A35A 3OSGA 5D4RA 1PYVA 5HDGA 3HBLA 3E0JB 4CO8A 3TEDA 3CCYA 4ZDOA 3M3YJ 1Z0XA 1FOYA 2VT2A 3CCVI 1XDUA 4YIIA 1W7PB 1HKQA 1REPC 2YR2A 2QBYB 1Y1VJ 1P6RA 3MVPA 5E79C 3LSGA 2YX7A 2W7NA 1Q1VA 1OCCH 3ON4A 2DTRA 3LQQA 4OIRF 1MIJA 4N9HA 3CCJI 3FISA 4ACIA 3VW0A 2BE5F 1U78A 2FE3A 1H88C 1JKOC 4BNCA 2FQ3A 4IF4A 3A03A 1LB2A 2EQRA 4N4NB 3RYPA 2V7FA 3OMYA 5M5WJ 4OIQF 2E7XA 4MHGA 3JAMK 1EJ9A 1UMQA 2NVUB 3GVAA 3H9JA 4HDVA 3F9KA 4M72A 2HOSA 3LL7A 3RD3A 1ZARA 2CQNA 3FXUA 4I0BA 3LQRA 5JHUA 4ENKA 3ZQGA 2GIZA 3L9FA 2F48A 1MH4A 3OWTA 5DS9A 1U9OA 4NDLA 1XD7A 5K1YA 4OU0A 4YEJA 2HR3A 2KT0A 1PUFA 2IP2A 4N0BA 3T5XA 3WTZA 1H8AC 3I53A 1TW2A 2UV1A 1T2KA 3AL0B 2HQRA 1T95A 2YPRA 3QPHA 1YIOA 4IXAA 2X1EA 1KZHA 3E6CC 3BHQA 5KAIC 3HOSA 3C2GA 3NXCA 3DEUA 1R23A 2VB6A 2GOXB 2UXHA 3H35A 1POGA 3F3XA 2R5ZB 1FP2A 2E2HJ 1RI7A 4BEHA 1FLIA 1MZBA 1Y6IA 3KP5A 1KU7A 2DA2A 3GW2A 4XONA 1DUXC 3PFIA 5K7ZA 3FXJA 4R79A 3GFIA 1SD5A 4U9LA 1WHUA 2WAQA 5LLQA 1YJWI 1TC3C 3OV8A 2E1OA 2K7LA 4JX4A 4A93J 3CCUI 2EFNA 4ESJA 2EBIA 3HHHA 3FXKA 4LD5A 4UDSA 3EUHC 4P9UA 1WQ2A 5DTDA 3CCSI 1ZGAA 2XAUA 1MBJA 1YG2A 2QQ9A 3OYHA 3QODA 5LFAA 2ZY9A 3RZOJ 2HNHA 2W24A 3ZXSA 3G6EI 4N9IA 4MQ9F 4YFKF 3CO7C 2M7AA 3RPUA 4PXIA 1R7JA 1W5TA 3CUQB 5DD4A 5HLHA 1VQ4I 3PQJA 1A36A 1VQKI 2GWRA 2LKPA 2L9VA 4P9FA 3DCFA 5D5UB 1Z91A 2VJJA 3OYGA 3PNYA 3FX3A 4A12A 2OI8A 1S3JA 2WB1N 3DLLF 1Z3XA 4WWCA 2QQBA 1JGGA 4LG3A 1LFUP 4WXDA 3BTIA 1XCVA 1A04A 2EILH 3GMEA 5F08A 4HX8A 1XG1A 4I99C 1EKEA 3ZCOA 1FP1D 2CSOA 4RAFA 5H20A 3V42A 2QSGX 2R7ZJ 4LLGF 3WGHA 5TGTA 3MQ0A 1KA8A 2DMUA 4F92B 1B9NA 4ME9A 1BI2A 1P9QC 4B3XA 2MLKA 2BXYA 2PJRB 2GFNA 1ETKA 2EZLA 4JKZA 1OJLA 5EGOB 1K83J 3KX2A 2A07F 2ZJ2A 3AG2H 2DFEA 5EEGA 2R4GA 2L7KA 4RAGA 5E3LA 3C18A 4ZDLA 5ICFA 1T39A 1IXCA 4BJTA 3PJRA 4OMYA 4XLPF 3J81Z 2QM3A 3K6GA 1XMXA 2DMTA 1D1BA 3R61A 4A3JJ 4GO1A 4X6AJ 3HPHA 3KP4A 4ITVA 2ZJPF 2XSDC 1S5LC 1YRNB 1LEBA 1FZPB 5GTHC 3VOKA 1I27A 1UFMA 3P9IA 5GAEJ 3HOXJ 1BJAA 2DMNA 1FNNA 4HLYA 2F5VA 3IH4A 4XKVA 1RKTA 3UR3C 1P4WA 3GYHX 1T8IA 2M3AA 2L3DA 2D45A 2G7GA 4L0ZB 2CW7A 4MEYF 1X4PA 2O9LA 1DGRM 2UXIA 3MKZA 3VP5A 4LIVA 1MMNA 5FKMA 4G7HF 2KIFA 1UG2A 2CH0A 4G12A 5HS9A 3BPXA 5LEKA 4XRSA 4G7OF 1WWXA 4AIKA 1MSFC 1DPRA 2KLOA 1MBFA 2PQ8A 1L0OC 1ORKA 2XAHA 3E5UA 4UNOA 3GX4X 2REKA 3F1BA 2VXZA 1JHHA 1HDDC 2DJNA 2EWNA 1N78A 2Q1ZB 1ETYA 3FM3A 2CU7A 2K40A 2O8KA 1G6NA 1X58A 5JHFA 2ZO4A 2MC4A 3ZQHA 1E2XA 3QU6A 5FKOA 2DOEA 2OZ6A 1I50J 4II2A 3WG9A 1IW7F 4ZYHA 1YJNI 4EMSA 2VUMJ 4LIUA 3K8PC 1SD6A 3IKVA 2BHYA 4PJMA 4GFLA 1F1ZA 3IV5A 2CV2A 2IS1A 2X48A 1IAWA 1BC7C 2Z33A 5J6XA 3WTTC 2VBXA 4GGGA 1IC8A 1GXPA 3H0GJ 2NAZA 2X6YA 5LRRA 4E7IA 5K7FA 3K4NA 3TBIA 1MJBA 3LA2A 3OYBA 2PBXA 2DDAA 5D4SA 4A3DJ 1Z1DA 1NK3P 2E1NA 3OYFA 3JRDA 1YI2I 4BXXJ 1J7KA 4F7ZA 4ICHA 1H9TA 3MWMA 4FX4A 2HTSA 3MMYB 4GYIA 4U7DA 4U0WA 1IRGA 1DGWY 2O7OA 4H4KC 1O3SA 1BR2A 1TQMA 2XROA 2CV0A 2RN7A 2A61A 2VBZA 2EIKH 2ZBKA 2EZKA 3IC7A 3J80K 3G2BA 1VQOI 2CGPA 3KP3A 4XRFA 1KQ0A 1EH6A 2LK2A 2EA4A 4BE2A 5GTIC 1X1CA 1KU3A 4EQQA 1NG6A 3FRQA 3VVYA 2HWVA 2XGXA 3L2UA 3B73A 3Q9SA 1E0EA 1EF4A 4HQEA 2TCTA 3BNIA 4S0HB 5D8LB 2QSFX 4ZYAA 4C2MA 2ACJA 1SFXA 4D1QA 1KYZA 3JRIA 4B44A 2ZOZA 4ZYEA 3OYJA 2QYOA 2BBYA 3S14J 3DEEA 4AU7A 2NP3A 4BGDA 4CICA 4GDFA 3O8HA 2VASA 1UCRA 2BEOA 2VJ5A 1Z9CA 1VQ6I 4ON0A 4AUXA 5JVGF 2Z16A 3KZ9A 4JX6A 1FOXA 1OYWA 2JSPA 5DEQA 4YG2F 2ZB9A 2PMHA 2IS2A 4L9NA 1HOMA 4V2GA 3WHBA 1FOKA 2HQAA 3M8FA 1J75A 2IXSA 1XSXA 3VVXA 4CGRA 2R5YA 1XGOA 2PFVA 4FX0A 2VONA 2NS8A 2L7MP 5J4YA 1WJCA 3K1NA 3S1RJ 2NVXJ 1LVKA 2VOPA 2ICWG 2VOOA 1AU7A 2OQRA 1UI6A 3KFWX 4BS9A 4KFCA 3K1MA 1IO2A 3KE2A 4J01A 1W5SA 5FLXZ 2DG7A 3PPBA 1QHGA 3I56I 5K5RA 3DTKA 4HDUA 3V7SA 1I6XA 4C3IJ 3UKGA
chains in the Genus database with same CATH topology
5IP9J 3BR2A 2MGQA 1F43A 2DA4A 1OFCX 1X2NA 2DMQA 2B63J 1W0TA 1MBEA 4GCKA 5IYDJ 1B72B 3GZIA 3ZQFA 1H89C 5FLVA 1GDTA 1MSEC 4XICA 2CRGA 3BG5A 1IUFA 2QKOA 1NTCA 4DW6A 3A02A 1RESA 1WH7A 1ZKGA 3Q0WA 3BTCA 2LP0A 2VPRA 5IYCJ 1ZGWA 3JRGA 1MBGA 2GUHA 3HTJA 3B6CA 3I4NJ 2RHAA 5IOZA 3Q3SA 2OERA 3NI7A 3CMYA 1E3OC 2NVQJ 3BCGA 3ZOBA 2JA8J 1O4XA 5D1RA 1BW6A 1Y1WJ 5E3MA 3O60A 3JRAA 3PASA 1RPWA 3BR3A 1JJ8C 1BW5A 4L5EA 1SFOJ 1XC5A 1GV2A 2H1KA 1FTZA 3IH3A 4D7NA 3BTLA 3CDLA 2N8GA 1VF9A 3JRHA 5EEAA 5IP6A 2QF7A 2W53A 2DMPA 4NN1A 3KKDA 2QCOA 3S17J 2WUIA 1AKHB 1WI3A 4D7MA 3RQIA 3PO2J 3HTAA 4UUTA 2QTQA 3DEWA 2XGCA 5J1YA 4D5CA 5EZGA 2XB5A 1ZQ3P 1SANA 4B3AA 3BRUA 4IEJA 1BL0A 1B72A 4ABZA 5CW8A 5E3OA 2DA6A 3H3VK 3HOUJ 3SDGA 4HNVA 5EDNA 1JKQC 3CWRA 2HI3A 4DYRA 1JKRC 1A6IA 3TP3A 2R92J 5JLWA 2ZCMA 1FIAA 1QVTA 4MK6A 3VIBA 2VKEA 3HEFA 4AC0A 2E2JJ 3HIMA 9ANTA 3P9TA 3OSFA 1XS9A 2X9DA 2KDZA 3AQSA 5DAJA 2DA3A 3TW7A 2LY9A 2Y2ZA 1RKWA 1X2MA 3FIWA 1T33A 3G1OA 4W1UA 1DU0A 3IUVA 2JWTA 3BG9A 1TWFJ 2FJ1A 1JTYA 4XRSG 2GLOA 5FLMJ 3EUPA 1ENHA 1RETA 2UXOA 3G7RA 4A3MJ 2ZCXA 4X1EA 3GTQJ 4Y52J 3L1PA 1JUSA 3JRFA 2DTZA 3S1MJ 5D19A 2LD5A 3S5RA 2L7ZA 5FMPA 2JA7J 1FJLA 2QIBA 3LHQA 2HYJA 5F1JA 1TWHJ 2M8GX 5GP9A 3LSPA 3CRJA 2HXOA 4NELA 4C3JJ 3PO3J 5HBUA 5M5YJ 2K9QA 3S1NJ 5J1UA 5E3NA 1YRNA 3RH2A 1UHSA 3B6AA 1JJ6C 2CJJA 3GTKJ 3ON2A 2CQXA 3MKLA 3QBMA 5IYBJ 3BJBA 3BG3A 1GV5A 2FD5A 4Y7NJ 4MXMA 3ZQIA 3C2BA 3HM5A 3JR9A 2K9NA 1TWAJ 3A01A 3OSGA 1W0UA 2FBQA 3HBLA 3TEDA 3CCYA 3M3YJ 1Z0XA 4L62A 2QWTA 3LJLA 3JRCA 3BQZA 3VVZA 3BTJA 1APLC 1Y1VJ 3M4OJ 2LTPA 3MVPA 2L9RA 3LSGA 4RBOA 5HSZA 1K61A 2LVSA 1TWGJ 5EFYA 1Q1VA 2CQQA 3COLA 3ON4A 4FE4A 2R93J 1ETWA 3BR6A 5EYRA 4C3HJ 5FHPA 3FISA 3K7AJ 4ACIA 3VW0A 2HOTA 1QPIA 4A3FJ 1U78A 1H88C 4JYKA 5C4YA 1JKOC 1SGMA 4JL3A 1GVDA 4FCYA 2OPTA 2XGDA 5EG0A 5AQCA 4GCTA 3HOZJ 2CUEA 3GTMJ 3A03A 1HDPA 1CQTA 3VOXA 1ETOA 2EQRA 2IU5A 2EZIA 3BR0A 5M5WJ 3HB9A 1NK2P 1IGNA 5K58A 5K7HA 3Q0VA 4XK4A 1UMQA 1IRZA 4FISA 3JSJA 1GUUA 2HOSA 5D18A 3FKIJ 3RD3A 2AO9A 4LOCA 4BBRJ 4QSHA 4MIMA 3RKQA 2Y0SN 1JUPA 3ZQGA 3FK6A 1FIPA 1MH4A 1ZR4A 1VI0A 5DS9A 1U9OA 4NDLA 2AHQA 2KT0A 5M3MJ 1PUFA 1JTXA 2FX0A 4GFBA 1H8AC 1AKHA 1VFCA 2GBYA 1UI5A 1MBKA 2LLKA 4YZEA 2JN6A 4A3EJ 3PM1A 1IJWC 3BHQA 1U8BA 1DU6A 3LSRA 5C4XJ 1HCRA 1T56A 3NXCA 4AC6A 1WCMJ 2M9HA 2UXHA 3E7QA 1POGA 2ID6A 1ETXA 1IDYA 2ME6A 2VI6A 2R5ZB 4B1RA 2E2HJ 3HGYA 2IEKA 3G1MA 3SJMA 4FE7A 2CUFA 3QPSA 2DA2A 5F0HA 5K7ZA 2ZCNA 4I6ZA 2DA7A 1FEXA 2NX4A 2L0KA 3BQYA 2K9SA 4RDUA 4M3BA 1TC3C 2O7TA 5FJ8J 2NVTJ 2E1OA 4JX4A 3HKZN 4A93J 1U9NA 5M5XJ 2EBIA 2HOAA 4AF5A 2IBDA 4UDSA 2DG8A 2MW8A 4A3CJ 2ECCA 3IH2A 4MLOA 5DTDA 1JKPC 1HF0A 2HDDA 2D6YA 1MBJA 1ZTRA 1AHDP 5HAWA 3NNRA 3LNQA 2YS9A 3K2AA 2GENA 4DYQA 3GTLJ 3RZOJ 1R9TJ 3G1LA 1JT6A 5GPAA 1IG7A 3NRGA 4PXIA 3W6VA 2E19A 3OOUA 5BNGA 2G7LA 3VW1A 1LFBA 4DZPA 3LWJA 4MFEA 4XIDA 5H9TA 2G7SA 2Y9YA 3DCFA 1P7JA 5C44J 4MFDA 3KNWA 4MO7A 2OI8A 2XRLA 2HKUA 2RAEA 2WB1N 2NOGA 2JMWA 3TP0A 5C3EJ 1JGGA 3LSJA 1LFUP 3FK7A 1D5YA 2WV1A 2P81A 2LKXA 3BTIA 3KKCA 3T6NA 4GCLA 2YVEA 5F08A 1XG1A 4I76A 1MBHA 2NVYJ 4BY1J 2UXUA 3JREA 2R7ZJ 2ZOYA 4C2MJ 2G3BA 4IHWA 5M3FJ 2DMUA 1MNMC 3S1QJ 4ME9A 5F27A 1MH3A 4M3GA 2GFNA 4M3DA 4M3EA 2YUSA 1ETKA 3HTIA 2EZLA 4JKZA 4A3BJ 1OJLA 5EGOB 1K83J 1ETVA 4UUSA 1FTTA 1F36A 2HXIA 2EH3A 3AQTA 5FGLA 2YU9J 1QVUA 5E3LA 3OIOA 2V57A 2LFBA 2G0EA 2DN0A 3HOVJ 5EZHA 4A3LJ 1I6HJ 1WH5A 2DMTA 2PMZN 4A3JJ 4A3IJ 4X6AJ 3QKXA 2XSDC 1YRNB 1ETQA 3GBGA 3S16J 3VOKA 3BR1A 5IPAA 3HOXJ 3S15J 4M3FA 1G2HA 1OCTC 4DZJA 2ME0A 3DPJA 2DMNA 3IH4A 2R5ZA 3S2DJ 3Q0UA 2XPWA 1A5JA 2JK3A 1RKTA 5FKNA 2M34A 5F0FA 2G7GA 1HLVA 1VNDA 2I10A 2XPVA 5EF6A 2O9LA 2UXIA 3VP5A 4V2FA 5FKMA 1UG2A 2HYTA 4G12A 3NPIA 2EZHA 4XRSA 2W48A 1MSFC 3HE0A 1JUMA 2COBA 1MBFA 1ORKA 3LOCA 3V78A 2L7FP 2REKA 3F1BA 3VW2A 5HODA 2M0CA 1HDDC 2DJNA 5EG0B 2Y9ZA 2QOPA 2ECBA 1ETYA 3VUQA 5CXGA 4A3KJ 2CU7A 4IHYA 2K40A 1GT0C 3I4MJ 1TWCJ 2O8KA 4JNNA 1X58A 3G56A 3ZQHA 3ZQCA 2Q24A 5FKOA 1I50J 2MSYA 2TRTA 1IV6A 2VUMJ 5JLXA 3V6GA 4B4CA 4GFLA 5CXIA 3IV5A 3ANGA 1JT0A 1WGXA 3F0CA 2MG4A 3HDDA 1BJZA 3WHCA 3QQAA 1S7EA 4IHXA 2X48A 2JA6J 3O8GA 1ITYA 4KWAA 3GTOJ 3SFIA 2UXPA 4D5FA 3BR5A 4M6VA 1WPKA 2Y30A 3H0GJ 5F04A 3A01B 1IC8A 2NS7A 5K7FA 4FTHA 5IOYA 3D1NI 4XRMA 1P7IA 2PBXA 3CJDA 1B8IA 4A3DJ 4BBSJ 3C07A 1NK3P 4GFKA 2E2IJ 3QPLA 3JRDA 5F0CA 2XPUA 4BXXJ 3BT9A 3HGGA 4ICHA 4J19A 1PUFB 4EEFG 2O7OA 2LR8A 4CYCB 5C4JJ 3GTGJ 3JRBA 4BKXA 2R0QC 2WGBA 1RR7A 2EZKA 4A69C 3ANPA 2LK2A 4UUSB 2X6OA 3EGQA 4IHVA 2D5VA 1BA5A 3B81A 2Y31A 3FRQA 3VVYA 3GTPJ 1EF4A 2XGEA 2TCTA 3HOWJ 4DYCA 3BNIA 4S0HB 3VPRA 1Z77A 1B8IB 1ZK8A 3TW6A 5GPCA 3JRIA 1LE8B 2XDNA 3S2HJ 2ZOZA 3E7LA 2HQ5A 3S14J 2PZ9A 4JP0A 2IAIA 4W97A 3RZDJ 2NP3A 2JJ7A 2VKVA 2XB0X 2GM4A 2F07A 4A3GJ 3O8HA 5FKKA 1QRYA 2JA5J 2M2EA 3NAUA 4AUXA 3KZ9A 5J1RA 3HOYJ 4JX6A 5EGOA 4JX5A 2OF7A 2ZB9A 5FKLA 1HOMA 3HTHA 3MNLA 4QTRA 4V2GA 3WHBA 3MN2A 2YVHA 3VVXA 1IDZA 4CYCA 4CGRA 5J3LA 2R5YA 2DA1A 1I3QJ 3GTJJ 2NS8A 1ZR2A 2FQ4A 2L7MP 4BY7J 4AYBN 2R5YB 2DA5A 3S1RJ 1LE8A 2RASA 2NVXJ 4QIWN 1AU7A 2H8RA 1UI6A 5IP7J 2NP5A 3PPBA 3GEUA 2DG7A 2WAQN 4HKUA 2ID3A 3NARA 1OCPA 3CQZJ 4C3IJ 3UKGA 3ZQLA 2ELKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 J;  3BR2 A;  2MGQ A;  1F43 A;  2DA4 A;  1OFC X;  1X2N A;  2DMQ A;  2B63 J;  1W0T A;  1MBE A;  4GCK A;  5IYD J;  1B72 B;  3GZI A;  3ZQF A;  1H89 C;  5FLV A;  1GDT A;  1MSE C;  4XIC A;  2CRG A;  3BG5 A;  1IUF A;  2QKO A;  1NTC A;  4DW6 A;  3A02 A;  1RES A;  1WH7 A;  1ZKG A;  3Q0W A;  3BTC A;  2LP0 A;  2VPR A;  5IYC J;  1ZGW A;  3JRG A;  1MBG A;  2GUH A;  3HTJ A;  3B6C A;  3I4N J;  2RHA A;  5IOZ A;  3Q3S A;  2OER A;  3NI7 A;  3CMY A;  1E3O C;  2NVQ J;  3BCG A;  3ZOB A;  2JA8 J;  1O4X A;  5D1R A;  1BW6 A;  1Y1W J;  5E3M A;  3O60 A;  3JRA A;  3PAS A;  1RPW A;  3BR3 A;  1JJ8 C;  1BW5 A;  4L5E A;  1SFO J;  1XC5 A;  1GV2 A;  2H1K A;  1FTZ A;  3IH3 A;  4D7N A;  3BTL A;  3CDL A;  2N8G A;  1VF9 A;  3JRH A;  5EEA A;  5IP6 A;  2QF7 A;  2W53 A;  2DMP A;  4NN1 A;  3KKD A;  2QCO A;  3S17 J;  2WUI A;  1AKH B;  1WI3 A;  4D7M A;  3RQI A;  3PO2 J;  3HTA A;  4UUT A;  2QTQ A;  3DEW A;  2XGC A;  5J1Y A;  4D5C A;  5EZG A;  2XB5 A;  1ZQ3 P;  1SAN A;  4B3A A;  3BRU A;  4IEJ A;  1BL0 A;  1B72 A;  4ABZ A;  5CW8 A;  5E3O A;  2DA6 A;  3H3V K;  3HOU J;  3SDG A;  4HNV A;  5EDN A;  1JKQ C;  3CWR A;  2HI3 A;  4DYR A;  1JKR C;  1A6I A;  3TP3 A;  2R92 J;  5JLW A;  2ZCM A;  1FIA A;  1QVT A;  4MK6 A;  3VIB A;  2VKE A;  3HEF A;  4AC0 A;  2E2J J;  3HIM A;  9ANT A;  3P9T A;  3OSF A;  1XS9 A;  2X9D A;  2KDZ A;  3AQS A;  5DAJ A;  2DA3 A;  3TW7 A;  2LY9 A;  2Y2Z A;  1RKW A;  1X2M A;  3FIW A;  1T33 A;  3G1O A;  4W1U A;  1DU0 A;  3IUV A;  2JWT A;  3BG9 A;  1TWF J;  2FJ1 A;  1JTY A;  4XRS G;  2GLO A;  5FLM J;  3EUP A;  1ENH A;  1RET A;  2UXO A;  3G7R A;  4A3M J;  2ZCX A;  4X1E A;  3GTQ J;  4Y52 J;  3L1P A;  1JUS A;  3JRF A;  2DTZ A;  3S1M J;  5D19 A;  2LD5 A;  3S5R A;  2L7Z A;  5FMP A;  2JA7 J;  1FJL A;  2QIB A;  3LHQ A;  2HYJ A;  5F1J A;  1TWH J;  2M8G X;  5GP9 A;  3LSP A;  3CRJ A;  2HXO A;  4NEL A;  4C3J J;  3PO3 J;  5HBU A;  5M5Y J;  2K9Q A;  3S1N J;  5J1U A;  5E3N A;  1YRN A;  3RH2 A;  1UHS A;  3B6A A;  1JJ6 C;  2CJJ A;  3GTK J;  3ON2 A;  2CQX A;  3MKL A;  3QBM A;  5IYB J;  3BJB A;  3BG3 A;  1GV5 A;  2FD5 A;  4Y7N J;  4MXM A;  3ZQI A;  3C2B A;  3HM5 A;  3JR9 A;  2K9N A;  1TWA J;  3A01 A;  3OSG A;  1W0U A;  2FBQ A;  3HBL A;  3TED A;  3CCY A;  3M3Y J;  1Z0X A;  4L62 A;  2QWT A;  3LJL A;  3JRC A;  3BQZ A;  3VVZ A;  3BTJ A;  1APL C;  1Y1V J;  3M4O J;  2LTP A;  3MVP A;  2L9R A;  3LSG A;  4RBO A;  5HSZ A;  1K61 A;  2LVS A;  1TWG J;  5EFY A;  1Q1V A;  2CQQ A;  3COL A;  3ON4 A;  4FE4 A;  2R93 J;  1ETW A;  3BR6 A;  5EYR A;  4C3H J;  5FHP A;  3FIS A;  3K7A J;  4ACI A;  3VW0 A;  2HOT A;  1QPI A;  4A3F J;  1U78 A;  1H88 C;  4JYK A;  5C4Y A;  1JKO C;  1SGM A;  4JL3 A;  1GVD A;  4FCY A;  2OPT A;  2XGD A;  5EG0 A;  5AQC A;  4GCT A;  3HOZ J;  2CUE A;  3GTM J;  3A03 A;  1HDP A;  1CQT A;  3VOX A;  1ETO A;  2EQR A;  2IU5 A;  2EZI A;  3BR0 A;  5M5W J;  3HB9 A;  1NK2 P;  1IGN A;  5K58 A;  5K7H A;  3Q0V A;  4XK4 A;  1UMQ A;  1IRZ A;  4FIS A;  3JSJ A;  1GUU A;  2HOS A;  5D18 A;  3FKI J;  3RD3 A;  2AO9 A;  4LOC A;  4BBR J;  4QSH A;  4MIM A;  3RKQ A;  2Y0S N;  1JUP A;  3ZQG A;  3FK6 A;  1FIP A;  1MH4 A;  1ZR4 A;  1VI0 A;  5DS9 A;  1U9O A;  4NDL A;  2AHQ A;  2KT0 A;  5M3M J;  1PUF A;  1JTX A;  2FX0 A;  4GFB A;  1H8A C;  1AKH A;  1VFC A;  2GBY A;  1UI5 A;  1MBK A;  2LLK A;  4YZE A;  2JN6 A;  4A3E J;  3PM1 A;  1IJW C;  3BHQ A;  1U8B A;  1DU6 A;  3LSR A;  5C4X J;  1HCR A;  1T56 A;  3NXC A;  4AC6 A;  1WCM J;  2M9H A;  2UXH A;  3E7Q A;  1POG A;  2ID6 A;  1ETX A;  1IDY A;  2ME6 A;  2VI6 A;  2R5Z B;  4B1R A;  2E2H J;  3HGY A;  2IEK A;  3G1M A;  3SJM A;  4FE7 A;  2CUF A;  3QPS A;  2DA2 A;  5F0H A;  5K7Z A;  2ZCN A;  4I6Z A;  2DA7 A;  1FEX A;  2NX4 A;  2L0K A;  3BQY A;  2K9S A;  4RDU A;  4M3B A;  1TC3 C;  2O7T A;  5FJ8 J;  2NVT J;  2E1O A;  4JX4 A;  3HKZ N;  4A93 J;  1U9N A;  5M5X J;  2EBI A;  2HOA A;  4AF5 A;  2IBD A;  4UDS A;  2DG8 A;  2MW8 A;  4A3C J;  2ECC A;  3IH2 A;  4MLO A;  5DTD A;  1JKP C;  1HF0 A;  2HDD A;  2D6Y A;  1MBJ A;  1ZTR A;  1AHD P;  5HAW A;  3NNR A;  3LNQ A;  2YS9 A;  3K2A A;  2GEN A;  4DYQ A;  3GTL J;  3RZO J;  1R9T J;  3G1L A;  1JT6 A;  5GPA A;  1IG7 A;  3NRG A;  4PXI A;  3W6V A;  2E19 A;  3OOU A;  5BNG A;  2G7L A;  3VW1 A;  1LFB A;  4DZP A;  3LWJ A;  4MFE A;  4XID A;  5H9T A;  2G7S A;  2Y9Y A;  3DCF A;  1P7J A;  5C44 J;  4MFD A;  3KNW A;  4MO7 A;  2OI8 A;  2XRL A;  2HKU A;  2RAE A;  2WB1 N;  2NOG A;  2JMW A;  3TP0 A;  5C3E J;  1JGG A;  3LSJ A;  1LFU P;  3FK7 A;  1D5Y A;  2WV1 A;  2P81 A;  2LKX A;  3BTI A;  3KKC A;  3T6N A;  4GCL A;  2YVE A;  5F08 A;  1XG1 A;  4I76 A;  1MBH A;  2NVY J;  4BY1 J;  2UXU A;  3JRE A;  2R7Z J;  2ZOY A;  4C2M J;  2G3B A;  4IHW A;  5M3F J;  2DMU A;  1MNM C;  3S1Q J;  4ME9 A;  5F27 A;  1MH3 A;  4M3G A;  2GFN A;  4M3D A;  4M3E A;  2YUS A;  1ETK A;  3HTI A;  2EZL A;  4JKZ A;  4A3B J;  1OJL A;  5EGO B;  1K83 J;  1ETV A;  4UUS A;  1FTT A;  1F36 A;  2HXI A;  2EH3 A;  3AQT A;  5FGL A;  2YU9 J;  1QVU A;  5E3L A;  3OIO A;  2V57 A;  2LFB A;  2G0E A;  2DN0 A;  3HOV J;  5EZH A;  4A3L J;  1I6H J;  1WH5 A;  2DMT A;  2PMZ N;  4A3J J;  4A3I J;  4X6A J;  3QKX A;  2XSD C;  1YRN B;  1ETQ A;  3GBG A;  3S16 J;  3VOK A;  3BR1 A;  5IPA A;  3HOX J;  3S15 J;  4M3F A;  1G2H A;  1OCT C;  4DZJ A;  2ME0 A;  3DPJ A;  2DMN A;  3IH4 A;  2R5Z A;  3S2D J;  3Q0U A;  2XPW A;  1A5J A;  2JK3 A;  1RKT A;  5FKN A;  2M34 A;  5F0F A;  2G7G A;  1HLV A;  1VND A;  2I10 A;  2XPV A;  5EF6 A;  2O9L A;  2UXI A;  3VP5 A;  4V2F A;  5FKM A;  1UG2 A;  2HYT A;  4G12 A;  3NPI A;  2EZH A;  4XRS A;  2W48 A;  1MSF C;  3HE0 A;  1JUM A;  2COB A;  1MBF A;  1ORK A;  3LOC A;  3V78 A;  2L7F P;  2REK A;  3F1B A;  3VW2 A;  5HOD A;  2M0C A;  1HDD C;  2DJN A;  5EG0 B;  2Y9Z A;  2QOP A;  2ECB A;  1ETY A;  3VUQ A;  5CXG A;  4A3K J;  2CU7 A;  4IHY A;  2K40 A;  1GT0 C;  3I4M J;  1TWC J;  2O8K A;  4JNN A;  1X58 A;  3G56 A;  3ZQH A;  3ZQC A;  2Q24 A;  5FKO A;  1I50 J;  2MSY A;  2TRT A;  1IV6 A;  2VUM J;  5JLX A;  3V6G A;  4B4C A;  4GFL A;  5CXI A;  3IV5 A;  3ANG A;  1JT0 A;  1WGX A;  3F0C A;  2MG4 A;  3HDD A;  1BJZ A;  3WHC A;  3QQA A;  1S7E A;  4IHX A;  2X48 A;  2JA6 J;  3O8G A;  1ITY A;  4KWA A;  3GTO J;  3SFI A;  2UXP A;  4D5F A;  3BR5 A;  4M6V A;  1WPK A;  2Y30 A;  3H0G J;  5F04 A;  3A01 B;  1IC8 A;  2NS7 A;  5K7F A;  4FTH A;  5IOY A;  3D1N I;  4XRM A;  1P7I A;  2PBX A;  3CJD A;  1B8I A;  4A3D J;  4BBS J;  3C07 A;  1NK3 P;  4GFK A;  2E2I J;  3QPL A;  3JRD A;  5F0C A;  2XPU A;  4BXX J;  3BT9 A;  3HGG A;  4ICH A;  4J19 A;  1PUF B;  4EEF G;  2O7O A;  2LR8 A;  4CYC B;  5C4J J;  3GTG J;  3JRB A;  4BKX A;  2R0Q C;  2WGB A;  1RR7 A;  2EZK A;  4A69 C;  3ANP A;  2LK2 A;  4UUS B;  2X6O A;  3EGQ A;  4IHV A;  2D5V A;  1BA5 A;  3B81 A;  2Y31 A;  3FRQ A;  3VVY A;  3GTP J;  1EF4 A;  2XGE A;  2TCT A;  3HOW J;  4DYC A;  3BNI A;  4S0H B;  3VPR A;  1Z77 A;  1B8I B;  1ZK8 A;  3TW6 A;  5GPC A;  3JRI A;  1LE8 B;  2XDN A;  3S2H J;  2ZOZ A;  3E7L A;  2HQ5 A;  3S14 J;  2PZ9 A;  4JP0 A;  2IAI A;  4W97 A;  3RZD J;  2NP3 A;  2JJ7 A;  2VKV A;  2XB0 X;  2GM4 A;  2F07 A;  4A3G J;  3O8H A;  5FKK A;  1QRY A;  2JA5 J;  2M2E A;  3NAU A;  4AUX A;  3KZ9 A;  5J1R A;  3HOY J;  4JX6 A;  5EGO A;  4JX5 A;  2OF7 A;  2ZB9 A;  5FKL A;  1HOM A;  3HTH A;  3MNL A;  4QTR A;  4V2G A;  3WHB A;  3MN2 A;  2YVH A;  3VVX A;  1IDZ A;  4CYC A;  4CGR A;  5J3L A;  2R5Y A;  2DA1 A;  1I3Q J;  3GTJ J;  2NS8 A;  1ZR2 A;  2FQ4 A;  2L7M P;  4BY7 J;  4AYB N;  2R5Y B;  2DA5 A;  3S1R J;  1LE8 A;  2RAS A;  2NVX J;  4QIW N;  1AU7 A;  2H8R A;  1UI6 A;  5IP7 J;  2NP5 A;  3PPB A;  3GEU A;  2DG7 A;  2WAQ N;  4HKU A;  2ID3 A;  3NAR A;  1OCP A;  3CQZ J;  4C3I J;  3UKG A;  3ZQL A;  2ELK A; 
#chains in the Genus database with same CATH topology
 3BCB A;  1J5Y A;  3BR2 A;  1UZC A;  2EV0 A;  2OQG A;  2QGU A;  3TO7 A;  3FM5 A;  1RIO H;  2EV5 A;  4XOR A;  2BVL A;  1MD0 A;  5FLV A;  3J7A Y;  3JAM Z;  1RZ4 A;  3V4G A;  4EAT A;  2QKO A;  1KQ8 A;  2A69 F;  2P6T A;  4HRI A;  3RIR A;  1OMI A;  1X19 A;  3C3W A;  3Q0W A;  2LKS A;  4GYG A;  1ZGW A;  3AFH A;  5CJ9 A;  2E71 A;  2HU9 A;  4PDK A;  1IN8 A;  1ZRD A;  5IOZ A;  3QYE A;  3NI7 A;  2AXT C;  3F6O A;  4ZC3 A;  3CMY A;  2HPM A;  4AM3 A;  5ICE A;  2VOD A;  1OIS A;  3BCG A;  2KPM A;  4CZZ A;  2QQ8 A;  1HC8 A;  5E3M A;  2CYY A;  2HVS A;  3O60 A;  4WIB A;  2BY1 A;  4EM2 A;  3RTR A;  4N4O B;  1SC7 A;  3E3V A;  3BTL A;  3K70 C;  3VSL A;  3JRH A;  2VLA A;  2VJI A;  2A5Y B;  3OS2 A;  3ESW B;  3ZR8 X;  1CGP A;  2LY1 A;  5FB2 A;  3RKY A;  4ZZD A;  2X4H A;  2UZK A;  4M6Y A;  1WI3 A;  3FMQ A;  1A31 A;  4MGR A;  4B43 A;  4XLF A;  2QTQ A;  1OCR H;  2XGC A;  3BRU A;  1ZQ3 P;  2IS6 A;  2F5E A;  1U5T B;  2M5W A;  2KFD A;  3RJP A;  1BC8 C;  4ABZ A;  3BC8 A;  2X1D A;  2LC2 A;  2RNJ A;  4XKB A;  4UB6 C;  4HNV A;  5EDN A;  3OS0 A;  3SDB A;  4E7Z A;  1I1G A;  1V55 H;  2K27 A;  4DYR A;  3D5L A;  5FFZ A;  1QQI A;  2R92 J;  3OL4 A;  2YU3 A;  5K5Q A;  3G3Z A;  3A0H C;  3M8E A;  3VIB A;  4B09 A;  5D5W B;  4UVA A;  3KLN A;  1H0M A;  2UXN A;  2NNY A;  2E2J J;  2JQ7 A;  3HIM A;  3P9T A;  3OSF A;  1ZG5 A;  1XS9 A;  2X9D A;  4P1W A;  4WX9 A;  2C6Y A;  4I2O A;  2KDZ A;  4LG0 B;  1B59 A;  3HPG A;  4KMU X;  3SZT A;  4JBA A;  3CJQ B;  2QEX I;  4UUV A;  2A6H F;  3CC4 I;  1RKW A;  1X2M A;  5A2Q Z;  3V7R A;  3FIW A;  1S8N A;  4HX4 A;  2XAJ A;  1K4S A;  2V26 A;  4ZYG A;  1OYY A;  1TWF J;  2HS5 A;  3S3M A;  3K4B A;  1E17 A;  3KZY A;  3DP7 A;  3VSK A;  2EV6 A;  2GLO A;  4IHT A;  2OTL I;  2A6T A;  3L2W A;  4EJV A;  3K70 D;  1CF7 B;  4Y15 A;  4D0P A;  3PIO F;  3KEO A;  1LUJ B;  4DIQ A;  2JA7 J;  2JTV A;  1T98 A;  4EVI A;  4IOA F;  5J4V A;  1QA6 A;  5DUI A;  1TWH J;  2M8G X;  1TL8 A;  5HBU A;  1UST A;  5M5Y J;  3S1N J;  3SHF A;  2MAB A;  1V4R A;  4NQW A;  1JJ6 C;  3HUG B;  2V1N A;  3RCO A;  3F22 A;  2CQX A;  2IGM A;  2OV7 A;  3ECH A;  3WGG A;  3TO9 A;  1GV5 A;  1ZYR F;  1MND A;  3HM5 A;  2V9P A;  2P5K A;  3H36 A;  1Y39 A;  4CDG A;  3H5R A;  1W0U A;  2RNG A;  1QGP A;  5B5E C;  3CCR I;  2QWT A;  3LJL A;  3FKJ A;  3GEZ A;  3OL3 A;  4TV7 A;  2O03 A;  3BTJ A;  4WXH A;  3GFM A;  2LTP A;  1XTA A;  1R5H A;  2LVS A;  3IRR A;  4E7K A;  2YSR A;  2OCC H;  2KZG A;  1BN5 A;  3ZN0 A;  4FE4 A;  2R93 J;  2MLG A;  3BR6 A;  2FSW A;  5EYR A;  4C3H J;  2DYS H;  1W1W E;  1ZAO A;  3ISP A;  1D3Y A;  4JYK A;  2K86 A;  4IRG A;  5AON A;  4FCY A;  2HDC A;  2XGD A;  2HVR A;  1PVE A;  2CUE A;  1CQT A;  1HDP A;  2M4K A;  3GTM J;  1ETO A;  4E6K G;  1YW9 A;  3R60 A;  4L18 B;  5GAD J;  2EZI A;  3BR0 A;  3RSN A;  2A5W A;  3J81 K;  3CCQ I;  1R5I D;  3W6J B;  3HB9 A;  3L09 A;  4OAZ A;  1YLF A;  5E1W A;  1NK2 P;  3PNV A;  1BI1 A;  3P9C A;  5K58 A;  5K7H A;  5ICC A;  4XK4 A;  4FIS A;  4WCG A;  1G8X A;  4LFU A;  2E36 A;  3QOP A;  5D18 A;  1RC9 A;  2AO9 A;  3HG9 A;  3FXQ A;  4LOC A;  4BBR J;  1BM9 A;  2H6B A;  1G3W A;  2KHM A;  1JUP A;  3ASO H;  4ETS A;  3GZ6 A;  1S6L A;  2ZJR F;  2K3F A;  3NWT A;  1I3A A;  1ZR4 A;  2XRN A;  2R7W A;  2AHQ A;  1C0W A;  5KK1 A;  5M3M J;  1OQY A;  2LNB A;  3REO A;  3CCE I;  3W6K B;  2GBY A;  2PMZ A;  5AIP A;  3CMA I;  1ZRF A;  2X6W A;  3T8R A;  1XGN A;  2WTE A;  3CO6 C;  2PMU A;  5L3B A;  4P5O A;  4YZE A;  2JN6 A;  1IJW C;  3PSI A;  1U8B A;  3LSR A;  5C4X J;  4E7S A;  4AC6 A;  1FY7 A;  1WCM J;  2G7H A;  1N77 A;  4MEX F;  1M1E B;  2ID6 A;  1ETX A;  1OKR A;  2ELH A;  2LMD A;  2VI6 A;  3JCU C;  2ME6 A;  4Z6Y A;  2H8W A;  1TQP A;  1D8K A;  4ZTF A;  2CUF A;  2ZCW A;  3QPS A;  2GA1 A;  5F0H A;  1BBY A;  4H0E A;  1S29 A;  4U7B A;  1H9G A;  2FBH A;  3V8J A;  2DA7 A;  3K4J A;  1VQL I;  4M3B A;  2JRT A;  2XKP A;  2NVT J;  3HKZ N;  4AF5 A;  5DD8 A;  3ZMZ A;  2DG8 A;  3CD6 I;  3ASN H;  2ECC A;  2AQE A;  4KJZ A;  2EB7 A;  2D6Y A;  1HF0 A;  1XCB A;  5E18 F;  5CKT A;  2HDD A;  1AHD P;  3CC2 I;  3KP7 A;  3H9Q A;  3P7N A;  2YS9 A;  1RR8 C;  3MEX A;  1K78 A;  1QBJ A;  1R36 A;  3GWZ A;  4DYQ A;  4OWR B;  4UVC A;  1R9T J;  4BJ6 C;  3CP8 A;  4BUP A;  5GPA A;  4FAS D;  5JVT A;  2E19 A;  3WE3 A;  2G7L A;  3VW1 A;  4Y13 A;  2W85 A;  1U5T A;  2QLZ A;  3CJT B;  1IUY A;  3VTI A;  2G7S A;  3J7A O;  2CMP A;  5C44 J;  4Q48 A;  1W7P D;  2IA0 A;  4MFD A;  2A2F X;  4KDP A;  1FBS A;  3KNW A;  3DPT A;  2YVX A;  2NOG A;  1D1C A;  2JMW A;  1YFH A;  2HPI A;  4I02 A;  3FK7 A;  1FC3 A;  3CLQ A;  2B7E A;  2P81 A;  3SZP A;  4BQQ A;  4HPQ A;  3GFL A;  4UV9 A;  4BDY A;  3FF5 A;  3S93 A;  4XL9 A;  4AIH A;  2ZOY A;  2MA3 A;  4LG0 A;  4C2M J;  1DDN A;  5M3F J;  4IHW A;  2G3B A;  1MNM C;  3S1Q J;  2FMY A;  5F27 A;  1MH3 A;  2YUS A;  3IUO A;  5A2Q K;  3DBR B;  1YO5 C;  4NHJ A;  3NWS A;  4A0Y A;  1R49 A;  1ETV A;  1FTT A;  2B0L A;  2HYF A;  2QSH X;  1FMV A;  3AQT A;  2CUJ A;  1U3E M;  4LLN A;  2VKH A;  1ZGJ A;  1IV8 A;  3OIO A;  4IRH A;  1MKM A;  2ISY A;  2AS5 F;  2G0E A;  3QAH A;  3ABT A;  3HOV J;  3HC7 A;  2Y0M A;  1YW8 A;  1UJ8 A;  2JVG A;  4A3L J;  4A3I J;  2K5C A;  2O8X A;  5HLG A;  2DU9 A;  3F21 A;  2E7W A;  3S16 J;  3DLA A;  3BR1 A;  4HYE A;  2F5F A;  3S15 J;  1G2H A;  2ME0 A;  4YFX F;  4RB0 A;  5CVV A;  3FMR A;  3Q0U A;  4NC8 A;  5FKN A;  5CQE A;  3W2V A;  4L5J A;  3KYD B;  2VJ4 A;  1HLV A;  4AVP A;  2AXL A;  4M74 A;  4LB6 B;  1VND A;  2Q0O A;  4CGZ A;  2ZJQ F;  4E7H A;  4CYD A;  3ZMV A;  3F8F A;  2COM A;  2DT7 B;  4FT8 A;  2KDO A;  5KNL A;  1VQM I;  3SFZ A;  3HE0 A;  3ABM H;  3HSF A;  2COB A;  3AG4 H;  3UNG C;  2L7F P;  3M1C A;  1D5V A;  3C2H A;  4BE1 A;  2Y9Z A;  2ECB A;  1SEU A;  4ZJZ A;  4ANJ A;  1YE9 A;  5FRM A;  3VYR B;  3PL8 A;  3G56 A;  3ZQC A;  3S2W A;  4UHT A;  4A6E A;  2TRT A;  2DCE A;  4C2T A;  1N75 A;  4HF1 A;  2OJE D;  2V79 A;  3CUO A;  2EA2 A;  3F0C A;  2B63 J;  4RGR A;  1YTY A;  2JA6 J;  4BYY A;  5E1Z B;  1MJ9 A;  1FWZ A;  4D5F A;  1MW7 A;  1ODD A;  4FTH A;  4DBQ A;  1O7L A;  2DOF A;  3K4M A;  1P7I A;  2DQL A;  3E5Q A;  4BBS J;  1Y8Q B;  3BLY A;  4IHS A;  2E2I J;  1KYW A;  4UY8 I;  2CS3 A;  3T8T A;  2IRF G;  3HGG A;  3ROU A;  1MMA A;  3RQ4 A;  3BOQ A;  5DYM A;  2GOM A;  3H5A A;  1PUF B;  4B48 A;  5C4J J;  2K4J A;  4CYC B;  4NC6 A;  1YIT I;  1O3Q A;  2LY2 A;  2R7X A;  2BY3 A;  4II3 A;  2VC0 A;  3MKY B;  1YX3 A;  2XSJ C;  4DVY P;  2M30 A;  3CDI A;  1MNE A;  2VL8 A;  1SFU A;  3I4P A;  1ZHF A;  2D5V A;  2Y31 A;  3JSP A;  5FD6 A;  1SVM A;  4YIR X;  2ZC2 A;  4L9T A;  1WFX A;  3OYK A;  3ZRG A;  3VPR A;  4PJL A;  1ZK8 A;  3TW6 A;  5GPC A;  1YX5 A;  5IT3 A;  3HZJ A;  3S2H J;  1D0X A;  3L00 A;  2Q24 A;  3C1D A;  2CWE A;  3G71 I;  2VC1 A;  2PZ9 A;  2GZW A;  2IAI A;  2DPD A;  3JW4 A;  4W97 A;  2XF6 A;  2VKV A;  2HVQ A;  2GM4 A;  5DCM A;  4BH9 A;  3M9A A;  2K9L A;  2O0Y A;  2O6G E;  3IP4 B;  1QRY A;  2JA5 J;  2M2E A;  2VE8 A;  3M1E A;  3I71 A;  3ZMU A;  4QLC U;  3WTW C;  3BJ6 A;  1W36 C;  3HTH A;  4QTR A;  3F8B A;  4O5V A;  1J2X A;  2JPC A;  1B1B A;  2WA0 A;  3PNT A;  5HNH A;  2R7U A;  1B6A A;  4CYC A;  5J3L A;  2DA1 A;  4XKW A;  4CCM A;  2WY8 Q;  2HYG D;  1ZR2 A;  4AYB N;  1J59 A;  2RAS A;  3NRV A;  1E3P A;  2K3P A;  3FBI B;  4QWQ A;  2NP5 A;  3S3N A;  2WAQ N;  4RLF A;  3V8K A;  2FML A;  3ZQL A;  1ZTR A;  3ELK A;  2V1D A;  2MGQ A;  3KPH A;  1F43 A;  4XN0 A;  1V5F A;  3QWL A;  4E7L A;  3MAJ A;  4IKF A;  1X2N A;  2QBY A;  2DMQ A;  3OYI A;  4OMZ A;  3ONQ A;  2XDV A;  3IHU A;  1W0T A;  2K85 A;  1MBE A;  2OTJ I;  2WC2 A;  3ZQF A;  2R7V A;  4YRV A;  4KIG A;  3CF5 F;  3KYL A;  1K6Y A;  2QUF A;  1DPU A;  4ESB A;  1IXR C;  2IGO A;  1R00 A;  2CO5 A;  1ZEL A;  2MD0 A;  1U8R A;  1ZH5 A;  2BW3 A;  2LG4 A;  3A02 A;  3A2K A;  3QRF F;  2LP0 A;  2JSC A;  2WWY A;  1HA8 A;  3IWF A;  1ZRE A;  3B6C A;  3HIF A;  3U1D A;  1L3L A;  4BQN A;  1U5T C;  2VQC A;  1YIJ I;  3JSO A;  2Y69 H;  1A6Q A;  1JE8 A;  3TMO A;  1E3O C;  2F5D A;  5LRS A;  3JRA A;  1RPW A;  3F23 A;  4ZH4 F;  2QKM B;  3IH3 A;  1FTZ A;  1T6S A;  2O5R A;  2CQ7 A;  2MBF A;  3CDL A;  4ZTJ A;  3GZ5 A;  1VZ0 A;  2XKO A;  5EEA A;  5IP6 A;  2UXX A;  3OIP A;  3FXL A;  2Z1D A;  2W53 A;  2HOE A;  1XMK A;  2DMP A;  5H2F C;  5IY5 H;  3KKD A;  3AAF A;  2WUI A;  4RGU A;  2RV8 A;  3KP2 A;  4RAZ A;  2JA2 A;  3KZZ A;  4D7M A;  3HTA A;  4UUT A;  3DKY A;  2XB5 A;  3H1C A;  1ZRC A;  4B3A A;  2VT3 A;  4IEJ A;  3H3Z A;  5FRO A;  3ZMT A;  4BXF A;  1IN7 A;  1IRF A;  2QWW A;  3DKX A;  4I7H A;  5E3O A;  2DA6 A;  1RUO A;  2HEO A;  3H3V K;  1J9I A;  3SDG A;  4QPO A;  2HI3 A;  1JKR C;  3TP3 A;  3QOE A;  3CZ6 A;  2ZCM A;  3X2Q H;  5CPR B;  1R58 A;  1QVT A;  3IRQ A;  5CVU A;  1TLH B;  2VKE A;  3HEF A;  2HKX A;  1USS A;  2VIX A;  2PG4 A;  1O57 A;  3AQS A;  1WJ5 A;  4CSW A;  2WV0 A;  4MTE A;  5DAJ A;  2DA3 A;  4XBF A;  3TW7 A;  3B02 A;  4HOB A;  5J8C A;  3WTU C;  4XOP A;  4ZYD A;  2OUM A;  3P9K A;  2JWT A;  1J0R A;  1LDJ A;  3DBH B;  3K0L A;  4XLN F;  2JUG A;  4XN3 A;  1KU2 A;  1ENH A;  2DT5 A;  2B3W A;  5ILU A;  1RET A;  1D8J A;  4KIF A;  1QU3 A;  5E8G A;  3S1M J;  2XAG A;  2BY2 A;  4M73 A;  3HSR A;  1N25 A;  2W4S A;  4BQA A;  1FJL A;  2QIB A;  3TOB A;  3LHQ A;  2EK5 A;  4EJU A;  3TDU C;  1FSH A;  1QPM A;  3CMM A;  3L2R A;  2KIS A;  2HXO A;  4C3J J;  1XDS A;  4HV5 A;  4FQG A;  5J1U A;  1LPQ A;  5E3N A;  1UHS A;  3B6A A;  2Z99 A;  3H5N A;  4KMF A;  2EFP A;  2KIM A;  1Z21 A;  1PP7 U;  3QBM A;  2CFX A;  5IYB J;  3TQN A;  3BG3 A;  4MXM A;  3C2B A;  3GLL A;  3OOP A;  5FRN A;  4A0X A;  2FBQ A;  1I39 A;  3RKX A;  4L62 A;  2VQL A;  3BQZ A;  3LMM A;  3VVZ A;  2D1H A;  1KQ9 A;  2FOW A;  5J47 A;  3CME I;  1KON A;  1APL C;  2ZME C;  4G94 A;  1D0Z A;  1GHC A;  4A5N A;  1TWG J;  2ZFU A;  4HSR A;  2OD5 A;  4ENM A;  3F8C A;  3COL A;  5EFY A;  1ETW A;  5FHP A;  3HYI A;  2IS4 A;  3TL4 X;  5DM7 F;  1B4A A;  3RDI A;  4DOZ A;  1V54 H;  2HOT A;  1O3R A;  2ETH A;  3RPQ A;  2E35 A;  4MQV A;  1SGM A;  1GVD A;  2K9M A;  2OPT A;  3VOE A;  5EG0 A;  2R7S A;  1SD4 A;  1G59 A;  4GCT A;  1U2W A;  1ZN2 A;  3R0A A;  6PAX A;  4X0G A;  3C7J A;  3I9V 2;  1R1U A;  3CDH A;  1FBQ A;  2H09 A;  3AG3 H;  3P5J A;  3PQK A;  4BHC A;  3JSJ A;  1Y0N A;  4OIP F;  5B1B H;  4HLX A;  5DCF A;  5FGM A;  1X1D A;  3W3C A;  1ZG1 A;  4BHB A;  1GUU A;  4LLL A;  5HDN A;  4CCJ A;  2Q8K A;  1K4T A;  4MIM A;  4QSH A;  2Y0S N;  3PUB A;  1QHH D;  4L9V A;  2TDX A;  2EJR A;  4KN4 X;  1VI0 A;  4JOM A;  1S72 I;  2CUZ A;  4RM3 A;  2DI3 A;  2LBF B;  2DPU A;  2FX0 A;  2OZU A;  5TJJ A;  1AKH A;  1K7A A;  4RGS A;  3BCA A;  1UI5 A;  2H94 A;  1MBK A;  4ESF A;  3QPT A;  3HL2 A;  4E7J A;  1EA3 A;  2BY0 A;  3PM1 A;  4A3E J;  1IRX A;  5CVJ A;  4BEH B;  2STT A;  5BPD A;  3HRM A;  2PX9 A;  4B1R A;  2CG4 A;  3HGY A;  2IEK A;  2DBB A;  3E1S A;  3G1M A;  1R22 A;  1OR7 A;  4IPA A;  2JZY A;  3SJM A;  4FE7 A;  2KRC A;  3BJA A;  3ZGK A;  2ZCN A;  1SVO A;  1LFP A;  2NX4 A;  3BQY A;  4RDU A;  3EUK L;  1RRJ A;  2O7T A;  2V9K A;  3ZP5 A;  1U9N A;  1WJF A;  5M5X J;  4IRV A;  4LJZ F;  3NEU A;  3TOA A;  2BW3 B;  2MW8 A;  4JQF A;  5CQG A;  4A3C J;  4MLO A;  1JKP C;  1O7F A;  3HOT A;  3NNR A;  3HTS B;  3K2A A;  2FNP A;  5D6E A;  1LVA A;  2WY7 Q;  3G1L A;  1LNW A;  3K4C A;  2GA2 A;  2JVH A;  3DU5 A;  3BZK A;  2Q2E A;  3DXJ F;  3CJN A;  3MKW B;  3FHN A;  5BNG A;  5BMZ A;  2BOL A;  2ZME B;  3FMS A;  4HAM A;  3M8J A;  4OD4 A;  4XID A;  5H9T A;  2Y9Y A;  3SEZ A;  3LAP A;  3ABU A;  3EUH A;  4MO7 A;  1TNT A;  1SAX A;  2F6C A;  2OCE A;  3TP0 A;  3LSJ A;  1X4O A;  2LKX A;  2R7D A;  1BR4 A;  4CZC A;  3KKC A;  1Y8R B;  4GCL A;  2V1X A;  2OAZ A;  3TKY A;  2CQK A;  2Z3Y A;  1I1S A;  2NVY J;  2RDP A;  4BY1 J;  3QP6 A;  5HOO A;  3DFG A;  4M3G A;  1OYI A;  3HTI A;  3DBL B;  4S04 A;  3OYM A;  4MNU A;  1S7A A;  3OYN A;  2PJR A;  1DQU A;  5D8K B;  1F36 A;  1MGT A;  2DW4 A;  3E5X A;  3I59 A;  2HXI A;  2JPB A;  4G6D A;  5FGL A;  2YU9 J;  1QVU A;  3CES A;  3I5U A;  4LMY A;  2V57 A;  1Z7U A;  3A4C A;  3COA C;  1YJ9 I;  4Y3O A;  1I6H J;  4HST A;  1SMY F;  4PSX A;  2DYR H;  1TTY A;  2IA2 A;  2KQR A;  2QVO A;  1VQ9 I;  3GBG A;  3MZ8 A;  1LJ9 A;  2KRF A;  2Z5U A;  3VYS B;  4M3F A;  4P55 A;  2ZME A;  2CFO A;  2YX4 A;  3DPJ A;  4BHP A;  3S2D J;  2Y0S A;  2JK3 A;  1KU9 A;  5J40 A;  2M34 A;  5F0F A;  2L9N A;  3O2P E;  4BQO A;  3U1K A;  2XPV A;  3HXL A;  2HYT A;  3NPI A;  5L3F A;  1VQ8 I;  4RLQ A;  4B8X A;  2GIV A;  3KYC B;  2EFQ A;  2W48 A;  2Y75 A;  4PJ0 C;  2DT6 A;  5HLI A;  5KVR A;  3LOC A;  4KN7 X;  4OAY A;  3I0T A;  5HOD A;  2M0C A;  2O3F A;  3VUQ A;  3GO5 A;  3TGN A;  3TO6 A;  4A3K J;  5FLX K;  5CXG A;  2GQQ A;  1GT0 C;  3I4M J;  2CW0 F;  3L2V A;  5ERI A;  3VYU B;  4B47 A;  2MSY A;  1XPX A;  3OY9 A;  1IV6 A;  1F5T A;  4OD5 A;  5JLX A;  3I59 B;  5HS8 A;  1GLN A;  2KL4 A;  5FFX A;  1WVR A;  1WGX A;  2MG4 A;  4Y17 A;  1BJZ A;  3HDD A;  1S7E A;  3H92 A;  1WJD A;  3SFI A;  1QZY A;  1FPQ A;  1BOA A;  5F04 A;  2STW A;  2NS7 A;  5F1R A;  2MFZ A;  1S9H A;  4RB3 C;  3RPU D;  1B8I A;  1W36 D;  3QPL A;  2KIU A;  2L2O A;  3LSK A;  5F0C A;  2XPU A;  3OYL A;  1V5G A;  3BT9 A;  1RNL A;  3L2C A;  3KP6 A;  2OA4 A;  3IAM 2;  2M45 A;  3GF2 A;  2J5P A;  4XR6 A;  1OPC A;  3R6S A;  2ESH A;  3HHG A;  2CV1 A;  1ZLJ A;  2ZXH A;  2W57 A;  2WAD A;  3GTG J;  1TP4 A;  2DLL A;  3JRB A;  2JUC A;  4HQM A;  2R0Q C;  2WGB A;  1RR7 A;  3JTG A;  2ESN A;  4UUS B;  4UXN A;  2X6O A;  4NB5 A;  5FD5 A;  1DP7 P;  4IHV A;  5DUK A;  1LDK B;  3B81 A;  2WAE A;  3DTE A;  5EEH A;  1D0Y A;  3J7Z I;  2HQN A;  1EV7 A;  2IVM A;  2WAF A;  4EJT A;  3MD2 A;  3GTP J;  3KCC A;  3EQL F;  3SEQ A;  4WF2 A;  4L5I A;  1WJB A;  3N97 A;  1Z77 A;  2LH9 A;  2XDN A;  1LE8 B;  1MDM A;  3E7L A;  2VE9 A;  5CVI A;  4JP0 A;  4PJN A;  2KMU A;  1TZL A;  2VPL A;  2FUG 2;  3RZD J;  4YFN F;  2JJ7 A;  3DTI A;  4RMN A;  5HDK A;  4HF0 A;  2XB0 X;  4O3M A;  2G9W A;  2V9V A;  4A3G J;  2O61 A;  1W7P A;  1XB4 A;  4A5M A;  4LGW A;  4G9Y A;  1UB9 A;  3ERM A;  5BPI A;  2HFH A;  2JRM A;  4M9X A;  1ZLK A;  2ZFW A;  5EGO A;  3DKW A;  4JX5 A;  2OF7 A;  4PZJ A;  5FKL A;  3MNL A;  4C2U A;  1OCZ H;  1PDN C;  1IDZ A;  2LDU A;  5L3C A;  4DGW B;  4HNT A;  1YOV B;  2UUZ A;  4NQW B;  1I3Q J;  2HTJ A;  3W2A A;  2FQ4 A;  2NYX A;  3GXO A;  2DA5 A;  2R5Y B;  2QQA A;  2R7O A;  4I09 A;  1PP8 F;  4U88 A;  2A05 A;  1AOY A;  2P0W A;  4AVZ A;  1P4X A;  5IP7 J;  4PFP A;  3GEU A;  1IXS B;  4NBQ A;  4RB1 A;  4L0Y B;  2ID3 A;  3NAR A;  1YYV A;  1OCP A;  2XAF A;  4BJ5 C;  4HV6 A;  5IP9 J;  4G8X A;  1T38 A;  2DA4 A;  2P7C B;  3ZMD A;  1OFC X;  1FX7 A;  2WBM A;  4KIS A;  5DCM B;  2Q2E B;  3F8N A;  4Q47 A;  2VQH A;  3EPZ A;  4UB8 C;  2R7R A;  4V19 K;  2AQF A;  2BV6 A;  4A2U A;  4GCK A;  2NRA C;  3WTS C;  4E70 A;  2RRE A;  1B72 B;  5IYD J;  3GZI A;  2FBK A;  4KA4 A;  3O3K A;  1MSE C;  2RKH A;  2R7F A;  4ENN A;  2CRG A;  3I54 A;  1IUF A;  5LHI A;  1NTC A;  1OLT A;  5B3S H;  1WRJ A;  2W1O A;  1RES A;  3VWB A;  1WH7 A;  5IYC J;  2VPR A;  2EPF A;  4XKC A;  1MBG A;  2GUH A;  1TQI A;  3I4N J;  2RHA A;  3DPL C;  2OER A;  2FEZ A;  4NUB A;  2IGN A;  3LWF A;  3LFK A;  1QO0 D;  1EH8 A;  2RVC A;  4Y4R A;  3SQN A;  2OBP A;  2P4W A;  2JA8 J;  5D1R A;  3FBN B;  1BW6 A;  2M7B A;  3F72 A;  4HA8 A;  5F6F A;  4E4H A;  5BS6 A;  1R71 A;  1BW5 A;  2UWM A;  1JJ8 C;  3BG6 A;  1JXS A;  4L5E A;  5CVR A;  1SFO J;  1T0F A;  1XC5 A;  1GV2 A;  2H1K A;  4P96 A;  2X6X A;  4I01 A;  4D7N A;  3T1B A;  3MCZ A;  1IF1 A;  2RQQ A;  3OYD A;  2MH9 A;  1U0J A;  4U0V A;  4NN1 A;  2QCO A;  1ONV A;  1SD7 A;  2JT1 A;  3PO2 J;  3RI4 A;  4C30 A;  3DEW A;  5J1Y A;  5EZG A;  1G3S A;  3NS4 A;  3HRS A;  3OR1 C;  2KJC A;  1NG7 A;  4EV0 A;  4F91 B;  2P5L C;  1B72 A;  3LST A;  2DQR A;  2FNA A;  2X51 A;  1R1T A;  3CUQ A;  5CW8 A;  1R4M B;  3HOU J;  5ILV A;  1JKQ C;  3CWR A;  2FU4 A;  4R8H A;  3FDY A;  5JLW A;  3H3U A;  1FIA A;  2E60 A;  2PN6 A;  2OC6 A;  4AC0 A;  2P7V B;  1T08 B;  1X3Z B;  2DO7 A;  2XF7 A;  4I98 B;  4EGY A;  4AID A;  4HX7 A;  2LY9 A;  3CCL I;  4HG2 A;  1P4A A;  5H6Q A;  3IUV A;  4F3Q A;  3R0J A;  5DDG A;  2ADU A;  4IRI A;  2FJ1 A;  1JTY A;  3ERE D;  2KRH A;  3GCM A;  3EUP A;  2Z9O A;  2HZD A;  4GXO A;  3G7R A;  3E6B A;  4A3M J;  4X1E A;  3GTQ J;  4Y52 J;  4KIT B;  3L1P A;  2B1E A;  1ZG3 A;  2PBI A;  3JRF A;  1MMS A;  5D19 A;  5FMP A;  3Q9V A;  2LD5 A;  2L7Z A;  1BR1 A;  2MH2 A;  1STZ A;  4C9Y A;  2XHK A;  4CCO A;  3LSP A;  2ISZ A;  5D6F A;  4M71 A;  2PI0 A;  4NEL A;  3WTV C;  3SZG A;  5TRD A;  4LB5 A;  4AD9 A;  3PO3 J;  1YRN A;  2P6S A;  4KIB A;  2HGC A;  3CC7 I;  3RH2 A;  1P2F A;  2CJJ A;  2VKD A;  3GTK J;  2IPQ X;  3MKL A;  1XGM A;  2M87 A;  4K2E A;  1HKS A;  2L54 A;  3HUG A;  4BXU A;  3BJB A;  4IL6 C;  4Y7N J;  4XSZ F;  3PFY A;  3ZQI A;  3OYA A;  4U0Y A;  3JR9 A;  1TWA J;  3A01 A;  5BOX A;  4RGX A;  1VQ7 I;  2A6E F;  1ERD A;  2E5Z A;  1UHW A;  3FXR A;  3JRC A;  1YHQ I;  3K4L A;  2DOA A;  2L01 A;  1HXD A;  3ZN1 A;  2X1C A;  4AWX B;  1FBU A;  3S3O A;  3M4O J;  2F4I A;  1FOW A;  2I8D A;  2H1L A;  2XAQ A;  3TDZ C;  2L9R A;  3KZI C;  4RBO A;  5HSZ A;  1K61 A;  2CQQ A;  3RKW A;  3WGI A;  5L3G A;  5KCM A;  2L02 A;  5FO5 A;  3MFK A;  3K7A J;  1QPI A;  5H6R A;  4A3F J;  3KEQ A;  1JGS A;  1FMW A;  1X3W B;  2PFB A;  4KNY A;  5C4Y A;  4XOT A;  4JL3 A;  3ABK H;  3BZ6 A;  4Q5S F;  4Q4Z F;  2XUB A;  5AQC A;  1BI3 A;  2DDB A;  1VQ5 I;  3HOZ J;  2R7T A;  3VOX A;  3EYI A;  2HDW A;  2LOO A;  4XQF A;  3BG7 A;  2IU5 A;  1UG0 A;  2LF8 A;  1MJA A;  2BHZ A;  3GZN B;  1TT5 B;  4BE0 A;  1NH3 A;  1IGN A;  3OS1 A;  1MMD A;  2BVM A;  3Q0V A;  1IRZ A;  3I3L A;  1QNT A;  4IQ4 A;  3GLX A;  4YEL A;  3FKI J;  4A6D A;  2NXN B;  2FA5 A;  2HZT A;  3LFU A;  5LBQ A;  3G73 A;  3RKQ A;  1IN6 A;  3EYY A;  3FK6 A;  2PLY A;  1FIP A;  2V6E A;  1UEL B;  3AG1 H;  1R4N B;  1Y56 A;  4CH7 A;  2IGK A;  3IKT A;  1WJE A;  3FXM A;  5JFR A;  1JTX A;  4HW0 A;  4XSX F;  4GFB A;  2L5Q A;  1VFC A;  3IWZ A;  5KAF C;  1XN7 A;  2EFO A;  1WJA A;  4GRI A;  2L4M A;  3HSE A;  4IO9 F;  3QYF A;  2FRH A;  2LLK A;  1ON2 A;  1DU6 A;  3IAS 2;  1HCR A;  1T56 A;  5LGU A;  5ILS A;  2M9H A;  3E7Q A;  2RQP A;  2GAU A;  2NOJ B;  3U21 A;  1IDY A;  4XLA A;  5E17 F;  3BZC A;  4HNU A;  4ENJ A;  1YQA A;  5HLT A;  2V1U A;  2D1V A;  2LSO A;  1TNS A;  5JI6 A;  4I6Z A;  4CHU A;  4PUS A;  3ULQ B;  1FEX A;  2L0K A;  2K9S A;  5FJ8 J;  3ECO A;  5CYV A;  3WOD F;  4RM2 A;  2DXI A;  2HOA A;  2IBD A;  1Z05 A;  2H6C A;  5AIQ A;  5L3E A;  5IT9 Z;  4AYB A;  1XMA A;  5LEJ A;  3IH2 A;  3LSH A;  5LHG A;  5HAW A;  4RA2 A;  2XV4 S;  3DPU A;  1V5E A;  3LNQ A;  3BY6 A;  1KGS A;  2GEN A;  3FWE A;  3OYC A;  4EGZ A;  3GTL J;  2DAO A;  3FHZ A;  1JT6 A;  1ULY A;  1IG7 A;  3NRG A;  1CF7 A;  1QZE A;  3W6V A;  3OOU A;  4LIT A;  4PGG A;  1LFB A;  4GCV A;  3WG7 H;  4DZP A;  3LWJ A;  4MFE A;  1P7J A;  1IN5 A;  1LEA A;  5LGT A;  4IX7 A;  2XRL A;  2HKU A;  2RAE A;  2VQG A;  1HW5 A;  4AIJ A;  1YS7 A;  1DP3 A;  4BU2 A;  5C3E J;  3OR2 C;  3HRU A;  1D5Y A;  2WV1 A;  4IVN A;  1X1B A;  4Z2Y A;  2FXA A;  3T6N A;  2VBW A;  1W5C C;  4HZF A;  2YVE A;  2CW8 A;  4I76 A;  3AKZ A;  1MBH A;  1SFE A;  2QZ8 A;  3LAJ A;  2K02 A;  3M07 A;  1LDD A;  2UXU A;  3JRE A;  3VDX A;  2FJI 1;  1FT9 A;  4PGH A;  3DU6 A;  4M3D A;  4M3E A;  1FYM A;  2DK8 A;  1WZ2 A;  4A3B J;  1GXQ A;  3K69 A;  2ELJ A;  3E97 A;  4G6Q A;  4UUS A;  4KT6 A;  2EH3 A;  2G7U A;  3J80 Z;  1G3Y A;  2LFB A;  2DN0 A;  4M9S A;  5EZH A;  1S7O A;  3CUQ C;  2WB1 A;  1WH5 A;  2PMZ N;  2BYV E;  2E1M B;  4ASN A;  2H27 A;  5TIS C;  2RC4 A;  4KUM A;  3QKX A;  1ETQ A;  4KT5 C;  1OR7 C;  3AL0 C;  5IPA A;  4ZDP A;  4PSW A;  4BAY A;  4DQ2 A;  1OCT C;  3CLO A;  4DZJ A;  3H0D A;  3FZV A;  1X1P A;  2Z2S B;  2R5Z A;  4OIO F;  3E6M A;  2XPW A;  1A5J A;  2EFW A;  1BOB A;  5E20 A;  3T0Y A;  5KHD A;  2DJI A;  1P92 A;  2EIJ H;  2DOD A;  3W2W A;  1OCO H;  2I10 A;  5EF6 A;  2VBY A;  1VTN C;  3K4K A;  3IL2 A;  3M7G A;  2FOK A;  4V2F A;  4PK4 A;  2EZH A;  4LK0 F;  2VN2 A;  1JUM A;  1X3U A;  2BXZ A;  4OOI A;  3V78 A;  5LD2 C;  3VW2 A;  3DWL E;  1X1A A;  5EG0 B;  2QOP A;  3KET A;  1T0F C;  2LYC A;  4RAY A;  5IT9 K;  4IHY A;  3VB2 A;  1TWC J;  1YW7 A;  2E34 A;  1TBX A;  3VYT B;  4BL0 B;  3RYR A;  1G3T A;  3MZH A;  2P5V A;  4CA0 A;  3V6G A;  4B4C A;  3ZQ7 A;  2LRD A;  3ZPL A;  4MTD A;  5CXI A;  2F5C A;  3ANG A;  1JT0 A;  4U9N A;  2Y48 A;  3A0B C;  5HNF A;  3WHC A;  3G4S I;  3QQA A;  4IHX A;  1ITY A;  5LHH A;  2V4J C;  1YS6 A;  3O8G A;  4RB2 C;  1LQ1 A;  3GTO J;  2UXP A;  2J5O A;  3CJR B;  2IW5 A;  2ZNY A;  3BR5 A;  4M6V A;  1BI0 A;  1WPK A;  2Y30 A;  5HVQ C;  3A01 B;  4BAC A;  2GXA A;  1Z7L A;  3HJE A;  1K79 A;  2LRE A;  3EET A;  4F52 A;  5IOY A;  4QPQ A;  4XRM A;  3D1N I;  5LGN A;  1R1V A;  2RGV A;  3CJD A;  4U87 A;  3C07 A;  2R7Q A;  4GFK A;  2LBF A;  5D5V B;  2F4M B;  3DQV C;  1I5Z A;  4Y33 A;  3LA3 A;  2IA1 A;  4NC7 A;  2OU2 A;  4J19 A;  4UVB A;  3CTA A;  4HEA 2;  4EEF G;  1Z67 A;  2LR8 A;  4YIF A;  4BKX A;  3N4M A;  2XAS A;  2PJP A;  3K10 A;  1J09 A;  4A69 C;  2E1M C;  3ANP A;  3HTU A;  2ZXW H;  1JI8 A;  1XX5 A;  4XLC A;  4FHT A;  3EGQ A;  2XF5 A;  1R6R A;  1BIB A;  1BA5 A;  3WU1 B;  1JHF A;  3S32 A;  2DK5 A;  3WU2 C;  2MYS A;  2F2E A;  2XGE A;  4JNN A;  4KIC A;  3HOW J;  3KEY A;  4HBL A;  4A0Z A;  4PFO A;  2BGC A;  4DYC A;  1NHA A;  4S05 A;  3PSF A;  3I64 A;  1B8I B;  2NNN A;  1XSD A;  1ACI A;  2L4A A;  2V6C A;  2L9S A;  2HQ5 A;  1HW2 A;  4DBR A;  3WTY C;  3U2R A;  1SAU A;  3GFJ A;  4G7Z F;  5BQT A;  3ABL H;  3ZQQ A;  2LF7 A;  4XM3 A;  2F07 A;  3QU3 A;  1Q1H A;  3BP8 A;  4ZZL A;  5FKK A;  4XMY A;  3NAU A;  1TT0 A;  1FSE A;  2ZSH B;  5J1R A;  3HOY J;  2R3S A;  3KLO A;  4PJJ A;  2ZKZ A;  4JK1 X;  2KZV A;  4XLE A;  3PUF A;  3BWG A;  2EIN H;  5DM6 F;  1Z3Y A;  3MN2 A;  2YVH A;  1UAA A;  4IQJ A;  3L2Q A;  4DJA A;  3FXO A;  1AA7 A;  3BRO A;  1F9N A;  2XC7 A;  3PIP F;  2KKO A;  4KWA A;  3S8P A;  2NS0 A;  5B66 C;  3GTJ J;  3ML6 A;  4BY7 J;  3VFZ A;  1HBX G;  2X85 A;  1LE8 A;  3E6D A;  3QP5 A;  3CF2 A;  1F4K A;  3HKZ A;  4QIW N;  2H8R A;  2ZNZ A;  2GXB A;  2M4G A;  4IJA A;  4HKU A;  5ED4 A;  4BDZ A;  1VQN I;  2KJB A;  2FF4 A;  3CQZ J;  4PCQ A;  3HRT A;  3A1Y A;  4OIN F;  2ELK A;  3LSM A;  1R5G A;  4M6X A;  4CCL A;  5F64 A;  3Q5F A;  2F4O B;  1PUE E;  3J7Y J;  3F6V A;  1XGS A;  2DFF A;  4IOC F;  3F8M A;  3GUD A;  4WK8 F;  1E3H A;  1AWC A;  2IJL A;  3WTX C;  1H89 C;  3V8L A;  3O6B B;  5GAG J;  1GDT A;  3D5S C;  2M0M A;  3D0S A;  4O6J A;  3CCM I;  4XIC A;  3BG5 A;  4UV8 A;  3VOD A;  3V7C A;  4DW6 A;  4EJO A;  1GVJ A;  1HQC A;  1XSV A;  1ZKG A;  4M9Z A;  4J00 A;  3BTC A;  4D9J A;  3LSI A;  3BJO A;  3N05 A;  3JRG A;  4XLH A;  3HTJ A;  2IT0 A;  3Q3S A;  1IZ1 A;  5D5X B;  3DF8 A;  2W82 A;  2NVQ J;  2PEX A;  1W4M A;  3ZOB A;  1Z6T A;  1O4X A;  1FYK A;  2M1B A;  2P8T A;  2MD5 A;  1Y1W J;  1G4D A;  1IN4 A;  5E1X A;  3BPV A;  3PAS A;  2XIG A;  3EDP A;  3BR3 A;  3K9T A;  1D1A A;  1HST A;  4EJW A;  2W25 A;  2EIM H;  1MMG A;  3L7W A;  2N8G A;  3JTH A;  1VF9 A;  3I58 A;  2QA4 I;  2QF7 A;  4FET A;  4CXF A;  3CP2 A;  5B1A H;  1LKX A;  3S17 J;  1AKH B;  4CUG A;  1Z6R A;  1WSU A;  5L3D A;  3RQI A;  4HF2 A;  2W84 A;  3QYB A;  2QEN A;  4G6T B;  3OIQ A;  4D5C A;  5CLS A;  1SAN A;  3D5R C;  1HW1 A;  2MC3 A;  3MZY A;  2W00 A;  5DV5 A;  1HSJ A;  4KYW A;  2DFI A;  1BL0 A;  3K1P A;  2ZSI B;  1Y0U A;  4CCN A;  3SYT A;  1K78 B;  4L9J A;  1PJR A;  3BDD A;  1A6I A;  5ICG A;  2FBI A;  3H9G A;  2HKO A;  2E1C A;  3I55 I;  4MK6 A;  2A3S A;  2ZXJ A;  4NNJ A;  9ANT A;  1WKM A;  2I5U A;  1O3T A;  3VEP A;  4LK1 F;  3LA7 A;  1HKT A;  4WXC A;  3KIO A;  1WI9 A;  3K2Z A;  3NQO A;  5E8I A;  3OYE A;  2QKL B;  4CCK A;  1SFK A;  2Y2Z A;  4I0A A;  2K4B A;  2ZXI A;  4R1H A;  3G1O A;  1ON1 A;  1T33 A;  2XVC A;  4W1U A;  2A68 F;  4EM1 A;  1DU0 A;  1K6O A;  3BG9 A;  4F55 A;  2E5N A;  1U6G A;  3SWH A;  4XRS G;  5FLM J;  5HS7 A;  1B9M A;  2DFH A;  2UXO A;  2B9S A;  2ZCX A;  3ZMS A;  3R4K A;  5J8F A;  2GXG A;  1VQP I;  1JUS A;  2X0L A;  2DTZ A;  3S5R A;  3WU0 A;  1EH7 A;  2VXD A;  4IZZ A;  2HYJ A;  5F1J A;  1TW3 A;  2D2W A;  5GP9 A;  3U9G A;  5GAH J;  3CRJ A;  1UHM A;  1FYL A;  3DV8 A;  5EJC A;  2K9Q A;  2BZT A;  4F93 B;  4RS8 A;  3SXY A;  2KP6 A;  4DNC A;  5JR3 A;  1BIA A;  3ON2 A;  5K5O A;  2KIQ A;  4XNF A;  1RUN A;  1SMT A;  1SVL A;  1MDM B;  3WE2 A;  4EM0 B;  2FD5 A;  1QZZ A;  1V3F A;  2K9N A;  2M8E A;  3EUA A;  1A35 A;  3OSG A;  5D4R A;  1PYV A;  5HDG A;  3HBL A;  3E0J B;  4CO8 A;  3TED A;  3CCY A;  4ZDO A;  3M3Y J;  1Z0X A;  1FOY A;  2VT2 A;  3CCV I;  1XDU A;  4YII A;  1W7P B;  1HKQ A;  1REP C;  2YR2 A;  2QBY B;  1Y1V J;  1P6R A;  3MVP A;  5E79 C;  3LSG A;  2YX7 A;  2W7N A;  1Q1V A;  1OCC H;  3ON4 A;  2DTR A;  3LQQ A;  4OIR F;  1MIJ A;  4N9H A;  3CCJ I;  3FIS A;  4ACI A;  3VW0 A;  2BE5 F;  1U78 A;  2FE3 A;  1H88 C;  1JKO C;  4BNC A;  2FQ3 A;  4IF4 A;  3A03 A;  1LB2 A;  2EQR A;  4N4N B;  3RYP A;  2V7F A;  3OMY A;  5M5W J;  4OIQ F;  2E7X A;  4MHG A;  3JAM K;  1EJ9 A;  1UMQ A;  2NVU B;  3GVA A;  3H9J A;  4HDV A;  3F9K A;  4M72 A;  2HOS A;  3LL7 A;  3RD3 A;  1ZAR A;  2CQN A;  3FXU A;  4I0B A;  3LQR A;  5JHU A;  4ENK A;  3ZQG A;  2GIZ A;  3L9F A;  2F48 A;  1MH4 A;  3OWT A;  5DS9 A;  1U9O A;  4NDL A;  1XD7 A;  5K1Y A;  4OU0 A;  4YEJ A;  2HR3 A;  2KT0 A;  1PUF A;  2IP2 A;  4N0B A;  3T5X A;  3WTZ A;  1H8A C;  3I53 A;  1TW2 A;  2UV1 A;  1T2K A;  3AL0 B;  2HQR A;  1T95 A;  2YPR A;  3QPH A;  1YIO A;  4IXA A;  2X1E A;  1KZH A;  3E6C C;  3BHQ A;  5KAI C;  3HOS A;  3C2G A;  3NXC A;  3DEU A;  1R23 A;  2VB6 A;  2GOX B;  2UXH A;  3H35 A;  1POG A;  3F3X A;  2R5Z B;  1FP2 A;  2E2H J;  1RI7 A;  4BEH A;  1FLI A;  1MZB A;  1Y6I A;  3KP5 A;  1KU7 A;  2DA2 A;  3GW2 A;  4XON A;  1DUX C;  3PFI A;  5K7Z A;  3FXJ A;  4R79 A;  3GFI A;  1SD5 A;  4U9L A;  1WHU A;  2WAQ A;  5LLQ A;  1YJW I;  1TC3 C;  3OV8 A;  2E1O A;  2K7L A;  4JX4 A;  4A93 J;  3CCU I;  2EFN A;  4ESJ A;  2EBI A;  3HHH A;  3FXK A;  4LD5 A;  4UDS A;  3EUH C;  4P9U A;  1WQ2 A;  5DTD A;  3CCS I;  1ZGA A;  2XAU A;  1MBJ A;  1YG2 A;  2QQ9 A;  3OYH A;  3QOD A;  5LFA A;  2ZY9 A;  3RZO J;  2HNH A;  2W24 A;  3ZXS A;  3G6E I;  4N9I A;  4MQ9 F;  4YFK F;  3CO7 C;  2M7A A;  3RPU A;  4PXI A;  1R7J A;  1W5T A;  3CUQ B;  5DD4 A;  5HLH A;  1VQ4 I;  3PQJ A;  1A36 A;  1VQK I;  2GWR A;  2LKP A;  2L9V A;  4P9F A;  3DCF A;  5D5U B;  1Z91 A;  2VJJ A;  3OYG A;  3PNY A;  3FX3 A;  4A12 A;  2OI8 A;  1S3J A;  2WB1 N;  3DLL F;  1Z3X A;  4WWC A;  2QQB A;  1JGG A;  4LG3 A;  1LFU P;  4WXD A;  3BTI A;  1XCV A;  1A04 A;  2EIL H;  3GME A;  5F08 A;  4HX8 A;  1XG1 A;  4I99 C;  1EKE A;  3ZCO A;  1FP1 D;  2CSO A;  4RAF A;  5H20 A;  3V42 A;  2QSG X;  2R7Z J;  4LLG F;  3WGH A;  5TGT A;  3MQ0 A;  1KA8 A;  2DMU A;  4F92 B;  1B9N A;  4ME9 A;  1BI2 A;  1P9Q C;  4B3X A;  2MLK A;  2BXY A;  2PJR B;  2GFN A;  1ETK A;  2EZL A;  4JKZ A;  1OJL A;  5EGO B;  1K83 J;  3KX2 A;  2A07 F;  2ZJ2 A;  3AG2 H;  2DFE A;  5EEG A;  2R4G A;  2L7K A;  4RAG A;  5E3L A;  3C18 A;  4ZDL A;  5ICF A;  1T39 A;  1IXC A;  4BJT A;  3PJR A;  4OMY A;  4XLP F;  3J81 Z;  2QM3 A;  3K6G A;  1XMX A;  2DMT A;  1D1B A;  3R61 A;  4A3J J;  4GO1 A;  4X6A J;  3HPH A;  3KP4 A;  4ITV A;  2ZJP F;  2XSD C;  1S5L C;  1YRN B;  1LEB A;  1FZP B;  5GTH C;  3VOK A;  1I27 A;  1UFM A;  3P9I A;  5GAE J;  3HOX J;  1BJA A;  2DMN A;  1FNN A;  4HLY A;  2F5V A;  3IH4 A;  4XKV A;  1RKT A;  3UR3 C;  1P4W A;  3GYH X;  1T8I A;  2M3A A;  2L3D A;  2D45 A;  2G7G A;  4L0Z B;  2CW7 A;  4MEY F;  1X4P A;  2O9L A;  1DGR M;  2UXI A;  3MKZ A;  3VP5 A;  4LIV A;  1MMN A;  5FKM A;  4G7H F;  2KIF A;  1UG2 A;  2CH0 A;  4G12 A;  5HS9 A;  3BPX A;  5LEK A;  4XRS A;  4G7O F;  1WWX A;  4AIK A;  1MSF C;  1DPR A;  2KLO A;  1MBF A;  2PQ8 A;  1L0O C;  1ORK A;  2XAH A;  3E5U A;  4UNO A;  3GX4 X;  2REK A;  3F1B A;  2VXZ A;  1JHH A;  1HDD C;  2DJN A;  2EWN A;  1N78 A;  2Q1Z B;  1ETY A;  3FM3 A;  2CU7 A;  2K40 A;  2O8K A;  1G6N A;  1X58 A;  5JHF A;  2ZO4 A;  2MC4 A;  3ZQH A;  1E2X A;  3QU6 A;  5FKO A;  2DOE A;  2OZ6 A;  1I50 J;  4II2 A;  3WG9 A;  1IW7 F;  4ZYH A;  1YJN I;  4EMS A;  2VUM J;  4LIU A;  3K8P C;  1SD6 A;  3IKV A;  2BHY A;  4PJM A;  4GFL A;  1F1Z A;  3IV5 A;  2CV2 A;  2IS1 A;  2X48 A;  1IAW A;  1BC7 C;  2Z33 A;  5J6X A;  3WTT C;  2VBX A;  4GGG A;  1IC8 A;  1GXP A;  3H0G J;  2NAZ A;  2X6Y A;  5LRR A;  4E7I A;  5K7F A;  3K4N A;  3TBI A;  1MJB A;  3LA2 A;  3OYB A;  2PBX A;  2DDA A;  5D4S A;  4A3D J;  1Z1D A;  1NK3 P;  2E1N A;  3OYF A;  3JRD A;  1YI2 I;  4BXX J;  1J7K A;  4F7Z A;  4ICH A;  1H9T A;  3MWM A;  4FX4 A;  2HTS A;  3MMY B;  4GYI A;  4U7D A;  4U0W A;  1IRG A;  1DGW Y;  2O7O A;  4H4K C;  1O3S A;  1BR2 A;  1TQM A;  2XRO A;  2CV0 A;  2RN7 A;  2A61 A;  2VBZ A;  2EIK H;  2ZBK A;  2EZK A;  3IC7 A;  3J80 K;  3G2B A;  1VQO I;  2CGP A;  3KP3 A;  4XRF A;  1KQ0 A;  1EH6 A;  2LK2 A;  2EA4 A;  4BE2 A;  5GTI C;  1X1C A;  1KU3 A;  4EQQ A;  1NG6 A;  3FRQ A;  3VVY A;  2HWV A;  2XGX A;  3L2U A;  3B73 A;  3Q9S A;  1E0E A;  1EF4 A;  4HQE A;  2TCT A;  3BNI A;  4S0H B;  5D8L B;  2QSF X;  4ZYA A;  4C2M A;  2ACJ A;  1SFX A;  4D1Q A;  1KYZ A;  3JRI A;  4B44 A;  2ZOZ A;  4ZYE A;  3OYJ A;  2QYO A;  2BBY A;  3S14 J;  3DEE A;  4AU7 A;  2NP3 A;  4BGD A;  4CIC A;  4GDF A;  3O8H A;  2VAS A;  1UCR A;  2BEO A;  2VJ5 A;  1Z9C A;  1VQ6 I;  4ON0 A;  4AUX A;  5JVG F;  2Z16 A;  3KZ9 A;  4JX6 A;  1FOX A;  1OYW A;  2JSP A;  5DEQ A;  4YG2 F;  2ZB9 A;  2PMH A;  2IS2 A;  4L9N A;  1HOM A;  4V2G A;  3WHB A;  1FOK A;  2HQA A;  3M8F A;  1J75 A;  2IXS A;  1XSX A;  3VVX A;  4CGR A;  2R5Y A;  1XGO A;  2PFV A;  4FX0 A;  2VON A;  2NS8 A;  2L7M P;  5J4Y A;  1WJC A;  3K1N A;  3S1R J;  2NVX J;  1LVK A;  2VOP A;  2ICW G;  2VOO A;  1AU7 A;  2OQR A;  1UI6 A;  3KFW X;  4BS9 A;  4KFC A;  3K1M A;  1IO2 A;  3KE2 A;  4J01 A;  1W5S A;  5FLX Z;  2DG7 A;  3PPB A;  1QHG A;  3I56 I;  5K5R A;  3DTK A;  4HDU A;  3V7S A;  1I6X A;  4C3I J;  3UKG A; 
#chains in the Genus database with same CATH homology
 5IP9 J;  3BR2 A;  2MGQ A;  1F43 A;  2DA4 A;  1OFC X;  1X2N A;  2DMQ A;  2B63 J;  1W0T A;  1MBE A;  4GCK A;  5IYD J;  1B72 B;  3GZI A;  3ZQF A;  1H89 C;  5FLV A;  1GDT A;  1MSE C;  4XIC A;  2CRG A;  3BG5 A;  1IUF A;  2QKO A;  1NTC A;  4DW6 A;  3A02 A;  1RES A;  1WH7 A;  1ZKG A;  3Q0W A;  3BTC A;  2LP0 A;  2VPR A;  5IYC J;  1ZGW A;  3JRG A;  1MBG A;  2GUH A;  3HTJ A;  3B6C A;  3I4N J;  2RHA A;  5IOZ A;  3Q3S A;  2OER A;  3NI7 A;  3CMY A;  1E3O C;  2NVQ J;  3BCG A;  3ZOB A;  2JA8 J;  1O4X A;  5D1R A;  1BW6 A;  1Y1W J;  5E3M A;  3O60 A;  3JRA A;  3PAS A;  1RPW A;  3BR3 A;  1JJ8 C;  1BW5 A;  4L5E A;  1SFO J;  1XC5 A;  1GV2 A;  2H1K A;  1FTZ A;  3IH3 A;  4D7N A;  3BTL A;  3CDL A;  2N8G A;  1VF9 A;  3JRH A;  5EEA A;  5IP6 A;  2QF7 A;  2W53 A;  2DMP A;  4NN1 A;  3KKD A;  2QCO A;  3S17 J;  2WUI A;  1AKH B;  1WI3 A;  4D7M A;  3RQI A;  3PO2 J;  3HTA A;  4UUT A;  2QTQ A;  3DEW A;  2XGC A;  5J1Y A;  4D5C A;  5EZG A;  2XB5 A;  1ZQ3 P;  1SAN A;  4B3A A;  3BRU A;  4IEJ A;  1BL0 A;  1B72 A;  4ABZ A;  5CW8 A;  5E3O A;  2DA6 A;  3H3V K;  3HOU J;  3SDG A;  4HNV A;  5EDN A;  1JKQ C;  3CWR A;  2HI3 A;  4DYR A;  1JKR C;  1A6I A;  3TP3 A;  2R92 J;  5JLW A;  2ZCM A;  1FIA A;  1QVT A;  4MK6 A;  3VIB A;  2VKE A;  3HEF A;  4AC0 A;  2E2J J;  3HIM A;  9ANT A;  3P9T A;  3OSF A;  1XS9 A;  2X9D A;  2KDZ A;  3AQS A;  5DAJ A;  2DA3 A;  3TW7 A;  2LY9 A;  2Y2Z A;  1RKW A;  1X2M A;  3FIW A;  1T33 A;  3G1O A;  4W1U A;  1DU0 A;  3IUV A;  2JWT A;  3BG9 A;  1TWF J;  2FJ1 A;  1JTY A;  4XRS G;  2GLO A;  5FLM J;  3EUP A;  1ENH A;  1RET A;  2UXO A;  3G7R A;  4A3M J;  2ZCX A;  4X1E A;  3GTQ J;  4Y52 J;  3L1P A;  1JUS A;  3JRF A;  2DTZ A;  3S1M J;  5D19 A;  2LD5 A;  3S5R A;  2L7Z A;  5FMP A;  2JA7 J;  1FJL A;  2QIB A;  3LHQ A;  2HYJ A;  5F1J A;  1TWH J;  2M8G X;  5GP9 A;  3LSP A;  3CRJ A;  2HXO A;  4NEL A;  4C3J J;  3PO3 J;  5HBU A;  5M5Y J;  2K9Q A;  3S1N J;  5J1U A;  5E3N A;  1YRN A;  3RH2 A;  1UHS A;  3B6A A;  1JJ6 C;  2CJJ A;  3GTK J;  3ON2 A;  2CQX A;  3MKL A;  3QBM A;  5IYB J;  3BJB A;  3BG3 A;  1GV5 A;  2FD5 A;  4Y7N J;  4MXM A;  3ZQI A;  3C2B A;  3HM5 A;  3JR9 A;  2K9N A;  1TWA J;  3A01 A;  3OSG A;  1W0U A;  2FBQ A;  3HBL A;  3TED A;  3CCY A;  3M3Y J;  1Z0X A;  4L62 A;  2QWT A;  3LJL A;  3JRC A;  3BQZ A;  3VVZ A;  3BTJ A;  1APL C;  1Y1V J;  3M4O J;  2LTP A;  3MVP A;  2L9R A;  3LSG A;  4RBO A;  5HSZ A;  1K61 A;  2LVS A;  1TWG J;  5EFY A;  1Q1V A;  2CQQ A;  3COL A;  3ON4 A;  4FE4 A;  2R93 J;  1ETW A;  3BR6 A;  5EYR A;  4C3H J;  5FHP A;  3FIS A;  3K7A J;  4ACI A;  3VW0 A;  2HOT A;  1QPI A;  4A3F J;  1U78 A;  1H88 C;  4JYK A;  5C4Y A;  1JKO C;  1SGM A;  4JL3 A;  1GVD A;  4FCY A;  2OPT A;  2XGD A;  5EG0 A;  5AQC A;  4GCT A;  3HOZ J;  2CUE A;  3GTM J;  3A03 A;  1HDP A;  1CQT A;  3VOX A;  1ETO A;  2EQR A;  2IU5 A;  2EZI A;  3BR0 A;  5M5W J;  3HB9 A;  1NK2 P;  1IGN A;  5K58 A;  5K7H A;  3Q0V A;  4XK4 A;  1UMQ A;  1IRZ A;  4FIS A;  3JSJ A;  1GUU A;  2HOS A;  5D18 A;  3FKI J;  3RD3 A;  2AO9 A;  4LOC A;  4BBR J;  4QSH A;  4MIM A;  3RKQ A;  2Y0S N;  1JUP A;  3ZQG A;  3FK6 A;  1FIP A;  1MH4 A;  1ZR4 A;  1VI0 A;  5DS9 A;  1U9O A;  4NDL A;  2AHQ A;  2KT0 A;  5M3M J;  1PUF A;  1JTX A;  2FX0 A;  4GFB A;  1H8A C;  1AKH A;  1VFC A;  2GBY A;  1UI5 A;  1MBK A;  2LLK A;  4YZE A;  2JN6 A;  4A3E J;  3PM1 A;  1IJW C;  3BHQ A;  1U8B A;  1DU6 A;  3LSR A;  5C4X J;  1HCR A;  1T56 A;  3NXC A;  4AC6 A;  1WCM J;  2M9H A;  2UXH A;  3E7Q A;  1POG A;  2ID6 A;  1ETX A;  1IDY A;  2ME6 A;  2VI6 A;  2R5Z B;  4B1R A;  2E2H J;  3HGY A;  2IEK A;  3G1M A;  3SJM A;  4FE7 A;  2CUF A;  3QPS A;  2DA2 A;  5F0H A;  5K7Z A;  2ZCN A;  4I6Z A;  2DA7 A;  1FEX A;  2NX4 A;  2L0K A;  3BQY A;  2K9S A;  4RDU A;  4M3B A;  1TC3 C;  2O7T A;  5FJ8 J;  2NVT J;  2E1O A;  4JX4 A;  3HKZ N;  4A93 J;  1U9N A;  5M5X J;  2EBI A;  2HOA A;  4AF5 A;  2IBD A;  4UDS A;  2DG8 A;  2MW8 A;  4A3C J;  2ECC A;  3IH2 A;  4MLO A;  5DTD A;  1JKP C;  1HF0 A;  2HDD A;  2D6Y A;  1MBJ A;  1ZTR A;  1AHD P;  5HAW A;  3NNR A;  3LNQ A;  2YS9 A;  3K2A A;  2GEN A;  4DYQ A;  3GTL J;  3RZO J;  1R9T J;  3G1L A;  1JT6 A;  5GPA A;  1IG7 A;  3NRG A;  4PXI A;  3W6V A;  2E19 A;  3OOU A;  5BNG A;  2G7L A;  3VW1 A;  1LFB A;  4DZP A;  3LWJ A;  4MFE A;  4XID A;  5H9T A;  2G7S A;  2Y9Y A;  3DCF A;  1P7J A;  5C44 J;  4MFD A;  3KNW A;  4MO7 A;  2OI8 A;  2XRL A;  2HKU A;  2RAE A;  2WB1 N;  2NOG A;  2JMW A;  3TP0 A;  5C3E J;  1JGG A;  3LSJ A;  1LFU P;  3FK7 A;  1D5Y A;  2WV1 A;  2P81 A;  2LKX A;  3BTI A;  3KKC A;  3T6N A;  4GCL A;  2YVE A;  5F08 A;  1XG1 A;  4I76 A;  1MBH A;  2NVY J;  4BY1 J;  2UXU A;  3JRE A;  2R7Z J;  2ZOY A;  4C2M J;  2G3B A;  4IHW A;  5M3F J;  2DMU A;  1MNM C;  3S1Q J;  4ME9 A;  5F27 A;  1MH3 A;  4M3G A;  2GFN A;  4M3D A;  4M3E A;  2YUS A;  1ETK A;  3HTI A;  2EZL A;  4JKZ A;  4A3B J;  1OJL A;  5EGO B;  1K83 J;  1ETV A;  4UUS A;  1FTT A;  1F36 A;  2HXI A;  2EH3 A;  3AQT A;  5FGL A;  2YU9 J;  1QVU A;  5E3L A;  3OIO A;  2V57 A;  2LFB A;  2G0E A;  2DN0 A;  3HOV J;  5EZH A;  4A3L J;  1I6H J;  1WH5 A;  2DMT A;  2PMZ N;  4A3J J;  4A3I J;  4X6A J;  3QKX A;  2XSD C;  1YRN B;  1ETQ A;  3GBG A;  3S16 J;  3VOK A;  3BR1 A;  5IPA A;  3HOX J;  3S15 J;  4M3F A;  1G2H A;  1OCT C;  4DZJ A;  2ME0 A;  3DPJ A;  2DMN A;  3IH4 A;  2R5Z A;  3S2D J;  3Q0U A;  2XPW A;  1A5J A;  2JK3 A;  1RKT A;  5FKN A;  2M34 A;  5F0F A;  2G7G A;  1HLV A;  1VND A;  2I10 A;  2XPV A;  5EF6 A;  2O9L A;  2UXI A;  3VP5 A;  4V2F A;  5FKM A;  1UG2 A;  2HYT A;  4G12 A;  3NPI A;  2EZH A;  4XRS A;  2W48 A;  1MSF C;  3HE0 A;  1JUM A;  2COB A;  1MBF A;  1ORK A;  3LOC A;  3V78 A;  2L7F P;  2REK A;  3F1B A;  3VW2 A;  5HOD A;  2M0C A;  1HDD C;  2DJN A;  5EG0 B;  2Y9Z A;  2QOP A;  2ECB A;  1ETY A;  3VUQ A;  5CXG A;  4A3K J;  2CU7 A;  4IHY A;  2K40 A;  1GT0 C;  3I4M J;  1TWC J;  2O8K A;  4JNN A;  1X58 A;  3G56 A;  3ZQH A;  3ZQC A;  2Q24 A;  5FKO A;  1I50 J;  2MSY A;  2TRT A;  1IV6 A;  2VUM J;  5JLX A;  3V6G A;  4B4C A;  4GFL A;  5CXI A;  3IV5 A;  3ANG A;  1JT0 A;  1WGX A;  3F0C A;  2MG4 A;  3HDD A;  1BJZ A;  3WHC A;  3QQA A;  1S7E A;  4IHX A;  2X48 A;  2JA6 J;  3O8G A;  1ITY A;  4KWA A;  3GTO J;  3SFI A;  2UXP A;  4D5F A;  3BR5 A;  4M6V A;  1WPK A;  2Y30 A;  3H0G J;  5F04 A;  3A01 B;  1IC8 A;  2NS7 A;  5K7F A;  4FTH A;  5IOY A;  3D1N I;  4XRM A;  1P7I A;  2PBX A;  3CJD A;  1B8I A;  4A3D J;  4BBS J;  3C07 A;  1NK3 P;  4GFK A;  2E2I J;  3QPL A;  3JRD A;  5F0C A;  2XPU A;  4BXX J;  3BT9 A;  3HGG A;  4ICH A;  4J19 A;  1PUF B;  4EEF G;  2O7O A;  2LR8 A;  4CYC B;  5C4J J;  3GTG J;  3JRB A;  4BKX A;  2R0Q C;  2WGB A;  1RR7 A;  2EZK A;  4A69 C;  3ANP A;  2LK2 A;  4UUS B;  2X6O A;  3EGQ A;  4IHV A;  2D5V A;  1BA5 A;  3B81 A;  2Y31 A;  3FRQ A;  3VVY A;  3GTP J;  1EF4 A;  2XGE A;  2TCT A;  3HOW J;  4DYC A;  3BNI A;  4S0H B;  3VPR A;  1Z77 A;  1B8I B;  1ZK8 A;  3TW6 A;  5GPC A;  3JRI A;  1LE8 B;  2XDN A;  3S2H J;  2ZOZ A;  3E7L A;  2HQ5 A;  3S14 J;  2PZ9 A;  4JP0 A;  2IAI A;  4W97 A;  3RZD J;  2NP3 A;  2JJ7 A;  2VKV A;  2XB0 X;  2GM4 A;  2F07 A;  4A3G J;  3O8H A;  5FKK A;  1QRY A;  2JA5 J;  2M2E A;  3NAU A;  4AUX A;  3KZ9 A;  5J1R A;  3HOY J;  4JX6 A;  5EGO A;  4JX5 A;  2OF7 A;  2ZB9 A;  5FKL A;  1HOM A;  3HTH A;  3MNL A;  4QTR A;  4V2G A;  3WHB A;  3MN2 A;  2YVH A;  3VVX A;  1IDZ A;  4CYC A;  4CGR A;  5J3L A;  2R5Y A;  2DA1 A;  1I3Q J;  3GTJ J;  2NS8 A;  1ZR2 A;  2FQ4 A;  2L7M P;  4BY7 J;  4AYB N;  2R5Y B;  2DA5 A;  3S1R J;  1LE8 A;  2RAS A;  2NVX J;  4QIW N;  1AU7 A;  2H8R A;  1UI6 A;  5IP7 J;  2NP5 A;  3PPB A;  3GEU A;  2DG7 A;  2WAQ N;  4HKU A;  2ID3 A;  3NAR A;  1OCP A;  3CQZ J;  4C3I J;  3UKG A;  3ZQL A;  2ELK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...