5GP9A

Structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
193
structure length
193
Chain Sequence
KKKGPKYDQIIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDVLISLFQEKMGRFVDKIRSQMNEATDVEEKLKILVNMHFKQLAADHKLAIVTQLELRQSNTELRLKINEVLKGYLNLLDELLMEGKEKGYFFQELDTRLARQMIFGTLDEVVTNWVMKDCKYDLTALVKPVHQLLLGGLRHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (TetR/AcrR family)
publication title Structural basis of operator sites recognition and effector binding in the TetR family transcription regulator FadR.
pubmed doi rcsb
source organism Bacillus halodurans (strain atcc baa-125 / dsm 18197 / ferm 7344 / jcm 9153 / c-
molecule tags Transcription, dna binding protein
total genus 81
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5gp9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5gp9A02
3RQIA 1A5JA 2R5ZA 3Q0WA 3HB9A 4ABZA 1WGXA 1U78A 4ME9A 2XGEA 1P7JA 3LOCA 2REKA 4JKZA 4I6ZA 2R7ZJ 2AHQA 1LFBA 4BBRJ 1JGGA 5E3LA 3JR9A 2WB1N 2E2HJ 3LSJA 2MSYA 3BNIA 4W1UA 4Y52J 1AU7A 4LOCA 5D1RA 2O7TA 2M34A 2QCOA 3KNWA 2GBYA 2E2IJ 3I4NJ 4IHXA 2ME0A 1IG7A 1DU0A 1MBKA 2XGDA 2GM4A 1D5YA 1HDDC 2GENA 3T6NA 2NVXJ 1CQTA 3QPLA 1JKOC 2LY9A 4G12A 4DYQA 2GFNA 4JX6A 4AF5A 1DU6A 5M3MJ 2M2EA 3JRDA 2JJ7A 4A3FJ 3QKXA 4C3JJ 3KKCA 4X6AJ 2VI6A 4JYKA 3BR6A 5EZHA 1ETYA 3JRFA 2E19A 3W6VA 1TWAJ 1ETQA 1F43A 2PZ9A 3TP3A 3L1PA 2KT0A 4XRSG 2ZCMA 1MBHA 3GTKJ 2G0EA 2QF7A 4D7NA 3PM1A 1MBFA 2LTPA 2P81A 2COBA 1MSEC 3IH2A 1SFOJ 2DA2A 2G7GA 1JTYA 2WV1A 4MFDA 2HOAA 5H9TA 3RD3A 5EG0A 1ETWA 2I10A 2Y31A 4QTRA 1P7IA 1XG1A 4S0HB 4A3BJ 1SGMA 4DZJA 2ZCXA 5FKLA 3JRCA 4BY1J 3EGQA 2ID3A 2JA5J 4DYCA 4JX5A 3HBLA 2QOPA 4J19A 1O4XA 2ME6A 1ETXA 3GTLJ 4A3DJ 2M0CA 3LSPA 5IYDJ 3PO2J 1MNMC 3S1MJ 1RPWA 3HOUJ 5FMPA 4GFKA 3RH2A 3S5RA 4L5EA 5E3NA 4DZPA 3JRAA 1ETVA 4B3AA 2DMQA 3H3VK 3M3YJ 3G1MA 4M3FA 2EZIA 3BR3A 2YVHA 2UXHA 2R5ZB 3OSGA 2Y9ZA 1I50J 1W0TA 4V2GA 3GZIA 2DMTA 2X9DA 3BR1A 3ZQGA 2CRGA 1JKRC 3BG5A 4DYRA 4A3CJ 1TWCJ 1T33A 1Z77A 1I6HJ 1AHDP 1TC3C 1TWGJ 1FIAA 1B8IB 2AO9A 1MBJA 2VKVA 1JKPC 1BW6A 1A6IA 4GCLA 1JJ8C 3PO3J 3HGGA 3LSGA 5K7HA 1JUSA 2HOSA 2UXPA 3VVZA 1Q1VA 4YZEA 1LE8B 2VUMJ 1X58A 2UXOA 2L7FP 2NVQJ 3IUVA 3TP0A 2Y2ZA 5IPAA 3GTPJ 3KKDA 3NAUA 3BG9A 1JT6A 3E7LA 3GTJJ 1HCRA 1XC5A 4PXIA 4C3HJ 2G7LA 4JL3A 2W53A 2KDZA 1OCTC 2XDNA 1WH5A 2XGCA 2JA8J 2DMUA 1XS9A 3VOKA 1UMQA 3MN2A 4M3EA 2NOGA 3VIBA 3TW6A 3IV5A 2RAEA 3V6GA 2CQXA 2HI3A 5IOZA 5EG0B 2VKEA 4AUXA 3S17J 2QTQA 3HTIA 4GCKA 2YVEA 1OJLA 3KZ9A 2GUHA 3LHQA 2XB0X 1GV5A 1T56A 4XIDA 1FTTA 5F08A 2CUEA 2LD5A 2DA5A 2LR8A 3RZOJ 3PPBA 1QRYA 2XPUA 4D5CA 5IP6A 3BG3A 5EDNA 1B8IA 1FJLA 3QQAA 4Y7NJ 1GUUA 3NARA 3C07A 3G1OA 3S15J 3VW2A 3QBMA 3ZQFA 2Y9YA 3S1NJ 3COLA 4GFLA 3Q0UA 3FK7A 1IC8A 1ZR2A 3WHBA 5F0HA 3JRIA 3BTLA 3S2DJ 9ANTA 1B72B 1HDPA 3P9TA 4QIWN 1Y1VJ 1K61A 2R0QC 1U9NA 1Y1WJ 1LE8A 3VW1A 4RDUA 5D18A 1QPIA 2R92J 5E3OA 3F0CA 1ZK8A 1ZR4A 1BL0A 1APLC 2MGQA 1ZQ3P 2ZOZA 2O7OA 2NX4A 3VP5A 2RHAA 5C4XJ 1QVTA 5EZGA 1TWFJ 3BT9A 2W48A 1NK3P 2Y0SN 5K7ZA 3CMYA 4A3GJ 3NPIA 3IH4A 1W0UA 3LJLA 3QPSA 5M3FJ 1YRNA 4MK6A 3VOXA 2DA7A 2ELKA 5K7FA 5M5YJ 5EYRA 2NVTJ 3BCGA 1NTCA 2TCTA 3MNLA 4HKUA 4AYBN 2D5VA 3VW0A 2K9SA 3ZQIA 3HOWJ 4MFEA 3NNRA 1IDYA 5IYBJ 2DA4A 3WHCA 2LVSA 3VVYA 1Z0XA 1ZKGA 2K9NA 2R5YB 3O60A 4A3IJ 2IBDA 2ECBA 2HXIA 2LP0A 2O8KA 2Y30A 5FLVA 4AC6A 2DG8A 3AQSA 1ITYA 1JTXA 3OIOA 2JN6A 4NELA 5HODA 2NVYJ 1WPKA 3S16J 2HDDA 4XICA 4IHWA 2CJJA 3BTCA 2TRTA 4B1RA 5JLWA 3HKZN 1JUMA 5IYCJ 4RBOA 3NXCA 1F36A 1RKTA 2Q24A 5F27A 3BR2A 3ON2A 3NRGA 2HXOA 2EH3A 1B72A 4EEFG 5C4JJ 1WH7A 4FE7A 2H8RA 1LFUP 1MH4A 2XPWA 1FIPA 2NS8A 5J1UA 3TW7A 2CQQA 5K58A 2XSDC 3S1QJ 1OFCX 2HYTA 3GTMJ 1HOMA 3JRHA 1WI3A 1JKQC 3FRQA 1BJZA 3F1BA 2RASA 2G7SA 4M6VA 4C3IJ 3CJDA 1RETA 3CRJA 1SANA 5AQCA 4FE4A 2L9RA 2XRLA 2DJNA 3AQTA 2JMWA 3CQZJ 3HTAA 2CU7A 5E3MA 4NDLA 4XRMA 3NI7A 4JP0A 1JUPA 4UUSB 3BTJA 2N8GA 2R5YA 4X1EA 2MW8A 2EZLA 1IDZA 4KWAA 3H0GJ 2PMZN 4BY7J 2YU9J 3B6AA 2L7ZA 2HKUA 2PBXA 1RKWA 2EBIA 4IEJA 3OSFA 1YRNB 2DN0A 2MG4A 4IHVA 3MVPA 1IRZA 2O9LA 5F04A 3VVXA 5JLXA 2LLKA 3A01A 3HOVJ 3DCFA 2FBQA 4DW6A 2IU5A 5GP9A 4CYCA 4ICHA 3IH3A 2ZOYA 3ANGA 3D1NI 3BRUA 1UI5A 5GPAA 3K7AJ 3BQZA 3DEWA 3LWJA 1FTZA 2LFBA 4FTHA 2XB5A 3HTJA 1ETOA 3HOYJ 3CWRA 3SFIA 4UUTA 2EZKA 4M3GA 5EGOA 5FGLA 5DAJA 3BQYA 3VPRA 4A93J 5DS9A 4M3BA 3ANPA 2K9QA 3FIWA 5F1JA 3FK6A 3HDDA 2HYJA 2ECCA 1ENHA 2UXUA 3BHQA 2QKOA 2X48A 4UUSA 5HAWA 1ORKA 1ZTRA 4A3JJ 1E3OC 4MO7A 3GTOJ 3RKQA 5C44J 3JSJA 4ACIA 4IHYA 3G7RA 4D5FA 1H89C 5FKNA 2D6YA 4XK4A 1U8BA 1GV2A 4V2FA 3RZDJ 3M4OJ 4BBSJ 5M5XJ 3LSRA 2EZHA 5GPCA 2K40A 2E2JJ 3V78A 1MSFC 1X2MA 3A02A 1HLVA 3E7QA 5FKKA 5C4YA 1IV6A 2L7MP 2CUFA 3O8GA 5HBUA 4D7MA 1VI0A 3HOZJ 2HOTA 5J1YA 2IAIA 2DA1A 3GTQJ 3JREA 1NK2P 4A3EJ 1U9OA 2M9HA 1FEXA 3HGYA 3LNQA 1GDTA 3ON4A 1JJ6C 3S2HJ 4UDSA 2NP5A 2XPVA 3JRBA 2ZCNA 1UG2A 1MH3A 3GBGA 1PUFA 4MLOA 3PASA 2NS7A 1AKHA 3EUPA 3VUQA 1S7EA 2WGBA 1VFCA 2ZB9A 5CW8A 1I3QJ 3A01B 2M8GX 2OPTA 2DG7A 2DMNA 2EQRA 3C2BA 3HOXJ 1ETKA 4CYCB 3HIMA 1MBEA 2FQ4A 2LKXA 3B81A 2JA7J 5M5WJ 5FKOA 2B63J 3G56A 1VNDA 2VPRA 3FISA 2V57A 1GT0C 3GTGJ 3HE0A 2NP3A 4JX4A 1X2NA 3ZQHA 2E1OA 3G1LA 3Q3SA 3GEUA 1WCMJ 4CGRA 5C3EJ 2GLOA 2WAQN 1BA5A 3BJBA 5CXIA 2ID6A 1H8AC 2X6OA 3Q0VA 5EGOB 1GVDA 2FD5A 5F0CA 5EFYA 4QSHA 3SDGA 1OCPA 5IOYA 5FJ8J 2H1KA 4GFBA 2JA6J 3CDLA 1BW5A 2DA6A 1G2HA 5F0FA 4L62A 3HEFA 2YS9A 1K83J 3DPJA 4M3DA 2QWTA 4JNNA 3CCYA 3ZOBA 5J3LA 2DA3A 2FX0A 5EF6A 3ZQCA 3I4MJ 3MKLA 2L0KA 4BKXA 5D19A 4I76A 3FKIJ 3JRGA 2OERA 1MBGA 5IP9J 1H88C 5BNGA 2G3BA 4B4CA 5CXGA 1IGNA 1UI6A 4BXXJ 3TEDA 2OI8A 5J1RA 2YUSA 5HSZA 3OOUA 3SJMA 4NN1A 1RR7A 3BR0A 3O8HA 1POGA 1IUFA 4A3KJ 1JT0A 4HNVA 5FLMJ 2IEKA 1RESA 3UKGA 4AC0A 2UXIA 2DMPA 1TWHJ 5FKMA 1R9TJ 4GCTA 3K2AA 4MXMA 2QIBA 2LK2A 2DTZA 2FJ1A 3BTIA 2OF7A 1VF9A 3A03A 5FHPA 1HF0A 1EF4A 3HTHA 2WUIA 3B6CA 5DTDA 1IJWC 2F07A 4FCYA 3BR5A 4A69C 4W97A 4A3MJ 5EEAA 4C2MJ 3S1RJ 1PUFB 1UHSA 1ZGWA 2HQ5A 2JWTA 1AKHB 4A3LJ 2JK3A 4FISA 4XRSA 5IP7J 2R93J 3S14J 1QVUA 4MIMA 3HM5A 3ZQLA
chains in the Genus database with same CATH superfamily
1FSEA 4WF2A 3W2WA 3Q0WA 3LAPA 1BOAA 2VXDA 2R7UA 2E60A 1WGXA 2XGEA 2Q0OA 1OCOH 2P4WA 1ZG5A 4YIFA 5LBQA 4ZYDA 1J59A 4CDGA 2F5VA 4BBRJ 2DJIA 3LSJA 2MSYA 4NBQA 5GAGJ 1OPCA 1VQ5I 2XASA 4W1UA 4Y52J 4F91B 2QSHX 5D1RA 3KNWA 4I2OA 5DD8A 2XGDA 1EH7A 1FOXA 2L9VA 1PVEA 3HRTA 2V6EA 3PSIA 4HLXA 3RPUD 1JKOC 2BY1A 1TTYA 4DYQA 1W5CC 1LNWA 4JX6A 1DU6A 2VQGA 4EVIA 3H92A 2KZGA 3F3XA 3KP4A 2QYOA 4L9VA 2K85A 2EJRA 5HS9A 2JJ7A 4A3FJ 4PZJA 4CZZA 1ERDA 4JYKA 5EZHA 1ETYA 3HRMA 2E19A 5ICGA 1ETQA 2KKOA 2KT0A 3NWTA 3LSIA 4XRSG 3K8PC 4D7NA 2P81A 1SD6A 4XKVA 4GCVA 3IKTA 3VTIA 1MSEC 1D0ZA 2BZTA 2DA2A 3DTKA 2G7GA 1JTYA 2R7TA 3FMRA 1K79A 4RMNA 2E5ZA 1Z3YA 3F8FA 3HUGA 3ABMH 2FQ3A 4A3BJ 4S0HB 2WY7Q 3DEEA 4EATA 3FXMA 3RKWA 4EQQA 4XLNF 2ZCXA 3JRCA 2OZUA 2LH9A 4OU0A 4UY8I 4ZYGA 4UV8A 4DVYP 4ZDLA 2OC6A 1I27A 3RQ4A 1MNMC 2FMLA 2XIGA 2FOWA 3HOUJ 1H9GA 4GFKA 4L5EA 5HDGA 2V9PA 2W57A 3HSRA 1ON2A 1N77A 3JRAA 3NRVA 3H3VK 1OKRA 2VIXA 1P4AA 3G3ZA 3G1MA 5H2FC 3QU3A 2VKDA 2YVHA 3OSGA 2Y9ZA 4A5MA 1XX5A 1L3LA 2DOAA 3K70D 2HFHA 3BOQA 1TW3A 1QBJA 3BG5A 1TWCJ 5FD5A 2CUJA 1T33A 3LQQA 1FIAA 1B8IB 1JKPC 5HVQC 3HGGA 3PSFA 5FRMA 3L2CA 4MQVA 4PJMA 5K7HA 2HOSA 4YELA 3VVZA 4E7LA 2GIZA 1Q1VA 5L3CA 3WGHA 1X58A 2A6HF 2L7FP 2DU9A 2NVQJ 5FB2A 3VYRB 3TP0A 1V54H 2Y2ZA 4ZH4F 3GTPJ 3E7LA 1HCRA 1OYIA 1D1BA 2VBWA 4JBAA 4R1HA 4FHTA 2FMYA 3A0BC 3L2VA 2L01A 2OUMA 1G4DA 3RPUA 2KDZA 2XDNA 2JA8J 2FRHA 2XDVA 1UMQA 3OY9A 4RGSA 1Q1HA 2FEZA 3OYNA 4DQ2A 2RAEA 2QA4I 3ZQ7A 1J2XA 3K10A 3ELKA 1KU9A 3ABKH 5KCMA 3DPTA 4FX0A 3I9V2 2HI3A 4OD5A 5IOZA 4U7BA 1FPQA 2RGVA 2V4JC 3S3OA 2BY3A 3FBNB 3HTIA 2YVEA 2L2OA 3KZ9A 2GUHA 3LHQA 2HU9A 1OCRH 4XIDA 1W5SA 3I56I 1D8JA 2DA5A 3RZOJ 2EIKH 1YX5A 1T6SA 3CJRB 3PFYA 5DD4A 5IP6A 4Y7NJ 2K4JA 3J80Z 1ZRDA 4I09A 3QBMA 1LKXA 2EV0A 3ZQFA 3COLA 3Q0UA 3FK7A 5DCMB 3ECHA 5F0HA 5D18A 4ENKA 4E7HA 1ZK8A 5E8GA 3WU2C 2LKPA 2O7OA 1FC3A 3A1YA 3KZYA 3VP5A 1Z91A 3K4BA 1HXDA 5EZGA 5B1AH 3TL4X 2W48A 1FBUA 4C9YA 2R7SA 1QZEA 3CMYA 4A3GJ 2R7DA 2QKMB 1HKQA 3J7YJ 2WV0A 3CCEI 5EYRA 4HKUA 3VW0A 1ON1A 2K9SA 4F92B 2D1HA 2H27A 4KMFA 5IYBJ 2LYCA 2MFZA 2ZFWA 4C2UA 1WJDA 2K9NA 2E1CA 4HF2A 2R5YB 2IBDA 4AIDA 2Y30A 4AC6A 2L5QA 3I54A 4M72A 3ZGKA 2HVSA 3S16J 4ZJZA 4L0ZB 5KAFC 2HDDA 4XICA 4E7IA 1B6AA 2CJJA 5JLWA 2TRTA 4IHWA 4ZTFA 3OYKA 2JPCA 1XSVA 4OOIA 4RBOA 2IS2A 1F36A 1RKTA 3GYHX 2PQ8A 1DQUA 2KRHA 3F8MA 1W4MA 3KPHA 1KU3A 2MH9A 3QOPA 4LK0F 5E79C 2UXXA 4XLHA 2WADA 5L3GA 5C4JJ 2YX4A 2CV0A 1AOYA 4L5IA 4D1QA 2R7WA 1Z9CA 1LFUP 1FIPA 1VQNI 2CQQA 2X6XA 3TOAA 4L9TA 3FBIB 4DBQA 2FUG2 3M8EA 1Z7LA 1OFCX 2HYTA 3GTMJ 1WI3A 1IXSB 2NRAC 1BJZA 3F1BA 2RASA 1S29A 1RR8C 5LHGA 4LITA 1V55H 4Y17A 3H3ZA 1S6LA 2L54A 3A4CA 4FETA 3CCSI 4U88A 2Z9OA 2LKSA 2XAUA 3PNYA 3DKWA 2M0MA 2GXGA 2IXSA 4BE1A 3IC7A 2A68F 4BACA 1RKWA 2IRFG 1ZH5A 2EBIA 3H9JA 3GCMA 2PBXA 4P96A 2IA1A 2Z1DA 2DN0A 4RS8A 3AG3H 2Z3YA 1IRZA 3HYIA 2HPMA 3HOSA 5F04A 1MMGA 1E17A 4CHUA 3CJQB 2CMPA 3DCFA 2FBQA 1HW5A 4DW6A 2IU5A 2KRFA 4Y33A 2RV8A 5CVRA 3K0LA 4ENMA 3FDYA 4BQQA 1SVLA 2QLZA 4E7SA 3FXJA 2HVQA 3E3VA 3WTYC 3ANGA 3T8RA 3HPGA 5GAHJ 3LWJA 1FY7A 4QWQA 2BOLA 1FBSA 3TO7A 3DKYA 1IRXA 3ZN1A 5LEJA 1F5TA 3TKYA 1T98A 3TDUC 3N97A 2ZMEB 4KJZA 4ZDPA 3KEOA 3QP5A 4E6KG 2HEOA 2W4SA 3IP4B 5DAJA 3VPRA 4A93J 1JHHA 1OR7A 2RC4A 2KIFA 1QGPA 2F4OB 4D9JA 3BC8A 4EJVA 3HDDA 2HYJA 3KZIC 3VOEA 1XCVA 2ECCA 2UXUA 1LDKB 2QKOA 5HAWA 1ONVA 2VPLA 2YVXA 3FXKA 2DK8A 2EILH 1MJ9A 3DPUA 4I0BA 2BEOA 3CJNA 3K4JA 4G9YA 1LFPA 1U8BA 4D0PA 1SC7A 2DQLA 3AG4H 3DV8A 5M5XJ 1K6OA 5GPCA 1JI8A 3HZJA 2V7FA 2P5VA 1QPMA 4UUVA 5LEKA 1K7AA 2CUFA 1HSJA 4HG2A 1MMDA 2HOTA 4G8XA 2F5DA 1SAXA 3IRQA 2DA1A 4L9NA 2EWNA 4OMYA 2YR2A 3L2RA 2OA4A 2JQ7A 5D5UB 1UG0A 2VKHA 2ETHA 3JTHA 4XN0A 1IF1A 3RIRA 4YRVA 1FEXA 4HV6A 4Q4ZF 3CUQB 3HGYA 3LNQA 2ELHA 1G3TA 4BJ6C 4S05A 3ON4A 2XGXA 1IN6A 3ECOA 4M6YA 3VUQA 1AKHA 3EUPA 1S72I 2WGBA 4R79A 4L18B 4UB8C 1I3QJ 2QKLB 3P5JA 2VJ5A 3HOXJ 4M74A 1ETKA 2BVMA 2RDPA 2L9SA 3OIPA 2H6BA 1I3AA 3V7RA 4LIVA 2VJ4A 3QYBA 1UELB 2DQRA 2V57A 1D3YA 2ISZA 2I8DA 2VL8A 4A0YA 2UXNA 3G1LA 3GO5A 1XGOA 4EM2A 2DPUA 1DPRA 1H0MA 2PEXA 4DGWB 5D5WB 2F4IA 4NUBA 3MZHA 1G3SA 4V19K 2Z33A 1WCMJ 5C3EJ 1O3RA 1N25A 2ID6A 1GVDA 2LY2A 4C2TA 3SDGA 5IOYA 4PFOA 3TOBA 2DA6A 2R7XA 1OLTA 2BW3A 2XF6A 3K1PA 3KIOA 2RNGA 3L9FA 2HZTA 4RB0A 1OMIA 3FHZA 5CVUA 4PGGA 4U0WA 1U2WA 1BI3A 1X19A 4E7KA 2Y69H 2V1XA 4KIFA 4XKCA 3V42A 4M3DA 2QWTA 4JNNA 3CCYA 5J3LA 2E1MB 5EF6A 2F4MB 3ZQCA 1FBQA 3OL3A 1WZ2A 3I4MJ 1LVKA 3G4SI 1I1SA 1O57A 3MKZA 2ZJ2A 3COAC 5FLXK 4K2EA 1MBGA 5IP9J 2ZC2A 2IPQX 1UI6A 3O6BB 3QYEA 4HYEA 3SXYA 5J1RA 4OIPF 2OI8A 2PX9A 2X6YA 1XMAA 2R7OA 3UNGC 4OIOF 3OOUA 1MKMA 4NN1A 1RR7A 3BR0A 2HKOA 4RGRA 3QRFF 3M1CA 2HYFA 1RESA 2DMPA 1R9TJ 2XKOA 3K2AA 3TDZC 4HDVA 2MYSA 3K9TA 1MMSA 2LK2A 2DTZA 1VF9A 4ZYHA 1TQIA 2ICWG 2A05A 2K3PA 4U0YA 3MQ0A 1BC7C 4A3MJ 1S7OA 2W24A 1SAUA 1WJFA 4PCQA 3W2AA 1ZGWA 2OTLI 2JWTA 1E2XA 4ENNA 1AKHB 3CESA 5L3DA 3V8LA 5LRRA 3WGGA 3CC4I 3R60A 3S14J 1QVUA 3HM5A 3RQIA 1X4OA 2M7BA 4LIUA 5D6FA 1KU7A 4YG2F 1SFXA 3LOCA 4I6ZA 2P6SA 3OOPA 2R7ZJ 1WFXA 4IRHA 5E17F 3SEZA 5E3LA 1JGGA 2EFQA 3OWTA 2ZMEC 3I59B 2E2IJ 5KVRA 4IHXA 2ME0A 3WU1B 4HBLA 1DU0A 4IRVA 2IA2A 4AWXB 3WTSC 3OYCA 1HDDC 3LA2A 2QVOA 4BAYA 3EUAA 3MKYB 2GENA 3HC7A 3PQJA 3QPLA 4HF1A 5BOXA 5DUKA 2B7EA 3PIOF 4HEA2 2QWWA 2GFNA 4AF5A 2WC2A 1IRFA 1R1VA 2M2EA 2XAHA 3ZXSA 1F9NA 2HQAA 2W84A 1I39A 2F2EA 3KKCA 1V3FA 3BR6A 2DT6A 4U9LA 1SD5A 3OYGA 3L1PA 2VQHA 2LBFB 2M30A 1MBHA 4PSXA 4EV0A 1BIBA 2G0EA 2ELJA 2ESNA 2QQ8A 2LTPA 4H0EA 1KA8A 2QEXI 2WV1A 2HOAA 2STTA 1YOVB 3J81K 5J8FA 2IGNA 5EG0A 4QTRA 5B3SH 2BXZA 1XG1A 4XLAA 3ZQQA 1ULYA 1U0JA 3EDPA 4Q5SF 1FYLA 3LMMA 1VZ0A 2LNBA 4PUSA 4DYCA 4I0AA 2XC7A 2QOPA 3BDDA 2EINH 1O4XA 3K4LA 2LF8A 1X1PA 2E7WA 4RLQA 1FMVA 2HYGD 2X85A 3IWFA 3LSPA 5IYDJ 5AONA 3U2RA 2R7QA 2L4MA 1T39A 3S5RA 3ERED 2NNYA 4OWRB 5ICCA 1MMNA 1Z67A 2GA1A 2PFBA 2Y0SA 3ML6A 4R8HA 1ETVA 2VBZA 4B3AA 3NWSA 1ZG3A 3BPVA 2UXHA 3CCLI 1W0TA 4YIRX 1Y0UA 3BR1A 1YW9A 2CRGA 4A3CJ 3WE3A 3SZPA 2P7VB 1AHDP 4WCGA 4M9ZA 4LFUA 3F22A 1TC3C 4L9JA 3QOEA 1BW6A 1A6IA 4GCLA 3PO3J 4IQJA 4BNCA 3LFKA 3LSGA 3CO6C 1JUSA 4CGZA 3JSOA 2MBFA 1TNSA 3CCRI 5JFRA 4XLEA 2UXPA 3M9AA 1OR7C 4YZEA 2M1BA 1LE8B 1LUJB 2VUMJ 1EJ9A 1A35A 1MGTA 3E0JB 2RNJA 3HKZA 2GXBA 3L2UA 3KKDA 4EM0B 2DXIA 3GTJJ 1JT6A 4IRIA 3TQNA 2E1MC 4BE2A 3E97A 1XC5A 4RB1A 3J7AO 1FOYA 2WWYA 4AIKA 1YFHA 2W53A 2MA3A 2XF7A 3OS2A 3JW4A 1WH5A 4IQ4A 3VOKA 1YLFA 3MN2A 3OS0A 3VIBA 5K5QA 1R6RA 3I0TA 5HOOA 2AXLA 2DK5A 3JAMK 3IKVA 3IV5A 1ZGAA 3JAMZ 3SHFA 1QO0D 3DFGA 5DM6F 5EG0B 1YYVA 5IT3A 3EUKL 3VODA 4M73A 5CQGA 3ZR8X 3KCCA 2QTQA 2LOOA 1OJLA 3ZMSA 3ZPLA 1NHAA 3ZCOA 3ZMVA 5GADJ 3CCQI 1T56A 4O3MA 1FTTA 4MEXF 1V5GA 2CUEA 3H9QA 1VQ9I 2LD5A 2K4BA 1K4SA 3PPBA 1B8IA 3S1QJ 3QQAA 3X2QH 1GUUA 3G1OA 3VW2A 4OMZA 5TJJA 1USSA 2JSCA 3S1NJ 1ZR2A 1RC9A 3KX2A 2DYSH 3CUOA 2IT0A 1BR2A 4CCOA 1B72B 1K61A 1Y1VJ 2R0QC 1Y1WJ 4CCLA 1QPIA 3CO7C 1ZQ3P 2MGQA 4G7HF 2XHKA 3F23A 3QAHA 3QODA 4KFCA 2RHAA 2ESHA 2ZXJA 2Y0SN 3K4CA 4ANJA 3IH4A 4MK6A 4I02A 1PDNC 1YRNA 3VOXA 2VOPA 2ELKA 5M5YJ 3DU6A 2KFDA 2EFWA 2MABA 2D1VA 2K5CA 4KIGA 2D5VA 3AAFA 1AA7A 2V1NA 2W1OA 3VWBA 3GLLA 1ZAOA 4U87A 3MD2A 4MFEA 3NNRA 2MLGA 2IP2A 5FGMA 2LVSA 1J0RA 4RA2A 1UAAA 2NAZA 3VVYA 3BWGA 1Z0XA 1ZGJA 4RGXA 4A3IJ 2ECBA 2LP0A 3FM3A 2DG8A 3M1EA 4BXFA 1S9HA 2GOMA 1USTA 2JN6A 4XLCA 1J5YA 2XKPA 1FP1D 1GXPA 3F72A 1HKSA 3GMEA 3HKZN 2BXYA 1WJ5A 3NXCA 3W2VA 3MZYA 5DCMA 4GDFA 3KLNA 5F27A 3BR2A 1R5HA 2EH3A 1GVJA 4N9HA 1FYMA 1DUXC 2O6GE 2RQPA 1HA8A 3KE2A 1MH4A 2IW5A 2KQRA 2XPWA 2NS8A 2EPFA 3TW7A 3EETA 4XNFA 1UB9A 1NG7A 2VT2A 3QP6A 3DLLF 1I6XA 2JRTA 4P9FA 1ACIA 4IXAA 5F6FA 4BDZA 5KK1A 4M6VA 4C3IJ 1PP8F 3OYJA 1Y0NA 1RETA 2DOEA 3CRJA 1SANA 5AQCA 3ABLH 2L9RA 1HSTA 2IGKA 3CQZJ 3GWZA 3HTAA 1TP4A 3RYPA 4KUMA 4NDLA 4XRMA 2UV1A 1JUPA 1A6QA 4JP0A 3BTJA 2N8GA 4BS9A 2R5YA 3S3NA 1B1BA 1X4PA 1OYWA 1IDZA 1HQCA 1WJAA 3H0GJ 2LC2A 4RM3A 3S8PA 2HKUA 3SEQA 5D4SA 1WJCA 4WK8F 1U5TB 1YRNB 2PJRB 3KEYA 4IHVA 3FHNA 3E6MA 3L2QA 3ABUA 2X1DA 3VVXA 1VQ6I 3VDXA 4WIBA 2ZFUA 3A01A 2WAEA 1TNTA 2XRNA 3HOVJ 3K1NA 4HNTA 3P9IA 3ONQA 5D8LB 1KZHA 1LEAA 4XM3A 2LF7A 4YEJA 1XB4A 4X0GA 3ZP5A 2VQLA 3BRUA 5GPAA 2V26A 4GRIA 1Z7UA 1FTZA 2LFBA 4FTHA 1UZCA 1YI2I 3HTJA 1ETOA 2KLOA 3BCAA 1UCRA 3KYLA 4Y3OA 4U9NA 2IS4A 2ZJPF 1LDDA 2P8TA 1HW2A 4UUTA 4IX7A 2EZKA 2UZKA 5EGOA 2B0LA 5FGLA 2PI0A 2CGPA 2IJLA 2DI3A 3GZ5A 4LD5A 3HTUA 3LA7A 2FBHA 2KZVA 3DU5A 3ZMTA 2DDAA 4MHGA 4LMYA 1KQ9A 4Z2YA 3KP7A 4NHJA 4MO7A 1P6RA 3KETA 5F64A 3JSJA 4ACIA 4HQEA 4IHYA 3G7RA 1J7KA 2CFOA 1YS7A 1SVMA 3OYLA 1TQMA 3K1MA 2ZXIA 4DNCA 3LSRA 2EZHA 2K40A 1E3PA 2K86A 2E2JJ 3V78A 1GXQA 5CYVA 3DF8A 1MSFC 3REOA 3W6JB 4EMSA 1HLVA 4BEHA 1B4AA 3HHHA 5ICEA 3BY6A 4D7MA 1XCBA 6PAXA 2BYVE 3DKXA 3OR2C 4C30A 3KEQA 2NVUB 2CS3A 2DAOA 5J1YA 4AVPA 2DBBA 3OV8A 3GTQJ 2VJIA 1D0XA 2Z5UA 4A3EJ 1TZLA 1QZYA 1JHFA 2Q1ZB 3ZMUA 1NH3A 4HX7A 1FWZA 4LK1F 3S2HJ 4UDSA 3I4PA 1P9QC 1UG2A 3GBGA 1VQMI 3Q9VA 2ZMEA 3OIQA 4UV9A 4B48A 1S7EA 4DIQA 2ZB9A 4KNYA 1SMTA 2X0LA 2ISYA 3A01B 2WB1A 1EH6A 2M8GX 2OPTA 2EQRA 3C2BA 4XOTA 2W25A 2M8EA 3B81A 2JA7J 3G56A 1YIJI 1S5LC 2LRDA 4F52A 2DFEA 4F3QA 3HE0A 2NP3A 2V79A 1X2NA 4NQWB 3ZQHA 5LHIA 2O3FA 1RI7A 1W36C 2STWA 1PJRA 4Z6YA 3V7CA 4E4HA 5K1YA 4WX9A 5JI6A 1BM9A 3Q3SA 3FWEA 1BA5A 3A0HC 3KP3A 3CMAI 1H8AC 2A5YB 3Q0VA 5EGOB 1YJ9I 3EUHC 4GFBA 2JA6J 3U1DA 3V8JA 3BZ6A 4L62A 4NC6A 3ZMZA 3H3UA 3OYDA 4CH7A 1IV8A 5HLHA 1K83J 2ZBKA 5H6RA 4DOZA 3DPJA 4FQGA 2VC1A 4I98B 2DA3A 2FX0A 3EQLF 2B9SA 1XSDA 5D19A 3KP6A 3FKIJ 4I76A 3CUQA 4RAZA 1H88C 5HS8A 4TV7A 5FFZA 5BNGA 1GLNA 4KT6A 2OCEA 4IPAA 4DBRA 3K4KA 3BZCA 3SJMA 3MKWB 2OD5A 4BEHB 4A3KJ 4GGGA 5FLMJ 4KN7X 4O6JA 5H20A 2IEKA 5J8CA 3HIFA 3LSTA 3V8KA 2MC4A 1TWHJ 1XDSA 4KYWA 4UNOA 4EGYA 4MXMA 4IO9F 2VOOA 2QIBA 3BTIA 2KMUA 2OF7A 1FSHA 4BGDA 3FF5A 5EEGA 1D1AA 5FHPA 2ZKZA 5DM7F 1Z3XA 4U7DA 2YSRA 4LB6B 1U5TC 5DTDA 2F07A 4MTDA 4FCYA 4A69C 4W97A 2AQEA 2DOFA 4XKBA 5B5EC 5TGTA 4A3LJ 3MAJA 1Y6IA 5IP7J 2K3FA 3FXOA 2CV2A 2EA4A 2JUCA 3CMMA 1SFKA 4PJ0C 2RVCA 2R5ZA 3HB9A 2XV4S 1VQPI 1SMYF 4ABZA 2REKA 2DW4A 1P2FA 2MD5A 1S8NA 3FMQA 4ZC3A 3VYTB 1LFBA 3MZ8A 3JR9A 2WB1N 3AL0B 3NS4A 1T8IA 3K69A 1LJ9A 2OZ6A 3BJ6A 2R7VA 1FX7A 1AU7A 4LOCA 2M34A 2QCOA 4BQAA 3G6EI 1IG7A 2PBIA 3OYAA 5FO5A 3CCUI 2KIMA 1G59A 4RLFA 4ZYAA 4PK4A 1LPQA 3T6NA 3MFKA 1U3EM 1A36A 1TT0A 1DP7P 2E71A 2HOEA 2LY9A 2O8XA 4G12A 4DJAA 1WKMA 1KONA 3I3LA 3JRDA 3DBHB 4II3A 4IJAA 3U9GA 2G7HA 2EV6A 3W6VA 1F43A 2KISA 2PZ9A 1X3ZB 2HQRA 3GUDA 2P0WA 4N9IA 4F55A 1LEBA 2ZCMA 2A6EF 2JPBA 1MD0A 3GTKJ 3CF2A 1UHMA 4HX4A 5DDGA 2COBA 2D2WA 2LDUA 2LG4A 2NOJB 2CFXA 1V5EA 2DT7B 3RD3A 2FJI1 2I10A 4ZTJA 2Q2EA 1O3SA 2OQRA 3VFZA 3EGQA 2JA5J 2BVLA 4JX5A 3HBLA 3VEPA 1YW7A 2HTSA 2ME6A 5JR3A 1ETXA 2M0CA 3O3KA 3S1MJ 1RPWA 4KN4X 3I59A 2HNHA 5FMPA 2XVCA 4HX8A 4L5JA 5EEHA 3RYRA 4DZPA 5E3NA 2VBYA 2M87A 2DFHA 4A12A 4OD4A 1WI9A 4AIHA 4XLPF 2ZSIB 2Z2SB 2DMQA 3M3YJ 3C1DA 2CG4A 2EZIA 3BR3A 5AIQA 1TQPA 4B47A 2QQAA 2R5ZB 1I50J 1YHQI 4V2GA 4AYBA 3GZIA 4RAFA 1WQ2A 1IW7F 2VQCA 2EFOA 2X9DA 5L3FA 1U8RA 1LVAA 1R4MB 1I6HJ 4ESBA 1VTNC 2PLYA 1Z6TA 3G71I 1MBJA 2VKVA 2RN7A 4OIRF 2LBFA 3PL8A 4NC7A 5FLXZ 1X1CA 4PJNA 1JJ8C 3F8BA 1KQ8A 2XAJA 4PJLA 4U0VA 1X1DA 4IOCF 2HR3A 4XOPA 2OTJI 1R5GA 3PUBA 1GHCA 4QPOA 3MCZA 1TT5B 1HBXG 4JK1X 2UXOA 3I64A 3GFMA 1P4WA 3FXUA 3GW2A 1ZRCA 3H0DA 3PNVA 3IUVA 3LWFA 3ZRGA 3BG6A 4B43A 3BG9A 5B66C 2V1UA 3AG2H 1H9TA 2P7CB 3DBLB 1LQ1A 4C3HJ 4I99C 4JL3A 4JQFA 3RKXA 2DYRH 3I71A 3T1BA 2DLLA 1XS9A 4HQMA 1FOWA 4M3EA 3V7SA 2NOGA 2BY2A 3OMYA 3TW6A 2QM3A 2CWEA 4EJOA 2HS5A 5AIPA 3V6GA 1YW8A 2A6TA 2D45A 2VKEA 2Q2EB 4XL9A 3OYHA 1O3TA 1IN8A 4RB3C 3O2PE 2ZJQF 2CYYA 1HC8A 1R1TA 2LR8A 3MEXA 4D5CA 2XPUA 5EDNA 3C07A 4ZZLA 4HDUA 3J7AY 2Y9YA 2NXNB 3GXOA 4GFLA 3TGNA 1IC8A 1QHGA 1X1AA 2AXTC 2YU3A 4JOMA 3WHBA 3BTLA 3P9TA 1HDPA 4BXUA 1W36D 1U9NA 2BY0A 3F6VA 3SFZA 4RDUA 1LE8A 1F1ZA 3VW1A 5GTHC 2R92J 1BL0A 1JGSA 1APLC 1RNLA 1YO5C 5C4XJ 3SWHA 1QVTA 4UB6C 3BT9A 2NYXA 4NC8A 1NK3P 2KRCA 2K7LA 3K4MA 1ZLKA 3AL0C 2EIJH 3NPIA 5CJ9A 1W0UA 4KIBA 3LJLA 3PIPF 1R36A 2OV7A 4F93B 3WTTC 2NVTJ 2CO5A 3I53A 1BR1A 1T95A 4AYBN 3FM5A 3CMEI 1J75A 1DPUA 4XORA 1VQ4I 2LSOA 3FXQA 1IDYA 5CLSA 2DA4A 3H35A 3WHCA 3J81Z 4RGUA 4CUGA 4OAZA 1ZKGA 1XD7A 1W7PD 5ILVA 2X4HA 2HXIA 3CC2I 1R4NB 5FLVA 2XUBA 3RI4A 4QPQA 1J09A 1JTXA 4NELA 4HOBA 3CUQC 5E1WA 5K5OA 4UVCA 4A0ZA 3BTCA 2V6CA 4KT5C 4B1RA 2VODA 5IYCJ 4WXCA 2H94A 2O5RA 1W5TA 2B3WA 3IAS2 1D1CA 4CYDA 5J4YA 3PNTA 5KAIC 3CF5F 2RKHA 2VC0A 3ON2A 3NRGA 4PFPA 2HXOA 1B72A 1C0WA 5D8KB 4LG0B 3CP2A 4FE7A 1T08B 2ZJRF 1O7LA 2K9MA 2X51A 3ISPA 5B1BH 1R49A 4M6XA 2HGCA 3HHGA 2EA2A 1ZLJA 2M3AA 3QU6A 1SFUA 3R0AA 1JKQC 3FRQA 5BQTA 2G7SA 1A31A 2K02A 2LY1A 3LAJA 1VQKI 2JA2A 2MC3A 4FE4A 5HDKA 5IT9K 3WODF 2XRLA 5IT9Z 2HWVA 2DJNA 2H6CA 2JMWA 3AQTA 4UVBA 5E3MA 2ZNZA 1QQIA 3S2WA 4IZZA 4UUSB 1QU3A 2M5WA 3FZVA 3AKZA 3BCBA 4IOAF 2MW8A 2EZLA 1XMXA 4KWAA 2A69F 3IWZA 4BY7J 2DDBA 4BU2A 3G2BA 3B6AA 2WY8Q 3HSFA 2IS1A 4ETSA 2NNNA 2M7AA 3F8NA 1FOKA 3OSFA 3CC7I 3LL7A 1N78A 3MVPA 2KJBA 1SD7A 2X1EA 5JLXA 2P5KA 3I55I 2LLKA 3GF2A 3EUHA 3PUFA 5GP9A 4CYCA 4ICHA 1R23A 1R00A 5J4VA 4YFNF 3IH3A 2ZOYA 3ESWB 1ZREA 5A2QK 3D1NI 4XQFA 2HTJA 1UI5A 4MEYF 3DEWA 1UFMA 3DP7A 4RAYA 4B3XA 2DT5A 2QQ9A 2WAFA 1BJAA 2XB5A 4I7HA 1HW1A 3HOYJ 1ZG1A 2KJCA 3CWRA 2BHYA 2CSOA 3SFIA 5JHUA 1S3JA 1G8XA 3K2ZA 3KYCB 4UHTA 1MJBA 2BHZA 2FNPA 1W7PA 4YIIA 3JTGA 1V5FA 3HXLA 2OBPA 3TO9A 3FIWA 5F1JA 3FK6A 1D8KA 3PQKA 4UXNA 4A0XA 2W00A 2BV6A 4OINF 2X48A 1LB2A 1ORKA 1ZTRA 4HSRA 3GTOJ 1G3WA 2P5LC 3RKQA 1K4TA 2CQNA 3RJPA 4EJUA 2BGCA 2VONA 4ESJA 3CZ6A 2D6YA 1MIJA 1VQOI 4V2FA 3RZDJ 1U5TA 1WVRA 2PJRA 3ULQB 2B1EA 1J9IA 3W6KB 1I1GA 2WA0A 4LGWA 3L7WA 3A02A 2GZWA 1F4KA 3EYYA 5C4YA 2L7MP 3KZZA 3O8GA 2OCCH 5E1XA 3HOZJ 1SEUA 3HPHA 1V4RA 2IAIA 1R71A 2FXAA 1XMKA 1U9OA 2M9HA 4A5NA 1PYVA 3ASNH 2XPVA 2IGOA 1MH3A 3T8TA 5FD6A 1HKTA 2NS7A 2J5PA 3PASA 3IL2A 4GYIA 2R7RA 5E8IA 2HDWA 2DG7A 2DMNA 1X3UA 2HKXA 2L3DA 4CYCB 1YX3A 3HIMA 1MBEA 3DTIA 5M5WJ 2B63J 4BJ5C 2VPRA 3H5RA 3P9CA 3GFLA 3M8FA 2JVGA 3F8CA 3BP8A 4JX4A 1WJBA 3LSKA 1OQYA 2E1OA 3EYIA 3R61A 2DTRA 1AWCA 1I5ZA 4IVNA 3TMOA 1MZBA 3H5AA 2Y0MA 4CGRA 2GLOA 1W7PB 4Y4RA 2JRMA 2X6OA 2FD5A 2BBYA 2BE5F 4G6DA 5FJ8J 1OCPA 4ENJA 3B02A 4RM2A 2E7XA 2H1KA 2QBYB 1BW5A 1G2HA 5D6EA 5F0FA 2CW8A 1STZA 4L0YB 4PDKA 3C18A 1RUNA 5JHFA 2YS9A 3S3MA 4XN3A 1ZELA 1W1WE 2CV1A 5FROA 1WJEA 3ZOBA 4MNUA 2FU4A 5HS7A 3I5UA 5D4RA 4CCNA 1EA3A 4CCJA 2NS0A 3IUOA 4HNUA 4BKXA 1WRJA 2EK5A 2L7KA 2OERA 1IO2A 3ABTA 3FXLA 5DEQA 4B4CA 3WTUC 5CXGA 3Q5FA 4ZYEA 2ZNYA 4M9XA 2GXAA 1UJ8A 3T5XA 2L9NA 1PP7U 4EM1A 4M9SA 1IUFA 4P1WA 3M07A 1YJNI 3UKGA 4XMYA 2XAQA 3DPLC 5FKMA 1XTAA 2VASA 3RTRA 2K27A 1TL8A 2V9KA 1KU2A 1EH8A 1T0FA 2FJ1A 1MJAA 5E1ZB 4NQWA 3CTAA 1BR4A 3CCVI 3A03A 4KISA 2G9WA 1EF4A 3BG7A 2AS5F 3HTHA 2WUIA 1YIOA 4LJZF 3B6CA 3ZN0A 3BR5A 4C2MJ 3BJOA 3HJEA 1Y56A 4WXHA 2HQ5A 1OYYA 3DWLE 4XSXF 2JK3A 4CCMA 1ZN2A 5BMZA 1FNNA 3HTSB 2R93J 2ZCWA 3HUGB 3ERMA 2EB7A 3CCJI 3ZQLA 4LLLA 4UVAA 3CJTB 1A5JA 2Z16A 1U78A 4I01A 4ME9A 1P7JA 4JKZA 5ED4A 1WHUA 1R7JA 2AHQA 2COMA 3FX3A 2CW7A 2E2HJ 2GWRA 1BN5A 1XN7A 2W85A 3N05A 3BNIA 5HNFA 3J80K 2UUZA 2EFPA 2O7TA 2GBYA 2XF5A 3BLYA 5FRNA 3I4NJ 4NNJA 4EGZA 3CD6I 1MBKA 5LGTA 2W7NA 2GM4A 1IN7A 1D5YA 2GOXB 2NVXJ 1CQTA 2VE8A 1TW2A 4A6DA 1YJWI 5CVVA 2Y75A 2QGUA 3HSEA 1REPC 1VQLI 3BROA 5M3MJ 4HRIA 4ESFA 3QKXA 3KFWX 4C3JJ 4B44A 4X6AJ 2P6TA 2VI6A 3JRFA 1TWAJ 4XBFA 3TP3A 2QQBA 2DFIA 1CF7A 2QF7A 4HW0A 3W3CA 2VN2A 3PM1A 5KHDA 1MBFA 2F5FA 2O03A 1MNEA 4Q47A 1G6NA 5D5XB 3R0JA 3IH2A 3U21A 3LSHA 3OYEA 3G73A 1SFOJ 3GFJA 2E35A 1EV7A 4MFDA 5H9TA 2DCEA 1FLIA 1YQAA 1ETWA 2Y31A 4BE0A 2QSGX 1P7IA 1OISA 2GQQA 1SGMA 3E6CC 2CH0A 2PJPA 4DZJA 5FKLA 1MNDA 2I5UA 4BY1J 2ID3A 1QZZA 3OL4A 2PG4A 4Q48A 3IRRA 2AQFA 4J19A 3GTLJ 1KQ0A 4LLGF 4A3DJ 2PMUA 1YG2A 2Z99A 3PO2J 2ACJA 4KICA 1JXSA 4AM3A 2RREA 3RH2A 2H09A 3KYDB 5E18F 2A3SA 4PSWA 1QNTA 3D0SA 3E5QA 1B9NA 2XSJC 2E5NA 3E6DA 4M3FA 2X1CA 3VSLA 2VB6A 5CVJA 1OCCH 3GVAA 2DMTA 4LG3A 2OU2A 3LFUA 3ZQGA 3CLQA 2R4GA 3HOTA 4DYRA 1JKRC 1ODDA 1YE9A 1Z77A 4BUPA 1TWGJ 3WTXC 4CICA 2AO9A 5HLTA 4BHBA 1DDNA 4BH9A 3K6GA 4M71A 1JE8A 3ZMDA 3WG7H 1VQ7I 4MTEA 2O61A 4NB5A 5ICFA 2MLKA 3C3WA 1NG6A 2WTEA 3LSMA 2PMHA 2F6CA 2UWMA 4P5OA 4BQNA 2CUZA 1U6GA 5IPAA 4LB5A 3NAUA 1FP2A 2IVMA 3L2WA 1CGPA 4PXIA 3D5RC 5HLGA 5EJCA 4EJTA 2KP6A 1XPXA 2G7LA 4RAGA 1EKEA 3P9KA 3CLOA 1OCTC 2XGCA 2DMUA 2XROA 2E1NA 1CF7B 2LMDA 3LQRA 4MGRA 2L02A 3H1CA 5LLQA 1G3YA 5LRSA 2CQXA 3F6OA 4WWCA 2KHMA 4AUXA 1WSUA 4BQOA 2W82A 1ZYRF 3U1KA 3WE2A 3OYBA 2TDXA 3S17J 4GCKA 1OCZH 1Z21A 5J6XA 1S7AA 3ROUA 2XB0X 1GV5A 1B59A 5F08A 1TLHB 5DYMA 2ADUA 3R4KA 1QRYA 3FKJA 1FJLA 3BG3A 1B9MA 1DP3A 4GO1A 3NARA 3H5NA 1QHHD 3FMSA 4WXDA 4CA0A 1K6YA 3S15J 4QLCU 2V1DA 3BZKA 1MDMA 1X3WB 2PMZA 4ZDOA 2VT3A 4HPQA 3JRIA 3S2DJ 4Y15A 9ANTA 2YPRA 4QIWN 2ZY9A 5DCFA 3NQOA 3TO6A 5HDNA 3S32A 5E3OA 3F0CA 3OYIA 3CCMI 1ZR4A 4LLNA 2ZOZA 2GIVA 3J7ZI 2NX4A 5JVTA 3CDHA 2O0YA 3WG9A 1TWFJ 5K7ZA 1N75A 3OR1C 3D5LA 3QPSA 1BBYA 3HRUA 4BHPA 5M3FJ 2DA7A 2HPIA 5K7FA 3SZGA 3BCGA 1NTCA 4XSZF 4HSTA 2TCTA 3MNLA 5KNLA 1D5VA 1QA6A 3IHUA 4XLFA 1Z1DA 3DEUA 3ZQIA 1SVOA 1FZPB 4E7JA 4S04A 3HOWJ 5BPDA 4Y13A 1E3HA 4BL0B 2E36A 3MWMA 2L4AA 3F21A 1BIAA 2EIMH 4KDPA 2HVRA 1WWXA 3O60A 3C7JA 2O8KA 2VXZA 1YITI 4N4NB 3OYFA 2Y48A 3AQSA 4J01A 2CW0F 1TBXA 4AD9A 2F5CA 3V4GA 3OIOA 5LD2C 1ITYA 4PJJA 5HODA 2FE3A 1IXRC 2JT1A 2NVYJ 1WPKA 3MMYB 1MMAA 4BHCA 1XGNA 1JUMA 5J40A 3GLXA 2VLAA 2CQ7A 2M45A 2Q24A 4BJTA 3KLOA 1YS6A 3DXJF 5HLIA 1IZ1A 4EEFG 1ZRFA 1R5ID 1WH7A 3GEZA 3NEUA 2H8RA 1IAWA 4IHTA 2OQGA 4XKWA 5J1UA 4FASD 1IN5A 1T0FC 4FX4A 2C6YA 5K58A 2XSDC 2KIQA 2FOKA 2H8WA 4CCKA 1HOMA 3JRHA 1T38A 4IHSA 3TBIA 3SDBA 5DUIA 1XSXA 2LREA 5LGNA 3CJDA 4G6TB 3HG9A 1IXCA 1MDMB 3SQNA 3S93A 5H6QA 2H1LA 1RRJA 4ZZDA 2PFVA 5CQEA 4G6QA 2A2FX 1Y8RB 4YFKF 2OJED 3R6SA 1YTYA 2CU7A 5FFXA 3M8JA 1UHWA 3NI7A 1XGSA 5CPRB 2HDCA 2X6WA 4II2A 3E5XA 2KL4A 4X1EA 1ZARA 3Q9SA 4ASNA 4IRGA 2PMZN 2FSWA 2YU9J 2L7ZA 4J00A 1ZHFA 2K9LA 1RUOA 2QUFA 3FXRA 4IEJA 4XR6A 2IA0A 2MG4A 3RCOA 2O9LA 4ON0A 1Y39A 3JCUC 5ERIA 1VQ8I 2E34A 2J5OA 3L00A 3F9KA 1RIOH 4LG0A 5LGUA 4RB2C 3WTWC 2WAQA 4P55A 4XONA 3QPTA 5K5RA 3VB2A 3K7AJ 3BQZA 2CQKA 1BI2A 3DTEA 3VSKA 3SZTA 1SFEA 1P92A 4HAMA 2HZDA 2IS6A 2MD0A 1A04A 4F7ZA 1DGRM 2RQQA 1RZ4A 1BI1A 3K70C 4M3GA 1Z6RA 1FYKA 1L0OC 3BQYA 5DS9A 1KYWA 4M3BA 3ANPA 2K9QA 3CDIA 2A07F 3B73A 4CSWA 4AIJA 1ENHA 3BJAA 1K78A 3BHQA 4UUSA 2KPMA 2YX7A 4A3JJ 1E3OC 3RKYA 5ILUA 1SD4A 5GTIC 5C44J 2QENA 3KP5A 4D5FA 1H89C 5FKNA 4IKFA 3QPHA 3UR3C 4XK4A 3C2HA 1GV2A 3M4OJ 4BBSJ 5JVGF 2F5EA 5CKTA 4A6EA 3GX4X 1X2MA 4H4KC 2R3SA 5LFAA 1BC8C 3HL2A 4O5VA 5CVIA 5FKKA 1IV6A 2BW3B 4AU7A 4CO8A 4EJWA 1IUYA 5HBUA 1VI0A 3WGIA 4HV5A 4G94A 3E5UA 2DO7A 1XGMA 4OAYA 4PGHA 3SYTA 2FF4A 3JREA 2JZYA 2VE9A 4E7ZA 3RSNA 1NK2P 3EPZA 5D5VB 5TISC 5IY5H 1P4XA 2ZSHB 2GAUA 4P9UA 4MQ9F 3K4NA 4YFXF 3N4MA 3OYMA 1GDTA 1JJ6C 2NP5A 2V9VA 2JTVA 5E20A 3JSPA 3JRBA 4HF0A 4XRFA 4MLOA 3OS1A 1PUFA 2ZCNA 1Y8QB 1MW7A 2A61A 4AVZA 4HZFA 1VFCA 1IRGA 3I58A 5CW8A 1M1EB 2M4KA 3DLAA 4IL6C 2ZO4A 3GFIA 1DGWY 2R7FA 4HLYA 5LHHA 2FQ4A 4KMUX 5BS6A 4CZCA 2LKXA 2DPDA 5FKOA 1VNDA 1R22A 1FT9A 3L09A 5BPIA 3FISA 3LA3A 2VBXA 1GT0C 3GTGJ 4FT8A 1KGSA 2FNAA 2EFNA 3PJRA 3ASOH 2DFFA 2M4GA 2A5WA 2QSFX 5L3BA 3IAM2 3GZNB 1E0EA 1R58A 3GEUA 2WAQN 3BJBA 5CXIA 2QZ8A 3VYSB 5F0CA 3A2KA 3H9GA 4QSHA 2XAGA 3GZ6A 3DBRB 5EFYA 3CDLA 2JSPA 2F48A 2KIUA 4BDYA 2OAZA 3C2GA 3PFIA 4N4OB 2IGMA 4CXFA 3HEFA 3WU0A 4KITB 1K78B 2ZXHA 5F1RA 3WTVC 3VYUB 3HRSA 4B8XA 2FBKA 1LDJA 3MKLA 1R1UA 1T2KA 2L0KA 5DV5A 2Q8KA 3JRGA 4BYYA 3RDIA 2G3BA 2XAFA 2GA2A 5HNHA 2DODA 5J47A 1IGNA 4BXXJ 3TEDA 4G7OF 1BOBA 2YUSA 3AFHA 4OIQF 1IN4A 5HSZA 3M7GA 3KP2A 3O8HA 1POGA 2HQNA 3CP8A 2MH2A 1JT0A 2WBMA 1KYZA 4A2UA 4HNVA 4C2MA 2JVHA 1D0YA 4HA8A 1BI0A 4GXOA 4AC0A 4B09A 3QYFA 2UXIA 1XDUA 4GCTA 4G7ZF 1O7FA 3AG1H 3E6BA 1O3QA 1FMWA 5GAEJ 2FBIA 5A2QZ 2G7UA 4KA4A 3E1SA 4ITVA 2FA5A 4IF4A 1HF0A 2VJJA 3BPXA 4E70A 5L3EA 1IJWC 5EEAA 1PUFB 2EV5A 3QWLA 3S1RJ 1UHSA 3RPQA 5ILSA 2JUGA 2KDOA 3T0YA 4FISA 1X1BA 3D5SC 3H36A 1Z05A 4GYGA 4XRSA 5TRDA 1PUEE 3WTZA 3DQVC 2QBYA 2PN6A 3P7NA 4N0BA 4MIMA 3E7QA 2ZXWH
chains in the Genus database with same CATH topology
3RQIA 1A5JA 2R5ZA 3Q0WA 3HB9A 4ABZA 1WGXA 1U78A 4ME9A 2XGEA 1P7JA 3LOCA 2REKA 4JKZA 4I6ZA 2R7ZJ 2AHQA 1LFBA 4BBRJ 1JGGA 5E3LA 3JR9A 2WB1N 2E2HJ 3LSJA 2MSYA 3BNIA 4W1UA 4Y52J 1AU7A 4LOCA 5D1RA 2O7TA 2M34A 2QCOA 3KNWA 2GBYA 2E2IJ 3I4NJ 4IHXA 2ME0A 1IG7A 1DU0A 1MBKA 2XGDA 2GM4A 1D5YA 1HDDC 2GENA 3T6NA 2NVXJ 1CQTA 3QPLA 1JKOC 2LY9A 4G12A 4DYQA 2GFNA 4JX6A 4AF5A 1DU6A 5M3MJ 2M2EA 3JRDA 2JJ7A 4A3FJ 3QKXA 4C3JJ 3KKCA 4X6AJ 2VI6A 4JYKA 3BR6A 5EZHA 1ETYA 3JRFA 2E19A 3W6VA 1TWAJ 1ETQA 1F43A 2PZ9A 3TP3A 3L1PA 2KT0A 4XRSG 2ZCMA 1MBHA 3GTKJ 2G0EA 2QF7A 4D7NA 3PM1A 1MBFA 2LTPA 2P81A 2COBA 1MSEC 3IH2A 1SFOJ 2DA2A 2G7GA 1JTYA 2WV1A 4MFDA 2HOAA 5H9TA 3RD3A 5EG0A 1ETWA 2I10A 2Y31A 4QTRA 1P7IA 1XG1A 4S0HB 4A3BJ 1SGMA 4DZJA 2ZCXA 5FKLA 3JRCA 4BY1J 3EGQA 2ID3A 2JA5J 4DYCA 4JX5A 3HBLA 2QOPA 4J19A 1O4XA 2ME6A 1ETXA 3GTLJ 4A3DJ 2M0CA 3LSPA 5IYDJ 3PO2J 1MNMC 3S1MJ 1RPWA 3HOUJ 5FMPA 4GFKA 3RH2A 3S5RA 4L5EA 5E3NA 4DZPA 3JRAA 1ETVA 4B3AA 2DMQA 3H3VK 3M3YJ 3G1MA 4M3FA 2EZIA 3BR3A 2YVHA 2UXHA 2R5ZB 3OSGA 2Y9ZA 1I50J 1W0TA 4V2GA 3GZIA 2DMTA 2X9DA 3BR1A 3ZQGA 2CRGA 1JKRC 3BG5A 4DYRA 4A3CJ 1TWCJ 1T33A 1Z77A 1I6HJ 1AHDP 1TC3C 1TWGJ 1FIAA 1B8IB 2AO9A 1MBJA 2VKVA 1JKPC 1BW6A 1A6IA 4GCLA 1JJ8C 3PO3J 3HGGA 3LSGA 5K7HA 1JUSA 2HOSA 2UXPA 3VVZA 1Q1VA 4YZEA 1LE8B 2VUMJ 1X58A 2UXOA 2L7FP 2NVQJ 3IUVA 3TP0A 2Y2ZA 5IPAA 3GTPJ 3KKDA 3NAUA 3BG9A 1JT6A 3E7LA 3GTJJ 1HCRA 1XC5A 4PXIA 4C3HJ 2G7LA 4JL3A 2W53A 2KDZA 1OCTC 2XDNA 1WH5A 2XGCA 2JA8J 2DMUA 1XS9A 3VOKA 1UMQA 3MN2A 4M3EA 2NOGA 3VIBA 3TW6A 3IV5A 2RAEA 3V6GA 2CQXA 2HI3A 5IOZA 5EG0B 2VKEA 4AUXA 3S17J 2QTQA 3HTIA 4GCKA 2YVEA 1OJLA 3KZ9A 2GUHA 3LHQA 2XB0X 1GV5A 1T56A 4XIDA 1FTTA 5F08A 2CUEA 2LD5A 2DA5A 2LR8A 3RZOJ 3PPBA 1QRYA 2XPUA 4D5CA 5IP6A 3BG3A 5EDNA 1B8IA 1FJLA 3QQAA 4Y7NJ 1GUUA 3NARA 3C07A 3G1OA 3S15J 3VW2A 3QBMA 3ZQFA 2Y9YA 3S1NJ 3COLA 4GFLA 3Q0UA 3FK7A 1IC8A 1ZR2A 3WHBA 5F0HA 3JRIA 3BTLA 3S2DJ 9ANTA 1B72B 1HDPA 3P9TA 4QIWN 1Y1VJ 1K61A 2R0QC 1U9NA 1Y1WJ 1LE8A 3VW1A 4RDUA 5D18A 1QPIA 2R92J 5E3OA 3F0CA 1ZK8A 1ZR4A 1BL0A 1APLC 2MGQA 1ZQ3P 2ZOZA 2O7OA 2NX4A 3VP5A 2RHAA 5C4XJ 1QVTA 5EZGA 1TWFJ 3BT9A 2W48A 1NK3P 2Y0SN 5K7ZA 3CMYA 4A3GJ 3NPIA 3IH4A 1W0UA 3LJLA 3QPSA 5M3FJ 1YRNA 4MK6A 3VOXA 2DA7A 2ELKA 5K7FA 5M5YJ 5EYRA 2NVTJ 3BCGA 1NTCA 2TCTA 3MNLA 4HKUA 4AYBN 2D5VA 3VW0A 2K9SA 3ZQIA 3HOWJ 4MFEA 3NNRA 1IDYA 5IYBJ 2DA4A 3WHCA 2LVSA 3VVYA 1Z0XA 1ZKGA 2K9NA 2R5YB 3O60A 4A3IJ 2IBDA 2ECBA 2HXIA 2LP0A 2O8KA 2Y30A 5FLVA 4AC6A 2DG8A 3AQSA 1ITYA 1JTXA 3OIOA 2JN6A 4NELA 5HODA 2NVYJ 1WPKA 3S16J 2HDDA 4XICA 4IHWA 2CJJA 3BTCA 2TRTA 4B1RA 5JLWA 3HKZN 1JUMA 5IYCJ 4RBOA 3NXCA 1F36A 1RKTA 2Q24A 5F27A 3BR2A 3ON2A 3NRGA 2HXOA 2EH3A 1B72A 4EEFG 5C4JJ 1WH7A 4FE7A 2H8RA 1LFUP 1MH4A 2XPWA 1FIPA 2NS8A 5J1UA 3TW7A 2CQQA 5K58A 2XSDC 3S1QJ 1OFCX 2HYTA 3GTMJ 1HOMA 3JRHA 1WI3A 1JKQC 3FRQA 1BJZA 3F1BA 2RASA 2G7SA 4M6VA 4C3IJ 3CJDA 1RETA 3CRJA 1SANA 5AQCA 4FE4A 2L9RA 2XRLA 2DJNA 3AQTA 2JMWA 3CQZJ 3HTAA 2CU7A 5E3MA 4NDLA 4XRMA 3NI7A 4JP0A 1JUPA 4UUSB 3BTJA 2N8GA 2R5YA 4X1EA 2MW8A 2EZLA 1IDZA 4KWAA 3H0GJ 2PMZN 4BY7J 2YU9J 3B6AA 2L7ZA 2HKUA 2PBXA 1RKWA 2EBIA 4IEJA 3OSFA 1YRNB 2DN0A 2MG4A 4IHVA 3MVPA 1IRZA 2O9LA 5F04A 3VVXA 5JLXA 2LLKA 3A01A 3HOVJ 3DCFA 2FBQA 4DW6A 2IU5A 5GP9A 4CYCA 4ICHA 3IH3A 2ZOYA 3ANGA 3D1NI 3BRUA 1UI5A 5GPAA 3K7AJ 3BQZA 3DEWA 3LWJA 1FTZA 2LFBA 4FTHA 2XB5A 3HTJA 1ETOA 3HOYJ 3CWRA 3SFIA 4UUTA 2EZKA 4M3GA 5EGOA 5FGLA 5DAJA 3BQYA 3VPRA 4A93J 5DS9A 4M3BA 3ANPA 2K9QA 3FIWA 5F1JA 3FK6A 3HDDA 2HYJA 2ECCA 1ENHA 2UXUA 3BHQA 2QKOA 2X48A 4UUSA 5HAWA 1ORKA 1ZTRA 4A3JJ 1E3OC 4MO7A 3GTOJ 3RKQA 5C44J 3JSJA 4ACIA 4IHYA 3G7RA 4D5FA 1H89C 5FKNA 2D6YA 4XK4A 1U8BA 1GV2A 4V2FA 3RZDJ 3M4OJ 4BBSJ 5M5XJ 3LSRA 2EZHA 5GPCA 2K40A 2E2JJ 3V78A 1MSFC 1X2MA 3A02A 1HLVA 3E7QA 5FKKA 5C4YA 1IV6A 2L7MP 2CUFA 3O8GA 5HBUA 4D7MA 1VI0A 3HOZJ 2HOTA 5J1YA 2IAIA 2DA1A 3GTQJ 3JREA 1NK2P 4A3EJ 1U9OA 2M9HA 1FEXA 3HGYA 3LNQA 1GDTA 3ON4A 1JJ6C 3S2HJ 4UDSA 2NP5A 2XPVA 3JRBA 2ZCNA 1UG2A 1MH3A 3GBGA 1PUFA 4MLOA 3PASA 2NS7A 1AKHA 3EUPA 3VUQA 1S7EA 2WGBA 1VFCA 2ZB9A 5CW8A 1I3QJ 3A01B 2M8GX 2OPTA 2DG7A 2DMNA 2EQRA 3C2BA 3HOXJ 1ETKA 4CYCB 3HIMA 1MBEA 2FQ4A 2LKXA 3B81A 2JA7J 5M5WJ 5FKOA 2B63J 3G56A 1VNDA 2VPRA 3FISA 2V57A 1GT0C 3GTGJ 3HE0A 2NP3A 4JX4A 1X2NA 3ZQHA 2E1OA 3G1LA 3Q3SA 3GEUA 1WCMJ 4CGRA 5C3EJ 2GLOA 2WAQN 1BA5A 3BJBA 5CXIA 2ID6A 1H8AC 2X6OA 3Q0VA 5EGOB 1GVDA 2FD5A 5F0CA 5EFYA 4QSHA 3SDGA 1OCPA 5IOYA 5FJ8J 2H1KA 4GFBA 2JA6J 3CDLA 1BW5A 2DA6A 1G2HA 5F0FA 4L62A 3HEFA 2YS9A 1K83J 3DPJA 4M3DA 2QWTA 4JNNA 3CCYA 3ZOBA 5J3LA 2DA3A 2FX0A 5EF6A 3ZQCA 3I4MJ 3MKLA 2L0KA 4BKXA 5D19A 4I76A 3FKIJ 3JRGA 2OERA 1MBGA 5IP9J 1H88C 5BNGA 2G3BA 4B4CA 5CXGA 1IGNA 1UI6A 4BXXJ 3TEDA 2OI8A 5J1RA 2YUSA 5HSZA 3OOUA 3SJMA 4NN1A 1RR7A 3BR0A 3O8HA 1POGA 1IUFA 4A3KJ 1JT0A 4HNVA 5FLMJ 2IEKA 1RESA 3UKGA 4AC0A 2UXIA 2DMPA 1TWHJ 5FKMA 1R9TJ 4GCTA 3K2AA 4MXMA 2QIBA 2LK2A 2DTZA 2FJ1A 3BTIA 2OF7A 1VF9A 3A03A 5FHPA 1HF0A 1EF4A 3HTHA 2WUIA 3B6CA 5DTDA 1IJWC 2F07A 4FCYA 3BR5A 4A69C 4W97A 4A3MJ 5EEAA 4C2MJ 3S1RJ 1PUFB 1UHSA 1ZGWA 2HQ5A 2JWTA 1AKHB 4A3LJ 2JK3A 4FISA 4XRSA 5IP7J 2R93J 3S14J 1QVUA 4MIMA 3HM5A 3ZQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQI A;  1A5J A;  2R5Z A;  3Q0W A;  3HB9 A;  4ABZ A;  1WGX A;  1U78 A;  4ME9 A;  2XGE A;  1P7J A;  3LOC A;  2REK A;  4JKZ A;  4I6Z A;  2R7Z J;  2AHQ A;  1LFB A;  4BBR J;  1JGG A;  5E3L A;  3JR9 A;  2WB1 N;  2E2H J;  3LSJ A;  2MSY A;  3BNI A;  4W1U A;  4Y52 J;  1AU7 A;  4LOC A;  5D1R A;  2O7T A;  2M34 A;  2QCO A;  3KNW A;  2GBY A;  2E2I J;  3I4N J;  4IHX A;  2ME0 A;  1IG7 A;  1DU0 A;  1MBK A;  2XGD A;  2GM4 A;  1D5Y A;  1HDD C;  2GEN A;  3T6N A;  2NVX J;  1CQT A;  3QPL A;  1JKO C;  2LY9 A;  4G12 A;  4DYQ A;  2GFN A;  4JX6 A;  4AF5 A;  1DU6 A;  5M3M J;  2M2E A;  3JRD A;  2JJ7 A;  4A3F J;  3QKX A;  4C3J J;  3KKC A;  4X6A J;  2VI6 A;  4JYK A;  3BR6 A;  5EZH A;  1ETY A;  3JRF A;  2E19 A;  3W6V A;  1TWA J;  1ETQ A;  1F43 A;  2PZ9 A;  3TP3 A;  3L1P A;  2KT0 A;  4XRS G;  2ZCM A;  1MBH A;  3GTK J;  2G0E A;  2QF7 A;  4D7N A;  3PM1 A;  1MBF A;  2LTP A;  2P81 A;  2COB A;  1MSE C;  3IH2 A;  1SFO J;  2DA2 A;  2G7G A;  1JTY A;  2WV1 A;  4MFD A;  2HOA A;  5H9T A;  3RD3 A;  5EG0 A;  1ETW A;  2I10 A;  2Y31 A;  4QTR A;  1P7I A;  1XG1 A;  4S0H B;  4A3B J;  1SGM A;  4DZJ A;  2ZCX A;  5FKL A;  3JRC A;  4BY1 J;  3EGQ A;  2ID3 A;  2JA5 J;  4DYC A;  4JX5 A;  3HBL A;  2QOP A;  4J19 A;  1O4X A;  2ME6 A;  1ETX A;  3GTL J;  4A3D J;  2M0C A;  3LSP A;  5IYD J;  3PO2 J;  1MNM C;  3S1M J;  1RPW A;  3HOU J;  5FMP A;  4GFK A;  3RH2 A;  3S5R A;  4L5E A;  5E3N A;  4DZP A;  3JRA A;  1ETV A;  4B3A A;  2DMQ A;  3H3V K;  3M3Y J;  3G1M A;  4M3F A;  2EZI A;  3BR3 A;  2YVH A;  2UXH A;  2R5Z B;  3OSG A;  2Y9Z A;  1I50 J;  1W0T A;  4V2G A;  3GZI A;  2DMT A;  2X9D A;  3BR1 A;  3ZQG A;  2CRG A;  1JKR C;  3BG5 A;  4DYR A;  4A3C J;  1TWC J;  1T33 A;  1Z77 A;  1I6H J;  1AHD P;  1TC3 C;  1TWG J;  1FIA A;  1B8I B;  2AO9 A;  1MBJ A;  2VKV A;  1JKP C;  1BW6 A;  1A6I A;  4GCL A;  1JJ8 C;  3PO3 J;  3HGG A;  3LSG A;  5K7H A;  1JUS A;  2HOS A;  2UXP A;  3VVZ A;  1Q1V A;  4YZE A;  1LE8 B;  2VUM J;  1X58 A;  2UXO A;  2L7F P;  2NVQ J;  3IUV A;  3TP0 A;  2Y2Z A;  5IPA A;  3GTP J;  3KKD A;  3NAU A;  3BG9 A;  1JT6 A;  3E7L A;  3GTJ J;  1HCR A;  1XC5 A;  4PXI A;  4C3H J;  2G7L A;  4JL3 A;  2W53 A;  2KDZ A;  1OCT C;  2XDN A;  1WH5 A;  2XGC A;  2JA8 J;  2DMU A;  1XS9 A;  3VOK A;  1UMQ A;  3MN2 A;  4M3E A;  2NOG A;  3VIB A;  3TW6 A;  3IV5 A;  2RAE A;  3V6G A;  2CQX A;  2HI3 A;  5IOZ A;  5EG0 B;  2VKE A;  4AUX A;  3S17 J;  2QTQ A;  3HTI A;  4GCK A;  2YVE A;  1OJL A;  3KZ9 A;  2GUH A;  3LHQ A;  2XB0 X;  1GV5 A;  1T56 A;  4XID A;  1FTT A;  5F08 A;  2CUE A;  2LD5 A;  2DA5 A;  2LR8 A;  3RZO J;  3PPB A;  1QRY A;  2XPU A;  4D5C A;  5IP6 A;  3BG3 A;  5EDN A;  1B8I A;  1FJL A;  3QQA A;  4Y7N J;  1GUU A;  3NAR A;  3C07 A;  3G1O A;  3S15 J;  3VW2 A;  3QBM A;  3ZQF A;  2Y9Y A;  3S1N J;  3COL A;  4GFL A;  3Q0U A;  3FK7 A;  1IC8 A;  1ZR2 A;  3WHB A;  5F0H A;  3JRI A;  3BTL A;  3S2D J;  9ANT A;  1B72 B;  1HDP A;  3P9T A;  4QIW N;  1Y1V J;  1K61 A;  2R0Q C;  1U9N A;  1Y1W J;  1LE8 A;  3VW1 A;  4RDU A;  5D18 A;  1QPI A;  2R92 J;  5E3O A;  3F0C A;  1ZK8 A;  1ZR4 A;  1BL0 A;  1APL C;  2MGQ A;  1ZQ3 P;  2ZOZ A;  2O7O A;  2NX4 A;  3VP5 A;  2RHA A;  5C4X J;  1QVT A;  5EZG A;  1TWF J;  3BT9 A;  2W48 A;  1NK3 P;  2Y0S N;  5K7Z A;  3CMY A;  4A3G J;  3NPI A;  3IH4 A;  1W0U A;  3LJL A;  3QPS A;  5M3F J;  1YRN A;  4MK6 A;  3VOX A;  2DA7 A;  2ELK A;  5K7F A;  5M5Y J;  5EYR A;  2NVT J;  3BCG A;  1NTC A;  2TCT A;  3MNL A;  4HKU A;  4AYB N;  2D5V A;  3VW0 A;  2K9S A;  3ZQI A;  3HOW J;  4MFE A;  3NNR A;  1IDY A;  5IYB J;  2DA4 A;  3WHC A;  2LVS A;  3VVY A;  1Z0X A;  1ZKG A;  2K9N A;  2R5Y B;  3O60 A;  4A3I J;  2IBD A;  2ECB A;  2HXI A;  2LP0 A;  2O8K A;  2Y30 A;  5FLV A;  4AC6 A;  2DG8 A;  3AQS A;  1ITY A;  1JTX A;  3OIO A;  2JN6 A;  4NEL A;  5HOD A;  2NVY J;  1WPK A;  3S16 J;  2HDD A;  4XIC A;  4IHW A;  2CJJ A;  3BTC A;  2TRT A;  4B1R A;  5JLW A;  3HKZ N;  1JUM A;  5IYC J;  4RBO A;  3NXC A;  1F36 A;  1RKT A;  2Q24 A;  5F27 A;  3BR2 A;  3ON2 A;  3NRG A;  2HXO A;  2EH3 A;  1B72 A;  4EEF G;  5C4J J;  1WH7 A;  4FE7 A;  2H8R A;  1LFU P;  1MH4 A;  2XPW A;  1FIP A;  2NS8 A;  5J1U A;  3TW7 A;  2CQQ A;  5K58 A;  2XSD C;  3S1Q J;  1OFC X;  2HYT A;  3GTM J;  1HOM A;  3JRH A;  1WI3 A;  1JKQ C;  3FRQ A;  1BJZ A;  3F1B A;  2RAS A;  2G7S A;  4M6V A;  4C3I J;  3CJD A;  1RET A;  3CRJ A;  1SAN A;  5AQC A;  4FE4 A;  2L9R A;  2XRL A;  2DJN A;  3AQT A;  2JMW A;  3CQZ J;  3HTA A;  2CU7 A;  5E3M A;  4NDL A;  4XRM A;  3NI7 A;  4JP0 A;  1JUP A;  4UUS B;  3BTJ A;  2N8G A;  2R5Y A;  4X1E A;  2MW8 A;  2EZL A;  1IDZ A;  4KWA A;  3H0G J;  2PMZ N;  4BY7 J;  2YU9 J;  3B6A A;  2L7Z A;  2HKU A;  2PBX A;  1RKW A;  2EBI A;  4IEJ A;  3OSF A;  1YRN B;  2DN0 A;  2MG4 A;  4IHV A;  3MVP A;  1IRZ A;  2O9L A;  5F04 A;  3VVX A;  5JLX A;  2LLK A;  3A01 A;  3HOV J;  3DCF A;  2FBQ A;  4DW6 A;  2IU5 A;  5GP9 A;  4CYC A;  4ICH A;  3IH3 A;  2ZOY A;  3ANG A;  3D1N I;  3BRU A;  1UI5 A;  5GPA A;  3K7A J;  3BQZ A;  3DEW A;  3LWJ A;  1FTZ A;  2LFB A;  4FTH A;  2XB5 A;  3HTJ A;  1ETO A;  3HOY J;  3CWR A;  3SFI A;  4UUT A;  2EZK A;  4M3G A;  5EGO A;  5FGL A;  5DAJ A;  3BQY A;  3VPR A;  4A93 J;  5DS9 A;  4M3B A;  3ANP A;  2K9Q A;  3FIW A;  5F1J A;  3FK6 A;  3HDD A;  2HYJ A;  2ECC A;  1ENH A;  2UXU A;  3BHQ A;  2QKO A;  2X48 A;  4UUS A;  5HAW A;  1ORK A;  1ZTR A;  4A3J J;  1E3O C;  4MO7 A;  3GTO J;  3RKQ A;  5C44 J;  3JSJ A;  4ACI A;  4IHY A;  3G7R A;  4D5F A;  1H89 C;  5FKN A;  2D6Y A;  4XK4 A;  1U8B A;  1GV2 A;  4V2F A;  3RZD J;  3M4O J;  4BBS J;  5M5X J;  3LSR A;  2EZH A;  5GPC A;  2K40 A;  2E2J J;  3V78 A;  1MSF C;  1X2M A;  3A02 A;  1HLV A;  3E7Q A;  5FKK A;  5C4Y A;  1IV6 A;  2L7M P;  2CUF A;  3O8G A;  5HBU A;  4D7M A;  1VI0 A;  3HOZ J;  2HOT A;  5J1Y A;  2IAI A;  2DA1 A;  3GTQ J;  3JRE A;  1NK2 P;  4A3E J;  1U9O A;  2M9H A;  1FEX A;  3HGY A;  3LNQ A;  1GDT A;  3ON4 A;  1JJ6 C;  3S2H J;  4UDS A;  2NP5 A;  2XPV A;  3JRB A;  2ZCN A;  1UG2 A;  1MH3 A;  3GBG A;  1PUF A;  4MLO A;  3PAS A;  2NS7 A;  1AKH A;  3EUP A;  3VUQ A;  1S7E A;  2WGB A;  1VFC A;  2ZB9 A;  5CW8 A;  1I3Q J;  3A01 B;  2M8G X;  2OPT A;  2DG7 A;  2DMN A;  2EQR A;  3C2B A;  3HOX J;  1ETK A;  4CYC B;  3HIM A;  1MBE A;  2FQ4 A;  2LKX A;  3B81 A;  2JA7 J;  5M5W J;  5FKO A;  2B63 J;  3G56 A;  1VND A;  2VPR A;  3FIS A;  2V57 A;  1GT0 C;  3GTG J;  3HE0 A;  2NP3 A;  4JX4 A;  1X2N A;  3ZQH A;  2E1O A;  3G1L A;  3Q3S A;  3GEU A;  1WCM J;  4CGR A;  5C3E J;  2GLO A;  2WAQ N;  1BA5 A;  3BJB A;  5CXI A;  2ID6 A;  1H8A C;  2X6O A;  3Q0V A;  5EGO B;  1GVD A;  2FD5 A;  5F0C A;  5EFY A;  4QSH A;  3SDG A;  1OCP A;  5IOY A;  5FJ8 J;  2H1K A;  4GFB A;  2JA6 J;  3CDL A;  1BW5 A;  2DA6 A;  1G2H A;  5F0F A;  4L62 A;  3HEF A;  2YS9 A;  1K83 J;  3DPJ A;  4M3D A;  2QWT A;  4JNN A;  3CCY A;  3ZOB A;  5J3L A;  2DA3 A;  2FX0 A;  5EF6 A;  3ZQC A;  3I4M J;  3MKL A;  2L0K A;  4BKX A;  5D19 A;  4I76 A;  3FKI J;  3JRG A;  2OER A;  1MBG A;  5IP9 J;  1H88 C;  5BNG A;  2G3B A;  4B4C A;  5CXG A;  1IGN A;  1UI6 A;  4BXX J;  3TED A;  2OI8 A;  5J1R A;  2YUS A;  5HSZ A;  3OOU A;  3SJM A;  4NN1 A;  1RR7 A;  3BR0 A;  3O8H A;  1POG A;  1IUF A;  4A3K J;  1JT0 A;  4HNV A;  5FLM J;  2IEK A;  1RES A;  3UKG A;  4AC0 A;  2UXI A;  2DMP A;  1TWH J;  5FKM A;  1R9T J;  4GCT A;  3K2A A;  4MXM A;  2QIB A;  2LK2 A;  2DTZ A;  2FJ1 A;  3BTI A;  2OF7 A;  1VF9 A;  3A03 A;  5FHP A;  1HF0 A;  1EF4 A;  3HTH A;  2WUI A;  3B6C A;  5DTD A;  1IJW C;  2F07 A;  4FCY A;  3BR5 A;  4A69 C;  4W97 A;  4A3M J;  5EEA A;  4C2M J;  3S1R J;  1PUF B;  1UHS A;  1ZGW A;  2HQ5 A;  2JWT A;  1AKH B;  4A3L J;  2JK3 A;  4FIS A;  4XRS A;  5IP7 J;  2R93 J;  3S14 J;  1QVU A;  4MIM A;  3HM5 A;  3ZQL A; 
#chains in the Genus database with same CATH topology
 1FSE A;  4WF2 A;  3W2W A;  3Q0W A;  3LAP A;  1BOA A;  2VXD A;  2R7U A;  2E60 A;  1WGX A;  2XGE A;  2Q0O A;  1OCO H;  2P4W A;  1ZG5 A;  4YIF A;  5LBQ A;  4ZYD A;  1J59 A;  4CDG A;  2F5V A;  4BBR J;  2DJI A;  3LSJ A;  2MSY A;  4NBQ A;  5GAG J;  1OPC A;  1VQ5 I;  2XAS A;  4W1U A;  4Y52 J;  4F91 B;  2QSH X;  5D1R A;  3KNW A;  4I2O A;  5DD8 A;  2XGD A;  1EH7 A;  1FOX A;  2L9V A;  1PVE A;  3HRT A;  2V6E A;  3PSI A;  4HLX A;  3RPU D;  1JKO C;  2BY1 A;  1TTY A;  4DYQ A;  1W5C C;  1LNW A;  4JX6 A;  1DU6 A;  2VQG A;  4EVI A;  3H92 A;  2KZG A;  3F3X A;  3KP4 A;  2QYO A;  4L9V A;  2K85 A;  2EJR A;  5HS9 A;  2JJ7 A;  4A3F J;  4PZJ A;  4CZZ A;  1ERD A;  4JYK A;  5EZH A;  1ETY A;  3HRM A;  2E19 A;  5ICG A;  1ETQ A;  2KKO A;  2KT0 A;  3NWT A;  3LSI A;  4XRS G;  3K8P C;  4D7N A;  2P81 A;  1SD6 A;  4XKV A;  4GCV A;  3IKT A;  3VTI A;  1MSE C;  1D0Z A;  2BZT A;  2DA2 A;  3DTK A;  2G7G A;  1JTY A;  2R7T A;  3FMR A;  1K79 A;  4RMN A;  2E5Z A;  1Z3Y A;  3F8F A;  3HUG A;  3ABM H;  2FQ3 A;  4A3B J;  4S0H B;  2WY7 Q;  3DEE A;  4EAT A;  3FXM A;  3RKW A;  4EQQ A;  4XLN F;  2ZCX A;  3JRC A;  2OZU A;  2LH9 A;  4OU0 A;  4UY8 I;  4ZYG A;  4UV8 A;  4DVY P;  4ZDL A;  2OC6 A;  1I27 A;  3RQ4 A;  1MNM C;  2FML A;  2XIG A;  2FOW A;  3HOU J;  1H9G A;  4GFK A;  4L5E A;  5HDG A;  2V9P A;  2W57 A;  3HSR A;  1ON2 A;  1N77 A;  3JRA A;  3NRV A;  3H3V K;  1OKR A;  2VIX A;  1P4A A;  3G3Z A;  3G1M A;  5H2F C;  3QU3 A;  2VKD A;  2YVH A;  3OSG A;  2Y9Z A;  4A5M A;  1XX5 A;  1L3L A;  2DOA A;  3K70 D;  2HFH A;  3BOQ A;  1TW3 A;  1QBJ A;  3BG5 A;  1TWC J;  5FD5 A;  2CUJ A;  1T33 A;  3LQQ A;  1FIA A;  1B8I B;  1JKP C;  5HVQ C;  3HGG A;  3PSF A;  5FRM A;  3L2C A;  4MQV A;  4PJM A;  5K7H A;  2HOS A;  4YEL A;  3VVZ A;  4E7L A;  2GIZ A;  1Q1V A;  5L3C A;  3WGH A;  1X58 A;  2A6H F;  2L7F P;  2DU9 A;  2NVQ J;  5FB2 A;  3VYR B;  3TP0 A;  1V54 H;  2Y2Z A;  4ZH4 F;  3GTP J;  3E7L A;  1HCR A;  1OYI A;  1D1B A;  2VBW A;  4JBA A;  4R1H A;  4FHT A;  2FMY A;  3A0B C;  3L2V A;  2L01 A;  2OUM A;  1G4D A;  3RPU A;  2KDZ A;  2XDN A;  2JA8 J;  2FRH A;  2XDV A;  1UMQ A;  3OY9 A;  4RGS A;  1Q1H A;  2FEZ A;  3OYN A;  4DQ2 A;  2RAE A;  2QA4 I;  3ZQ7 A;  1J2X A;  3K10 A;  3ELK A;  1KU9 A;  3ABK H;  5KCM A;  3DPT A;  4FX0 A;  3I9V 2;  2HI3 A;  4OD5 A;  5IOZ A;  4U7B A;  1FPQ A;  2RGV A;  2V4J C;  3S3O A;  2BY3 A;  3FBN B;  3HTI A;  2YVE A;  2L2O A;  3KZ9 A;  2GUH A;  3LHQ A;  2HU9 A;  1OCR H;  4XID A;  1W5S A;  3I56 I;  1D8J A;  2DA5 A;  3RZO J;  2EIK H;  1YX5 A;  1T6S A;  3CJR B;  3PFY A;  5DD4 A;  5IP6 A;  4Y7N J;  2K4J A;  3J80 Z;  1ZRD A;  4I09 A;  3QBM A;  1LKX A;  2EV0 A;  3ZQF A;  3COL A;  3Q0U A;  3FK7 A;  5DCM B;  3ECH A;  5F0H A;  5D18 A;  4ENK A;  4E7H A;  1ZK8 A;  5E8G A;  3WU2 C;  2LKP A;  2O7O A;  1FC3 A;  3A1Y A;  3KZY A;  3VP5 A;  1Z91 A;  3K4B A;  1HXD A;  5EZG A;  5B1A H;  3TL4 X;  2W48 A;  1FBU A;  4C9Y A;  2R7S A;  1QZE A;  3CMY A;  4A3G J;  2R7D A;  2QKM B;  1HKQ A;  3J7Y J;  2WV0 A;  3CCE I;  5EYR A;  4HKU A;  3VW0 A;  1ON1 A;  2K9S A;  4F92 B;  2D1H A;  2H27 A;  4KMF A;  5IYB J;  2LYC A;  2MFZ A;  2ZFW A;  4C2U A;  1WJD A;  2K9N A;  2E1C A;  4HF2 A;  2R5Y B;  2IBD A;  4AID A;  2Y30 A;  4AC6 A;  2L5Q A;  3I54 A;  4M72 A;  3ZGK A;  2HVS A;  3S16 J;  4ZJZ A;  4L0Z B;  5KAF C;  2HDD A;  4XIC A;  4E7I A;  1B6A A;  2CJJ A;  5JLW A;  2TRT A;  4IHW A;  4ZTF A;  3OYK A;  2JPC A;  1XSV A;  4OOI A;  4RBO A;  2IS2 A;  1F36 A;  1RKT A;  3GYH X;  2PQ8 A;  1DQU A;  2KRH A;  3F8M A;  1W4M A;  3KPH A;  1KU3 A;  2MH9 A;  3QOP A;  4LK0 F;  5E79 C;  2UXX A;  4XLH A;  2WAD A;  5L3G A;  5C4J J;  2YX4 A;  2CV0 A;  1AOY A;  4L5I A;  4D1Q A;  2R7W A;  1Z9C A;  1LFU P;  1FIP A;  1VQN I;  2CQQ A;  2X6X A;  3TOA A;  4L9T A;  3FBI B;  4DBQ A;  2FUG 2;  3M8E A;  1Z7L A;  1OFC X;  2HYT A;  3GTM J;  1WI3 A;  1IXS B;  2NRA C;  1BJZ A;  3F1B A;  2RAS A;  1S29 A;  1RR8 C;  5LHG A;  4LIT A;  1V55 H;  4Y17 A;  3H3Z A;  1S6L A;  2L54 A;  3A4C A;  4FET A;  3CCS I;  4U88 A;  2Z9O A;  2LKS A;  2XAU A;  3PNY A;  3DKW A;  2M0M A;  2GXG A;  2IXS A;  4BE1 A;  3IC7 A;  2A68 F;  4BAC A;  1RKW A;  2IRF G;  1ZH5 A;  2EBI A;  3H9J A;  3GCM A;  2PBX A;  4P96 A;  2IA1 A;  2Z1D A;  2DN0 A;  4RS8 A;  3AG3 H;  2Z3Y A;  1IRZ A;  3HYI A;  2HPM A;  3HOS A;  5F04 A;  1MMG A;  1E17 A;  4CHU A;  3CJQ B;  2CMP A;  3DCF A;  2FBQ A;  1HW5 A;  4DW6 A;  2IU5 A;  2KRF A;  4Y33 A;  2RV8 A;  5CVR A;  3K0L A;  4ENM A;  3FDY A;  4BQQ A;  1SVL A;  2QLZ A;  4E7S A;  3FXJ A;  2HVQ A;  3E3V A;  3WTY C;  3ANG A;  3T8R A;  3HPG A;  5GAH J;  3LWJ A;  1FY7 A;  4QWQ A;  2BOL A;  1FBS A;  3TO7 A;  3DKY A;  1IRX A;  3ZN1 A;  5LEJ A;  1F5T A;  3TKY A;  1T98 A;  3TDU C;  3N97 A;  2ZME B;  4KJZ A;  4ZDP A;  3KEO A;  3QP5 A;  4E6K G;  2HEO A;  2W4S A;  3IP4 B;  5DAJ A;  3VPR A;  4A93 J;  1JHH A;  1OR7 A;  2RC4 A;  2KIF A;  1QGP A;  2F4O B;  4D9J A;  3BC8 A;  4EJV A;  3HDD A;  2HYJ A;  3KZI C;  3VOE A;  1XCV A;  2ECC A;  2UXU A;  1LDK B;  2QKO A;  5HAW A;  1ONV A;  2VPL A;  2YVX A;  3FXK A;  2DK8 A;  2EIL H;  1MJ9 A;  3DPU A;  4I0B A;  2BEO A;  3CJN A;  3K4J A;  4G9Y A;  1LFP A;  1U8B A;  4D0P A;  1SC7 A;  2DQL A;  3AG4 H;  3DV8 A;  5M5X J;  1K6O A;  5GPC A;  1JI8 A;  3HZJ A;  2V7F A;  2P5V A;  1QPM A;  4UUV A;  5LEK A;  1K7A A;  2CUF A;  1HSJ A;  4HG2 A;  1MMD A;  2HOT A;  4G8X A;  2F5D A;  1SAX A;  3IRQ A;  2DA1 A;  4L9N A;  2EWN A;  4OMY A;  2YR2 A;  3L2R A;  2OA4 A;  2JQ7 A;  5D5U B;  1UG0 A;  2VKH A;  2ETH A;  3JTH A;  4XN0 A;  1IF1 A;  3RIR A;  4YRV A;  1FEX A;  4HV6 A;  4Q4Z F;  3CUQ B;  3HGY A;  3LNQ A;  2ELH A;  1G3T A;  4BJ6 C;  4S05 A;  3ON4 A;  2XGX A;  1IN6 A;  3ECO A;  4M6Y A;  3VUQ A;  1AKH A;  3EUP A;  1S72 I;  2WGB A;  4R79 A;  4L18 B;  4UB8 C;  1I3Q J;  2QKL B;  3P5J A;  2VJ5 A;  3HOX J;  4M74 A;  1ETK A;  2BVM A;  2RDP A;  2L9S A;  3OIP A;  2H6B A;  1I3A A;  3V7R A;  4LIV A;  2VJ4 A;  3QYB A;  1UEL B;  2DQR A;  2V57 A;  1D3Y A;  2ISZ A;  2I8D A;  2VL8 A;  4A0Y A;  2UXN A;  3G1L A;  3GO5 A;  1XGO A;  4EM2 A;  2DPU A;  1DPR A;  1H0M A;  2PEX A;  4DGW B;  5D5W B;  2F4I A;  4NUB A;  3MZH A;  1G3S A;  4V19 K;  2Z33 A;  1WCM J;  5C3E J;  1O3R A;  1N25 A;  2ID6 A;  1GVD A;  2LY2 A;  4C2T A;  3SDG A;  5IOY A;  4PFO A;  3TOB A;  2DA6 A;  2R7X A;  1OLT A;  2BW3 A;  2XF6 A;  3K1P A;  3KIO A;  2RNG A;  3L9F A;  2HZT A;  4RB0 A;  1OMI A;  3FHZ A;  5CVU A;  4PGG A;  4U0W A;  1U2W A;  1BI3 A;  1X19 A;  4E7K A;  2Y69 H;  2V1X A;  4KIF A;  4XKC A;  3V42 A;  4M3D A;  2QWT A;  4JNN A;  3CCY A;  5J3L A;  2E1M B;  5EF6 A;  2F4M B;  3ZQC A;  1FBQ A;  3OL3 A;  1WZ2 A;  3I4M J;  1LVK A;  3G4S I;  1I1S A;  1O57 A;  3MKZ A;  2ZJ2 A;  3COA C;  5FLX K;  4K2E A;  1MBG A;  5IP9 J;  2ZC2 A;  2IPQ X;  1UI6 A;  3O6B B;  3QYE A;  4HYE A;  3SXY A;  5J1R A;  4OIP F;  2OI8 A;  2PX9 A;  2X6Y A;  1XMA A;  2R7O A;  3UNG C;  4OIO F;  3OOU A;  1MKM A;  4NN1 A;  1RR7 A;  3BR0 A;  2HKO A;  4RGR A;  3QRF F;  3M1C A;  2HYF A;  1RES A;  2DMP A;  1R9T J;  2XKO A;  3K2A A;  3TDZ C;  4HDV A;  2MYS A;  3K9T A;  1MMS A;  2LK2 A;  2DTZ A;  1VF9 A;  4ZYH A;  1TQI A;  2ICW G;  2A05 A;  2K3P A;  4U0Y A;  3MQ0 A;  1BC7 C;  4A3M J;  1S7O A;  2W24 A;  1SAU A;  1WJF A;  4PCQ A;  3W2A A;  1ZGW A;  2OTL I;  2JWT A;  1E2X A;  4ENN A;  1AKH B;  3CES A;  5L3D A;  3V8L A;  5LRR A;  3WGG A;  3CC4 I;  3R60 A;  3S14 J;  1QVU A;  3HM5 A;  3RQI A;  1X4O A;  2M7B A;  4LIU A;  5D6F A;  1KU7 A;  4YG2 F;  1SFX A;  3LOC A;  4I6Z A;  2P6S A;  3OOP A;  2R7Z J;  1WFX A;  4IRH A;  5E17 F;  3SEZ A;  5E3L A;  1JGG A;  2EFQ A;  3OWT A;  2ZME C;  3I59 B;  2E2I J;  5KVR A;  4IHX A;  2ME0 A;  3WU1 B;  4HBL A;  1DU0 A;  4IRV A;  2IA2 A;  4AWX B;  3WTS C;  3OYC A;  1HDD C;  3LA2 A;  2QVO A;  4BAY A;  3EUA A;  3MKY B;  2GEN A;  3HC7 A;  3PQJ A;  3QPL A;  4HF1 A;  5BOX A;  5DUK A;  2B7E A;  3PIO F;  4HEA 2;  2QWW A;  2GFN A;  4AF5 A;  2WC2 A;  1IRF A;  1R1V A;  2M2E A;  2XAH A;  3ZXS A;  1F9N A;  2HQA A;  2W84 A;  1I39 A;  2F2E A;  3KKC A;  1V3F A;  3BR6 A;  2DT6 A;  4U9L A;  1SD5 A;  3OYG A;  3L1P A;  2VQH A;  2LBF B;  2M30 A;  1MBH A;  4PSX A;  4EV0 A;  1BIB A;  2G0E A;  2ELJ A;  2ESN A;  2QQ8 A;  2LTP A;  4H0E A;  1KA8 A;  2QEX I;  2WV1 A;  2HOA A;  2STT A;  1YOV B;  3J81 K;  5J8F A;  2IGN A;  5EG0 A;  4QTR A;  5B3S H;  2BXZ A;  1XG1 A;  4XLA A;  3ZQQ A;  1ULY A;  1U0J A;  3EDP A;  4Q5S F;  1FYL A;  3LMM A;  1VZ0 A;  2LNB A;  4PUS A;  4DYC A;  4I0A A;  2XC7 A;  2QOP A;  3BDD A;  2EIN H;  1O4X A;  3K4L A;  2LF8 A;  1X1P A;  2E7W A;  4RLQ A;  1FMV A;  2HYG D;  2X85 A;  3IWF A;  3LSP A;  5IYD J;  5AON A;  3U2R A;  2R7Q A;  2L4M A;  1T39 A;  3S5R A;  3ERE D;  2NNY A;  4OWR B;  5ICC A;  1MMN A;  1Z67 A;  2GA1 A;  2PFB A;  2Y0S A;  3ML6 A;  4R8H A;  1ETV A;  2VBZ A;  4B3A A;  3NWS A;  1ZG3 A;  3BPV A;  2UXH A;  3CCL I;  1W0T A;  4YIR X;  1Y0U A;  3BR1 A;  1YW9 A;  2CRG A;  4A3C J;  3WE3 A;  3SZP A;  2P7V B;  1AHD P;  4WCG A;  4M9Z A;  4LFU A;  3F22 A;  1TC3 C;  4L9J A;  3QOE A;  1BW6 A;  1A6I A;  4GCL A;  3PO3 J;  4IQJ A;  4BNC A;  3LFK A;  3LSG A;  3CO6 C;  1JUS A;  4CGZ A;  3JSO A;  2MBF A;  1TNS A;  3CCR I;  5JFR A;  4XLE A;  2UXP A;  3M9A A;  1OR7 C;  4YZE A;  2M1B A;  1LE8 B;  1LUJ B;  2VUM J;  1EJ9 A;  1A35 A;  1MGT A;  3E0J B;  2RNJ A;  3HKZ A;  2GXB A;  3L2U A;  3KKD A;  4EM0 B;  2DXI A;  3GTJ J;  1JT6 A;  4IRI A;  3TQN A;  2E1M C;  4BE2 A;  3E97 A;  1XC5 A;  4RB1 A;  3J7A O;  1FOY A;  2WWY A;  4AIK A;  1YFH A;  2W53 A;  2MA3 A;  2XF7 A;  3OS2 A;  3JW4 A;  1WH5 A;  4IQ4 A;  3VOK A;  1YLF A;  3MN2 A;  3OS0 A;  3VIB A;  5K5Q A;  1R6R A;  3I0T A;  5HOO A;  2AXL A;  2DK5 A;  3JAM K;  3IKV A;  3IV5 A;  1ZGA A;  3JAM Z;  3SHF A;  1QO0 D;  3DFG A;  5DM6 F;  5EG0 B;  1YYV A;  5IT3 A;  3EUK L;  3VOD A;  4M73 A;  5CQG A;  3ZR8 X;  3KCC A;  2QTQ A;  2LOO A;  1OJL A;  3ZMS A;  3ZPL A;  1NHA A;  3ZCO A;  3ZMV A;  5GAD J;  3CCQ I;  1T56 A;  4O3M A;  1FTT A;  4MEX F;  1V5G A;  2CUE A;  3H9Q A;  1VQ9 I;  2LD5 A;  2K4B A;  1K4S A;  3PPB A;  1B8I A;  3S1Q J;  3QQA A;  3X2Q H;  1GUU A;  3G1O A;  3VW2 A;  4OMZ A;  5TJJ A;  1USS A;  2JSC A;  3S1N J;  1ZR2 A;  1RC9 A;  3KX2 A;  2DYS H;  3CUO A;  2IT0 A;  1BR2 A;  4CCO A;  1B72 B;  1K61 A;  1Y1V J;  2R0Q C;  1Y1W J;  4CCL A;  1QPI A;  3CO7 C;  1ZQ3 P;  2MGQ A;  4G7H F;  2XHK A;  3F23 A;  3QAH A;  3QOD A;  4KFC A;  2RHA A;  2ESH A;  2ZXJ A;  2Y0S N;  3K4C A;  4ANJ A;  3IH4 A;  4MK6 A;  4I02 A;  1PDN C;  1YRN A;  3VOX A;  2VOP A;  2ELK A;  5M5Y J;  3DU6 A;  2KFD A;  2EFW A;  2MAB A;  2D1V A;  2K5C A;  4KIG A;  2D5V A;  3AAF A;  1AA7 A;  2V1N A;  2W1O A;  3VWB A;  3GLL A;  1ZAO A;  4U87 A;  3MD2 A;  4MFE A;  3NNR A;  2MLG A;  2IP2 A;  5FGM A;  2LVS A;  1J0R A;  4RA2 A;  1UAA A;  2NAZ A;  3VVY A;  3BWG A;  1Z0X A;  1ZGJ A;  4RGX A;  4A3I J;  2ECB A;  2LP0 A;  3FM3 A;  2DG8 A;  3M1E A;  4BXF A;  1S9H A;  2GOM A;  1UST A;  2JN6 A;  4XLC A;  1J5Y A;  2XKP A;  1FP1 D;  1GXP A;  3F72 A;  1HKS A;  3GME A;  3HKZ N;  2BXY A;  1WJ5 A;  3NXC A;  3W2V A;  3MZY A;  5DCM A;  4GDF A;  3KLN A;  5F27 A;  3BR2 A;  1R5H A;  2EH3 A;  1GVJ A;  4N9H A;  1FYM A;  1DUX C;  2O6G E;  2RQP A;  1HA8 A;  3KE2 A;  1MH4 A;  2IW5 A;  2KQR A;  2XPW A;  2NS8 A;  2EPF A;  3TW7 A;  3EET A;  4XNF A;  1UB9 A;  1NG7 A;  2VT2 A;  3QP6 A;  3DLL F;  1I6X A;  2JRT A;  4P9F A;  1ACI A;  4IXA A;  5F6F A;  4BDZ A;  5KK1 A;  4M6V A;  4C3I J;  1PP8 F;  3OYJ A;  1Y0N A;  1RET A;  2DOE A;  3CRJ A;  1SAN A;  5AQC A;  3ABL H;  2L9R A;  1HST A;  2IGK A;  3CQZ J;  3GWZ A;  3HTA A;  1TP4 A;  3RYP A;  4KUM A;  4NDL A;  4XRM A;  2UV1 A;  1JUP A;  1A6Q A;  4JP0 A;  3BTJ A;  2N8G A;  4BS9 A;  2R5Y A;  3S3N A;  1B1B A;  1X4P A;  1OYW A;  1IDZ A;  1HQC A;  1WJA A;  3H0G J;  2LC2 A;  4RM3 A;  3S8P A;  2HKU A;  3SEQ A;  5D4S A;  1WJC A;  4WK8 F;  1U5T B;  1YRN B;  2PJR B;  3KEY A;  4IHV A;  3FHN A;  3E6M A;  3L2Q A;  3ABU A;  2X1D A;  3VVX A;  1VQ6 I;  3VDX A;  4WIB A;  2ZFU A;  3A01 A;  2WAE A;  1TNT A;  2XRN A;  3HOV J;  3K1N A;  4HNT A;  3P9I A;  3ONQ A;  5D8L B;  1KZH A;  1LEA A;  4XM3 A;  2LF7 A;  4YEJ A;  1XB4 A;  4X0G A;  3ZP5 A;  2VQL A;  3BRU A;  5GPA A;  2V26 A;  4GRI A;  1Z7U A;  1FTZ A;  2LFB A;  4FTH A;  1UZC A;  1YI2 I;  3HTJ A;  1ETO A;  2KLO A;  3BCA A;  1UCR A;  3KYL A;  4Y3O A;  4U9N A;  2IS4 A;  2ZJP F;  1LDD A;  2P8T A;  1HW2 A;  4UUT A;  4IX7 A;  2EZK A;  2UZK A;  5EGO A;  2B0L A;  5FGL A;  2PI0 A;  2CGP A;  2IJL A;  2DI3 A;  3GZ5 A;  4LD5 A;  3HTU A;  3LA7 A;  2FBH A;  2KZV A;  3DU5 A;  3ZMT A;  2DDA A;  4MHG A;  4LMY A;  1KQ9 A;  4Z2Y A;  3KP7 A;  4NHJ A;  4MO7 A;  1P6R A;  3KET A;  5F64 A;  3JSJ A;  4ACI A;  4HQE A;  4IHY A;  3G7R A;  1J7K A;  2CFO A;  1YS7 A;  1SVM A;  3OYL A;  1TQM A;  3K1M A;  2ZXI A;  4DNC A;  3LSR A;  2EZH A;  2K40 A;  1E3P A;  2K86 A;  2E2J J;  3V78 A;  1GXQ A;  5CYV A;  3DF8 A;  1MSF C;  3REO A;  3W6J B;  4EMS A;  1HLV A;  4BEH A;  1B4A A;  3HHH A;  5ICE A;  3BY6 A;  4D7M A;  1XCB A;  6PAX A;  2BYV E;  3DKX A;  3OR2 C;  4C30 A;  3KEQ A;  2NVU B;  2CS3 A;  2DAO A;  5J1Y A;  4AVP A;  2DBB A;  3OV8 A;  3GTQ J;  2VJI A;  1D0X A;  2Z5U A;  4A3E J;  1TZL A;  1QZY A;  1JHF A;  2Q1Z B;  3ZMU A;  1NH3 A;  4HX7 A;  1FWZ A;  4LK1 F;  3S2H J;  4UDS A;  3I4P A;  1P9Q C;  1UG2 A;  3GBG A;  1VQM I;  3Q9V A;  2ZME A;  3OIQ A;  4UV9 A;  4B48 A;  1S7E A;  4DIQ A;  2ZB9 A;  4KNY A;  1SMT A;  2X0L A;  2ISY A;  3A01 B;  2WB1 A;  1EH6 A;  2M8G X;  2OPT A;  2EQR A;  3C2B A;  4XOT A;  2W25 A;  2M8E A;  3B81 A;  2JA7 J;  3G56 A;  1YIJ I;  1S5L C;  2LRD A;  4F52 A;  2DFE A;  4F3Q A;  3HE0 A;  2NP3 A;  2V79 A;  1X2N A;  4NQW B;  3ZQH A;  5LHI A;  2O3F A;  1RI7 A;  1W36 C;  2STW A;  1PJR A;  4Z6Y A;  3V7C A;  4E4H A;  5K1Y A;  4WX9 A;  5JI6 A;  1BM9 A;  3Q3S A;  3FWE A;  1BA5 A;  3A0H C;  3KP3 A;  3CMA I;  1H8A C;  2A5Y B;  3Q0V A;  5EGO B;  1YJ9 I;  3EUH C;  4GFB A;  2JA6 J;  3U1D A;  3V8J A;  3BZ6 A;  4L62 A;  4NC6 A;  3ZMZ A;  3H3U A;  3OYD A;  4CH7 A;  1IV8 A;  5HLH A;  1K83 J;  2ZBK A;  5H6R A;  4DOZ A;  3DPJ A;  4FQG A;  2VC1 A;  4I98 B;  2DA3 A;  2FX0 A;  3EQL F;  2B9S A;  1XSD A;  5D19 A;  3KP6 A;  3FKI J;  4I76 A;  3CUQ A;  4RAZ A;  1H88 C;  5HS8 A;  4TV7 A;  5FFZ A;  5BNG A;  1GLN A;  4KT6 A;  2OCE A;  4IPA A;  4DBR A;  3K4K A;  3BZC A;  3SJM A;  3MKW B;  2OD5 A;  4BEH B;  4A3K J;  4GGG A;  5FLM J;  4KN7 X;  4O6J A;  5H20 A;  2IEK A;  5J8C A;  3HIF A;  3LST A;  3V8K A;  2MC4 A;  1TWH J;  1XDS A;  4KYW A;  4UNO A;  4EGY A;  4MXM A;  4IO9 F;  2VOO A;  2QIB A;  3BTI A;  2KMU A;  2OF7 A;  1FSH A;  4BGD A;  3FF5 A;  5EEG A;  1D1A A;  5FHP A;  2ZKZ A;  5DM7 F;  1Z3X A;  4U7D A;  2YSR A;  4LB6 B;  1U5T C;  5DTD A;  2F07 A;  4MTD A;  4FCY A;  4A69 C;  4W97 A;  2AQE A;  2DOF A;  4XKB A;  5B5E C;  5TGT A;  4A3L J;  3MAJ A;  1Y6I A;  5IP7 J;  2K3F A;  3FXO A;  2CV2 A;  2EA4 A;  2JUC A;  3CMM A;  1SFK A;  4PJ0 C;  2RVC A;  2R5Z A;  3HB9 A;  2XV4 S;  1VQP I;  1SMY F;  4ABZ A;  2REK A;  2DW4 A;  1P2F A;  2MD5 A;  1S8N A;  3FMQ A;  4ZC3 A;  3VYT B;  1LFB A;  3MZ8 A;  3JR9 A;  2WB1 N;  3AL0 B;  3NS4 A;  1T8I A;  3K69 A;  1LJ9 A;  2OZ6 A;  3BJ6 A;  2R7V A;  1FX7 A;  1AU7 A;  4LOC A;  2M34 A;  2QCO A;  4BQA A;  3G6E I;  1IG7 A;  2PBI A;  3OYA A;  5FO5 A;  3CCU I;  2KIM A;  1G59 A;  4RLF A;  4ZYA A;  4PK4 A;  1LPQ A;  3T6N A;  3MFK A;  1U3E M;  1A36 A;  1TT0 A;  1DP7 P;  2E71 A;  2HOE A;  2LY9 A;  2O8X A;  4G12 A;  4DJA A;  1WKM A;  1KON A;  3I3L A;  3JRD A;  3DBH B;  4II3 A;  4IJA A;  3U9G A;  2G7H A;  2EV6 A;  3W6V A;  1F43 A;  2KIS A;  2PZ9 A;  1X3Z B;  2HQR A;  3GUD A;  2P0W A;  4N9I A;  4F55 A;  1LEB A;  2ZCM A;  2A6E F;  2JPB A;  1MD0 A;  3GTK J;  3CF2 A;  1UHM A;  4HX4 A;  5DDG A;  2COB A;  2D2W A;  2LDU A;  2LG4 A;  2NOJ B;  2CFX A;  1V5E A;  2DT7 B;  3RD3 A;  2FJI 1;  2I10 A;  4ZTJ A;  2Q2E A;  1O3S A;  2OQR A;  3VFZ A;  3EGQ A;  2JA5 J;  2BVL A;  4JX5 A;  3HBL A;  3VEP A;  1YW7 A;  2HTS A;  2ME6 A;  5JR3 A;  1ETX A;  2M0C A;  3O3K A;  3S1M J;  1RPW A;  4KN4 X;  3I59 A;  2HNH A;  5FMP A;  2XVC A;  4HX8 A;  4L5J A;  5EEH A;  3RYR A;  4DZP A;  5E3N A;  2VBY A;  2M87 A;  2DFH A;  4A12 A;  4OD4 A;  1WI9 A;  4AIH A;  4XLP F;  2ZSI B;  2Z2S B;  2DMQ A;  3M3Y J;  3C1D A;  2CG4 A;  2EZI A;  3BR3 A;  5AIQ A;  1TQP A;  4B47 A;  2QQA A;  2R5Z B;  1I50 J;  1YHQ I;  4V2G A;  4AYB A;  3GZI A;  4RAF A;  1WQ2 A;  1IW7 F;  2VQC A;  2EFO A;  2X9D A;  5L3F A;  1U8R A;  1LVA A;  1R4M B;  1I6H J;  4ESB A;  1VTN C;  2PLY A;  1Z6T A;  3G71 I;  1MBJ A;  2VKV A;  2RN7 A;  4OIR F;  2LBF A;  3PL8 A;  4NC7 A;  5FLX Z;  1X1C A;  4PJN A;  1JJ8 C;  3F8B A;  1KQ8 A;  2XAJ A;  4PJL A;  4U0V A;  1X1D A;  4IOC F;  2HR3 A;  4XOP A;  2OTJ I;  1R5G A;  3PUB A;  1GHC A;  4QPO A;  3MCZ A;  1TT5 B;  1HBX G;  4JK1 X;  2UXO A;  3I64 A;  3GFM A;  1P4W A;  3FXU A;  3GW2 A;  1ZRC A;  3H0D A;  3PNV A;  3IUV A;  3LWF A;  3ZRG A;  3BG6 A;  4B43 A;  3BG9 A;  5B66 C;  2V1U A;  3AG2 H;  1H9T A;  2P7C B;  3DBL B;  1LQ1 A;  4C3H J;  4I99 C;  4JL3 A;  4JQF A;  3RKX A;  2DYR H;  3I71 A;  3T1B A;  2DLL A;  1XS9 A;  4HQM A;  1FOW A;  4M3E A;  3V7S A;  2NOG A;  2BY2 A;  3OMY A;  3TW6 A;  2QM3 A;  2CWE A;  4EJO A;  2HS5 A;  5AIP A;  3V6G A;  1YW8 A;  2A6T A;  2D45 A;  2VKE A;  2Q2E B;  4XL9 A;  3OYH A;  1O3T A;  1IN8 A;  4RB3 C;  3O2P E;  2ZJQ F;  2CYY A;  1HC8 A;  1R1T A;  2LR8 A;  3MEX A;  4D5C A;  2XPU A;  5EDN A;  3C07 A;  4ZZL A;  4HDU A;  3J7A Y;  2Y9Y A;  2NXN B;  3GXO A;  4GFL A;  3TGN A;  1IC8 A;  1QHG A;  1X1A A;  2AXT C;  2YU3 A;  4JOM A;  3WHB A;  3BTL A;  3P9T A;  1HDP A;  4BXU A;  1W36 D;  1U9N A;  2BY0 A;  3F6V A;  3SFZ A;  4RDU A;  1LE8 A;  1F1Z A;  3VW1 A;  5GTH C;  2R92 J;  1BL0 A;  1JGS A;  1APL C;  1RNL A;  1YO5 C;  5C4X J;  3SWH A;  1QVT A;  4UB6 C;  3BT9 A;  2NYX A;  4NC8 A;  1NK3 P;  2KRC A;  2K7L A;  3K4M A;  1ZLK A;  3AL0 C;  2EIJ H;  3NPI A;  5CJ9 A;  1W0U A;  4KIB A;  3LJL A;  3PIP F;  1R36 A;  2OV7 A;  4F93 B;  3WTT C;  2NVT J;  2CO5 A;  3I53 A;  1BR1 A;  1T95 A;  4AYB N;  3FM5 A;  3CME I;  1J75 A;  1DPU A;  4XOR A;  1VQ4 I;  2LSO A;  3FXQ A;  1IDY A;  5CLS A;  2DA4 A;  3H35 A;  3WHC A;  3J81 Z;  4RGU A;  4CUG A;  4OAZ A;  1ZKG A;  1XD7 A;  1W7P D;  5ILV A;  2X4H A;  2HXI A;  3CC2 I;  1R4N B;  5FLV A;  2XUB A;  3RI4 A;  4QPQ A;  1J09 A;  1JTX A;  4NEL A;  4HOB A;  3CUQ C;  5E1W A;  5K5O A;  4UVC A;  4A0Z A;  3BTC A;  2V6C A;  4KT5 C;  4B1R A;  2VOD A;  5IYC J;  4WXC A;  2H94 A;  2O5R A;  1W5T A;  2B3W A;  3IAS 2;  1D1C A;  4CYD A;  5J4Y A;  3PNT A;  5KAI C;  3CF5 F;  2RKH A;  2VC0 A;  3ON2 A;  3NRG A;  4PFP A;  2HXO A;  1B72 A;  1C0W A;  5D8K B;  4LG0 B;  3CP2 A;  4FE7 A;  1T08 B;  2ZJR F;  1O7L A;  2K9M A;  2X51 A;  3ISP A;  5B1B H;  1R49 A;  4M6X A;  2HGC A;  3HHG A;  2EA2 A;  1ZLJ A;  2M3A A;  3QU6 A;  1SFU A;  3R0A A;  1JKQ C;  3FRQ A;  5BQT A;  2G7S A;  1A31 A;  2K02 A;  2LY1 A;  3LAJ A;  1VQK I;  2JA2 A;  2MC3 A;  4FE4 A;  5HDK A;  5IT9 K;  3WOD F;  2XRL A;  5IT9 Z;  2HWV A;  2DJN A;  2H6C A;  2JMW A;  3AQT A;  4UVB A;  5E3M A;  2ZNZ A;  1QQI A;  3S2W A;  4IZZ A;  4UUS B;  1QU3 A;  2M5W A;  3FZV A;  3AKZ A;  3BCB A;  4IOA F;  2MW8 A;  2EZL A;  1XMX A;  4KWA A;  2A69 F;  3IWZ A;  4BY7 J;  2DDB A;  4BU2 A;  3G2B A;  3B6A A;  2WY8 Q;  3HSF A;  2IS1 A;  4ETS A;  2NNN A;  2M7A A;  3F8N A;  1FOK A;  3OSF A;  3CC7 I;  3LL7 A;  1N78 A;  3MVP A;  2KJB A;  1SD7 A;  2X1E A;  5JLX A;  2P5K A;  3I55 I;  2LLK A;  3GF2 A;  3EUH A;  3PUF A;  5GP9 A;  4CYC A;  4ICH A;  1R23 A;  1R00 A;  5J4V A;  4YFN F;  3IH3 A;  2ZOY A;  3ESW B;  1ZRE A;  5A2Q K;  3D1N I;  4XQF A;  2HTJ A;  1UI5 A;  4MEY F;  3DEW A;  1UFM A;  3DP7 A;  4RAY A;  4B3X A;  2DT5 A;  2QQ9 A;  2WAF A;  1BJA A;  2XB5 A;  4I7H A;  1HW1 A;  3HOY J;  1ZG1 A;  2KJC A;  3CWR A;  2BHY A;  2CSO A;  3SFI A;  5JHU A;  1S3J A;  1G8X A;  3K2Z A;  3KYC B;  4UHT A;  1MJB A;  2BHZ A;  2FNP A;  1W7P A;  4YII A;  3JTG A;  1V5F A;  3HXL A;  2OBP A;  3TO9 A;  3FIW A;  5F1J A;  3FK6 A;  1D8K A;  3PQK A;  4UXN A;  4A0X A;  2W00 A;  2BV6 A;  4OIN F;  2X48 A;  1LB2 A;  1ORK A;  1ZTR A;  4HSR A;  3GTO J;  1G3W A;  2P5L C;  3RKQ A;  1K4T A;  2CQN A;  3RJP A;  4EJU A;  2BGC A;  2VON A;  4ESJ A;  3CZ6 A;  2D6Y A;  1MIJ A;  1VQO I;  4V2F A;  3RZD J;  1U5T A;  1WVR A;  2PJR A;  3ULQ B;  2B1E A;  1J9I A;  3W6K B;  1I1G A;  2WA0 A;  4LGW A;  3L7W A;  3A02 A;  2GZW A;  1F4K A;  3EYY A;  5C4Y A;  2L7M P;  3KZZ A;  3O8G A;  2OCC H;  5E1X A;  3HOZ J;  1SEU A;  3HPH A;  1V4R A;  2IAI A;  1R71 A;  2FXA A;  1XMK A;  1U9O A;  2M9H A;  4A5N A;  1PYV A;  3ASN H;  2XPV A;  2IGO A;  1MH3 A;  3T8T A;  5FD6 A;  1HKT A;  2NS7 A;  2J5P A;  3PAS A;  3IL2 A;  4GYI A;  2R7R A;  5E8I A;  2HDW A;  2DG7 A;  2DMN A;  1X3U A;  2HKX A;  2L3D A;  4CYC B;  1YX3 A;  3HIM A;  1MBE A;  3DTI A;  5M5W J;  2B63 J;  4BJ5 C;  2VPR A;  3H5R A;  3P9C A;  3GFL A;  3M8F A;  2JVG A;  3F8C A;  3BP8 A;  4JX4 A;  1WJB A;  3LSK A;  1OQY A;  2E1O A;  3EYI A;  3R61 A;  2DTR A;  1AWC A;  1I5Z A;  4IVN A;  3TMO A;  1MZB A;  3H5A A;  2Y0M A;  4CGR A;  2GLO A;  1W7P B;  4Y4R A;  2JRM A;  2X6O A;  2FD5 A;  2BBY A;  2BE5 F;  4G6D A;  5FJ8 J;  1OCP A;  4ENJ A;  3B02 A;  4RM2 A;  2E7X A;  2H1K A;  2QBY B;  1BW5 A;  1G2H A;  5D6E A;  5F0F A;  2CW8 A;  1STZ A;  4L0Y B;  4PDK A;  3C18 A;  1RUN A;  5JHF A;  2YS9 A;  3S3M A;  4XN3 A;  1ZEL A;  1W1W E;  2CV1 A;  5FRO A;  1WJE A;  3ZOB A;  4MNU A;  2FU4 A;  5HS7 A;  3I5U A;  5D4R A;  4CCN A;  1EA3 A;  4CCJ A;  2NS0 A;  3IUO A;  4HNU A;  4BKX A;  1WRJ A;  2EK5 A;  2L7K A;  2OER A;  1IO2 A;  3ABT A;  3FXL A;  5DEQ A;  4B4C A;  3WTU C;  5CXG A;  3Q5F A;  4ZYE A;  2ZNY A;  4M9X A;  2GXA A;  1UJ8 A;  3T5X A;  2L9N A;  1PP7 U;  4EM1 A;  4M9S A;  1IUF A;  4P1W A;  3M07 A;  1YJN I;  3UKG A;  4XMY A;  2XAQ A;  3DPL C;  5FKM A;  1XTA A;  2VAS A;  3RTR A;  2K27 A;  1TL8 A;  2V9K A;  1KU2 A;  1EH8 A;  1T0F A;  2FJ1 A;  1MJA A;  5E1Z B;  4NQW A;  3CTA A;  1BR4 A;  3CCV I;  3A03 A;  4KIS A;  2G9W A;  1EF4 A;  3BG7 A;  2AS5 F;  3HTH A;  2WUI A;  1YIO A;  4LJZ F;  3B6C A;  3ZN0 A;  3BR5 A;  4C2M J;  3BJO A;  3HJE A;  1Y56 A;  4WXH A;  2HQ5 A;  1OYY A;  3DWL E;  4XSX F;  2JK3 A;  4CCM A;  1ZN2 A;  5BMZ A;  1FNN A;  3HTS B;  2R93 J;  2ZCW A;  3HUG B;  3ERM A;  2EB7 A;  3CCJ I;  3ZQL A;  4LLL A;  4UVA A;  3CJT B;  1A5J A;  2Z16 A;  1U78 A;  4I01 A;  4ME9 A;  1P7J A;  4JKZ A;  5ED4 A;  1WHU A;  1R7J A;  2AHQ A;  2COM A;  3FX3 A;  2CW7 A;  2E2H J;  2GWR A;  1BN5 A;  1XN7 A;  2W85 A;  3N05 A;  3BNI A;  5HNF A;  3J80 K;  2UUZ A;  2EFP A;  2O7T A;  2GBY A;  2XF5 A;  3BLY A;  5FRN A;  3I4N J;  4NNJ A;  4EGZ A;  3CD6 I;  1MBK A;  5LGT A;  2W7N A;  2GM4 A;  1IN7 A;  1D5Y A;  2GOX B;  2NVX J;  1CQT A;  2VE8 A;  1TW2 A;  4A6D A;  1YJW I;  5CVV A;  2Y75 A;  2QGU A;  3HSE A;  1REP C;  1VQL I;  3BRO A;  5M3M J;  4HRI A;  4ESF A;  3QKX A;  3KFW X;  4C3J J;  4B44 A;  4X6A J;  2P6T A;  2VI6 A;  3JRF A;  1TWA J;  4XBF A;  3TP3 A;  2QQB A;  2DFI A;  1CF7 A;  2QF7 A;  4HW0 A;  3W3C A;  2VN2 A;  3PM1 A;  5KHD A;  1MBF A;  2F5F A;  2O03 A;  1MNE A;  4Q47 A;  1G6N A;  5D5X B;  3R0J A;  3IH2 A;  3U21 A;  3LSH A;  3OYE A;  3G73 A;  1SFO J;  3GFJ A;  2E35 A;  1EV7 A;  4MFD A;  5H9T A;  2DCE A;  1FLI A;  1YQA A;  1ETW A;  2Y31 A;  4BE0 A;  2QSG X;  1P7I A;  1OIS A;  2GQQ A;  1SGM A;  3E6C C;  2CH0 A;  2PJP A;  4DZJ A;  5FKL A;  1MND A;  2I5U A;  4BY1 J;  2ID3 A;  1QZZ A;  3OL4 A;  2PG4 A;  4Q48 A;  3IRR A;  2AQF A;  4J19 A;  3GTL J;  1KQ0 A;  4LLG F;  4A3D J;  2PMU A;  1YG2 A;  2Z99 A;  3PO2 J;  2ACJ A;  4KIC A;  1JXS A;  4AM3 A;  2RRE A;  3RH2 A;  2H09 A;  3KYD B;  5E18 F;  2A3S A;  4PSW A;  1QNT A;  3D0S A;  3E5Q A;  1B9N A;  2XSJ C;  2E5N A;  3E6D A;  4M3F A;  2X1C A;  3VSL A;  2VB6 A;  5CVJ A;  1OCC H;  3GVA A;  2DMT A;  4LG3 A;  2OU2 A;  3LFU A;  3ZQG A;  3CLQ A;  2R4G A;  3HOT A;  4DYR A;  1JKR C;  1ODD A;  1YE9 A;  1Z77 A;  4BUP A;  1TWG J;  3WTX C;  4CIC A;  2AO9 A;  5HLT A;  4BHB A;  1DDN A;  4BH9 A;  3K6G A;  4M71 A;  1JE8 A;  3ZMD A;  3WG7 H;  1VQ7 I;  4MTE A;  2O61 A;  4NB5 A;  5ICF A;  2MLK A;  3C3W A;  1NG6 A;  2WTE A;  3LSM A;  2PMH A;  2F6C A;  2UWM A;  4P5O A;  4BQN A;  2CUZ A;  1U6G A;  5IPA A;  4LB5 A;  3NAU A;  1FP2 A;  2IVM A;  3L2W A;  1CGP A;  4PXI A;  3D5R C;  5HLG A;  5EJC A;  4EJT A;  2KP6 A;  1XPX A;  2G7L A;  4RAG A;  1EKE A;  3P9K A;  3CLO A;  1OCT C;  2XGC A;  2DMU A;  2XRO A;  2E1N A;  1CF7 B;  2LMD A;  3LQR A;  4MGR A;  2L02 A;  3H1C A;  5LLQ A;  1G3Y A;  5LRS A;  2CQX A;  3F6O A;  4WWC A;  2KHM A;  4AUX A;  1WSU A;  4BQO A;  2W82 A;  1ZYR F;  3U1K A;  3WE2 A;  3OYB A;  2TDX A;  3S17 J;  4GCK A;  1OCZ H;  1Z21 A;  5J6X A;  1S7A A;  3ROU A;  2XB0 X;  1GV5 A;  1B59 A;  5F08 A;  1TLH B;  5DYM A;  2ADU A;  3R4K A;  1QRY A;  3FKJ A;  1FJL A;  3BG3 A;  1B9M A;  1DP3 A;  4GO1 A;  3NAR A;  3H5N A;  1QHH D;  3FMS A;  4WXD A;  4CA0 A;  1K6Y A;  3S15 J;  4QLC U;  2V1D A;  3BZK A;  1MDM A;  1X3W B;  2PMZ A;  4ZDO A;  2VT3 A;  4HPQ A;  3JRI A;  3S2D J;  4Y15 A;  9ANT A;  2YPR A;  4QIW N;  2ZY9 A;  5DCF A;  3NQO A;  3TO6 A;  5HDN A;  3S32 A;  5E3O A;  3F0C A;  3OYI A;  3CCM I;  1ZR4 A;  4LLN A;  2ZOZ A;  2GIV A;  3J7Z I;  2NX4 A;  5JVT A;  3CDH A;  2O0Y A;  3WG9 A;  1TWF J;  5K7Z A;  1N75 A;  3OR1 C;  3D5L A;  3QPS A;  1BBY A;  3HRU A;  4BHP A;  5M3F J;  2DA7 A;  2HPI A;  5K7F A;  3SZG A;  3BCG A;  1NTC A;  4XSZ F;  4HST A;  2TCT A;  3MNL A;  5KNL A;  1D5V A;  1QA6 A;  3IHU A;  4XLF A;  1Z1D A;  3DEU A;  3ZQI A;  1SVO A;  1FZP B;  4E7J A;  4S04 A;  3HOW J;  5BPD A;  4Y13 A;  1E3H A;  4BL0 B;  2E36 A;  3MWM A;  2L4A A;  3F21 A;  1BIA A;  2EIM H;  4KDP A;  2HVR A;  1WWX A;  3O60 A;  3C7J A;  2O8K A;  2VXZ A;  1YIT I;  4N4N B;  3OYF A;  2Y48 A;  3AQS A;  4J01 A;  2CW0 F;  1TBX A;  4AD9 A;  2F5C A;  3V4G A;  3OIO A;  5LD2 C;  1ITY A;  4PJJ A;  5HOD A;  2FE3 A;  1IXR C;  2JT1 A;  2NVY J;  1WPK A;  3MMY B;  1MMA A;  4BHC A;  1XGN A;  1JUM A;  5J40 A;  3GLX A;  2VLA A;  2CQ7 A;  2M45 A;  2Q24 A;  4BJT A;  3KLO A;  1YS6 A;  3DXJ F;  5HLI A;  1IZ1 A;  4EEF G;  1ZRF A;  1R5I D;  1WH7 A;  3GEZ A;  3NEU A;  2H8R A;  1IAW A;  4IHT A;  2OQG A;  4XKW A;  5J1U A;  4FAS D;  1IN5 A;  1T0F C;  4FX4 A;  2C6Y A;  5K58 A;  2XSD C;  2KIQ A;  2FOK A;  2H8W A;  4CCK A;  1HOM A;  3JRH A;  1T38 A;  4IHS A;  3TBI A;  3SDB A;  5DUI A;  1XSX A;  2LRE A;  5LGN A;  3CJD A;  4G6T B;  3HG9 A;  1IXC A;  1MDM B;  3SQN A;  3S93 A;  5H6Q A;  2H1L A;  1RRJ A;  4ZZD A;  2PFV A;  5CQE A;  4G6Q A;  2A2F X;  1Y8R B;  4YFK F;  2OJE D;  3R6S A;  1YTY A;  2CU7 A;  5FFX A;  3M8J A;  1UHW A;  3NI7 A;  1XGS A;  5CPR B;  2HDC A;  2X6W A;  4II2 A;  3E5X A;  2KL4 A;  4X1E A;  1ZAR A;  3Q9S A;  4ASN A;  4IRG A;  2PMZ N;  2FSW A;  2YU9 J;  2L7Z A;  4J00 A;  1ZHF A;  2K9L A;  1RUO A;  2QUF A;  3FXR A;  4IEJ A;  4XR6 A;  2IA0 A;  2MG4 A;  3RCO A;  2O9L A;  4ON0 A;  1Y39 A;  3JCU C;  5ERI A;  1VQ8 I;  2E34 A;  2J5O A;  3L00 A;  3F9K A;  1RIO H;  4LG0 A;  5LGU A;  4RB2 C;  3WTW C;  2WAQ A;  4P55 A;  4XON A;  3QPT A;  5K5R A;  3VB2 A;  3K7A J;  3BQZ A;  2CQK A;  1BI2 A;  3DTE A;  3VSK A;  3SZT A;  1SFE A;  1P92 A;  4HAM A;  2HZD A;  2IS6 A;  2MD0 A;  1A04 A;  4F7Z A;  1DGR M;  2RQQ A;  1RZ4 A;  1BI1 A;  3K70 C;  4M3G A;  1Z6R A;  1FYK A;  1L0O C;  3BQY A;  5DS9 A;  1KYW A;  4M3B A;  3ANP A;  2K9Q A;  3CDI A;  2A07 F;  3B73 A;  4CSW A;  4AIJ A;  1ENH A;  3BJA A;  1K78 A;  3BHQ A;  4UUS A;  2KPM A;  2YX7 A;  4A3J J;  1E3O C;  3RKY A;  5ILU A;  1SD4 A;  5GTI C;  5C44 J;  2QEN A;  3KP5 A;  4D5F A;  1H89 C;  5FKN A;  4IKF A;  3QPH A;  3UR3 C;  4XK4 A;  3C2H A;  1GV2 A;  3M4O J;  4BBS J;  5JVG F;  2F5E A;  5CKT A;  4A6E A;  3GX4 X;  1X2M A;  4H4K C;  2R3S A;  5LFA A;  1BC8 C;  3HL2 A;  4O5V A;  5CVI A;  5FKK A;  1IV6 A;  2BW3 B;  4AU7 A;  4CO8 A;  4EJW A;  1IUY A;  5HBU A;  1VI0 A;  3WGI A;  4HV5 A;  4G94 A;  3E5U A;  2DO7 A;  1XGM A;  4OAY A;  4PGH A;  3SYT A;  2FF4 A;  3JRE A;  2JZY A;  2VE9 A;  4E7Z A;  3RSN A;  1NK2 P;  3EPZ A;  5D5V B;  5TIS C;  5IY5 H;  1P4X A;  2ZSH B;  2GAU A;  4P9U A;  4MQ9 F;  3K4N A;  4YFX F;  3N4M A;  3OYM A;  1GDT A;  1JJ6 C;  2NP5 A;  2V9V A;  2JTV A;  5E20 A;  3JSP A;  3JRB A;  4HF0 A;  4XRF A;  4MLO A;  3OS1 A;  1PUF A;  2ZCN A;  1Y8Q B;  1MW7 A;  2A61 A;  4AVZ A;  4HZF A;  1VFC A;  1IRG A;  3I58 A;  5CW8 A;  1M1E B;  2M4K A;  3DLA A;  4IL6 C;  2ZO4 A;  3GFI A;  1DGW Y;  2R7F A;  4HLY A;  5LHH A;  2FQ4 A;  4KMU X;  5BS6 A;  4CZC A;  2LKX A;  2DPD A;  5FKO A;  1VND A;  1R22 A;  1FT9 A;  3L09 A;  5BPI A;  3FIS A;  3LA3 A;  2VBX A;  1GT0 C;  3GTG J;  4FT8 A;  1KGS A;  2FNA A;  2EFN A;  3PJR A;  3ASO H;  2DFF A;  2M4G A;  2A5W A;  2QSF X;  5L3B A;  3IAM 2;  3GZN B;  1E0E A;  1R58 A;  3GEU A;  2WAQ N;  3BJB A;  5CXI A;  2QZ8 A;  3VYS B;  5F0C A;  3A2K A;  3H9G A;  4QSH A;  2XAG A;  3GZ6 A;  3DBR B;  5EFY A;  3CDL A;  2JSP A;  2F48 A;  2KIU A;  4BDY A;  2OAZ A;  3C2G A;  3PFI A;  4N4O B;  2IGM A;  4CXF A;  3HEF A;  3WU0 A;  4KIT B;  1K78 B;  2ZXH A;  5F1R A;  3WTV C;  3VYU B;  3HRS A;  4B8X A;  2FBK A;  1LDJ A;  3MKL A;  1R1U A;  1T2K A;  2L0K A;  5DV5 A;  2Q8K A;  3JRG A;  4BYY A;  3RDI A;  2G3B A;  2XAF A;  2GA2 A;  5HNH A;  2DOD A;  5J47 A;  1IGN A;  4BXX J;  3TED A;  4G7O F;  1BOB A;  2YUS A;  3AFH A;  4OIQ F;  1IN4 A;  5HSZ A;  3M7G A;  3KP2 A;  3O8H A;  1POG A;  2HQN A;  3CP8 A;  2MH2 A;  1JT0 A;  2WBM A;  1KYZ A;  4A2U A;  4HNV A;  4C2M A;  2JVH A;  1D0Y A;  4HA8 A;  1BI0 A;  4GXO A;  4AC0 A;  4B09 A;  3QYF A;  2UXI A;  1XDU A;  4GCT A;  4G7Z F;  1O7F A;  3AG1 H;  3E6B A;  1O3Q A;  1FMW A;  5GAE J;  2FBI A;  5A2Q Z;  2G7U A;  4KA4 A;  3E1S A;  4ITV A;  2FA5 A;  4IF4 A;  1HF0 A;  2VJJ A;  3BPX A;  4E70 A;  5L3E A;  1IJW C;  5EEA A;  1PUF B;  2EV5 A;  3QWL A;  3S1R J;  1UHS A;  3RPQ A;  5ILS A;  2JUG A;  2KDO A;  3T0Y A;  4FIS A;  1X1B A;  3D5S C;  3H36 A;  1Z05 A;  4GYG A;  4XRS A;  5TRD A;  1PUE E;  3WTZ A;  3DQV C;  2QBY A;  2PN6 A;  3P7N A;  4N0B A;  4MIM A;  3E7Q A;  2ZXW H; 
#chains in the Genus database with same CATH homology
 3RQI A;  1A5J A;  2R5Z A;  3Q0W A;  3HB9 A;  4ABZ A;  1WGX A;  1U78 A;  4ME9 A;  2XGE A;  1P7J A;  3LOC A;  2REK A;  4JKZ A;  4I6Z A;  2R7Z J;  2AHQ A;  1LFB A;  4BBR J;  1JGG A;  5E3L A;  3JR9 A;  2WB1 N;  2E2H J;  3LSJ A;  2MSY A;  3BNI A;  4W1U A;  4Y52 J;  1AU7 A;  4LOC A;  5D1R A;  2O7T A;  2M34 A;  2QCO A;  3KNW A;  2GBY A;  2E2I J;  3I4N J;  4IHX A;  2ME0 A;  1IG7 A;  1DU0 A;  1MBK A;  2XGD A;  2GM4 A;  1D5Y A;  1HDD C;  2GEN A;  3T6N A;  2NVX J;  1CQT A;  3QPL A;  1JKO C;  2LY9 A;  4G12 A;  4DYQ A;  2GFN A;  4JX6 A;  4AF5 A;  1DU6 A;  5M3M J;  2M2E A;  3JRD A;  2JJ7 A;  4A3F J;  3QKX A;  4C3J J;  3KKC A;  4X6A J;  2VI6 A;  4JYK A;  3BR6 A;  5EZH A;  1ETY A;  3JRF A;  2E19 A;  3W6V A;  1TWA J;  1ETQ A;  1F43 A;  2PZ9 A;  3TP3 A;  3L1P A;  2KT0 A;  4XRS G;  2ZCM A;  1MBH A;  3GTK J;  2G0E A;  2QF7 A;  4D7N A;  3PM1 A;  1MBF A;  2LTP A;  2P81 A;  2COB A;  1MSE C;  3IH2 A;  1SFO J;  2DA2 A;  2G7G A;  1JTY A;  2WV1 A;  4MFD A;  2HOA A;  5H9T A;  3RD3 A;  5EG0 A;  1ETW A;  2I10 A;  2Y31 A;  4QTR A;  1P7I A;  1XG1 A;  4S0H B;  4A3B J;  1SGM A;  4DZJ A;  2ZCX A;  5FKL A;  3JRC A;  4BY1 J;  3EGQ A;  2ID3 A;  2JA5 J;  4DYC A;  4JX5 A;  3HBL A;  2QOP A;  4J19 A;  1O4X A;  2ME6 A;  1ETX A;  3GTL J;  4A3D J;  2M0C A;  3LSP A;  5IYD J;  3PO2 J;  1MNM C;  3S1M J;  1RPW A;  3HOU J;  5FMP A;  4GFK A;  3RH2 A;  3S5R A;  4L5E A;  5E3N A;  4DZP A;  3JRA A;  1ETV A;  4B3A A;  2DMQ A;  3H3V K;  3M3Y J;  3G1M A;  4M3F A;  2EZI A;  3BR3 A;  2YVH A;  2UXH A;  2R5Z B;  3OSG A;  2Y9Z A;  1I50 J;  1W0T A;  4V2G A;  3GZI A;  2DMT A;  2X9D A;  3BR1 A;  3ZQG A;  2CRG A;  1JKR C;  3BG5 A;  4DYR A;  4A3C J;  1TWC J;  1T33 A;  1Z77 A;  1I6H J;  1AHD P;  1TC3 C;  1TWG J;  1FIA A;  1B8I B;  2AO9 A;  1MBJ A;  2VKV A;  1JKP C;  1BW6 A;  1A6I A;  4GCL A;  1JJ8 C;  3PO3 J;  3HGG A;  3LSG A;  5K7H A;  1JUS A;  2HOS A;  2UXP A;  3VVZ A;  1Q1V A;  4YZE A;  1LE8 B;  2VUM J;  1X58 A;  2UXO A;  2L7F P;  2NVQ J;  3IUV A;  3TP0 A;  2Y2Z A;  5IPA A;  3GTP J;  3KKD A;  3NAU A;  3BG9 A;  1JT6 A;  3E7L A;  3GTJ J;  1HCR A;  1XC5 A;  4PXI A;  4C3H J;  2G7L A;  4JL3 A;  2W53 A;  2KDZ A;  1OCT C;  2XDN A;  1WH5 A;  2XGC A;  2JA8 J;  2DMU A;  1XS9 A;  3VOK A;  1UMQ A;  3MN2 A;  4M3E A;  2NOG A;  3VIB A;  3TW6 A;  3IV5 A;  2RAE A;  3V6G A;  2CQX A;  2HI3 A;  5IOZ A;  5EG0 B;  2VKE A;  4AUX A;  3S17 J;  2QTQ A;  3HTI A;  4GCK A;  2YVE A;  1OJL A;  3KZ9 A;  2GUH A;  3LHQ A;  2XB0 X;  1GV5 A;  1T56 A;  4XID A;  1FTT A;  5F08 A;  2CUE A;  2LD5 A;  2DA5 A;  2LR8 A;  3RZO J;  3PPB A;  1QRY A;  2XPU A;  4D5C A;  5IP6 A;  3BG3 A;  5EDN A;  1B8I A;  1FJL A;  3QQA A;  4Y7N J;  1GUU A;  3NAR A;  3C07 A;  3G1O A;  3S15 J;  3VW2 A;  3QBM A;  3ZQF A;  2Y9Y A;  3S1N J;  3COL A;  4GFL A;  3Q0U A;  3FK7 A;  1IC8 A;  1ZR2 A;  3WHB A;  5F0H A;  3JRI A;  3BTL A;  3S2D J;  9ANT A;  1B72 B;  1HDP A;  3P9T A;  4QIW N;  1Y1V J;  1K61 A;  2R0Q C;  1U9N A;  1Y1W J;  1LE8 A;  3VW1 A;  4RDU A;  5D18 A;  1QPI A;  2R92 J;  5E3O A;  3F0C A;  1ZK8 A;  1ZR4 A;  1BL0 A;  1APL C;  2MGQ A;  1ZQ3 P;  2ZOZ A;  2O7O A;  2NX4 A;  3VP5 A;  2RHA A;  5C4X J;  1QVT A;  5EZG A;  1TWF J;  3BT9 A;  2W48 A;  1NK3 P;  2Y0S N;  5K7Z A;  3CMY A;  4A3G J;  3NPI A;  3IH4 A;  1W0U A;  3LJL A;  3QPS A;  5M3F J;  1YRN A;  4MK6 A;  3VOX A;  2DA7 A;  2ELK A;  5K7F A;  5M5Y J;  5EYR A;  2NVT J;  3BCG A;  1NTC A;  2TCT A;  3MNL A;  4HKU A;  4AYB N;  2D5V A;  3VW0 A;  2K9S A;  3ZQI A;  3HOW J;  4MFE A;  3NNR A;  1IDY A;  5IYB J;  2DA4 A;  3WHC A;  2LVS A;  3VVY A;  1Z0X A;  1ZKG A;  2K9N A;  2R5Y B;  3O60 A;  4A3I J;  2IBD A;  2ECB A;  2HXI A;  2LP0 A;  2O8K A;  2Y30 A;  5FLV A;  4AC6 A;  2DG8 A;  3AQS A;  1ITY A;  1JTX A;  3OIO A;  2JN6 A;  4NEL A;  5HOD A;  2NVY J;  1WPK A;  3S16 J;  2HDD A;  4XIC A;  4IHW A;  2CJJ A;  3BTC A;  2TRT A;  4B1R A;  5JLW A;  3HKZ N;  1JUM A;  5IYC J;  4RBO A;  3NXC A;  1F36 A;  1RKT A;  2Q24 A;  5F27 A;  3BR2 A;  3ON2 A;  3NRG A;  2HXO A;  2EH3 A;  1B72 A;  4EEF G;  5C4J J;  1WH7 A;  4FE7 A;  2H8R A;  1LFU P;  1MH4 A;  2XPW A;  1FIP A;  2NS8 A;  5J1U A;  3TW7 A;  2CQQ A;  5K58 A;  2XSD C;  3S1Q J;  1OFC X;  2HYT A;  3GTM J;  1HOM A;  3JRH A;  1WI3 A;  1JKQ C;  3FRQ A;  1BJZ A;  3F1B A;  2RAS A;  2G7S A;  4M6V A;  4C3I J;  3CJD A;  1RET A;  3CRJ A;  1SAN A;  5AQC A;  4FE4 A;  2L9R A;  2XRL A;  2DJN A;  3AQT A;  2JMW A;  3CQZ J;  3HTA A;  2CU7 A;  5E3M A;  4NDL A;  4XRM A;  3NI7 A;  4JP0 A;  1JUP A;  4UUS B;  3BTJ A;  2N8G A;  2R5Y A;  4X1E A;  2MW8 A;  2EZL A;  1IDZ A;  4KWA A;  3H0G J;  2PMZ N;  4BY7 J;  2YU9 J;  3B6A A;  2L7Z A;  2HKU A;  2PBX A;  1RKW A;  2EBI A;  4IEJ A;  3OSF A;  1YRN B;  2DN0 A;  2MG4 A;  4IHV A;  3MVP A;  1IRZ A;  2O9L A;  5F04 A;  3VVX A;  5JLX A;  2LLK A;  3A01 A;  3HOV J;  3DCF A;  2FBQ A;  4DW6 A;  2IU5 A;  5GP9 A;  4CYC A;  4ICH A;  3IH3 A;  2ZOY A;  3ANG A;  3D1N I;  3BRU A;  1UI5 A;  5GPA A;  3K7A J;  3BQZ A;  3DEW A;  3LWJ A;  1FTZ A;  2LFB A;  4FTH A;  2XB5 A;  3HTJ A;  1ETO A;  3HOY J;  3CWR A;  3SFI A;  4UUT A;  2EZK A;  4M3G A;  5EGO A;  5FGL A;  5DAJ A;  3BQY A;  3VPR A;  4A93 J;  5DS9 A;  4M3B A;  3ANP A;  2K9Q A;  3FIW A;  5F1J A;  3FK6 A;  3HDD A;  2HYJ A;  2ECC A;  1ENH A;  2UXU A;  3BHQ A;  2QKO A;  2X48 A;  4UUS A;  5HAW A;  1ORK A;  1ZTR A;  4A3J J;  1E3O C;  4MO7 A;  3GTO J;  3RKQ A;  5C44 J;  3JSJ A;  4ACI A;  4IHY A;  3G7R A;  4D5F A;  1H89 C;  5FKN A;  2D6Y A;  4XK4 A;  1U8B A;  1GV2 A;  4V2F A;  3RZD J;  3M4O J;  4BBS J;  5M5X J;  3LSR A;  2EZH A;  5GPC A;  2K40 A;  2E2J J;  3V78 A;  1MSF C;  1X2M A;  3A02 A;  1HLV A;  3E7Q A;  5FKK A;  5C4Y A;  1IV6 A;  2L7M P;  2CUF A;  3O8G A;  5HBU A;  4D7M A;  1VI0 A;  3HOZ J;  2HOT A;  5J1Y A;  2IAI A;  2DA1 A;  3GTQ J;  3JRE A;  1NK2 P;  4A3E J;  1U9O A;  2M9H A;  1FEX A;  3HGY A;  3LNQ A;  1GDT A;  3ON4 A;  1JJ6 C;  3S2H J;  4UDS A;  2NP5 A;  2XPV A;  3JRB A;  2ZCN A;  1UG2 A;  1MH3 A;  3GBG A;  1PUF A;  4MLO A;  3PAS A;  2NS7 A;  1AKH A;  3EUP A;  3VUQ A;  1S7E A;  2WGB A;  1VFC A;  2ZB9 A;  5CW8 A;  1I3Q J;  3A01 B;  2M8G X;  2OPT A;  2DG7 A;  2DMN A;  2EQR A;  3C2B A;  3HOX J;  1ETK A;  4CYC B;  3HIM A;  1MBE A;  2FQ4 A;  2LKX A;  3B81 A;  2JA7 J;  5M5W J;  5FKO A;  2B63 J;  3G56 A;  1VND A;  2VPR A;  3FIS A;  2V57 A;  1GT0 C;  3GTG J;  3HE0 A;  2NP3 A;  4JX4 A;  1X2N A;  3ZQH A;  2E1O A;  3G1L A;  3Q3S A;  3GEU A;  1WCM J;  4CGR A;  5C3E J;  2GLO A;  2WAQ N;  1BA5 A;  3BJB A;  5CXI A;  2ID6 A;  1H8A C;  2X6O A;  3Q0V A;  5EGO B;  1GVD A;  2FD5 A;  5F0C A;  5EFY A;  4QSH A;  3SDG A;  1OCP A;  5IOY A;  5FJ8 J;  2H1K A;  4GFB A;  2JA6 J;  3CDL A;  1BW5 A;  2DA6 A;  1G2H A;  5F0F A;  4L62 A;  3HEF A;  2YS9 A;  1K83 J;  3DPJ A;  4M3D A;  2QWT A;  4JNN A;  3CCY A;  3ZOB A;  5J3L A;  2DA3 A;  2FX0 A;  5EF6 A;  3ZQC A;  3I4M J;  3MKL A;  2L0K A;  4BKX A;  5D19 A;  4I76 A;  3FKI J;  3JRG A;  2OER A;  1MBG A;  5IP9 J;  1H88 C;  5BNG A;  2G3B A;  4B4C A;  5CXG A;  1IGN A;  1UI6 A;  4BXX J;  3TED A;  2OI8 A;  5J1R A;  2YUS A;  5HSZ A;  3OOU A;  3SJM A;  4NN1 A;  1RR7 A;  3BR0 A;  3O8H A;  1POG A;  1IUF A;  4A3K J;  1JT0 A;  4HNV A;  5FLM J;  2IEK A;  1RES A;  3UKG A;  4AC0 A;  2UXI A;  2DMP A;  1TWH J;  5FKM A;  1R9T J;  4GCT A;  3K2A A;  4MXM A;  2QIB A;  2LK2 A;  2DTZ A;  2FJ1 A;  3BTI A;  2OF7 A;  1VF9 A;  3A03 A;  5FHP A;  1HF0 A;  1EF4 A;  3HTH A;  2WUI A;  3B6C A;  5DTD A;  1IJW C;  2F07 A;  4FCY A;  3BR5 A;  4A69 C;  4W97 A;  4A3M J;  5EEA A;  4C2M J;  3S1R J;  1PUF B;  1UHS A;  1ZGW A;  2HQ5 A;  2JWT A;  1AKH B;  4A3L J;  2JK3 A;  4FIS A;  4XRS A;  5IP7 J;  2R93 J;  3S14 J;  1QVU A;  4MIM A;  3HM5 A;  3ZQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...