5GP9A

Structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
193
structure length
193
Chain Sequence
KKKGPKYDQIIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDVLISLFQEKMGRFVDKIRSQMNEATDVEEKLKILVNMHFKQLAADHKLAIVTQLELRQSNTELRLKINEVLKGYLNLLDELLMEGKEKGYFFQELDTRLARQMIFGTLDEVVTNWVMKDCKYDLTALVKPVHQLLLGGLRHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of operator sites recognition and effector binding in the TetR family transcription regulator FadR.
pubmed doi rcsb
source organism Bacillus halodurans (strain atcc baa-125 / dsm 18197 / ferm 7344 / jcm 9153 / c-
molecule tags Transcription, dna binding protein
molecule keywords Transcriptional regulator (TetR/AcrR family)
total genus 81
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5gp9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5gp9A02
1PUFA 3G1MA 2EBIA 2IU5A 4CGRA 4A3GJ 1VNDA 5IP7J 1UI6A 2VKEA 1YRNB 4HKUA 3VW2A 3TW7A 2IEKA 1Q1VA 2R92J 5IYBJ 3O60A 3BR6A 4DYCA 1R9TJ 5IOZA 5E3OA 2M8GX 1UHSA 1W0UA 4JYKA 1FEXA 5F27A 2CUFA 4FTHA 3VW0A 3PM1A 2OF7A 3B6CA 4HNVA 1ZQ3P 5EG0B 3HOZJ 4ICHA 2VI6A 3GTKJ 2YVHA 1HDDC 1VF9A 1IDYA 2GLOA 2JMWA 1UMQA 2O8KA 1IUFA 2DJNA 1AKHB 3COLA 1ORKA 2EZIA 3O8GA 4XICA 1JT0A 3P9TA 3M4OJ 2QF7A 2HYTA 2DA4A 1IC8A 3VVZA 5F08A 3Q0VA 1O4XA 1JJ8C 3K7AJ 1JTYA 4RBOA 5F0CA 3ZQFA 3RZDJ 1OCTC 3S2HJ 3NRGA 2NS8A 3EGQA 1RKTA 1F36A 4BY7J 4IHWA 5IOYA 4BKXA 5GPAA 1HOMA 3BJBA 3D1NI 2NVTJ 4I6ZA 4BBSJ 5HAWA 4L62A 2O7TA 3VPRA 3A01A 1IV6A 2DA3A 3HOXJ 1MBFA 2FX0A 2QWTA 2GBYA 1IG7A 5GPCA 1H89C 2X48A 4MFDA 3HIMA 3FIWA 5EYRA 1HDPA 5EG0A 5EGOB 5D19A 2EZHA 1OFCX 5EFYA 3BG5A 3LSRA 2DA6A 4A3KJ 1JUMA 3L1PA 5FKNA 3M3YJ 3S14J 2ZOZA 3NNRA 2NVXJ 3HDDA 3G1OA 3IV5A 1FTTA 2REKA 2K9SA 3BR3A 3CCYA 2CU7A 2NX4A 3OSFA 2UXOA 5FKLA 2CRGA 3WHBA 4BXXJ 3VW1A 3BTIA 3MN2A 2KDZA 3F1BA 4UUSB 1CQTA 2R5ZB 2JA6J 1HLVA 2LK2A 3RKQA 3BG9A 4A3LJ 2F07A 1X58A 2H8RA 1E3OC 1ITYA 5F0FA 1MBKA 3SFIA 5FKKA 4BY1J 3IUVA 2OERA 1XS9A 2DMNA 1T33A 3HEFA 1U78A 3DCFA 4UDSA 2VPRA 2XSDC 3F0CA 3GTJJ 4D5CA 3LSJA 2ZCXA 5BNGA 5M3MJ 2DA5A 5JLWA 1SGMA 4MIMA 4AC6A 3QPSA 1JGGA 3BHQA 1Y1WJ 2FD5A 2W53A 1JJ6C 1IJWC 3CWRA 2YU9J 2N8GA 2OPTA 1ZKGA 3ZQIA 4GCTA 2IBDA 2QTQA 3C2BA 4XRSA 2RASA 3S1RJ 1B72A 4S0HB 2UXHA 2JK3A 1U8BA 1MNMC 3BNIA 2G7LA 3BQZA 2IAIA 2LVSA 5HBUA 2DA2A 2PMZN 2JN6A 4A3MJ 2Y9ZA 2R0QC 2G7GA 3BQYA 1ETWA 3VOKA 1GT0C 4AUXA 1DU0A 2XPVA 3CDLA 3E7LA 4W97A 1LE8B 2E1OA 5M5YJ 2L7FP 1TWFJ 2M34A 3HOUJ 2JA8J 1K83J 3I4NJ 3JRDA 2WUIA 5CXGA 2DN0A 5DAJA 4FE7A 2YS9A 5J1RA 3BTJA 1QPIA 2HOTA 3G56A 4JKZA 3GTOJ 4UUTA 1RESA 3IH4A 5FHPA 2EZLA 3KKDA 3QKXA 2ELKA 3RH2A 4J19A 3ZQCA 1BJZA 5EZHA 5IPAA 3S5RA 2LLKA 3GBGA 3BR1A 3Q0UA 4D7NA 4MO7A 1TWCJ 4GFLA 1LE8A 2M0CA 4M3BA 3S16J 2O9LA 2KT0A 2O7OA 1F43A 3TP0A 1WH5A 1HCRA 2WAQN 2CUEA 2K9NA 2XB5A 2JJ7A 2GFNA 2Y2ZA 5GP9A 2ZCNA 4IHXA 5DTDA 1I3QJ 1TWAJ 1IDZA 1MBGA 3HB9A 2ID6A 4CYCA 4DYRA 1AKHA 2LTPA 1ENHA 1MBJA 5FKOA 2R93J 2L9RA 2EH3A 1TWGJ 3SDGA 1GDTA 4NELA 3JR9A 2V57A 2XRLA 5IYCJ 4M6VA 1UG2A 4C3IJ 2R5YA 3AQTA 3OOUA 3FK6A 1YRNA 2Y0SN 4B4CA 3LNQA 1FTZA 2CQQA 5D1RA 3ZQHA 3JSJA 2P81A 3GTLJ 3WHCA 1JTXA 4MFEA 4DYQA 1Z77A 5FLMJ 4FISA 3H0GJ 1ZR4A 2FBQA 2ZOYA 2XPWA 3JRIA 1ETYA 3VOXA 4A69C 3RD3A 4PXIA 5CW8A 3E7QA 3OSGA 1W0TA 5CXIA 2XPUA 4LOCA 3IH2A 4GFKA 1MH3A 3LSPA 3FISA 5K7FA 3TW6A 1ETVA 3HKZN 3QPLA 5K7ZA 4AC0A 2Y31A 5E3NA 5C4XJ 2MSYA 2DMUA 1GV5A 2DA7A 2DG7A 3HTIA 5FMPA 1X2NA 1ETXA 3MNLA 3V78A 3CRJA 3JRCA 3JRGA 1VFCA 1OJLA 5C3EJ 2CQXA 2R5ZA 4EEFG 4D5FA 2XB0X 3JRFA 3PPBA 4FCYA 1AU7A 2HQ5A 1A5JA 4W1UA 3KKCA 3A02A 1RETA 1SFOJ 3G7RA 5H9TA 2JA5J 1EF4A 5J1YA 5J3LA 3UKGA 3QQAA 1RR7A 3BTCA 3O8HA 3VP5A 4V2GA 3HGGA 1FIAA 4JX6A 5DS9A 2AHQA 1Z0XA 2LP0A 3S2DJ 4QTRA 2E19A 2NOGA 4JNNA 1HF0A 5E3MA 3JREA 5FJ8J 2YVEA 3ON4A 3S1QJ 1A6IA 2VKVA 1ETKA 3GTQJ 2G3BA 4AYBN 2D6YA 4MLOA 3TP3A 5C4JJ 4M3DA 5JLXA 3HOWJ 5C44J 3S15J 1XG1A 1BW5A 2FQ4A 1MBHA 3Q3SA 3EUPA 3ON2A 2I10A 4IHYA 2XGDA 3GZIA 2RHAA 3RZOJ 3NI7A 4M3FA 3V6GA 3NPIA 1MH4A 1U9NA 2WV1A 2EQRA 4X1EA 5EDNA 1H88C 4MK6A 1POGA 1JKRC 3OIOA 5EGOA 1VI0A 3HTAA 3B81A 3HTHA 4G12A 2X9DA 2NVQJ 3VVXA 3G1LA 3A03A 5F1JA 2GM4A 4GCLA 4XIDA 3VVYA 1ETOA 3RQIA 1WGXA 1RPWA 1MSEC 2OI8A 3ANPA 3HOVJ 1TWHJ 2LD5A 5AQCA 1SANA 4C3HJ 2Y30A 5IP9J 1B72B 2RAEA 4JL3A 5FLVA 3KNWA 2TCTA 1IGNA 1IRZA 2XGEA 2HYJA 1ZK8A 5EZGA 2LR8A 3I4MJ 1BA5A 2ZCMA 2LFBA 3HE0A 3PO3J 1ZGWA 1WCMJ 4V2FA 2L7ZA 2NP3A 2WB1N 3SJMA 1P7IA 5M3FJ 3CJDA 1TC3C 4B3AA 2CJJA 2Y9YA 3C07A 4NN1A 1JUPA 3BTLA 3ZQGA 1H8AC 2ME0A 1QVUA 3LWJA 2DMPA 2UXPA 1OCPA 2HI3A 5HODA 3CMYA 2QKOA 4ABZA 3S1NJ 3GTMJ 3IH3A 2HDDA 1UI5A 4BBRJ 2LY9A 4UUSA 3JRBA 2E2IJ 2L0KA 4A3CJ 4M3GA 2W48A 2QOPA 3W6VA 3MKLA 5M5WJ 2VUMJ 4L5EA 1U9OA 3BR2A 2MG4A 2L7MP 2H1KA 3VIBA 1GVDA 4MXMA 2ID3A 4A3DJ 3S17J 3LJLA 1D5YA 4JP0A 3FRQA 4IEJA 2MW8A 1ETQA 3HOYJ 4XK4A 2PBXA 4CYCB 4KWAA 1I6HJ 2G0EA 3PO2J 4GCKA 2PZ9A 1RKWA 4A3JJ 3ZQLA 3PASA 4M3EA 1NTCA 3JRHA 2GUHA 3KZ9A 2R5YB 3AQSA 4YZEA 2K9QA 1WPKA 3TEDA 5F04A 4ME9A 2R7ZJ 2WGBA 1BL0A 2XDNA 1NK2P 2QCOA 3S1MJ 2D5VA 3HBLA 1B8IA 2GENA 4DW6A 4A93J 2LKXA 4QIWN 3LHQA 4X6AJ 4Y7NJ 2UXUA 4D7MA 3JRAA 3K2AA 1APLC 1MBEA 4XRSG 3BG3A 2NS7A 4DZJA 3GEUA 2DTZA 2ME6A 2HOSA 4AF5A 4C3JJ 3A01B 1S7EA 3Q0WA 5IP6A 2E2HJ 2MGQA 1JKPC 4IHVA 2X6OA 1NK3P 2DMQA 4XRMA 1AHDP 5M5XJ 5IYDJ 2HXIA 3DEWA 4C2MJ 2UXIA 1DU6A 3LOCA 4A3EJ 5FKMA 3FK7A 3HM5A 1LFUP 3NAUA 3FKIJ 1G2HA 3BR0A 4DZPA 1MSFC 4JX4A 3GTGJ 2Q24A 3NXCA 2XGCA 1XC5A 3LSGA 1K61A 3BRUA 5D18A 2COBA 2DMTA 2M2EA 5J1UA 4A3BJ 2NVYJ 2YUSA 4A3FJ 3MVPA 5K58A 3BT9A 9ANTA 3HTJA 4RDUA 1P7JA 5E3LA 4FE4A 2HKUA 2K40A 3NARA 2HXOA 4Y52J 1T56A 5HSZA 1FIPA 5FGLA 3ANGA 3DPJA 2ZB9A 1QVTA 2HOAA 4GFBA 1BW6A 5K7HA 2QIBA 3B6AA 1PUFB 1FJLA 1JT6A 2TRTA 1ZTRA 2M9HA 4B1RA 2ECCA 1B8IB 4JX5A 2E2JJ 3H3VK 3VUQA 2G7SA 3QBMA 4I76A 1JKQC 4QSHA 1WI3A 1ZR2A 1WH7A 1I50J 2DA1A 2ECBA 3ZOBA 2JA7J 1X2MA 2B63J 4ACIA 1JUSA 4A3IJ 2EZKA 5F0HA 1LFBA 3HGYA 4NDLA 2NP5A 2DG8A 3CQZJ 2FJ1A 5EF6A 2AO9A 1JKOC 3GTPJ 3T6NA 5C4YA 1Y1VJ 1QRYA 3BR5A 5EEAA 2JWTA 1GUUA 1GV2A 3BCGA
chains in the Genus database with same CATH superfamily
1IUYA 4R1HA 3VSKA 1MMNA 2FNPA 4A3GJ 3T5XA 4KN4X 2QSHX 1PVEA 4AIJA 1YRNB 2DTRA 2ZFUA 1VQMI 3BR6A 3IRRA 3REOA 3OS1A 4IO9F 5E3OA 2M8GX 1UHSA 4WX9A 2L4MA 1MJAA 5DUKA 2OBPA 3PSFA 3L2CA 4XLNF 1M1EB 2OF7A 3FXKA 2BZTA 1O7FA 4IXAA 3UR3C 1ZQ3P 3OOPA 3GTKJ 2UV1A 1VF9A 2GLOA 2GIVA 2JMWA 2YR2A 3F6OA 2O8KA 3TOBA 3COLA 1EJ9A 2EZIA 3O8GA 5FLXZ 3AFHA 2CYYA 4HF1A 1K4TA 4IHSA 2L4AA 1ZELA 1JJ8C 1CF7B 3BP8A 2E1MC 2DAOA 3K4BA 4ANJA 4RBOA 2DU9A 3K70D 3ZQFA 1TW3A 2NS8A 5IOYA 1MIJA 5GPAA 3BJBA 2ZSHB 3D1NI 2DI3A 3IC7A 4L62A 5D4RA 4IQJA 2BV6A 2VQLA 3A01A 1IV6A 1MBFA 1O7LA 4E7HA 3H9JA 2QWTA 5GPCA 3AG3H 4MFDA 3RKXA 3Q5FA 5EGOB 2DODA 3HYIA 2R7SA 3LSHA 1IV8A 2O5RA 3S14J 3M3YJ 3BZKA 3HDDA 3KETA 3G1OA 2OQGA 1U5TB 2EFNA 3KP2A 2REKA 3MZHA 2VJ4A 1FY7A 2NX4A 2OJED 5FKLA 4E7IA 4DVYP 1R4NB 2A5WA 4YG2F 3WHBA 2JVHA 4BXXJ 3DKYA 3VYTB 5HDGA 2CSOA 2R5ZB 2JA6J 2LK2A 1JHHA 1WJEA 3H9GA 4ZYAA 3G73A 2MC4A 2B1EA 2F07A 1X58A 3HSRA 1MBKA 3SFIA 2K3PA 2X1CA 2M7BA 3O3KA 3IUVA 1U3EM 1IXSB 1T33A 2NXNB 4QLCU 1BR2A 2OV7A 2HNHA 4GGGA 2VPRA 4D5CA 5EEHA 3SZTA 2KIMA 5BNGA 5JLWA 2HEOA 2KHMA 4AC6A 1BOBA 3F8BA 1Y1WJ 2FD5A 3B02A 3DKWA 3KZZA 3CWRA 3E6BA 3KP7A 2YU9J 3I59B 4I98B 3WTWC 2IS1A 2IBDA 1J0RA 3C2BA 4IRIA 2M45A 4LFUA 2ESHA 1MNMC 2IAIA 2RV8A 4JQFA 5HBUA 2XASA 2PMZN 4ZZLA 2L54A 3D5RC 2PI0A 2BVMA 2DFFA 3FXJA 1GT0C 1K78B 3GW2A 1DU0A 1VTNC 4W97A 1SC7A 3E7LA 4PCQA 1DPRA 2VT3A 1RNLA 2H94A 3HSEA 1LDDA 3JW4A 1TWFJ 3F8CA 5CQGA 1HSJA 3RI4A 3HOUJ 2V79A 1EH8A 2B3WA 2DN0A 1LKXA 4G6DA 2M3AA 3A1YA 3RJPA 3DTIA 5DCMB 1BIBA 4OMYA 4KIFA 2R3SA 3DQVC 3QU6A 4QWQA 4C9YA 5FHPA 3W6JB 3KKDA 3QKXA 2ELKA 3RH2A 2VOOA 3G71I 2VASA 4F3QA 3F72A 2VBWA 5HVQC 4L18B 2XSJC 3KP6A 4ZDLA 5EZHA 5LHGA 1I39A 3HZJA 1FOYA 1B59A 2ESNA 1TWCJ 4GFLA 4RB3C 3S16J 1HKQA 2M4KA 4L9JA 4G6TB 5KK1A 1F43A 4ENJA 1WH5A 5IT3A 2WAQN 1HCRA 2XB5A 2Y2ZA 5GP9A 4BQNA 4YIFA 2IJLA 4LITA 1VQ7I 2LKPA 4DYRA 2EFWA 1MBJA 2R93J 1S9HA 3GFLA 3KLOA 2A61A 3SDGA 2BY1A 3V8KA 4NELA 3W6KB 3GVAA 3VDXA 1R7JA 1UG2A 4NNJA 2R5YA 3FK6A 2IGOA 3ZQHA 2QYOA 3E1SA 3GUDA 1UFMA 3GTLJ 3DXJF 2CH0A 3ZCOA 4XSXF 2CGPA 3GLXA 1ZR4A 4FASD 3MKWB 3BJAA 1QO0D 2XPWA 2A6EF 3OYLA 3VOXA 4A69C 2DXIA 4UV9A 2L02A 4BHPA 3QODA 3IH2A 1MH3A 1YIOA 1SFUA 3TW6A 2BHZA 2E7XA 2KDOA 4XOTA 2XV4S 5DDGA 1LDJA 2D1HA 5E3NA 4PUSA 2FMLA 5D8KB 3GF2A 5LLQA 2DG7A 3HTIA 3HXLA 1P92A 2R7OA 2VODA 3DKXA 2Z5UA 2VC0A 5FD6A 3EDPA 2UXXA 5EEGA 5H2FC 3RYPA 4FCYA 1AU7A 1A5JA 4NQWA 4NC8A 1RETA 2L5QA 1KQ0A 4HQMA 3OYHA 2E60A 3BTCA 3O8HA 2A3SA 1E2XA 4N9HA 3AL0C 1RC9A 1RZ4A 4JX6A 3CC2I 5DS9A 3KX2A 3KZIC 1QHGA 4ZYGA 5E3MA 5FJ8J 2QKMB 5CVJA 1D1CA 2Y0SA 4WIBA 3GTQJ 3U9GA 3CMEI 5AONA 1XG1A 4B44A 5E8IA 5IT9K 2I10A 3K9TA 1ZLJA 3H5RA 4KICA 2RNJA 5GADJ 3I0TA 3GZIA 3RZOJ 1YJ9I 5LGNA 4LD5A 3I3LA 1U9NA 3R4KA 2EILH 2EQRA 2B0LA 1IAWA 4BE1A 3VODA 2DCEA 3BY6A 2KRCA 1VI0A 4GYGA 5HLIA 3HTHA 1WHUA 2PX9A 4G12A 2STTA 2AXTC 3RIRA 1XGSA 4J01A 3VVYA 1YI2I 4CZZA 1FOWA 2A68F 1MSEC 3HOVJ 1TWHJ 1FYLA 1V3FA 1ON1A 1FWZA 2LKSA 4HSRA 4BJTA 4C3HJ 2YPRA 5AQCA 1OR7A 5IP9J 4HDVA 1HW5A 3M8EA 4ZTFA 2R7WA 2VOPA 1SFKA 3OIPA 2XGEA 4RGUA 2R7XA 4Z2YA 4G8XA 4WXCA 4V2FA 5JR3A 1MDMB 2VJ5A 1XDUA 4YELA 3VYSB 3SJMA 2KL4A 1YJNI 4EM2A 3ECHA 3WG7H 3OL3A 1LDKB 2ZO4A 1I27A 1JUPA 3A4CA 3BTLA 4IF4A 3K10A 2HU9A 2AXLA 1FP1D 3H35A 3CCEI 3EYIA 2VE8A 2DDBA 2HI3A 2R7FA 4PSWA 4ABZA 1XB4A 2C6YA 3S1NJ 2BY0A 1I1SA 2R4GA 3IH3A 1TLHB 2HDCA 5HLGA 2EPFA 3OYGA 1SD4A 4A3CJ 1TT0A 2W48A 4KMUX 5M5WJ 2VUMJ 4L5EA 3BR2A 2MG4A 3GWZA 1ERDA 2L7MP 3SHFA 4DBRA 4LB5A 1GVDA 1IXCA 3OR2C 4M6YA 3TDZC 1UHWA 2AQEA 2VC1A 2Z2SB 1IRGA 4KYWA 2BYVE 3CF2A 2XHKA 3FRQA 3DTKA 4DQ2A 5HS8A 2FE3A 5ICGA 3HOYJ 1P4XA 3KEQA 3SZGA 4P9UA 2O3FA 2KZVA 3FBIB 1R5ID 3M1CA 1E0EA 4UVCA 3WGIA 2HQRA 3FM5A 3LL7A 4M3EA 3JRHA 2L01A 2R5YB 5FLXK 1TW2A 1WPKA 1U5TA 4ENKA 1TBXA 3D0SA 1IF1A 2R7ZJ 5KVRA 1NK2P 5DD8A 2LMDA 2XAUA 3EUHA 2QUFA 3LWFA 4YIIA 2VIXA 2D5VA 1OCCH 2A2FX 2KIQA 3DF8A 3I4PA 4UXNA 4MTEA 3VSLA 3TGNA 3K2AA 1APLC 4EV0A 4DZJA 4IPAA 2W4SA 3PNYA 4XQFA 2GA1A 5HLTA 4LIVA 2KFDA 3GLLA 2F4OB 4IRGA 5F6FA 2QQAA 4PGHA 3PL8A 5FRMA 4EVIA 1NK3P 3LQRA 3LFKA 3VFZA 5M5XJ 1VQPI 1Y39A 3CCVI 2E5ZA 2EV6A 2ZFWA 1DU6A 3NEUA 1LFUP 2DPUA 1Z7UA 3FKIJ 4PJNA 4XKBA 3WU2C 2HKXA 2JVGA 3ERMA 4HPQA 2J5OA 3T8TA 3T1BA 4OINF 3V8LA 3NXCA 1KA8A 4OD4A 4IOCF 2XGCA 4MGRA 1H9GA 1K61A 5D18A 5BS6A 5J1UA 3J81Z 1BM9A 4A3BJ 2HTJA 3CP2A 1G3SA 3MVPA 4A3FJ 5K58A 3BT9A 1YFHA 3HTJA 4LG0B 4RDUA 3CC4I 3OWTA 5E3LA 2HKUA 4HX8A 2MFZA 3VWBA 3TBIA 4PJ0C 4KA4A 4TV7A 2D1VA 5LRSA 1FIPA 1ON2A 3ANGA 1HKSA 1BN5A 1OPCA 1X3UA 2ZB9A 4N0BA 2ZBKA 5K7HA 4GFBA 2QIBA 3K4NA 4HNUA 4IRHA 3SZPA 2HZDA 4L9TA 1LVAA 1ZTRA 4H0EA 4B1RA 1B8IB 1NG6A 3H3VK 1J9IA 1D0ZA 3QBMA 1T2KA 1PDNC 2A69F 1Y0NA 2NNNA 2E1CA 4I76A 4I99C 4QSHA 5B3SH 1H9TA 5DYMA 4RAYA 2JA7J 2VONA 4AIHA 3F22A 2O6GE 4BS9A 3WE2A 5J4YA 3WTVC 3HUGB 4LIUA 2F5CA 4AIDA 4D0PA 2IW5A 3QP5A 4ZC3A 1LFBA 3QOPA 4XLFA 2NP5A 3CQZJ 3FWEA 5EF6A 4OMZA 2LYCA 5GAGJ 1JKOC 4XORA 2KP6A 2W84A 1Y1VJ 4PJMA 3AAFA 5DUIA 3CUOA 2HYGD 2VE9A 2JWTA 4BUPA 1JHFA 3DWLE 2PN6A 2JPCA 1J7KA 2FU4A 5DM6F 5DCFA 3BCGA 2RQPA 3P9IA 5J4VA 1TQIA 3BPVA 2IU5A 4CGRA 1P9QC 4AU7A 3WE3A 2DLLA 3KPHA 1UI6A 2VKEA 1HKTA 3VW2A 2IGMA 2R92J 3KP3A 2R7RA 2A5YB 1PYVA 2WAQA 5LEJA 4DYCA 2WB1A 3FHZA 1VQLI 1R9TJ 5KCMA 4EM0B 4HZFA 1W0UA 4JYKA 3I64A 4BEHB 5F27A 2CUFA 4N4NB 3B6CA 3CMAI 1S5LC 4P9FA 4S05A 1Y0UA 4AVZA 1R71A 1IDYA 4OAYA 1UMQA 5AIPA 1IUFA 3GZ5A 1QZZA 2ELJA 2H8WA 2P6SA 4XICA 4CICA 1JT0A 1YE9A 3KFWX 1IC8A 3Q0VA 5J6XA 4XLHA 3FMRA 4S04A 4XOPA 3K7AJ 1YYVA 3BDDA 4LLNA 4IL6C 3RZDJ 3S2HJ 2Q1ZB 1K79A 1ZRDA 1IN6A 1RKTA 3CUQA 3EGQA 5D6EA 1YX5A 4H4KC 1F4KA 3NS4A 3ZN1A 1HOMA 4KISA 2NVTJ 5HAWA 3A0HC 3M8JA 4M9XA 2DT7B 2FQ3A 2IGNA 3VPRA 5D5UB 4G6QA 2GBYA 3BWGA 1IG7A 2HYFA 3FM3A 2EZHA 1OFCX 4U9LA 1IXRC 2JUCA 3LSRA 3HSFA 4Z6YA 3OYBA 5FKNA 4HF0A 3WG9A 2PMUA 4B48A 3L00A 1OMIA 1R23A 2F48A 2CU7A 3OSFA 2WA0A 4KFCA 4Q48A 3P5JA 3F1BA 2M0MA 4RGRA 5HDKA 1DPUA 1YQAA 1LFPA 4KNYA 4XLAA 1HLVA 4OIQF 4A3LJ 3Q9SA 1E3OC 1ITYA 2MA3A 3H36A 3C2HA 3EETA 3W2WA 1ZLKA 1ZREA 2P5VA 4BQOA 2LF7A 3F0CA 4PJJA 3LSJA 2ZCXA 3CLQA 3MCZA 1XGNA 2DA5A 5M3MJ 1SGMA 1OQYA 4MIMA 3QPSA 4RM3A 5DV5A 1XGOA 1SEUA 3H92A 2ISZA 1K6OA 1B1BA 1IZ1A 3Q9VA 1WJ5A 4GCTA 2QTQA 4DJAA 4BE0A 3MWMA 4UHTA 3BJ6A 2UXHA 2JK3A 3E5UA 3I9V2 2LRDA 5JI6A 1SFXA 3HG9A 3BQZA 2G7LA 2L7KA 2OZUA 1S29A 2DA2A 2OCEA 2JN6A 2R0QC 3CO7C 3KLNA 5J40A 3SEQA 1MDMA 1ETWA 2AS5F 4AUXA 3CMMA 2XPVA 1T95A 2E1OA 5M5YJ 2IA0A 2DBBA 4RS8A 1S3JA 3PSIA 4CCJA 4BACA 1U5TC 2MD5A 5FROA 2JA8J 1K83J 3I4NJ 3JRDA 3FZVA 2WUIA 3K1MA 5BOXA 3RQ4A 1V54H 2YS9A 5J1RA 4G9YA 2LC2A 1GXPA 4JK1X 1QPIA 3AG1H 4U0YA 3G56A 4JKZA 2D2WA 1RESA 5B1BH 3P7NA 2FRHA 1HA8A 3JTGA 4J19A 1YX3A 2IT0A 2VXZA 5LHIA 2VKHA 2H09A 5IPAA 3OYNA 2CV2A 3S5RA 3GBGA 1A36A 3Q0UA 2L3DA 2M0CA 2E1MB 5TRDA 2WBMA 2O7OA 4Y3OA 1N77A 2CUEA 3M1EA 3ZRGA 1Z9CA 3PNVA 1I3QJ 3S2WA 1UHMA 2DDAA 1Z21A 1TWAJ 3HB9A 5LFAA 1DGWY 4CYCA 2L9RA 1TWGJ 1GDTA 1XCVA 2LDUA 3NQOA 3K69A 1X1DA 4XRFA 2L9VA 2XRLA 3JSOA 3FMSA 2JUGA 3LQQA 5BQTA 3JCUC 3OYDA 1REPC 5EJCA 3RTRA 2XVCA 1R58A 1L3LA 1YHQI 4MQVA 1X1BA 1T6SA 2WC2A 1XGMA 4RAZA 3OY9A 4Y17A 1JTXA 4YRVA 2PBIA 1Z77A 4CDGA 2HTSA 2MLGA 2R7UA 1YIJI 3OIQA 4I09A 2B9SA 1ETYA 2V7FA 4PXIA 2CV0A 2W85A 3N4MA 3TMOA 5CXIA 4DBQA 5LHHA 3C7JA 5K7FA 1ETVA 1RUNA 1FBSA 2IVMA 2K4BA 2XF7A 3QPLA 3EPZA 3F8FA 4P5OA 4AC0A 3I5UA 3L2UA 5CJ9A 3HHGA 1GV5A 4FETA 4P96A 5FMPA 1X2NA 3CRJA 3T8RA 3LSIA 4I2OA 3S3MA 4EEFG 3IUOA 1D1AA 2XB0X 3SQNA 3PPBA 4ZJZA 4WF2A 4KIGA 4F92B 1RUOA 4PGGA 5AIQA 3OR1C 2F5FA 3W3CA 1R5HA 2HVSA 1EF4A 3X2QH 2BW3A 2JPBA 1VQ9I 3QQAA 2LY1A 3OYJA 2M8EA 3VP5A 4V2GA 3ZMUA 1FIAA 2ZNZA 1VQ6I 3K8PC 3ABKH 2AHQA 2DOEA 3S2DJ 3GCMA 4HBLA 3ON4A 4HX7A 2W24A 3LA2A 1JE8A 1ULYA 1OCOH 2VKVA 1ETKA 1ZH5A 1VQNI 4WWCA 2EWNA 4AYBN 2ETHA 4MLOA 5B5EC 1YW8A 1KU9A 3IWZA 1BW5A 3OYAA 3HOWJ 4E7KA 3S15J 2K9MA 2UUZA 5IY5H 2MH2A 3Q3SA 3CJTB 3HRTA 1OISA 4IHYA 2OTLI 2WWYA 2RHAA 2JTVA 4I02A 4XL9A 3O2PE 3H5AA 4BEHA 5J8FA 2WV1A 4X1EA 2K9LA 3RSNA 2JT1A 4L0ZB 2VQCA 4DNCA 3OIOA 4XN3A 1R00A 4A0XA 3HTAA 3CCUI 3BCAA 4UB8C 3VVXA 3A03A 3H3ZA 2XAQA 5F1JA 4GCLA 2VN2A 4XIDA 4M9ZA 4D1QA 4IVNA 2W25A 1T38A 5K5QA 1RPWA 2OI8A 3ZPLA 2X6YA 1U0JA 4DGWB 3HC7A 1B72B 3ELKA 4RAGA 4JL3A 1WKMA 3CCQI 2TCTA 3DEUA 1IRZA 2E34A 5GAHJ 3PQKA 1ZK8A 5EZGA 2LR8A 5D5WB 2VLAA 3I4MJ 2ZCMA 2Y0MA 2CG4A 2Z1DA 3HE0A 1ZGWA 4N4OB 2QA4I 3U2RA 1P4AA 1USTA 2L7ZA 2NP3A 4XSZF 3I56I 3A2KA 1WFXA 3CJDA 3LFUA 2R7TA 4XNFA 2CJJA 4I7HA 1LNWA 2BE5F 3C07A 1FOKA 4NN1A 4M6XA 4RB1A 3F8MA 1QVUA 3LA3A 5ICEA 1KU2A 3JTHA 2QKOA 4U88A 3GTMJ 2MD0A 2HDDA 1EH7A 3JRBA 2L0KA 2K86A 5DD4A 3F23A 4M3GA 4ZTJA 2DOAA 2QOPA 3IL2A 3DPUA 5H20A 2W1OA 4A6EA 4IRVA 1W4MA 3VIBA 3BZ6A 1WJFA 1UB9A 2HZTA 1RR8C 4A3DJ 3ISPA 3BLYA 4MEYF 3FX3A 1TP4A 5A2QK 2GQQA 4NQWB 1IRFA 4LG3A 4IEJA 1ETQA 4MTDA 4CYCB 3FXQA 3GFMA 4ZYDA 1OKRA 3FDYA 1MNEA 2DYRH 2GXGA 3PO2J 2DO7A 2OQRA 3AG2H 4CO8A 4EGZA 2QVOA 1SMTA 3PFIA 2PZ9A 1RKWA 3F8NA 3ZQLA 3K4LA 1IN4A 3LMMA 2XRNA 4B8XA 3V7SA 2V4JC 2K9QA 4F52A 3R0AA 3TEDA 1FYKA 2BY2A 4OWRB 3QPTA 4KIBA 1QZEA 2QSFX 2IA1A 3CJNA 3CCMI 2F5EA 2FXAA 2P7CB 3M9AA 4HSTA 4II3A 4A93J 3PUBA 2LKXA 3LHQA 4AD9A 1U2WA 4ESBA 4Y7NJ 4IX7A 4D7MA 3N97A 1MMAA 2HKOA 1TT5B 1X19A 3EUKL 4RLQA 1MBEA 3I53A 4O5VA 3GEUA 2FJI1 2HOSA 1I6XA 4AF5A 3L7WA 3A01B 1D0XA 3BROA 1S7EA 1YG2A 4HYEA 2XAFA 5IP6A 2RDPA 1JKPC 1DUXC 1STZA 4IHVA 1BIAA 5J47A 2DMQA 1AHDP 2QQ8A 2DFEA 2DQLA 2VQGA 2HXIA 1Z05A 2EFQA 5CVIA 3DEWA 3TO6A 1WJAA 5ERIA 2P7VB 2FUG2 3PQJA 3J7ZI 2PJRA 3L2VA 3TO7A 1ZG3A 3LOCA 3S3NA 3HM5A 2X1DA 3GX4X 3NAUA 1E3PA 1Z67A 3E3VA 4F7ZA 4DZPA 1MSFC 4JX4A 3HOSA 3GTGJ 2Q24A 3O6BB 4PJLA 4LGWA 5FO5A 1X3ZB 2CW7A 4CGZA 3TO9A 2CFOA 3BRUA 4UV8A 2COBA 2DMTA 4FX0A 2NVYJ 2YUSA 5FRNA 2A6HF 2EB7A 4HAMA 3TL4X 5BMZA 4KITB 4ZDPA 2MABA 2PMZA 4FE4A 3SXYA 3CP8A 3CLOA 2Z99A 3NARA 3IKVA 1F9NA 1WQ2A 4XLEA 4CSWA 4YFKF 1VQ4I 3HOTA 2IS4A 5HSZA 1U8RA 2UZKA 1O3TA 2BOLA 1P4WA 1BW6A 2FMYA 3P9KA 1MMDA 2VBZA 1PUFB 2ZCWA 1B6AA 3HPGA 4CXFA 3OS2A 1SVMA 2FF4A 2E2JJ 1RRJA 3HL2A 1IO2A 1VZ0A 1IW7F 2EFPA 1Y8RB 1Z91A 4E7JA 4L9NA 2X4HA 1JKQC 2LSOA 3DBHB 3V8JA 4BQAA 1I50J 2Q2EA 3ZOBA 3J80Z 1Z7LA 1I3AA 1KYWA 3F21A 3AG4H 2GXBA 4ACIA 2Z16A 4WCGA 5CYVA 3KP4A 1TQMA 1V5GA 3FXLA 1BC8C 3HGYA 4NDLA 5TJJA 3GTPJ 3MFKA 2V9PA 3T6NA 4XLPF 4HQEA 1VQ8I 5C4YA 2RNGA 3L2WA 1IN7A 2BGCA 2ZJRF 2KIUA 2TDXA 3C3WA 4L5JA 3CD6I 5EEAA 4E70A 2HR3A 3I59A 1Z6RA 3LSKA 3ML6A 2M30A 1GHCA 1K6YA 3I71A 3K4KA 3MZYA 3R6SA 1VNDA 3COAC 4CCOA 1W7PA 6PAXA 3TW7A 3ZR8X 1Q1VA 4XKCA 5IYBJ 5HNFA 1W36D 2V1XA 3CDIA 3DPTA 1XX5A 1MD0A 2V6EA 4QPOA 2DFHA 3HJEA 1FEXA 1R4MB 4FTHA 3PM1A 2HVQA 1OYWA 2KKOA 3HOZJ 4ICHA 2VI6A 3LSTA 4GRIA 2BXYA 4XBFA 1AKHB 2GXAA 1ORKA 2GOXB 2PMHA 4LK1F 3EUAA 5TISC 2HYTA 2DA4A 2P8TA 3VVZA 1O4XA 2XUBA 3ZMZA 3MD2A 5L3CA 1JTYA 5E18F 2K27A 1HC8A 1G8XA 4E7LA 1HSTA 3RKWA 4C30A 1OCTC 2IRFG 4CCLA 1F36A 3OMYA 4BY7J 2EV0A 2L9SA 2M1BA 4IHWA 4BKXA 1EH6A 3H0DA 4BBSJ 4I6ZA 1SVLA 3R60A 5K1YA 1G59A 3R61A 1GXQA 3HOXJ 2FX0A 5TGTA 2GIZA 1H89C 2A6TA 5HS9A 3RYRA 1FLIA 3FIWA 5EYRA 3QPHA 5EG0A 2CQ7A 2QGUA 2NNYA 5D19A 2E7WA 4I01A 2OD5A 3BG5A 3OL4A 4A3KJ 2OTJI 2XGXA 5BPDA 1P6RA 4HG2A 4F55A 1SVOA 3L1PA 2ZOZA 5D5XB 3NNRA 4ZYHA 1QZYA 2KMUA 4M9SA 3IV5A 1FTTA 2W57A 2UXOA 1FBQA 1HXDA 3VW1A 5B1AH 2ZXWH 3MN2A 4UUSB 3NWSA 2BXZA 3HIFA 1R49A 4IHTA 1CQTA 2JQ7A 3RKQA 3BG9A 5FGMA 5D8LB 4U7BA 1SD6A 2H8RA 5F0FA 2QKLB 5JHUA 1V4RA 1XS9A 2DMNA 4ASNA 1U78A 4UDSA 3DLAA 2XSDC 3GTJJ 5KHDA 3V7RA 1Y56A 1YOVB 1JGGA 3BHQA 2QZ8A 2BW3B 4ITVA 4G7OF 1YJWI 2W53A 1IJWC 3ESWB 3UNGC 2G9WA 2LBFA 3C2GA 2N8GA 4WXDA 1ZG5A 1ZKGA 1D3YA 1LJ9A 3RPUA 2RASA 4XRSA 4ESJA 5L3FA 2PEXA 4RA2A 3MKZA 1B72A 4S0HB 1U8BA 3BPXA 5GTHC 3SWHA 2LVSA 2OUMA 4I0BA 4U0VA 1KYZA 4A3MJ 4BGDA 2G7GA 3HRUA 3VTIA 1KU3A 5ILSA 3K4MA 2L7FP 5E1ZB 3WGGA 2ZKZA 2R7VA 3WTUC 2M34A 1OCZH 2X51A 2FOKA 5CXGA 2WAFA 1MKMA 5DAJA 3F3XA 2ZXJA 4FE7A 3CC7I 3BTJA 1YO5C 2HOTA 3HKZA 2F5VA 2KISA 1LEBA 2OC6A 4UUTA 2DK8A 3IH4A 1OLTA 2ZXHA 3CTAA 4U0WA 2EZLA 1SAUA 3P9CA 4AVPA 3WODF 3V4GA 1FZPB 1XD7A 5CVUA 3H3UA 3ZQCA 3RPUD 2E71A 1XTAA 4PFPA 1XPXA 4JBAA 1UAAA 2H1LA 2GAUA 2VL8A 2CMPA 1HW2A 2KJBA 4MO7A 1VQOI 4PZJA 1YS7A 1G6NA 4M3BA 5IT9Z 4ZYEA 3PUFA 3DV8A 2ZCNA 4IHXA 3DBLB 1IDZA 1MBGA 4KN7X 2M4GA 4OAZA 2EH3A 4RAFA 4E7SA 3JR9A 4WXHA 4D9JA 3VYRB 1WSUA 1FMWA 5HOOA 5IYCJ 5JVTA 4M6VA 1R1UA 2FSWA 2BHYA 2IPQX 3AQTA 1D1BA 1YRNA 1BI0A 2K4JA 2CQQA 1E17A 4IZZA 3WHCA 2STWA 2FNAA 3H9QA 4HLYA 4MFEA 4DYQA 1XMKA 5FLMJ 1KONA 4FISA 4Q4ZF 2ZOYA 2FBQA 1TL8A 4R8HA 2PQ8A 3AL0B 4HV5A 4KMFA 1W1WE 2IXSA 2CW0F 3EUHC 5CPRB 3RD3A 3MKYB 1F1ZA 2RQQA 2CW8A 5CW8A 5HS7A 3E7QA 1MW7A 4MNUA 4OOIA 1YS6A 5FB2A 3KYCB 4LOCA 4R79A 3LSPA 1W7PD 2NAZA 1ZN2A 3ZMDA 4XMYA 3FXUA 3OV8A 5K7ZA 1XMXA 2NOJB 5C4XJ 2MSYA 4OIOF 2DMUA 4BNCA 2CQNA 5CKTA 2JRTA 4BJ5C 1IN8A 4L9VA 4ON0A 3V78A 3EQLF 4E7ZA 3DP7A 2HPIA 3JRCA 3JRGA 4NC6A 1OJLA 5C3EJ 2Z3YA 2R5ZA 3JRFA 4M72A 4U87A 2LF8A 2MC3A 4NUBA 4W1UA 1NHAA 3KKCA 3A02A 3HRSA 2WAEA 3KEOA 5FFXA 2XC7A 1BI2A 5H9TA 1TTYA 3CDHA 2VKDA 5J3LA 3DBRB 2VJJA 1HBXG 1PUEE 1PP7U 2E35A 5DM7F 1FX7A 4G7HF 2MLKA 2E19A 3QOEA 3OYKA 2ZJQF 4BXFA 3E6MA 4JNNA 1HF0A 3JREA 2E36A 2Y48A 1ZHFA 2YVEA 3S1QJ 2CV1A 1FOXA 1A6IA 4B43A 1MJBA 3QYBA 1J2XA 1CF7A 2VJIA 2CUZA 1BR4A 1VQKI 3ZQ7A 4Y13A 2D6YA 3TOAA 3TP3A 2HQNA 5C4JJ 2PLYA 3ZP5A 2O8XA 2HS5A 2QWWA 5C44J 4Q47A 2NRAC 1MBHA 3L9FA 1WI9A 1ONVA 5GAEJ 3WTSC 2YX7A 1FP2A 5H6QA 3DPLC 2XGDA 3KCCA 3V7CA 1QU3A 1IRXA 3NI7A 2CFXA 3PNTA 4UB6C 3HHHA 4K2EA 3NPIA 1G3WA 1W5CC 3RPQA 4HV6A 5EDNA 1H88C 2DFIA 4LG0A 2EV5A 5J8CA 1UJ8A 2WTEA 1FYMA 3ABMH 2WADA 2XF5A 2X9DA 3LAPA 5LD2C 3G1LA 1JI8A 3FBNB 4U7DA 2LOOA 1ETOA 3RQIA 5LEKA 4CH7A 1SAXA 5DCMA 1WGXA 4LLGF 2FBHA 2LD5A 3D5SC 4YFXF 2YX4A 3SFZA 4ESFA 2Y30A 2RAEA 3ZMVA 3M07A 2XAGA 2Y69H 5A2QZ 5FLVA 1IGNA 5KAIC 2HYJA 1GVJA 3CO6C 1WRJA 3S32A 1EA3A 2V9KA 4GCVA 2I5UA 2G7UA 2AQFA 3PO3J 2NYXA 1G3YA 1DGRM 2WB1N 4UVBA 3TDUC 1P7IA 1OR7C 5M3FJ 2EJRA 1TC3C 1SD7A 3K4CA 2HFHA 2Y9YA 2A07F 1T0FA 2QLZA 3LWJA 1WJDA 2DMPA 3E97A 4AYBA 1KQ9A 1OCPA 1PP8F 3CMYA 4GO1A 1XN7A 4XONA 3U1DA 4DIQA 4O3MA 1I1GA 1UI5A 5GTIC 5ICCA 2LY9A 2E2IJ 4HRIA 1BI1A 3MKLA 2LH9A 2ACJA 4OU0A 1U9OA 3FMQA 2YVXA 4A5NA 2QQBA 1JGSA 2HQAA 4OIRF 4GDFA 3IAS2 2JRMA 1D5YA 4JP0A 1RIOH 4KDPA 5LGUA 4EGYA 4GYIA 4M71A 3C18A 2PBXA 2ICWG 2HGCA 1QBJA 2QQ9A 2HWVA 2G0EA 4GCKA 4A2UA 4A3JJ 1N78A 3PASA 2GUHA 3KZ9A 2FOWA 3U1KA 3AQSA 2EIJH 4I0AA 3IRQA 2XDVA 5F04A 4ME9A 1BL0A 2VQHA 3G2BA 2QCOA 3IKTA 4NHJA 3F6VA 3S1MJ 1ZARA 1B9MA 2VBYA 5FD5A 2OCCH 1XSVA 4DW6A 5HLHA 4MQ9F 2UXNA 4YFNF 4HF2A 2UXUA 1SD5A 4YIRX 2H6CA 4XRSG 3BG3A 2CO5A 3RCOA 3ZMSA 4C3JJ 3QAHA 3LSMA 3Q0WA 1SMYF 1LEAA 2RREA 3FXOA 5F1RA 4ZDOA 3QWLA 4UUVA 4PK4A 3F9KA 2PJRB 2CWEA 4RB0A 2CQKA 4PDKA 2VBXA 1R5GA 1MGTA 3IWFA 5ICFA 3MEXA 5K5OA 5FKMA 3JAMK 4A3EJ 3FK7A 2VXDA 3CJQB 4EATA 3BCBA 4GXOA 3J80K 1UG0A 2PFVA 1G2HA 2M5WA 1V5EA 4NBQA 1XC5A 3BZCA 5B66C 3S8PA 1K7AA 4A6DA 2M2EA 3W2VA 4WK8F 3H5NA 4UVAA 2J5PA 9ANTA 2KRHA 1T0FC 4DOZA 1S72I 3W2AA 2XAHA 4RGSA 1LVKA 4E4HA 1MMSA 4U9NA 2NS0A 3MZ8A 2HXOA 3K1PA 1T56A 3KYDB 1KQ8A 2R7QA 4HDUA 2Q8KA 5FGLA 3BG7A 2HOAA 5ILVA 3BJOA 3B6AA 2X6XA 3N05A 3ZQQA 1FJLA 4II2A 2M9HA 2ECCA 3VUQA 4JX5A 4M73A 2QSGX 1W36C 2XKOA 2DA1A 1CGPA 2NVUB 1KU7A 3CCLI 2F4MB 2B63J 2KQRA 1JUSA 2XF6A 1BOAA 2P5KA 4BXUA 4A3IJ 5LBQA 5F0HA 3J7AY 4CA0A 1J09A 1ACIA 3GZ6A 2DG8A 3ABTA 2AO9A 1B9NA 3KYLA 3K70C 2K5CA 4BE2A 2LNBA 3GEZA 3BR5A 2RGVA 4HW0A 4N9IA 3ZMTA 1T39A 1GUUA 2B7EA 1GV2A 1P2FA 1UCRA 1PUFA 3G1MA 2EBIA 4LMYA 4EJVA 2OZ6A 4HEA2 4A0ZA 5IP7J 4NB5A 4HKUA 2IEKA 3O60A 2KZGA 3PFYA 5IOZA 1ZRCA 3G4SI 4ENMA 2EINH 5CQEA 1K4SA 3QP6A 3QYEA 4BQQA 3VW0A 2R7DA 4HNVA 4BAYA 5EG0B 2K85A 2YVHA 1HDDC 1GLNA 2Z9OA 4IJAA 2DJNA 1HQCA 3K2ZA 4LK0F 4EMSA 3P9TA 3M4OJ 2QF7A 4F93B 1C0WA 5F08A 3BOQA 1S7AA 1A35A 3E6DA 5F0CA 3L2RA 1N75A 1NH3A 3NRGA 1BC7C 3GZNB 3MAJA 2EIMH 1D0YA 4XKWA 3KP5A 2WY8Q 1EV7A 5JHFA 1J5YA 2F2EA 4LB6B 2KIFA 2CUJA 2RKHA 3CF5F 3HTSB 2O7TA 2DA3A 3CESA 3ROUA 1Z3XA 3PIPF 2KRFA 2X48A 5CLSA 3HIMA 1TNSA 1HDPA 2ISYA 1ODDA 1X1PA 5EFYA 3G6EI 2LBFB 1USSA 2DA6A 1QQIA 1JUMA 2IP2A 3PIOF 5D4SA 1XSDA 4RB2C 2NVXJ 1X3WB 2K9SA 5E1XA 3BR3A 2KJCA 3CCYA 4AIKA 2Y75A 4KT5C 2CRGA 2F6CA 1WVRA 3CCRI 1MNDA 1W7PB 3QRFF 3BTIA 2KDZA 5ED4A 3HRMA 4FHTA 3SEZA 1KZHA 1R1TA 4HA8A 2BEOA 2WV0A 2E5NA 3ASOH 4CYDA 5FKKA 5ILUA 4BY1J 2OERA 3DFGA 3HEFA 3DCFA 1T98A 2OA4A 4BJ6C 5L3DA 3JSPA 3KIOA 4EM1A 5LGTA 3J7YJ 1MJ9A 3KE2A 2YU3A 4C2TA 3GYHX 3SYTA 4AM3A 1UELB 2DT6A 1JJ6C 3E0JB 1NG7A 2OPTA 3WTZA 4CCNA 2JA2A 2VB6A 3ZQIA 1R22A 3KEYA 3S1RJ 4A12A 4KUMA 1OYYA 4RGXA 4BHBA 3BNIA 1RI7A 1Q1HA 1OYIA 3QYFA 2Y9ZA 3ERED 3BQYA 3D5LA 3E5XA 1QGPA 1DP7P 3VOKA 3G3ZA 3CDLA 1LE8B 2Q2EB 1X1CA 4XM3A 3J81K 2QBYA 2K7LA 2PFBA 2X1EA 3OYMA 2IS6A 4BDZA 3ECOA 2F4IA 2V26A 4FT8A 5FFZA 3GTOJ 4BYYA 1BBYA 2LY2A 2W7NA 1W5TA 1X4PA 4IQ4A 3VB2A 3S93A 1HW1A 1I5ZA 5E1WA 1BJZA 2W82A 3V42A 2LLKA 2RC4A 3BR1A 2ZMEA 4D7NA 4EJOA 2VPLA 1LE8A 2Q0OA 1W5SA 2O9LA 4OD5A 2KT0A 3TP0A 3WTYC 2GFNA 2K9NA 2JJ7A 1Z3YA 5DTDA 5L3GA 2E1NA 2I8DA 3K4JA 4B3XA 2ID6A 3CUQC 1AKHA 2LTPA 1ENHA 5FKOA 2MH9A 4CUGA 2V57A 3VOEA 1BR1A 4RLFA 4F91B 2EK5A 2P0WA 2OU2A 4ENNA 1IN5A 4C3IJ 3OYIA 3OOUA 2DT5A 2Y0SN 4B4CA 3LNQA 1YLFA 1FTZA 5D1RA 3JSJA 2P81A 1XMAA 1PJRA 3WTTC 3OYEA 4V19K 1FBUA 1XCBA 3ABUA 4KT6A 3H0GJ 4RM2A 3WTXC 3L2QA 3JRIA 1F5TA 1FC3A 4LLLA 2V6CA 1QNTA 4A5MA 3OSGA 5HNHA 1W0TA 2XPUA 2KPMA 4GFKA 3LA7A 3FISA 4G94A 3WGHA 4AWXB 3IAM2 4L0YB 3I54A 3HKZN 3CCSI 3DEEA 1FMVA 2PG4A 1TNTA 2FBIA 2Y31A 1Y8QB 1R6RA 4X0GA 2DA7A 2GA2A 2OAZA 1EKEA 4C2UA 1ETXA 4NC7A 3MNLA 3K0LA 4O6JA 1UZCA 2JZYA 1FSEA 2COMA 2GWRA 2IA2A 3HPHA 1VFCA 2BY3A 1JXSA 2ELHA 2CQXA 3GXOA 4BH9A 1O57A 4D5FA 2DW4A 3WU1B 2FA5A 3M8FA 1FNNA 1S8NA 2RN7A 2HQ5A 1T08B 4YEJA 2HVRA 3GMEA 3GFIA 1SFOJ 5KNLA 3G7RA 4E6KG 1D5VA 3TQNA 4PSXA 2EA2A 2JA5J 5J1YA 3UKGA 1QHHD 3HUGA 4HLXA 1RR7A 2O03A 3CJRB 2HDWA 3ABLH 2MBFA 2UWMA 4XKVA 3HGGA 4MEXF 1D8JA 2HOEA 1A04A 1Z0XA 2LP0A 4QTRA 2NOGA 3SDBA 2DYSH 3RKYA 3IHUA 3GFJA 2XROA 3L09A 5E20A 5E17F 4HX4A 2G3BA 2ZSIB 3DU5A 4M3DA 5JLXA 2FQ4A 1J59A 1X4OA 2QENA 3EUPA 3ON2A 2F5DA 2ZMEC 4BL0B 1LB2A 2ZNYA 4KJZA 4M3FA 1D8KA 3V6GA 1TZLA 1MH4A 1S7OA 2QEXI 4MK6A 1POGA 1YW9A 2ZMEB 3ASNH 4JOMA 2X0LA 1JKRC 2M7AA 5EGOA 1BI3A 3T0YA 3B81A 1KGSA 2NVQJ 2K02A 2QM3A 4BDYA 2GM4A 2H6BA 2IGKA 3CZ6A 3VYUB 3FHNA 2FEZA 3RDIA 2X6WA 2JSPA 3ANPA 1G3TA 1XSXA 5E8GA 4EJWA 5CVVA 1SANA 2D45A 3KNWA 4EJUA 2M87A 4C2MA 1DP3A 1ZGJA 3OYCA 2L2OA 3CUQB 1BA5A 2FBKA 2LFBA 1FSHA 3U21A 5LRRA 4ETSA 3FXMA 2RVCA 1MMGA 1WCMJ 2L9NA 4P1WA 4Y15A 1K78A 3QU3A 3MMYB 3LAJA 4CCMA 1YITI 1BJAA 4B3AA 4G7ZF 4LJZF 3ZQGA 2ZC2A 1H8AC 2ME0A 1ZRFA 3DU6A 2ZJ2A 2UXPA 2XIGA 3ZN0A 3DTEA 4CHUA 5HODA 1R36A 3FF5A 3GO5A 4BBRJ 1DQUA 4Y33A 4UUSA 4MHGA 3IP4B 3W6VA 2XKPA 4XN0A 4Y4RA 4B09A 4Q5SF 3BG6A 1QPMA 3ONQA 2EIKH 3VEPA 3FXRA 2H1KA 4MXMA 2ID3A 2ZXIA 1AA7A 1TQPA 1XDSA 5H6RA 3S17J 4CZCA 3LJLA 2DOFA 1AWCA 2IS2A 3M7GA 2CS3A 2MW8A 3KZYA 2ADUA 5DEQA 4XK4A 3R0JA 3J7AO 2GOMA 4KWAA 2KLOA 2Z33A 1LUJB 1YW7A 3K1NA 3TKYA 3JAMZ 5L3EA 1I6HJ 4B47A 2HPMA 3EYYA 1O3QA 1L0OC 1WJBA 4UNOA 1AOYA 3FKJA 1WJCA 2DJIA 2K3FA 1NTCA 4YZEA 1DDNA 2ZJPF 1X1AA 4A0YA 4IOAF 3E5QA 3S3OA 4M74A 5D6FA 4ZZDA 2WGBA 2V1NA 2XDNA 4QPQA 2ZY9A 1H0MA 1LQ1A 3WU0A 3HBLA 2BBYA 1B8IA 2V1UA 2GENA 1ZG1A 4QIWN 4X6AJ 1O3SA 2G7HA 1ZAOA 1ZGAA 3MQ0A 3JRAA 4OIPF 1T8IA 2LREA 2H27A 2NS7A 2DTZA 2ME6A 2WY7Q 2E2HJ 4J00A 2DPDA 1B4AA 1WWXA 2MGQA 2X6OA 1LPQA 2O61A 1SFEA 2W00A 4XRMA 3CCJI 4EJTA 1WZ2A 5IYDJ 2VT2A 5JFRA 5CVRA 2XAJA 3H1CA 4C2MJ 4ZH4F 2MYSA 4L5IA 4BU2A 4XR6A 2UXIA 1FT9A 2EFOA 2P6TA 1R1VA 4HNTA 2V9VA 5KAFC 2YSRA 3OYFA 1MZBA 3K6GA 4IKFA 2BVLA 3ZGKA 1N25A 2DK5A 2GZWA 3BR0A 1G4DA 3BC8A 1QA6A 3LSGA 4P55A 4HOBA 4XLCA 5K5RA 5JVGF 3NRVA 3HTUA 1A31A 3NWTA 1P7JA 2A05A 5L3BA 1S6LA 2QBYB 2JSCA 4PFOA 2K40A 3AKZA 4Y52J 1VQ5I 1FPQA 5E79C 4CCKA 5D5VB 2DQRA 3DPJA 2EA4A 1QVTA 3DLLF 4RMNA 4UY8I 1A6QA 3A0BC 3E6CC 1JT6A 2LG4A 2TRTA 2X85A 2P4WA 1Y6IA 1V55H 1Z6TA 2O0YA 3ZXSA 2G7SA 4EQQA 3I55I 1WI3A 3ULQB 1U6GA 1V5FA 1ZR2A 1WH7A 2ECBA 1X2MA 3I58A 3C1DA 1OCRH 3B73A 2EZKA 4FQGA 5BPIA 1J75A 2PJPA 2FJ1A 4FX4A 2P5LC 1ZYRF 1Z1DA 1YTYA 1QRYA 4BHCA 5F64A 5HDNA 2V1DA 3PJRA 3OS0A 1O3RA 1E3HA
chains in the Genus database with same CATH topology
1PUFA 3G1MA 2EBIA 2IU5A 4CGRA 4A3GJ 1VNDA 5IP7J 1UI6A 2VKEA 1YRNB 4HKUA 3VW2A 3TW7A 2IEKA 1Q1VA 2R92J 5IYBJ 3O60A 3BR6A 4DYCA 1R9TJ 5IOZA 5E3OA 2M8GX 1UHSA 1W0UA 4JYKA 1FEXA 5F27A 2CUFA 4FTHA 3VW0A 3PM1A 2OF7A 3B6CA 4HNVA 1ZQ3P 5EG0B 3HOZJ 4ICHA 2VI6A 3GTKJ 2YVHA 1HDDC 1VF9A 1IDYA 2GLOA 2JMWA 1UMQA 2O8KA 1IUFA 2DJNA 1AKHB 3COLA 1ORKA 2EZIA 3O8GA 4XICA 1JT0A 3P9TA 3M4OJ 2QF7A 2HYTA 2DA4A 1IC8A 3VVZA 5F08A 3Q0VA 1O4XA 1JJ8C 3K7AJ 1JTYA 4RBOA 5F0CA 3ZQFA 3RZDJ 1OCTC 3S2HJ 3NRGA 2NS8A 3EGQA 1RKTA 1F36A 4BY7J 4IHWA 5IOYA 4BKXA 5GPAA 1HOMA 3BJBA 3D1NI 2NVTJ 4I6ZA 4BBSJ 5HAWA 4L62A 2O7TA 3VPRA 3A01A 1IV6A 2DA3A 3HOXJ 1MBFA 2FX0A 2QWTA 2GBYA 1IG7A 5GPCA 1H89C 2X48A 4MFDA 3HIMA 3FIWA 5EYRA 1HDPA 5EG0A 5EGOB 5D19A 2EZHA 1OFCX 5EFYA 3BG5A 3LSRA 2DA6A 4A3KJ 1JUMA 3L1PA 5FKNA 3M3YJ 3S14J 2ZOZA 3NNRA 2NVXJ 3HDDA 3G1OA 3IV5A 1FTTA 2REKA 2K9SA 3BR3A 3CCYA 2CU7A 2NX4A 3OSFA 2UXOA 5FKLA 2CRGA 3WHBA 4BXXJ 3VW1A 3BTIA 3MN2A 2KDZA 3F1BA 4UUSB 1CQTA 2R5ZB 2JA6J 1HLVA 2LK2A 3RKQA 3BG9A 4A3LJ 2F07A 1X58A 2H8RA 1E3OC 1ITYA 5F0FA 1MBKA 3SFIA 5FKKA 4BY1J 3IUVA 2OERA 1XS9A 2DMNA 1T33A 3HEFA 1U78A 3DCFA 4UDSA 2VPRA 2XSDC 3F0CA 3GTJJ 4D5CA 3LSJA 2ZCXA 5BNGA 5M3MJ 2DA5A 5JLWA 1SGMA 4MIMA 4AC6A 3QPSA 1JGGA 3BHQA 1Y1WJ 2FD5A 2W53A 1JJ6C 1IJWC 3CWRA 2YU9J 2N8GA 2OPTA 1ZKGA 3ZQIA 4GCTA 2IBDA 2QTQA 3C2BA 4XRSA 2RASA 3S1RJ 1B72A 4S0HB 2UXHA 2JK3A 1U8BA 1MNMC 3BNIA 2G7LA 3BQZA 2IAIA 2LVSA 5HBUA 2DA2A 2PMZN 2JN6A 4A3MJ 2Y9ZA 2R0QC 2G7GA 3BQYA 1ETWA 3VOKA 1GT0C 4AUXA 1DU0A 2XPVA 3CDLA 3E7LA 4W97A 1LE8B 2E1OA 5M5YJ 2L7FP 1TWFJ 2M34A 3HOUJ 2JA8J 1K83J 3I4NJ 3JRDA 2WUIA 5CXGA 2DN0A 5DAJA 4FE7A 2YS9A 5J1RA 3BTJA 1QPIA 2HOTA 3G56A 4JKZA 3GTOJ 4UUTA 1RESA 3IH4A 5FHPA 2EZLA 3KKDA 3QKXA 2ELKA 3RH2A 4J19A 3ZQCA 1BJZA 5EZHA 5IPAA 3S5RA 2LLKA 3GBGA 3BR1A 3Q0UA 4D7NA 4MO7A 1TWCJ 4GFLA 1LE8A 2M0CA 4M3BA 3S16J 2O9LA 2KT0A 2O7OA 1F43A 3TP0A 1WH5A 1HCRA 2WAQN 2CUEA 2K9NA 2XB5A 2JJ7A 2GFNA 2Y2ZA 5GP9A 2ZCNA 4IHXA 5DTDA 1I3QJ 1TWAJ 1IDZA 1MBGA 3HB9A 2ID6A 4CYCA 4DYRA 1AKHA 2LTPA 1ENHA 1MBJA 5FKOA 2R93J 2L9RA 2EH3A 1TWGJ 3SDGA 1GDTA 4NELA 3JR9A 2V57A 2XRLA 5IYCJ 4M6VA 1UG2A 4C3IJ 2R5YA 3AQTA 3OOUA 3FK6A 1YRNA 2Y0SN 4B4CA 3LNQA 1FTZA 2CQQA 5D1RA 3ZQHA 3JSJA 2P81A 3GTLJ 3WHCA 1JTXA 4MFEA 4DYQA 1Z77A 5FLMJ 4FISA 3H0GJ 1ZR4A 2FBQA 2ZOYA 2XPWA 3JRIA 1ETYA 3VOXA 4A69C 3RD3A 4PXIA 5CW8A 3E7QA 3OSGA 1W0TA 5CXIA 2XPUA 4LOCA 3IH2A 4GFKA 1MH3A 3LSPA 3FISA 5K7FA 3TW6A 1ETVA 3HKZN 3QPLA 5K7ZA 4AC0A 2Y31A 5E3NA 5C4XJ 2MSYA 2DMUA 1GV5A 2DA7A 2DG7A 3HTIA 5FMPA 1X2NA 1ETXA 3MNLA 3V78A 3CRJA 3JRCA 3JRGA 1VFCA 1OJLA 5C3EJ 2CQXA 2R5ZA 4EEFG 4D5FA 2XB0X 3JRFA 3PPBA 4FCYA 1AU7A 2HQ5A 1A5JA 4W1UA 3KKCA 3A02A 1RETA 1SFOJ 3G7RA 5H9TA 2JA5J 1EF4A 5J1YA 5J3LA 3UKGA 3QQAA 1RR7A 3BTCA 3O8HA 3VP5A 4V2GA 3HGGA 1FIAA 4JX6A 5DS9A 2AHQA 1Z0XA 2LP0A 3S2DJ 4QTRA 2E19A 2NOGA 4JNNA 1HF0A 5E3MA 3JREA 5FJ8J 2YVEA 3ON4A 3S1QJ 1A6IA 2VKVA 1ETKA 3GTQJ 2G3BA 4AYBN 2D6YA 4MLOA 3TP3A 5C4JJ 4M3DA 5JLXA 3HOWJ 5C44J 3S15J 1XG1A 1BW5A 2FQ4A 1MBHA 3Q3SA 3EUPA 3ON2A 2I10A 4IHYA 2XGDA 3GZIA 2RHAA 3RZOJ 3NI7A 4M3FA 3V6GA 3NPIA 1MH4A 1U9NA 2WV1A 2EQRA 4X1EA 5EDNA 1H88C 4MK6A 1POGA 1JKRC 3OIOA 5EGOA 1VI0A 3HTAA 3B81A 3HTHA 4G12A 2X9DA 2NVQJ 3VVXA 3G1LA 3A03A 5F1JA 2GM4A 4GCLA 4XIDA 3VVYA 1ETOA 3RQIA 1WGXA 1RPWA 1MSEC 2OI8A 3ANPA 3HOVJ 1TWHJ 2LD5A 5AQCA 1SANA 4C3HJ 2Y30A 5IP9J 1B72B 2RAEA 4JL3A 5FLVA 3KNWA 2TCTA 1IGNA 1IRZA 2XGEA 2HYJA 1ZK8A 5EZGA 2LR8A 3I4MJ 1BA5A 2ZCMA 2LFBA 3HE0A 3PO3J 1ZGWA 1WCMJ 4V2FA 2L7ZA 2NP3A 2WB1N 3SJMA 1P7IA 5M3FJ 3CJDA 1TC3C 4B3AA 2CJJA 2Y9YA 3C07A 4NN1A 1JUPA 3BTLA 3ZQGA 1H8AC 2ME0A 1QVUA 3LWJA 2DMPA 2UXPA 1OCPA 2HI3A 5HODA 3CMYA 2QKOA 4ABZA 3S1NJ 3GTMJ 3IH3A 2HDDA 1UI5A 4BBRJ 2LY9A 4UUSA 3JRBA 2E2IJ 2L0KA 4A3CJ 4M3GA 2W48A 2QOPA 3W6VA 3MKLA 5M5WJ 2VUMJ 4L5EA 1U9OA 3BR2A 2MG4A 2L7MP 2H1KA 3VIBA 1GVDA 4MXMA 2ID3A 4A3DJ 3S17J 3LJLA 1D5YA 4JP0A 3FRQA 4IEJA 2MW8A 1ETQA 3HOYJ 4XK4A 2PBXA 4CYCB 4KWAA 1I6HJ 2G0EA 3PO2J 4GCKA 2PZ9A 1RKWA 4A3JJ 3ZQLA 3PASA 4M3EA 1NTCA 3JRHA 2GUHA 3KZ9A 2R5YB 3AQSA 4YZEA 2K9QA 1WPKA 3TEDA 5F04A 4ME9A 2R7ZJ 2WGBA 1BL0A 2XDNA 1NK2P 2QCOA 3S1MJ 2D5VA 3HBLA 1B8IA 2GENA 4DW6A 4A93J 2LKXA 4QIWN 3LHQA 4X6AJ 4Y7NJ 2UXUA 4D7MA 3JRAA 3K2AA 1APLC 1MBEA 4XRSG 3BG3A 2NS7A 4DZJA 3GEUA 2DTZA 2ME6A 2HOSA 4AF5A 4C3JJ 3A01B 1S7EA 3Q0WA 5IP6A 2E2HJ 2MGQA 1JKPC 4IHVA 2X6OA 1NK3P 2DMQA 4XRMA 1AHDP 5M5XJ 5IYDJ 2HXIA 3DEWA 4C2MJ 2UXIA 1DU6A 3LOCA 4A3EJ 5FKMA 3FK7A 3HM5A 1LFUP 3NAUA 3FKIJ 1G2HA 3BR0A 4DZPA 1MSFC 4JX4A 3GTGJ 2Q24A 3NXCA 2XGCA 1XC5A 3LSGA 1K61A 3BRUA 5D18A 2COBA 2DMTA 2M2EA 5J1UA 4A3BJ 2NVYJ 2YUSA 4A3FJ 3MVPA 5K58A 3BT9A 9ANTA 3HTJA 4RDUA 1P7JA 5E3LA 4FE4A 2HKUA 2K40A 3NARA 2HXOA 4Y52J 1T56A 5HSZA 1FIPA 5FGLA 3ANGA 3DPJA 2ZB9A 1QVTA 2HOAA 4GFBA 1BW6A 5K7HA 2QIBA 3B6AA 1PUFB 1FJLA 1JT6A 2TRTA 1ZTRA 2M9HA 4B1RA 2ECCA 1B8IB 4JX5A 2E2JJ 3H3VK 3VUQA 2G7SA 3QBMA 4I76A 1JKQC 4QSHA 1WI3A 1ZR2A 1WH7A 1I50J 2DA1A 2ECBA 3ZOBA 2JA7J 1X2MA 2B63J 4ACIA 1JUSA 4A3IJ 2EZKA 5F0HA 1LFBA 3HGYA 4NDLA 2NP5A 2DG8A 3CQZJ 2FJ1A 5EF6A 2AO9A 1JKOC 3GTPJ 3T6NA 5C4YA 1Y1VJ 1QRYA 3BR5A 5EEAA 2JWTA 1GUUA 1GV2A 3BCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUF A;  3G1M A;  2EBI A;  2IU5 A;  4CGR A;  4A3G J;  1VND A;  5IP7 J;  1UI6 A;  2VKE A;  1YRN B;  4HKU A;  3VW2 A;  3TW7 A;  2IEK A;  1Q1V A;  2R92 J;  5IYB J;  3O60 A;  3BR6 A;  4DYC A;  1R9T J;  5IOZ A;  5E3O A;  2M8G X;  1UHS A;  1W0U A;  4JYK A;  1FEX A;  5F27 A;  2CUF A;  4FTH A;  3VW0 A;  3PM1 A;  2OF7 A;  3B6C A;  4HNV A;  1ZQ3 P;  5EG0 B;  3HOZ J;  4ICH A;  2VI6 A;  3GTK J;  2YVH A;  1HDD C;  1VF9 A;  1IDY A;  2GLO A;  2JMW A;  1UMQ A;  2O8K A;  1IUF A;  2DJN A;  1AKH B;  3COL A;  1ORK A;  2EZI A;  3O8G A;  4XIC A;  1JT0 A;  3P9T A;  3M4O J;  2QF7 A;  2HYT A;  2DA4 A;  1IC8 A;  3VVZ A;  5F08 A;  3Q0V A;  1O4X A;  1JJ8 C;  3K7A J;  1JTY A;  4RBO A;  5F0C A;  3ZQF A;  3RZD J;  1OCT C;  3S2H J;  3NRG A;  2NS8 A;  3EGQ A;  1RKT A;  1F36 A;  4BY7 J;  4IHW A;  5IOY A;  4BKX A;  5GPA A;  1HOM A;  3BJB A;  3D1N I;  2NVT J;  4I6Z A;  4BBS J;  5HAW A;  4L62 A;  2O7T A;  3VPR A;  3A01 A;  1IV6 A;  2DA3 A;  3HOX J;  1MBF A;  2FX0 A;  2QWT A;  2GBY A;  1IG7 A;  5GPC A;  1H89 C;  2X48 A;  4MFD A;  3HIM A;  3FIW A;  5EYR A;  1HDP A;  5EG0 A;  5EGO B;  5D19 A;  2EZH A;  1OFC X;  5EFY A;  3BG5 A;  3LSR A;  2DA6 A;  4A3K J;  1JUM A;  3L1P A;  5FKN A;  3M3Y J;  3S14 J;  2ZOZ A;  3NNR A;  2NVX J;  3HDD A;  3G1O A;  3IV5 A;  1FTT A;  2REK A;  2K9S A;  3BR3 A;  3CCY A;  2CU7 A;  2NX4 A;  3OSF A;  2UXO A;  5FKL A;  2CRG A;  3WHB A;  4BXX J;  3VW1 A;  3BTI A;  3MN2 A;  2KDZ A;  3F1B A;  4UUS B;  1CQT A;  2R5Z B;  2JA6 J;  1HLV A;  2LK2 A;  3RKQ A;  3BG9 A;  4A3L J;  2F07 A;  1X58 A;  2H8R A;  1E3O C;  1ITY A;  5F0F A;  1MBK A;  3SFI A;  5FKK A;  4BY1 J;  3IUV A;  2OER A;  1XS9 A;  2DMN A;  1T33 A;  3HEF A;  1U78 A;  3DCF A;  4UDS A;  2VPR A;  2XSD C;  3F0C A;  3GTJ J;  4D5C A;  3LSJ A;  2ZCX A;  5BNG A;  5M3M J;  2DA5 A;  5JLW A;  1SGM A;  4MIM A;  4AC6 A;  3QPS A;  1JGG A;  3BHQ A;  1Y1W J;  2FD5 A;  2W53 A;  1JJ6 C;  1IJW C;  3CWR A;  2YU9 J;  2N8G A;  2OPT A;  1ZKG A;  3ZQI A;  4GCT A;  2IBD A;  2QTQ A;  3C2B A;  4XRS A;  2RAS A;  3S1R J;  1B72 A;  4S0H B;  2UXH A;  2JK3 A;  1U8B A;  1MNM C;  3BNI A;  2G7L A;  3BQZ A;  2IAI A;  2LVS A;  5HBU A;  2DA2 A;  2PMZ N;  2JN6 A;  4A3M J;  2Y9Z A;  2R0Q C;  2G7G A;  3BQY A;  1ETW A;  3VOK A;  1GT0 C;  4AUX A;  1DU0 A;  2XPV A;  3CDL A;  3E7L A;  4W97 A;  1LE8 B;  2E1O A;  5M5Y J;  2L7F P;  1TWF J;  2M34 A;  3HOU J;  2JA8 J;  1K83 J;  3I4N J;  3JRD A;  2WUI A;  5CXG A;  2DN0 A;  5DAJ A;  4FE7 A;  2YS9 A;  5J1R A;  3BTJ A;  1QPI A;  2HOT A;  3G56 A;  4JKZ A;  3GTO J;  4UUT A;  1RES A;  3IH4 A;  5FHP A;  2EZL A;  3KKD A;  3QKX A;  2ELK A;  3RH2 A;  4J19 A;  3ZQC A;  1BJZ A;  5EZH A;  5IPA A;  3S5R A;  2LLK A;  3GBG A;  3BR1 A;  3Q0U A;  4D7N A;  4MO7 A;  1TWC J;  4GFL A;  1LE8 A;  2M0C A;  4M3B A;  3S16 J;  2O9L A;  2KT0 A;  2O7O A;  1F43 A;  3TP0 A;  1WH5 A;  1HCR A;  2WAQ N;  2CUE A;  2K9N A;  2XB5 A;  2JJ7 A;  2GFN A;  2Y2Z A;  5GP9 A;  2ZCN A;  4IHX A;  5DTD A;  1I3Q J;  1TWA J;  1IDZ A;  1MBG A;  3HB9 A;  2ID6 A;  4CYC A;  4DYR A;  1AKH A;  2LTP A;  1ENH A;  1MBJ A;  5FKO A;  2R93 J;  2L9R A;  2EH3 A;  1TWG J;  3SDG A;  1GDT A;  4NEL A;  3JR9 A;  2V57 A;  2XRL A;  5IYC J;  4M6V A;  1UG2 A;  4C3I J;  2R5Y A;  3AQT A;  3OOU A;  3FK6 A;  1YRN A;  2Y0S N;  4B4C A;  3LNQ A;  1FTZ A;  2CQQ A;  5D1R A;  3ZQH A;  3JSJ A;  2P81 A;  3GTL J;  3WHC A;  1JTX A;  4MFE A;  4DYQ A;  1Z77 A;  5FLM J;  4FIS A;  3H0G J;  1ZR4 A;  2FBQ A;  2ZOY A;  2XPW A;  3JRI A;  1ETY A;  3VOX A;  4A69 C;  3RD3 A;  4PXI A;  5CW8 A;  3E7Q A;  3OSG A;  1W0T A;  5CXI A;  2XPU A;  4LOC A;  3IH2 A;  4GFK A;  1MH3 A;  3LSP A;  3FIS A;  5K7F A;  3TW6 A;  1ETV A;  3HKZ N;  3QPL A;  5K7Z A;  4AC0 A;  2Y31 A;  5E3N A;  5C4X J;  2MSY A;  2DMU A;  1GV5 A;  2DA7 A;  2DG7 A;  3HTI A;  5FMP A;  1X2N A;  1ETX A;  3MNL A;  3V78 A;  3CRJ A;  3JRC A;  3JRG A;  1VFC A;  1OJL A;  5C3E J;  2CQX A;  2R5Z A;  4EEF G;  4D5F A;  2XB0 X;  3JRF A;  3PPB A;  4FCY A;  1AU7 A;  2HQ5 A;  1A5J A;  4W1U A;  3KKC A;  3A02 A;  1RET A;  1SFO J;  3G7R A;  5H9T A;  2JA5 J;  1EF4 A;  5J1Y A;  5J3L A;  3UKG A;  3QQA A;  1RR7 A;  3BTC A;  3O8H A;  3VP5 A;  4V2G A;  3HGG A;  1FIA A;  4JX6 A;  5DS9 A;  2AHQ A;  1Z0X A;  2LP0 A;  3S2D J;  4QTR A;  2E19 A;  2NOG A;  4JNN A;  1HF0 A;  5E3M A;  3JRE A;  5FJ8 J;  2YVE A;  3ON4 A;  3S1Q J;  1A6I A;  2VKV A;  1ETK A;  3GTQ J;  2G3B A;  4AYB N;  2D6Y A;  4MLO A;  3TP3 A;  5C4J J;  4M3D A;  5JLX A;  3HOW J;  5C44 J;  3S15 J;  1XG1 A;  1BW5 A;  2FQ4 A;  1MBH A;  3Q3S A;  3EUP A;  3ON2 A;  2I10 A;  4IHY A;  2XGD A;  3GZI A;  2RHA A;  3RZO J;  3NI7 A;  4M3F A;  3V6G A;  3NPI A;  1MH4 A;  1U9N A;  2WV1 A;  2EQR A;  4X1E A;  5EDN A;  1H88 C;  4MK6 A;  1POG A;  1JKR C;  3OIO A;  5EGO A;  1VI0 A;  3HTA A;  3B81 A;  3HTH A;  4G12 A;  2X9D A;  2NVQ J;  3VVX A;  3G1L A;  3A03 A;  5F1J A;  2GM4 A;  4GCL A;  4XID A;  3VVY A;  1ETO A;  3RQI A;  1WGX A;  1RPW A;  1MSE C;  2OI8 A;  3ANP A;  3HOV J;  1TWH J;  2LD5 A;  5AQC A;  1SAN A;  4C3H J;  2Y30 A;  5IP9 J;  1B72 B;  2RAE A;  4JL3 A;  5FLV A;  3KNW A;  2TCT A;  1IGN A;  1IRZ A;  2XGE A;  2HYJ A;  1ZK8 A;  5EZG A;  2LR8 A;  3I4M J;  1BA5 A;  2ZCM A;  2LFB A;  3HE0 A;  3PO3 J;  1ZGW A;  1WCM J;  4V2F A;  2L7Z A;  2NP3 A;  2WB1 N;  3SJM A;  1P7I A;  5M3F J;  3CJD A;  1TC3 C;  4B3A A;  2CJJ A;  2Y9Y A;  3C07 A;  4NN1 A;  1JUP A;  3BTL A;  3ZQG A;  1H8A C;  2ME0 A;  1QVU A;  3LWJ A;  2DMP A;  2UXP A;  1OCP A;  2HI3 A;  5HOD A;  3CMY A;  2QKO A;  4ABZ A;  3S1N J;  3GTM J;  3IH3 A;  2HDD A;  1UI5 A;  4BBR J;  2LY9 A;  4UUS A;  3JRB A;  2E2I J;  2L0K A;  4A3C J;  4M3G A;  2W48 A;  2QOP A;  3W6V A;  3MKL A;  5M5W J;  2VUM J;  4L5E A;  1U9O A;  3BR2 A;  2MG4 A;  2L7M P;  2H1K A;  3VIB A;  1GVD A;  4MXM A;  2ID3 A;  4A3D J;  3S17 J;  3LJL A;  1D5Y A;  4JP0 A;  3FRQ A;  4IEJ A;  2MW8 A;  1ETQ A;  3HOY J;  4XK4 A;  2PBX A;  4CYC B;  4KWA A;  1I6H J;  2G0E A;  3PO2 J;  4GCK A;  2PZ9 A;  1RKW A;  4A3J J;  3ZQL A;  3PAS A;  4M3E A;  1NTC A;  3JRH A;  2GUH A;  3KZ9 A;  2R5Y B;  3AQS A;  4YZE A;  2K9Q A;  1WPK A;  3TED A;  5F04 A;  4ME9 A;  2R7Z J;  2WGB A;  1BL0 A;  2XDN A;  1NK2 P;  2QCO A;  3S1M J;  2D5V A;  3HBL A;  1B8I A;  2GEN A;  4DW6 A;  4A93 J;  2LKX A;  4QIW N;  3LHQ A;  4X6A J;  4Y7N J;  2UXU A;  4D7M A;  3JRA A;  3K2A A;  1APL C;  1MBE A;  4XRS G;  3BG3 A;  2NS7 A;  4DZJ A;  3GEU A;  2DTZ A;  2ME6 A;  2HOS A;  4AF5 A;  4C3J J;  3A01 B;  1S7E A;  3Q0W A;  5IP6 A;  2E2H J;  2MGQ A;  1JKP C;  4IHV A;  2X6O A;  1NK3 P;  2DMQ A;  4XRM A;  1AHD P;  5M5X J;  5IYD J;  2HXI A;  3DEW A;  4C2M J;  2UXI A;  1DU6 A;  3LOC A;  4A3E J;  5FKM A;  3FK7 A;  3HM5 A;  1LFU P;  3NAU A;  3FKI J;  1G2H A;  3BR0 A;  4DZP A;  1MSF C;  4JX4 A;  3GTG J;  2Q24 A;  3NXC A;  2XGC A;  1XC5 A;  3LSG A;  1K61 A;  3BRU A;  5D18 A;  2COB A;  2DMT A;  2M2E A;  5J1U A;  4A3B J;  2NVY J;  2YUS A;  4A3F J;  3MVP A;  5K58 A;  3BT9 A;  9ANT A;  3HTJ A;  4RDU A;  1P7J A;  5E3L A;  4FE4 A;  2HKU A;  2K40 A;  3NAR A;  2HXO A;  4Y52 J;  1T56 A;  5HSZ A;  1FIP A;  5FGL A;  3ANG A;  3DPJ A;  2ZB9 A;  1QVT A;  2HOA A;  4GFB A;  1BW6 A;  5K7H A;  2QIB A;  3B6A A;  1PUF B;  1FJL A;  1JT6 A;  2TRT A;  1ZTR A;  2M9H A;  4B1R A;  2ECC A;  1B8I B;  4JX5 A;  2E2J J;  3H3V K;  3VUQ A;  2G7S A;  3QBM A;  4I76 A;  1JKQ C;  4QSH A;  1WI3 A;  1ZR2 A;  1WH7 A;  1I50 J;  2DA1 A;  2ECB A;  3ZOB A;  2JA7 J;  1X2M A;  2B63 J;  4ACI A;  1JUS A;  4A3I J;  2EZK A;  5F0H A;  1LFB A;  3HGY A;  4NDL A;  2NP5 A;  2DG8 A;  3CQZ J;  2FJ1 A;  5EF6 A;  2AO9 A;  1JKO C;  3GTP J;  3T6N A;  5C4Y A;  1Y1V J;  1QRY A;  3BR5 A;  5EEA A;  2JWT A;  1GUU A;  1GV2 A;  3BCG A; 
#chains in the Genus database with same CATH topology
 1IUY A;  4R1H A;  3VSK A;  1MMN A;  2FNP A;  4A3G J;  3T5X A;  4KN4 X;  2QSH X;  1PVE A;  4AIJ A;  1YRN B;  2DTR A;  2ZFU A;  1VQM I;  3BR6 A;  3IRR A;  3REO A;  3OS1 A;  4IO9 F;  5E3O A;  2M8G X;  1UHS A;  4WX9 A;  2L4M A;  1MJA A;  5DUK A;  2OBP A;  3PSF A;  3L2C A;  4XLN F;  1M1E B;  2OF7 A;  3FXK A;  2BZT A;  1O7F A;  4IXA A;  3UR3 C;  1ZQ3 P;  3OOP A;  3GTK J;  2UV1 A;  1VF9 A;  2GLO A;  2GIV A;  2JMW A;  2YR2 A;  3F6O A;  2O8K A;  3TOB A;  3COL A;  1EJ9 A;  2EZI A;  3O8G A;  5FLX Z;  3AFH A;  2CYY A;  4HF1 A;  1K4T A;  4IHS A;  2L4A A;  1ZEL A;  1JJ8 C;  1CF7 B;  3BP8 A;  2E1M C;  2DAO A;  3K4B A;  4ANJ A;  4RBO A;  2DU9 A;  3K70 D;  3ZQF A;  1TW3 A;  2NS8 A;  5IOY A;  1MIJ A;  5GPA A;  3BJB A;  2ZSH B;  3D1N I;  2DI3 A;  3IC7 A;  4L62 A;  5D4R A;  4IQJ A;  2BV6 A;  2VQL A;  3A01 A;  1IV6 A;  1MBF A;  1O7L A;  4E7H A;  3H9J A;  2QWT A;  5GPC A;  3AG3 H;  4MFD A;  3RKX A;  3Q5F A;  5EGO B;  2DOD A;  3HYI A;  2R7S A;  3LSH A;  1IV8 A;  2O5R A;  3S14 J;  3M3Y J;  3BZK A;  3HDD A;  3KET A;  3G1O A;  2OQG A;  1U5T B;  2EFN A;  3KP2 A;  2REK A;  3MZH A;  2VJ4 A;  1FY7 A;  2NX4 A;  2OJE D;  5FKL A;  4E7I A;  4DVY P;  1R4N B;  2A5W A;  4YG2 F;  3WHB A;  2JVH A;  4BXX J;  3DKY A;  3VYT B;  5HDG A;  2CSO A;  2R5Z B;  2JA6 J;  2LK2 A;  1JHH A;  1WJE A;  3H9G A;  4ZYA A;  3G73 A;  2MC4 A;  2B1E A;  2F07 A;  1X58 A;  3HSR A;  1MBK A;  3SFI A;  2K3P A;  2X1C A;  2M7B A;  3O3K A;  3IUV A;  1U3E M;  1IXS B;  1T33 A;  2NXN B;  4QLC U;  1BR2 A;  2OV7 A;  2HNH A;  4GGG A;  2VPR A;  4D5C A;  5EEH A;  3SZT A;  2KIM A;  5BNG A;  5JLW A;  2HEO A;  2KHM A;  4AC6 A;  1BOB A;  3F8B A;  1Y1W J;  2FD5 A;  3B02 A;  3DKW A;  3KZZ A;  3CWR A;  3E6B A;  3KP7 A;  2YU9 J;  3I59 B;  4I98 B;  3WTW C;  2IS1 A;  2IBD A;  1J0R A;  3C2B A;  4IRI A;  2M45 A;  4LFU A;  2ESH A;  1MNM C;  2IAI A;  2RV8 A;  4JQF A;  5HBU A;  2XAS A;  2PMZ N;  4ZZL A;  2L54 A;  3D5R C;  2PI0 A;  2BVM A;  2DFF A;  3FXJ A;  1GT0 C;  1K78 B;  3GW2 A;  1DU0 A;  1VTN C;  4W97 A;  1SC7 A;  3E7L A;  4PCQ A;  1DPR A;  2VT3 A;  1RNL A;  2H94 A;  3HSE A;  1LDD A;  3JW4 A;  1TWF J;  3F8C A;  5CQG A;  1HSJ A;  3RI4 A;  3HOU J;  2V79 A;  1EH8 A;  2B3W A;  2DN0 A;  1LKX A;  4G6D A;  2M3A A;  3A1Y A;  3RJP A;  3DTI A;  5DCM B;  1BIB A;  4OMY A;  4KIF A;  2R3S A;  3DQV C;  3QU6 A;  4QWQ A;  4C9Y A;  5FHP A;  3W6J B;  3KKD A;  3QKX A;  2ELK A;  3RH2 A;  2VOO A;  3G71 I;  2VAS A;  4F3Q A;  3F72 A;  2VBW A;  5HVQ C;  4L18 B;  2XSJ C;  3KP6 A;  4ZDL A;  5EZH A;  5LHG A;  1I39 A;  3HZJ A;  1FOY A;  1B59 A;  2ESN A;  1TWC J;  4GFL A;  4RB3 C;  3S16 J;  1HKQ A;  2M4K A;  4L9J A;  4G6T B;  5KK1 A;  1F43 A;  4ENJ A;  1WH5 A;  5IT3 A;  2WAQ N;  1HCR A;  2XB5 A;  2Y2Z A;  5GP9 A;  4BQN A;  4YIF A;  2IJL A;  4LIT A;  1VQ7 I;  2LKP A;  4DYR A;  2EFW A;  1MBJ A;  2R93 J;  1S9H A;  3GFL A;  3KLO A;  2A61 A;  3SDG A;  2BY1 A;  3V8K A;  4NEL A;  3W6K B;  3GVA A;  3VDX A;  1R7J A;  1UG2 A;  4NNJ A;  2R5Y A;  3FK6 A;  2IGO A;  3ZQH A;  2QYO A;  3E1S A;  3GUD A;  1UFM A;  3GTL J;  3DXJ F;  2CH0 A;  3ZCO A;  4XSX F;  2CGP A;  3GLX A;  1ZR4 A;  4FAS D;  3MKW B;  3BJA A;  1QO0 D;  2XPW A;  2A6E F;  3OYL A;  3VOX A;  4A69 C;  2DXI A;  4UV9 A;  2L02 A;  4BHP A;  3QOD A;  3IH2 A;  1MH3 A;  1YIO A;  1SFU A;  3TW6 A;  2BHZ A;  2E7X A;  2KDO A;  4XOT A;  2XV4 S;  5DDG A;  1LDJ A;  2D1H A;  5E3N A;  4PUS A;  2FML A;  5D8K B;  3GF2 A;  5LLQ A;  2DG7 A;  3HTI A;  3HXL A;  1P92 A;  2R7O A;  2VOD A;  3DKX A;  2Z5U A;  2VC0 A;  5FD6 A;  3EDP A;  2UXX A;  5EEG A;  5H2F C;  3RYP A;  4FCY A;  1AU7 A;  1A5J A;  4NQW A;  4NC8 A;  1RET A;  2L5Q A;  1KQ0 A;  4HQM A;  3OYH A;  2E60 A;  3BTC A;  3O8H A;  2A3S A;  1E2X A;  4N9H A;  3AL0 C;  1RC9 A;  1RZ4 A;  4JX6 A;  3CC2 I;  5DS9 A;  3KX2 A;  3KZI C;  1QHG A;  4ZYG A;  5E3M A;  5FJ8 J;  2QKM B;  5CVJ A;  1D1C A;  2Y0S A;  4WIB A;  3GTQ J;  3U9G A;  3CME I;  5AON A;  1XG1 A;  4B44 A;  5E8I A;  5IT9 K;  2I10 A;  3K9T A;  1ZLJ A;  3H5R A;  4KIC A;  2RNJ A;  5GAD J;  3I0T A;  3GZI A;  3RZO J;  1YJ9 I;  5LGN A;  4LD5 A;  3I3L A;  1U9N A;  3R4K A;  2EIL H;  2EQR A;  2B0L A;  1IAW A;  4BE1 A;  3VOD A;  2DCE A;  3BY6 A;  2KRC A;  1VI0 A;  4GYG A;  5HLI A;  3HTH A;  1WHU A;  2PX9 A;  4G12 A;  2STT A;  2AXT C;  3RIR A;  1XGS A;  4J01 A;  3VVY A;  1YI2 I;  4CZZ A;  1FOW A;  2A68 F;  1MSE C;  3HOV J;  1TWH J;  1FYL A;  1V3F A;  1ON1 A;  1FWZ A;  2LKS A;  4HSR A;  4BJT A;  4C3H J;  2YPR A;  5AQC A;  1OR7 A;  5IP9 J;  4HDV A;  1HW5 A;  3M8E A;  4ZTF A;  2R7W A;  2VOP A;  1SFK A;  3OIP A;  2XGE A;  4RGU A;  2R7X A;  4Z2Y A;  4G8X A;  4WXC A;  4V2F A;  5JR3 A;  1MDM B;  2VJ5 A;  1XDU A;  4YEL A;  3VYS B;  3SJM A;  2KL4 A;  1YJN I;  4EM2 A;  3ECH A;  3WG7 H;  3OL3 A;  1LDK B;  2ZO4 A;  1I27 A;  1JUP A;  3A4C A;  3BTL A;  4IF4 A;  3K10 A;  2HU9 A;  2AXL A;  1FP1 D;  3H35 A;  3CCE I;  3EYI A;  2VE8 A;  2DDB A;  2HI3 A;  2R7F A;  4PSW A;  4ABZ A;  1XB4 A;  2C6Y A;  3S1N J;  2BY0 A;  1I1S A;  2R4G A;  3IH3 A;  1TLH B;  2HDC A;  5HLG A;  2EPF A;  3OYG A;  1SD4 A;  4A3C J;  1TT0 A;  2W48 A;  4KMU X;  5M5W J;  2VUM J;  4L5E A;  3BR2 A;  2MG4 A;  3GWZ A;  1ERD A;  2L7M P;  3SHF A;  4DBR A;  4LB5 A;  1GVD A;  1IXC A;  3OR2 C;  4M6Y A;  3TDZ C;  1UHW A;  2AQE A;  2VC1 A;  2Z2S B;  1IRG A;  4KYW A;  2BYV E;  3CF2 A;  2XHK A;  3FRQ A;  3DTK A;  4DQ2 A;  5HS8 A;  2FE3 A;  5ICG A;  3HOY J;  1P4X A;  3KEQ A;  3SZG A;  4P9U A;  2O3F A;  2KZV A;  3FBI B;  1R5I D;  3M1C A;  1E0E A;  4UVC A;  3WGI A;  2HQR A;  3FM5 A;  3LL7 A;  4M3E A;  3JRH A;  2L01 A;  2R5Y B;  5FLX K;  1TW2 A;  1WPK A;  1U5T A;  4ENK A;  1TBX A;  3D0S A;  1IF1 A;  2R7Z J;  5KVR A;  1NK2 P;  5DD8 A;  2LMD A;  2XAU A;  3EUH A;  2QUF A;  3LWF A;  4YII A;  2VIX A;  2D5V A;  1OCC H;  2A2F X;  2KIQ A;  3DF8 A;  3I4P A;  4UXN A;  4MTE A;  3VSL A;  3TGN A;  3K2A A;  1APL C;  4EV0 A;  4DZJ A;  4IPA A;  2W4S A;  3PNY A;  4XQF A;  2GA1 A;  5HLT A;  4LIV A;  2KFD A;  3GLL A;  2F4O B;  4IRG A;  5F6F A;  2QQA A;  4PGH A;  3PL8 A;  5FRM A;  4EVI A;  1NK3 P;  3LQR A;  3LFK A;  3VFZ A;  5M5X J;  1VQP I;  1Y39 A;  3CCV I;  2E5Z A;  2EV6 A;  2ZFW A;  1DU6 A;  3NEU A;  1LFU P;  2DPU A;  1Z7U A;  3FKI J;  4PJN A;  4XKB A;  3WU2 C;  2HKX A;  2JVG A;  3ERM A;  4HPQ A;  2J5O A;  3T8T A;  3T1B A;  4OIN F;  3V8L A;  3NXC A;  1KA8 A;  4OD4 A;  4IOC F;  2XGC A;  4MGR A;  1H9G A;  1K61 A;  5D18 A;  5BS6 A;  5J1U A;  3J81 Z;  1BM9 A;  4A3B J;  2HTJ A;  3CP2 A;  1G3S A;  3MVP A;  4A3F J;  5K58 A;  3BT9 A;  1YFH A;  3HTJ A;  4LG0 B;  4RDU A;  3CC4 I;  3OWT A;  5E3L A;  2HKU A;  4HX8 A;  2MFZ A;  3VWB A;  3TBI A;  4PJ0 C;  4KA4 A;  4TV7 A;  2D1V A;  5LRS A;  1FIP A;  1ON2 A;  3ANG A;  1HKS A;  1BN5 A;  1OPC A;  1X3U A;  2ZB9 A;  4N0B A;  2ZBK A;  5K7H A;  4GFB A;  2QIB A;  3K4N A;  4HNU A;  4IRH A;  3SZP A;  2HZD A;  4L9T A;  1LVA A;  1ZTR A;  4H0E A;  4B1R A;  1B8I B;  1NG6 A;  3H3V K;  1J9I A;  1D0Z A;  3QBM A;  1T2K A;  1PDN C;  2A69 F;  1Y0N A;  2NNN A;  2E1C A;  4I76 A;  4I99 C;  4QSH A;  5B3S H;  1H9T A;  5DYM A;  4RAY A;  2JA7 J;  2VON A;  4AIH A;  3F22 A;  2O6G E;  4BS9 A;  3WE2 A;  5J4Y A;  3WTV C;  3HUG B;  4LIU A;  2F5C A;  4AID A;  4D0P A;  2IW5 A;  3QP5 A;  4ZC3 A;  1LFB A;  3QOP A;  4XLF A;  2NP5 A;  3CQZ J;  3FWE A;  5EF6 A;  4OMZ A;  2LYC A;  5GAG J;  1JKO C;  4XOR A;  2KP6 A;  2W84 A;  1Y1V J;  4PJM A;  3AAF A;  5DUI A;  3CUO A;  2HYG D;  2VE9 A;  2JWT A;  4BUP A;  1JHF A;  3DWL E;  2PN6 A;  2JPC A;  1J7K A;  2FU4 A;  5DM6 F;  5DCF A;  3BCG A;  2RQP A;  3P9I A;  5J4V A;  1TQI A;  3BPV A;  2IU5 A;  4CGR A;  1P9Q C;  4AU7 A;  3WE3 A;  2DLL A;  3KPH A;  1UI6 A;  2VKE A;  1HKT A;  3VW2 A;  2IGM A;  2R92 J;  3KP3 A;  2R7R A;  2A5Y B;  1PYV A;  2WAQ A;  5LEJ A;  4DYC A;  2WB1 A;  3FHZ A;  1VQL I;  1R9T J;  5KCM A;  4EM0 B;  4HZF A;  1W0U A;  4JYK A;  3I64 A;  4BEH B;  5F27 A;  2CUF A;  4N4N B;  3B6C A;  3CMA I;  1S5L C;  4P9F A;  4S05 A;  1Y0U A;  4AVZ A;  1R71 A;  1IDY A;  4OAY A;  1UMQ A;  5AIP A;  1IUF A;  3GZ5 A;  1QZZ A;  2ELJ A;  2H8W A;  2P6S A;  4XIC A;  4CIC A;  1JT0 A;  1YE9 A;  3KFW X;  1IC8 A;  3Q0V A;  5J6X A;  4XLH A;  3FMR A;  4S04 A;  4XOP A;  3K7A J;  1YYV A;  3BDD A;  4LLN A;  4IL6 C;  3RZD J;  3S2H J;  2Q1Z B;  1K79 A;  1ZRD A;  1IN6 A;  1RKT A;  3CUQ A;  3EGQ A;  5D6E A;  1YX5 A;  4H4K C;  1F4K A;  3NS4 A;  3ZN1 A;  1HOM A;  4KIS A;  2NVT J;  5HAW A;  3A0H C;  3M8J A;  4M9X A;  2DT7 B;  2FQ3 A;  2IGN A;  3VPR A;  5D5U B;  4G6Q A;  2GBY A;  3BWG A;  1IG7 A;  2HYF A;  3FM3 A;  2EZH A;  1OFC X;  4U9L A;  1IXR C;  2JUC A;  3LSR A;  3HSF A;  4Z6Y A;  3OYB A;  5FKN A;  4HF0 A;  3WG9 A;  2PMU A;  4B48 A;  3L00 A;  1OMI A;  1R23 A;  2F48 A;  2CU7 A;  3OSF A;  2WA0 A;  4KFC A;  4Q48 A;  3P5J A;  3F1B A;  2M0M A;  4RGR A;  5HDK A;  1DPU A;  1YQA A;  1LFP A;  4KNY A;  4XLA A;  1HLV A;  4OIQ F;  4A3L J;  3Q9S A;  1E3O C;  1ITY A;  2MA3 A;  3H36 A;  3C2H A;  3EET A;  3W2W A;  1ZLK A;  1ZRE A;  2P5V A;  4BQO A;  2LF7 A;  3F0C A;  4PJJ A;  3LSJ A;  2ZCX A;  3CLQ A;  3MCZ A;  1XGN A;  2DA5 A;  5M3M J;  1SGM A;  1OQY A;  4MIM A;  3QPS A;  4RM3 A;  5DV5 A;  1XGO A;  1SEU A;  3H92 A;  2ISZ A;  1K6O A;  1B1B A;  1IZ1 A;  3Q9V A;  1WJ5 A;  4GCT A;  2QTQ A;  4DJA A;  4BE0 A;  3MWM A;  4UHT A;  3BJ6 A;  2UXH A;  2JK3 A;  3E5U A;  3I9V 2;  2LRD A;  5JI6 A;  1SFX A;  3HG9 A;  3BQZ A;  2G7L A;  2L7K A;  2OZU A;  1S29 A;  2DA2 A;  2OCE A;  2JN6 A;  2R0Q C;  3CO7 C;  3KLN A;  5J40 A;  3SEQ A;  1MDM A;  1ETW A;  2AS5 F;  4AUX A;  3CMM A;  2XPV A;  1T95 A;  2E1O A;  5M5Y J;  2IA0 A;  2DBB A;  4RS8 A;  1S3J A;  3PSI A;  4CCJ A;  4BAC A;  1U5T C;  2MD5 A;  5FRO A;  2JA8 J;  1K83 J;  3I4N J;  3JRD A;  3FZV A;  2WUI A;  3K1M A;  5BOX A;  3RQ4 A;  1V54 H;  2YS9 A;  5J1R A;  4G9Y A;  2LC2 A;  1GXP A;  4JK1 X;  1QPI A;  3AG1 H;  4U0Y A;  3G56 A;  4JKZ A;  2D2W A;  1RES A;  5B1B H;  3P7N A;  2FRH A;  1HA8 A;  3JTG A;  4J19 A;  1YX3 A;  2IT0 A;  2VXZ A;  5LHI A;  2VKH A;  2H09 A;  5IPA A;  3OYN A;  2CV2 A;  3S5R A;  3GBG A;  1A36 A;  3Q0U A;  2L3D A;  2M0C A;  2E1M B;  5TRD A;  2WBM A;  2O7O A;  4Y3O A;  1N77 A;  2CUE A;  3M1E A;  3ZRG A;  1Z9C A;  3PNV A;  1I3Q J;  3S2W A;  1UHM A;  2DDA A;  1Z21 A;  1TWA J;  3HB9 A;  5LFA A;  1DGW Y;  4CYC A;  2L9R A;  1TWG J;  1GDT A;  1XCV A;  2LDU A;  3NQO A;  3K69 A;  1X1D A;  4XRF A;  2L9V A;  2XRL A;  3JSO A;  3FMS A;  2JUG A;  3LQQ A;  5BQT A;  3JCU C;  3OYD A;  1REP C;  5EJC A;  3RTR A;  2XVC A;  1R58 A;  1L3L A;  1YHQ I;  4MQV A;  1X1B A;  1T6S A;  2WC2 A;  1XGM A;  4RAZ A;  3OY9 A;  4Y17 A;  1JTX A;  4YRV A;  2PBI A;  1Z77 A;  4CDG A;  2HTS A;  2MLG A;  2R7U A;  1YIJ I;  3OIQ A;  4I09 A;  2B9S A;  1ETY A;  2V7F A;  4PXI A;  2CV0 A;  2W85 A;  3N4M A;  3TMO A;  5CXI A;  4DBQ A;  5LHH A;  3C7J A;  5K7F A;  1ETV A;  1RUN A;  1FBS A;  2IVM A;  2K4B A;  2XF7 A;  3QPL A;  3EPZ A;  3F8F A;  4P5O A;  4AC0 A;  3I5U A;  3L2U A;  5CJ9 A;  3HHG A;  1GV5 A;  4FET A;  4P96 A;  5FMP A;  1X2N A;  3CRJ A;  3T8R A;  3LSI A;  4I2O A;  3S3M A;  4EEF G;  3IUO A;  1D1A A;  2XB0 X;  3SQN A;  3PPB A;  4ZJZ A;  4WF2 A;  4KIG A;  4F92 B;  1RUO A;  4PGG A;  5AIQ A;  3OR1 C;  2F5F A;  3W3C A;  1R5H A;  2HVS A;  1EF4 A;  3X2Q H;  2BW3 A;  2JPB A;  1VQ9 I;  3QQA A;  2LY1 A;  3OYJ A;  2M8E A;  3VP5 A;  4V2G A;  3ZMU A;  1FIA A;  2ZNZ A;  1VQ6 I;  3K8P C;  3ABK H;  2AHQ A;  2DOE A;  3S2D J;  3GCM A;  4HBL A;  3ON4 A;  4HX7 A;  2W24 A;  3LA2 A;  1JE8 A;  1ULY A;  1OCO H;  2VKV A;  1ETK A;  1ZH5 A;  1VQN I;  4WWC A;  2EWN A;  4AYB N;  2ETH A;  4MLO A;  5B5E C;  1YW8 A;  1KU9 A;  3IWZ A;  1BW5 A;  3OYA A;  3HOW J;  4E7K A;  3S15 J;  2K9M A;  2UUZ A;  5IY5 H;  2MH2 A;  3Q3S A;  3CJT B;  3HRT A;  1OIS A;  4IHY A;  2OTL I;  2WWY A;  2RHA A;  2JTV A;  4I02 A;  4XL9 A;  3O2P E;  3H5A A;  4BEH A;  5J8F A;  2WV1 A;  4X1E A;  2K9L A;  3RSN A;  2JT1 A;  4L0Z B;  2VQC A;  4DNC A;  3OIO A;  4XN3 A;  1R00 A;  4A0X A;  3HTA A;  3CCU I;  3BCA A;  4UB8 C;  3VVX A;  3A03 A;  3H3Z A;  2XAQ A;  5F1J A;  4GCL A;  2VN2 A;  4XID A;  4M9Z A;  4D1Q A;  4IVN A;  2W25 A;  1T38 A;  5K5Q A;  1RPW A;  2OI8 A;  3ZPL A;  2X6Y A;  1U0J A;  4DGW B;  3HC7 A;  1B72 B;  3ELK A;  4RAG A;  4JL3 A;  1WKM A;  3CCQ I;  2TCT A;  3DEU A;  1IRZ A;  2E34 A;  5GAH J;  3PQK A;  1ZK8 A;  5EZG A;  2LR8 A;  5D5W B;  2VLA A;  3I4M J;  2ZCM A;  2Y0M A;  2CG4 A;  2Z1D A;  3HE0 A;  1ZGW A;  4N4O B;  2QA4 I;  3U2R A;  1P4A A;  1UST A;  2L7Z A;  2NP3 A;  4XSZ F;  3I56 I;  3A2K A;  1WFX A;  3CJD A;  3LFU A;  2R7T A;  4XNF A;  2CJJ A;  4I7H A;  1LNW A;  2BE5 F;  3C07 A;  1FOK A;  4NN1 A;  4M6X A;  4RB1 A;  3F8M A;  1QVU A;  3LA3 A;  5ICE A;  1KU2 A;  3JTH A;  2QKO A;  4U88 A;  3GTM J;  2MD0 A;  2HDD A;  1EH7 A;  3JRB A;  2L0K A;  2K86 A;  5DD4 A;  3F23 A;  4M3G A;  4ZTJ A;  2DOA A;  2QOP A;  3IL2 A;  3DPU A;  5H20 A;  2W1O A;  4A6E A;  4IRV A;  1W4M A;  3VIB A;  3BZ6 A;  1WJF A;  1UB9 A;  2HZT A;  1RR8 C;  4A3D J;  3ISP A;  3BLY A;  4MEY F;  3FX3 A;  1TP4 A;  5A2Q K;  2GQQ A;  4NQW B;  1IRF A;  4LG3 A;  4IEJ A;  1ETQ A;  4MTD A;  4CYC B;  3FXQ A;  3GFM A;  4ZYD A;  1OKR A;  3FDY A;  1MNE A;  2DYR H;  2GXG A;  3PO2 J;  2DO7 A;  2OQR A;  3AG2 H;  4CO8 A;  4EGZ A;  2QVO A;  1SMT A;  3PFI A;  2PZ9 A;  1RKW A;  3F8N A;  3ZQL A;  3K4L A;  1IN4 A;  3LMM A;  2XRN A;  4B8X A;  3V7S A;  2V4J C;  2K9Q A;  4F52 A;  3R0A A;  3TED A;  1FYK A;  2BY2 A;  4OWR B;  3QPT A;  4KIB A;  1QZE A;  2QSF X;  2IA1 A;  3CJN A;  3CCM I;  2F5E A;  2FXA A;  2P7C B;  3M9A A;  4HST A;  4II3 A;  4A93 J;  3PUB A;  2LKX A;  3LHQ A;  4AD9 A;  1U2W A;  4ESB A;  4Y7N J;  4IX7 A;  4D7M A;  3N97 A;  1MMA A;  2HKO A;  1TT5 B;  1X19 A;  3EUK L;  4RLQ A;  1MBE A;  3I53 A;  4O5V A;  3GEU A;  2FJI 1;  2HOS A;  1I6X A;  4AF5 A;  3L7W A;  3A01 B;  1D0X A;  3BRO A;  1S7E A;  1YG2 A;  4HYE A;  2XAF A;  5IP6 A;  2RDP A;  1JKP C;  1DUX C;  1STZ A;  4IHV A;  1BIA A;  5J47 A;  2DMQ A;  1AHD P;  2QQ8 A;  2DFE A;  2DQL A;  2VQG A;  2HXI A;  1Z05 A;  2EFQ A;  5CVI A;  3DEW A;  3TO6 A;  1WJA A;  5ERI A;  2P7V B;  2FUG 2;  3PQJ A;  3J7Z I;  2PJR A;  3L2V A;  3TO7 A;  1ZG3 A;  3LOC A;  3S3N A;  3HM5 A;  2X1D A;  3GX4 X;  3NAU A;  1E3P A;  1Z67 A;  3E3V A;  4F7Z A;  4DZP A;  1MSF C;  4JX4 A;  3HOS A;  3GTG J;  2Q24 A;  3O6B B;  4PJL A;  4LGW A;  5FO5 A;  1X3Z B;  2CW7 A;  4CGZ A;  3TO9 A;  2CFO A;  3BRU A;  4UV8 A;  2COB A;  2DMT A;  4FX0 A;  2NVY J;  2YUS A;  5FRN A;  2A6H F;  2EB7 A;  4HAM A;  3TL4 X;  5BMZ A;  4KIT B;  4ZDP A;  2MAB A;  2PMZ A;  4FE4 A;  3SXY A;  3CP8 A;  3CLO A;  2Z99 A;  3NAR A;  3IKV A;  1F9N A;  1WQ2 A;  4XLE A;  4CSW A;  4YFK F;  1VQ4 I;  3HOT A;  2IS4 A;  5HSZ A;  1U8R A;  2UZK A;  1O3T A;  2BOL A;  1P4W A;  1BW6 A;  2FMY A;  3P9K A;  1MMD A;  2VBZ A;  1PUF B;  2ZCW A;  1B6A A;  3HPG A;  4CXF A;  3OS2 A;  1SVM A;  2FF4 A;  2E2J J;  1RRJ A;  3HL2 A;  1IO2 A;  1VZ0 A;  1IW7 F;  2EFP A;  1Y8R B;  1Z91 A;  4E7J A;  4L9N A;  2X4H A;  1JKQ C;  2LSO A;  3DBH B;  3V8J A;  4BQA A;  1I50 J;  2Q2E A;  3ZOB A;  3J80 Z;  1Z7L A;  1I3A A;  1KYW A;  3F21 A;  3AG4 H;  2GXB A;  4ACI A;  2Z16 A;  4WCG A;  5CYV A;  3KP4 A;  1TQM A;  1V5G A;  3FXL A;  1BC8 C;  3HGY A;  4NDL A;  5TJJ A;  3GTP J;  3MFK A;  2V9P A;  3T6N A;  4XLP F;  4HQE A;  1VQ8 I;  5C4Y A;  2RNG A;  3L2W A;  1IN7 A;  2BGC A;  2ZJR F;  2KIU A;  2TDX A;  3C3W A;  4L5J A;  3CD6 I;  5EEA A;  4E70 A;  2HR3 A;  3I59 A;  1Z6R A;  3LSK A;  3ML6 A;  2M30 A;  1GHC A;  1K6Y A;  3I71 A;  3K4K A;  3MZY A;  3R6S A;  1VND A;  3COA C;  4CCO A;  1W7P A;  6PAX A;  3TW7 A;  3ZR8 X;  1Q1V A;  4XKC A;  5IYB J;  5HNF A;  1W36 D;  2V1X A;  3CDI A;  3DPT A;  1XX5 A;  1MD0 A;  2V6E A;  4QPO A;  2DFH A;  3HJE A;  1FEX A;  1R4M B;  4FTH A;  3PM1 A;  2HVQ A;  1OYW A;  2KKO A;  3HOZ J;  4ICH A;  2VI6 A;  3LST A;  4GRI A;  2BXY A;  4XBF A;  1AKH B;  2GXA A;  1ORK A;  2GOX B;  2PMH A;  4LK1 F;  3EUA A;  5TIS C;  2HYT A;  2DA4 A;  2P8T A;  3VVZ A;  1O4X A;  2XUB A;  3ZMZ A;  3MD2 A;  5L3C A;  1JTY A;  5E18 F;  2K27 A;  1HC8 A;  1G8X A;  4E7L A;  1HST A;  3RKW A;  4C30 A;  1OCT C;  2IRF G;  4CCL A;  1F36 A;  3OMY A;  4BY7 J;  2EV0 A;  2L9S A;  2M1B A;  4IHW A;  4BKX A;  1EH6 A;  3H0D A;  4BBS J;  4I6Z A;  1SVL A;  3R60 A;  5K1Y A;  1G59 A;  3R61 A;  1GXQ A;  3HOX J;  2FX0 A;  5TGT A;  2GIZ A;  1H89 C;  2A6T A;  5HS9 A;  3RYR A;  1FLI A;  3FIW A;  5EYR A;  3QPH A;  5EG0 A;  2CQ7 A;  2QGU A;  2NNY A;  5D19 A;  2E7W A;  4I01 A;  2OD5 A;  3BG5 A;  3OL4 A;  4A3K J;  2OTJ I;  2XGX A;  5BPD A;  1P6R A;  4HG2 A;  4F55 A;  1SVO A;  3L1P A;  2ZOZ A;  5D5X B;  3NNR A;  4ZYH A;  1QZY A;  2KMU A;  4M9S A;  3IV5 A;  1FTT A;  2W57 A;  2UXO A;  1FBQ A;  1HXD A;  3VW1 A;  5B1A H;  2ZXW H;  3MN2 A;  4UUS B;  3NWS A;  2BXZ A;  3HIF A;  1R49 A;  4IHT A;  1CQT A;  2JQ7 A;  3RKQ A;  3BG9 A;  5FGM A;  5D8L B;  4U7B A;  1SD6 A;  2H8R A;  5F0F A;  2QKL B;  5JHU A;  1V4R A;  1XS9 A;  2DMN A;  4ASN A;  1U78 A;  4UDS A;  3DLA A;  2XSD C;  3GTJ J;  5KHD A;  3V7R A;  1Y56 A;  1YOV B;  1JGG A;  3BHQ A;  2QZ8 A;  2BW3 B;  4ITV A;  4G7O F;  1YJW I;  2W53 A;  1IJW C;  3ESW B;  3UNG C;  2G9W A;  2LBF A;  3C2G A;  2N8G A;  4WXD A;  1ZG5 A;  1ZKG A;  1D3Y A;  1LJ9 A;  3RPU A;  2RAS A;  4XRS A;  4ESJ A;  5L3F A;  2PEX A;  4RA2 A;  3MKZ A;  1B72 A;  4S0H B;  1U8B A;  3BPX A;  5GTH C;  3SWH A;  2LVS A;  2OUM A;  4I0B A;  4U0V A;  1KYZ A;  4A3M J;  4BGD A;  2G7G A;  3HRU A;  3VTI A;  1KU3 A;  5ILS A;  3K4M A;  2L7F P;  5E1Z B;  3WGG A;  2ZKZ A;  2R7V A;  3WTU C;  2M34 A;  1OCZ H;  2X51 A;  2FOK A;  5CXG A;  2WAF A;  1MKM A;  5DAJ A;  3F3X A;  2ZXJ A;  4FE7 A;  3CC7 I;  3BTJ A;  1YO5 C;  2HOT A;  3HKZ A;  2F5V A;  2KIS A;  1LEB A;  2OC6 A;  4UUT A;  2DK8 A;  3IH4 A;  1OLT A;  2ZXH A;  3CTA A;  4U0W A;  2EZL A;  1SAU A;  3P9C A;  4AVP A;  3WOD F;  3V4G A;  1FZP B;  1XD7 A;  5CVU A;  3H3U A;  3ZQC A;  3RPU D;  2E71 A;  1XTA A;  4PFP A;  1XPX A;  4JBA A;  1UAA A;  2H1L A;  2GAU A;  2VL8 A;  2CMP A;  1HW2 A;  2KJB A;  4MO7 A;  1VQO I;  4PZJ A;  1YS7 A;  1G6N A;  4M3B A;  5IT9 Z;  4ZYE A;  3PUF A;  3DV8 A;  2ZCN A;  4IHX A;  3DBL B;  1IDZ A;  1MBG A;  4KN7 X;  2M4G A;  4OAZ A;  2EH3 A;  4RAF A;  4E7S A;  3JR9 A;  4WXH A;  4D9J A;  3VYR B;  1WSU A;  1FMW A;  5HOO A;  5IYC J;  5JVT A;  4M6V A;  1R1U A;  2FSW A;  2BHY A;  2IPQ X;  3AQT A;  1D1B A;  1YRN A;  1BI0 A;  2K4J A;  2CQQ A;  1E17 A;  4IZZ A;  3WHC A;  2STW A;  2FNA A;  3H9Q A;  4HLY A;  4MFE A;  4DYQ A;  1XMK A;  5FLM J;  1KON A;  4FIS A;  4Q4Z F;  2ZOY A;  2FBQ A;  1TL8 A;  4R8H A;  2PQ8 A;  3AL0 B;  4HV5 A;  4KMF A;  1W1W E;  2IXS A;  2CW0 F;  3EUH C;  5CPR B;  3RD3 A;  3MKY B;  1F1Z A;  2RQQ A;  2CW8 A;  5CW8 A;  5HS7 A;  3E7Q A;  1MW7 A;  4MNU A;  4OOI A;  1YS6 A;  5FB2 A;  3KYC B;  4LOC A;  4R79 A;  3LSP A;  1W7P D;  2NAZ A;  1ZN2 A;  3ZMD A;  4XMY A;  3FXU A;  3OV8 A;  5K7Z A;  1XMX A;  2NOJ B;  5C4X J;  2MSY A;  4OIO F;  2DMU A;  4BNC A;  2CQN A;  5CKT A;  2JRT A;  4BJ5 C;  1IN8 A;  4L9V A;  4ON0 A;  3V78 A;  3EQL F;  4E7Z A;  3DP7 A;  2HPI A;  3JRC A;  3JRG A;  4NC6 A;  1OJL A;  5C3E J;  2Z3Y A;  2R5Z A;  3JRF A;  4M72 A;  4U87 A;  2LF8 A;  2MC3 A;  4NUB A;  4W1U A;  1NHA A;  3KKC A;  3A02 A;  3HRS A;  2WAE A;  3KEO A;  5FFX A;  2XC7 A;  1BI2 A;  5H9T A;  1TTY A;  3CDH A;  2VKD A;  5J3L A;  3DBR B;  2VJJ A;  1HBX G;  1PUE E;  1PP7 U;  2E35 A;  5DM7 F;  1FX7 A;  4G7H F;  2MLK A;  2E19 A;  3QOE A;  3OYK A;  2ZJQ F;  4BXF A;  3E6M A;  4JNN A;  1HF0 A;  3JRE A;  2E36 A;  2Y48 A;  1ZHF A;  2YVE A;  3S1Q J;  2CV1 A;  1FOX A;  1A6I A;  4B43 A;  1MJB A;  3QYB A;  1J2X A;  1CF7 A;  2VJI A;  2CUZ A;  1BR4 A;  1VQK I;  3ZQ7 A;  4Y13 A;  2D6Y A;  3TOA A;  3TP3 A;  2HQN A;  5C4J J;  2PLY A;  3ZP5 A;  2O8X A;  2HS5 A;  2QWW A;  5C44 J;  4Q47 A;  2NRA C;  1MBH A;  3L9F A;  1WI9 A;  1ONV A;  5GAE J;  3WTS C;  2YX7 A;  1FP2 A;  5H6Q A;  3DPL C;  2XGD A;  3KCC A;  3V7C A;  1QU3 A;  1IRX A;  3NI7 A;  2CFX A;  3PNT A;  4UB6 C;  3HHH A;  4K2E A;  3NPI A;  1G3W A;  1W5C C;  3RPQ A;  4HV6 A;  5EDN A;  1H88 C;  2DFI A;  4LG0 A;  2EV5 A;  5J8C A;  1UJ8 A;  2WTE A;  1FYM A;  3ABM H;  2WAD A;  2XF5 A;  2X9D A;  3LAP A;  5LD2 C;  3G1L A;  1JI8 A;  3FBN B;  4U7D A;  2LOO A;  1ETO A;  3RQI A;  5LEK A;  4CH7 A;  1SAX A;  5DCM A;  1WGX A;  4LLG F;  2FBH A;  2LD5 A;  3D5S C;  4YFX F;  2YX4 A;  3SFZ A;  4ESF A;  2Y30 A;  2RAE A;  3ZMV A;  3M07 A;  2XAG A;  2Y69 H;  5A2Q Z;  5FLV A;  1IGN A;  5KAI C;  2HYJ A;  1GVJ A;  3CO6 C;  1WRJ A;  3S32 A;  1EA3 A;  2V9K A;  4GCV A;  2I5U A;  2G7U A;  2AQF A;  3PO3 J;  2NYX A;  1G3Y A;  1DGR M;  2WB1 N;  4UVB A;  3TDU C;  1P7I A;  1OR7 C;  5M3F J;  2EJR A;  1TC3 C;  1SD7 A;  3K4C A;  2HFH A;  2Y9Y A;  2A07 F;  1T0F A;  2QLZ A;  3LWJ A;  1WJD A;  2DMP A;  3E97 A;  4AYB A;  1KQ9 A;  1OCP A;  1PP8 F;  3CMY A;  4GO1 A;  1XN7 A;  4XON A;  3U1D A;  4DIQ A;  4O3M A;  1I1G A;  1UI5 A;  5GTI C;  5ICC A;  2LY9 A;  2E2I J;  4HRI A;  1BI1 A;  3MKL A;  2LH9 A;  2ACJ A;  4OU0 A;  1U9O A;  3FMQ A;  2YVX A;  4A5N A;  2QQB A;  1JGS A;  2HQA A;  4OIR F;  4GDF A;  3IAS 2;  2JRM A;  1D5Y A;  4JP0 A;  1RIO H;  4KDP A;  5LGU A;  4EGY A;  4GYI A;  4M71 A;  3C18 A;  2PBX A;  2ICW G;  2HGC A;  1QBJ A;  2QQ9 A;  2HWV A;  2G0E A;  4GCK A;  4A2U A;  4A3J J;  1N78 A;  3PAS A;  2GUH A;  3KZ9 A;  2FOW A;  3U1K A;  3AQS A;  2EIJ H;  4I0A A;  3IRQ A;  2XDV A;  5F04 A;  4ME9 A;  1BL0 A;  2VQH A;  3G2B A;  2QCO A;  3IKT A;  4NHJ A;  3F6V A;  3S1M J;  1ZAR A;  1B9M A;  2VBY A;  5FD5 A;  2OCC H;  1XSV A;  4DW6 A;  5HLH A;  4MQ9 F;  2UXN A;  4YFN F;  4HF2 A;  2UXU A;  1SD5 A;  4YIR X;  2H6C A;  4XRS G;  3BG3 A;  2CO5 A;  3RCO A;  3ZMS A;  4C3J J;  3QAH A;  3LSM A;  3Q0W A;  1SMY F;  1LEA A;  2RRE A;  3FXO A;  5F1R A;  4ZDO A;  3QWL A;  4UUV A;  4PK4 A;  3F9K A;  2PJR B;  2CWE A;  4RB0 A;  2CQK A;  4PDK A;  2VBX A;  1R5G A;  1MGT A;  3IWF A;  5ICF A;  3MEX A;  5K5O A;  5FKM A;  3JAM K;  4A3E J;  3FK7 A;  2VXD A;  3CJQ B;  4EAT A;  3BCB A;  4GXO A;  3J80 K;  1UG0 A;  2PFV A;  1G2H A;  2M5W A;  1V5E A;  4NBQ A;  1XC5 A;  3BZC A;  5B66 C;  3S8P A;  1K7A A;  4A6D A;  2M2E A;  3W2V A;  4WK8 F;  3H5N A;  4UVA A;  2J5P A;  9ANT A;  2KRH A;  1T0F C;  4DOZ A;  1S72 I;  3W2A A;  2XAH A;  4RGS A;  1LVK A;  4E4H A;  1MMS A;  4U9N A;  2NS0 A;  3MZ8 A;  2HXO A;  3K1P A;  1T56 A;  3KYD B;  1KQ8 A;  2R7Q A;  4HDU A;  2Q8K A;  5FGL A;  3BG7 A;  2HOA A;  5ILV A;  3BJO A;  3B6A A;  2X6X A;  3N05 A;  3ZQQ A;  1FJL A;  4II2 A;  2M9H A;  2ECC A;  3VUQ A;  4JX5 A;  4M73 A;  2QSG X;  1W36 C;  2XKO A;  2DA1 A;  1CGP A;  2NVU B;  1KU7 A;  3CCL I;  2F4M B;  2B63 J;  2KQR A;  1JUS A;  2XF6 A;  1BOA A;  2P5K A;  4BXU A;  4A3I J;  5LBQ A;  5F0H A;  3J7A Y;  4CA0 A;  1J09 A;  1ACI A;  3GZ6 A;  2DG8 A;  3ABT A;  2AO9 A;  1B9N A;  3KYL A;  3K70 C;  2K5C A;  4BE2 A;  2LNB A;  3GEZ A;  3BR5 A;  2RGV A;  4HW0 A;  4N9I A;  3ZMT A;  1T39 A;  1GUU A;  2B7E A;  1GV2 A;  1P2F A;  1UCR A;  1PUF A;  3G1M A;  2EBI A;  4LMY A;  4EJV A;  2OZ6 A;  4HEA 2;  4A0Z A;  5IP7 J;  4NB5 A;  4HKU A;  2IEK A;  3O60 A;  2KZG A;  3PFY A;  5IOZ A;  1ZRC A;  3G4S I;  4ENM A;  2EIN H;  5CQE A;  1K4S A;  3QP6 A;  3QYE A;  4BQQ A;  3VW0 A;  2R7D A;  4HNV A;  4BAY A;  5EG0 B;  2K85 A;  2YVH A;  1HDD C;  1GLN A;  2Z9O A;  4IJA A;  2DJN A;  1HQC A;  3K2Z A;  4LK0 F;  4EMS A;  3P9T A;  3M4O J;  2QF7 A;  4F93 B;  1C0W A;  5F08 A;  3BOQ A;  1S7A A;  1A35 A;  3E6D A;  5F0C A;  3L2R A;  1N75 A;  1NH3 A;  3NRG A;  1BC7 C;  3GZN B;  3MAJ A;  2EIM H;  1D0Y A;  4XKW A;  3KP5 A;  2WY8 Q;  1EV7 A;  5JHF A;  1J5Y A;  2F2E A;  4LB6 B;  2KIF A;  2CUJ A;  2RKH A;  3CF5 F;  3HTS B;  2O7T A;  2DA3 A;  3CES A;  3ROU A;  1Z3X A;  3PIP F;  2KRF A;  2X48 A;  5CLS A;  3HIM A;  1TNS A;  1HDP A;  2ISY A;  1ODD A;  1X1P A;  5EFY A;  3G6E I;  2LBF B;  1USS A;  2DA6 A;  1QQI A;  1JUM A;  2IP2 A;  3PIO F;  5D4S A;  1XSD A;  4RB2 C;  2NVX J;  1X3W B;  2K9S A;  5E1X A;  3BR3 A;  2KJC A;  3CCY A;  4AIK A;  2Y75 A;  4KT5 C;  2CRG A;  2F6C A;  1WVR A;  3CCR I;  1MND A;  1W7P B;  3QRF F;  3BTI A;  2KDZ A;  5ED4 A;  3HRM A;  4FHT A;  3SEZ A;  1KZH A;  1R1T A;  4HA8 A;  2BEO A;  2WV0 A;  2E5N A;  3ASO H;  4CYD A;  5FKK A;  5ILU A;  4BY1 J;  2OER A;  3DFG A;  3HEF A;  3DCF A;  1T98 A;  2OA4 A;  4BJ6 C;  5L3D A;  3JSP A;  3KIO A;  4EM1 A;  5LGT A;  3J7Y J;  1MJ9 A;  3KE2 A;  2YU3 A;  4C2T A;  3GYH X;  3SYT A;  4AM3 A;  1UEL B;  2DT6 A;  1JJ6 C;  3E0J B;  1NG7 A;  2OPT A;  3WTZ A;  4CCN A;  2JA2 A;  2VB6 A;  3ZQI A;  1R22 A;  3KEY A;  3S1R J;  4A12 A;  4KUM A;  1OYY A;  4RGX A;  4BHB A;  3BNI A;  1RI7 A;  1Q1H A;  1OYI A;  3QYF A;  2Y9Z A;  3ERE D;  3BQY A;  3D5L A;  3E5X A;  1QGP A;  1DP7 P;  3VOK A;  3G3Z A;  3CDL A;  1LE8 B;  2Q2E B;  1X1C A;  4XM3 A;  3J81 K;  2QBY A;  2K7L A;  2PFB A;  2X1E A;  3OYM A;  2IS6 A;  4BDZ A;  3ECO A;  2F4I A;  2V26 A;  4FT8 A;  5FFZ A;  3GTO J;  4BYY A;  1BBY A;  2LY2 A;  2W7N A;  1W5T A;  1X4P A;  4IQ4 A;  3VB2 A;  3S93 A;  1HW1 A;  1I5Z A;  5E1W A;  1BJZ A;  2W82 A;  3V42 A;  2LLK A;  2RC4 A;  3BR1 A;  2ZME A;  4D7N A;  4EJO A;  2VPL A;  1LE8 A;  2Q0O A;  1W5S A;  2O9L A;  4OD5 A;  2KT0 A;  3TP0 A;  3WTY C;  2GFN A;  2K9N A;  2JJ7 A;  1Z3Y A;  5DTD A;  5L3G A;  2E1N A;  2I8D A;  3K4J A;  4B3X A;  2ID6 A;  3CUQ C;  1AKH A;  2LTP A;  1ENH A;  5FKO A;  2MH9 A;  4CUG A;  2V57 A;  3VOE A;  1BR1 A;  4RLF A;  4F91 B;  2EK5 A;  2P0W A;  2OU2 A;  4ENN A;  1IN5 A;  4C3I J;  3OYI A;  3OOU A;  2DT5 A;  2Y0S N;  4B4C A;  3LNQ A;  1YLF A;  1FTZ A;  5D1R A;  3JSJ A;  2P81 A;  1XMA A;  1PJR A;  3WTT C;  3OYE A;  4V19 K;  1FBU A;  1XCB A;  3ABU A;  4KT6 A;  3H0G J;  4RM2 A;  3WTX C;  3L2Q A;  3JRI A;  1F5T A;  1FC3 A;  4LLL A;  2V6C A;  1QNT A;  4A5M A;  3OSG A;  5HNH A;  1W0T A;  2XPU A;  2KPM A;  4GFK A;  3LA7 A;  3FIS A;  4G94 A;  3WGH A;  4AWX B;  3IAM 2;  4L0Y B;  3I54 A;  3HKZ N;  3CCS I;  3DEE A;  1FMV A;  2PG4 A;  1TNT A;  2FBI A;  2Y31 A;  1Y8Q B;  1R6R A;  4X0G A;  2DA7 A;  2GA2 A;  2OAZ A;  1EKE A;  4C2U A;  1ETX A;  4NC7 A;  3MNL A;  3K0L A;  4O6J A;  1UZC A;  2JZY A;  1FSE A;  2COM A;  2GWR A;  2IA2 A;  3HPH A;  1VFC A;  2BY3 A;  1JXS A;  2ELH A;  2CQX A;  3GXO A;  4BH9 A;  1O57 A;  4D5F A;  2DW4 A;  3WU1 B;  2FA5 A;  3M8F A;  1FNN A;  1S8N A;  2RN7 A;  2HQ5 A;  1T08 B;  4YEJ A;  2HVR A;  3GME A;  3GFI A;  1SFO J;  5KNL A;  3G7R A;  4E6K G;  1D5V A;  3TQN A;  4PSX A;  2EA2 A;  2JA5 J;  5J1Y A;  3UKG A;  1QHH D;  3HUG A;  4HLX A;  1RR7 A;  2O03 A;  3CJR B;  2HDW A;  3ABL H;  2MBF A;  2UWM A;  4XKV A;  3HGG A;  4MEX F;  1D8J A;  2HOE A;  1A04 A;  1Z0X A;  2LP0 A;  4QTR A;  2NOG A;  3SDB A;  2DYS H;  3RKY A;  3IHU A;  3GFJ A;  2XRO A;  3L09 A;  5E20 A;  5E17 F;  4HX4 A;  2G3B A;  2ZSI B;  3DU5 A;  4M3D A;  5JLX A;  2FQ4 A;  1J59 A;  1X4O A;  2QEN A;  3EUP A;  3ON2 A;  2F5D A;  2ZME C;  4BL0 B;  1LB2 A;  2ZNY A;  4KJZ A;  4M3F A;  1D8K A;  3V6G A;  1TZL A;  1MH4 A;  1S7O A;  2QEX I;  4MK6 A;  1POG A;  1YW9 A;  2ZME B;  3ASN H;  4JOM A;  2X0L A;  1JKR C;  2M7A A;  5EGO A;  1BI3 A;  3T0Y A;  3B81 A;  1KGS A;  2NVQ J;  2K02 A;  2QM3 A;  4BDY A;  2GM4 A;  2H6B A;  2IGK A;  3CZ6 A;  3VYU B;  3FHN A;  2FEZ A;  3RDI A;  2X6W A;  2JSP A;  3ANP A;  1G3T A;  1XSX A;  5E8G A;  4EJW A;  5CVV A;  1SAN A;  2D45 A;  3KNW A;  4EJU A;  2M87 A;  4C2M A;  1DP3 A;  1ZGJ A;  3OYC A;  2L2O A;  3CUQ B;  1BA5 A;  2FBK A;  2LFB A;  1FSH A;  3U21 A;  5LRR A;  4ETS A;  3FXM A;  2RVC A;  1MMG A;  1WCM J;  2L9N A;  4P1W A;  4Y15 A;  1K78 A;  3QU3 A;  3MMY B;  3LAJ A;  4CCM A;  1YIT I;  1BJA A;  4B3A A;  4G7Z F;  4LJZ F;  3ZQG A;  2ZC2 A;  1H8A C;  2ME0 A;  1ZRF A;  3DU6 A;  2ZJ2 A;  2UXP A;  2XIG A;  3ZN0 A;  3DTE A;  4CHU A;  5HOD A;  1R36 A;  3FF5 A;  3GO5 A;  4BBR J;  1DQU A;  4Y33 A;  4UUS A;  4MHG A;  3IP4 B;  3W6V A;  2XKP A;  4XN0 A;  4Y4R A;  4B09 A;  4Q5S F;  3BG6 A;  1QPM A;  3ONQ A;  2EIK H;  3VEP A;  3FXR A;  2H1K A;  4MXM A;  2ID3 A;  2ZXI A;  1AA7 A;  1TQP A;  1XDS A;  5H6R A;  3S17 J;  4CZC A;  3LJL A;  2DOF A;  1AWC A;  2IS2 A;  3M7G A;  2CS3 A;  2MW8 A;  3KZY A;  2ADU A;  5DEQ A;  4XK4 A;  3R0J A;  3J7A O;  2GOM A;  4KWA A;  2KLO A;  2Z33 A;  1LUJ B;  1YW7 A;  3K1N A;  3TKY A;  3JAM Z;  5L3E A;  1I6H J;  4B47 A;  2HPM A;  3EYY A;  1O3Q A;  1L0O C;  1WJB A;  4UNO A;  1AOY A;  3FKJ A;  1WJC A;  2DJI A;  2K3F A;  1NTC A;  4YZE A;  1DDN A;  2ZJP F;  1X1A A;  4A0Y A;  4IOA F;  3E5Q A;  3S3O A;  4M74 A;  5D6F A;  4ZZD A;  2WGB A;  2V1N A;  2XDN A;  4QPQ A;  2ZY9 A;  1H0M A;  1LQ1 A;  3WU0 A;  3HBL A;  2BBY A;  1B8I A;  2V1U A;  2GEN A;  1ZG1 A;  4QIW N;  4X6A J;  1O3S A;  2G7H A;  1ZAO A;  1ZGA A;  3MQ0 A;  3JRA A;  4OIP F;  1T8I A;  2LRE A;  2H27 A;  2NS7 A;  2DTZ A;  2ME6 A;  2WY7 Q;  2E2H J;  4J00 A;  2DPD A;  1B4A A;  1WWX A;  2MGQ A;  2X6O A;  1LPQ A;  2O61 A;  1SFE A;  2W00 A;  4XRM A;  3CCJ I;  4EJT A;  1WZ2 A;  5IYD J;  2VT2 A;  5JFR A;  5CVR A;  2XAJ A;  3H1C A;  4C2M J;  4ZH4 F;  2MYS A;  4L5I A;  4BU2 A;  4XR6 A;  2UXI A;  1FT9 A;  2EFO A;  2P6T A;  1R1V A;  4HNT A;  2V9V A;  5KAF C;  2YSR A;  3OYF A;  1MZB A;  3K6G A;  4IKF A;  2BVL A;  3ZGK A;  1N25 A;  2DK5 A;  2GZW A;  3BR0 A;  1G4D A;  3BC8 A;  1QA6 A;  3LSG A;  4P55 A;  4HOB A;  4XLC A;  5K5R A;  5JVG F;  3NRV A;  3HTU A;  1A31 A;  3NWT A;  1P7J A;  2A05 A;  5L3B A;  1S6L A;  2QBY B;  2JSC A;  4PFO A;  2K40 A;  3AKZ A;  4Y52 J;  1VQ5 I;  1FPQ A;  5E79 C;  4CCK A;  5D5V B;  2DQR A;  3DPJ A;  2EA4 A;  1QVT A;  3DLL F;  4RMN A;  4UY8 I;  1A6Q A;  3A0B C;  3E6C C;  1JT6 A;  2LG4 A;  2TRT A;  2X85 A;  2P4W A;  1Y6I A;  1V55 H;  1Z6T A;  2O0Y A;  3ZXS A;  2G7S A;  4EQQ A;  3I55 I;  1WI3 A;  3ULQ B;  1U6G A;  1V5F A;  1ZR2 A;  1WH7 A;  2ECB A;  1X2M A;  3I58 A;  3C1D A;  1OCR H;  3B73 A;  2EZK A;  4FQG A;  5BPI A;  1J75 A;  2PJP A;  2FJ1 A;  4FX4 A;  2P5L C;  1ZYR F;  1Z1D A;  1YTY A;  1QRY A;  4BHC A;  5F64 A;  5HDN A;  2V1D A;  3PJR A;  3OS0 A;  1O3R A;  1E3H A; 
#chains in the Genus database with same CATH homology
 1PUF A;  3G1M A;  2EBI A;  2IU5 A;  4CGR A;  4A3G J;  1VND A;  5IP7 J;  1UI6 A;  2VKE A;  1YRN B;  4HKU A;  3VW2 A;  3TW7 A;  2IEK A;  1Q1V A;  2R92 J;  5IYB J;  3O60 A;  3BR6 A;  4DYC A;  1R9T J;  5IOZ A;  5E3O A;  2M8G X;  1UHS A;  1W0U A;  4JYK A;  1FEX A;  5F27 A;  2CUF A;  4FTH A;  3VW0 A;  3PM1 A;  2OF7 A;  3B6C A;  4HNV A;  1ZQ3 P;  5EG0 B;  3HOZ J;  4ICH A;  2VI6 A;  3GTK J;  2YVH A;  1HDD C;  1VF9 A;  1IDY A;  2GLO A;  2JMW A;  1UMQ A;  2O8K A;  1IUF A;  2DJN A;  1AKH B;  3COL A;  1ORK A;  2EZI A;  3O8G A;  4XIC A;  1JT0 A;  3P9T A;  3M4O J;  2QF7 A;  2HYT A;  2DA4 A;  1IC8 A;  3VVZ A;  5F08 A;  3Q0V A;  1O4X A;  1JJ8 C;  3K7A J;  1JTY A;  4RBO A;  5F0C A;  3ZQF A;  3RZD J;  1OCT C;  3S2H J;  3NRG A;  2NS8 A;  3EGQ A;  1RKT A;  1F36 A;  4BY7 J;  4IHW A;  5IOY A;  4BKX A;  5GPA A;  1HOM A;  3BJB A;  3D1N I;  2NVT J;  4I6Z A;  4BBS J;  5HAW A;  4L62 A;  2O7T A;  3VPR A;  3A01 A;  1IV6 A;  2DA3 A;  3HOX J;  1MBF A;  2FX0 A;  2QWT A;  2GBY A;  1IG7 A;  5GPC A;  1H89 C;  2X48 A;  4MFD A;  3HIM A;  3FIW A;  5EYR A;  1HDP A;  5EG0 A;  5EGO B;  5D19 A;  2EZH A;  1OFC X;  5EFY A;  3BG5 A;  3LSR A;  2DA6 A;  4A3K J;  1JUM A;  3L1P A;  5FKN A;  3M3Y J;  3S14 J;  2ZOZ A;  3NNR A;  2NVX J;  3HDD A;  3G1O A;  3IV5 A;  1FTT A;  2REK A;  2K9S A;  3BR3 A;  3CCY A;  2CU7 A;  2NX4 A;  3OSF A;  2UXO A;  5FKL A;  2CRG A;  3WHB A;  4BXX J;  3VW1 A;  3BTI A;  3MN2 A;  2KDZ A;  3F1B A;  4UUS B;  1CQT A;  2R5Z B;  2JA6 J;  1HLV A;  2LK2 A;  3RKQ A;  3BG9 A;  4A3L J;  2F07 A;  1X58 A;  2H8R A;  1E3O C;  1ITY A;  5F0F A;  1MBK A;  3SFI A;  5FKK A;  4BY1 J;  3IUV A;  2OER A;  1XS9 A;  2DMN A;  1T33 A;  3HEF A;  1U78 A;  3DCF A;  4UDS A;  2VPR A;  2XSD C;  3F0C A;  3GTJ J;  4D5C A;  3LSJ A;  2ZCX A;  5BNG A;  5M3M J;  2DA5 A;  5JLW A;  1SGM A;  4MIM A;  4AC6 A;  3QPS A;  1JGG A;  3BHQ A;  1Y1W J;  2FD5 A;  2W53 A;  1JJ6 C;  1IJW C;  3CWR A;  2YU9 J;  2N8G A;  2OPT A;  1ZKG A;  3ZQI A;  4GCT A;  2IBD A;  2QTQ A;  3C2B A;  4XRS A;  2RAS A;  3S1R J;  1B72 A;  4S0H B;  2UXH A;  2JK3 A;  1U8B A;  1MNM C;  3BNI A;  2G7L A;  3BQZ A;  2IAI A;  2LVS A;  5HBU A;  2DA2 A;  2PMZ N;  2JN6 A;  4A3M J;  2Y9Z A;  2R0Q C;  2G7G A;  3BQY A;  1ETW A;  3VOK A;  1GT0 C;  4AUX A;  1DU0 A;  2XPV A;  3CDL A;  3E7L A;  4W97 A;  1LE8 B;  2E1O A;  5M5Y J;  2L7F P;  1TWF J;  2M34 A;  3HOU J;  2JA8 J;  1K83 J;  3I4N J;  3JRD A;  2WUI A;  5CXG A;  2DN0 A;  5DAJ A;  4FE7 A;  2YS9 A;  5J1R A;  3BTJ A;  1QPI A;  2HOT A;  3G56 A;  4JKZ A;  3GTO J;  4UUT A;  1RES A;  3IH4 A;  5FHP A;  2EZL A;  3KKD A;  3QKX A;  2ELK A;  3RH2 A;  4J19 A;  3ZQC A;  1BJZ A;  5EZH A;  5IPA A;  3S5R A;  2LLK A;  3GBG A;  3BR1 A;  3Q0U A;  4D7N A;  4MO7 A;  1TWC J;  4GFL A;  1LE8 A;  2M0C A;  4M3B A;  3S16 J;  2O9L A;  2KT0 A;  2O7O A;  1F43 A;  3TP0 A;  1WH5 A;  1HCR A;  2WAQ N;  2CUE A;  2K9N A;  2XB5 A;  2JJ7 A;  2GFN A;  2Y2Z A;  5GP9 A;  2ZCN A;  4IHX A;  5DTD A;  1I3Q J;  1TWA J;  1IDZ A;  1MBG A;  3HB9 A;  2ID6 A;  4CYC A;  4DYR A;  1AKH A;  2LTP A;  1ENH A;  1MBJ A;  5FKO A;  2R93 J;  2L9R A;  2EH3 A;  1TWG J;  3SDG A;  1GDT A;  4NEL A;  3JR9 A;  2V57 A;  2XRL A;  5IYC J;  4M6V A;  1UG2 A;  4C3I J;  2R5Y A;  3AQT A;  3OOU A;  3FK6 A;  1YRN A;  2Y0S N;  4B4C A;  3LNQ A;  1FTZ A;  2CQQ A;  5D1R A;  3ZQH A;  3JSJ A;  2P81 A;  3GTL J;  3WHC A;  1JTX A;  4MFE A;  4DYQ A;  1Z77 A;  5FLM J;  4FIS A;  3H0G J;  1ZR4 A;  2FBQ A;  2ZOY A;  2XPW A;  3JRI A;  1ETY A;  3VOX A;  4A69 C;  3RD3 A;  4PXI A;  5CW8 A;  3E7Q A;  3OSG A;  1W0T A;  5CXI A;  2XPU A;  4LOC A;  3IH2 A;  4GFK A;  1MH3 A;  3LSP A;  3FIS A;  5K7F A;  3TW6 A;  1ETV A;  3HKZ N;  3QPL A;  5K7Z A;  4AC0 A;  2Y31 A;  5E3N A;  5C4X J;  2MSY A;  2DMU A;  1GV5 A;  2DA7 A;  2DG7 A;  3HTI A;  5FMP A;  1X2N A;  1ETX A;  3MNL A;  3V78 A;  3CRJ A;  3JRC A;  3JRG A;  1VFC A;  1OJL A;  5C3E J;  2CQX A;  2R5Z A;  4EEF G;  4D5F A;  2XB0 X;  3JRF A;  3PPB A;  4FCY A;  1AU7 A;  2HQ5 A;  1A5J A;  4W1U A;  3KKC A;  3A02 A;  1RET A;  1SFO J;  3G7R A;  5H9T A;  2JA5 J;  1EF4 A;  5J1Y A;  5J3L A;  3UKG A;  3QQA A;  1RR7 A;  3BTC A;  3O8H A;  3VP5 A;  4V2G A;  3HGG A;  1FIA A;  4JX6 A;  5DS9 A;  2AHQ A;  1Z0X A;  2LP0 A;  3S2D J;  4QTR A;  2E19 A;  2NOG A;  4JNN A;  1HF0 A;  5E3M A;  3JRE A;  5FJ8 J;  2YVE A;  3ON4 A;  3S1Q J;  1A6I A;  2VKV A;  1ETK A;  3GTQ J;  2G3B A;  4AYB N;  2D6Y A;  4MLO A;  3TP3 A;  5C4J J;  4M3D A;  5JLX A;  3HOW J;  5C44 J;  3S15 J;  1XG1 A;  1BW5 A;  2FQ4 A;  1MBH A;  3Q3S A;  3EUP A;  3ON2 A;  2I10 A;  4IHY A;  2XGD A;  3GZI A;  2RHA A;  3RZO J;  3NI7 A;  4M3F A;  3V6G A;  3NPI A;  1MH4 A;  1U9N A;  2WV1 A;  2EQR A;  4X1E A;  5EDN A;  1H88 C;  4MK6 A;  1POG A;  1JKR C;  3OIO A;  5EGO A;  1VI0 A;  3HTA A;  3B81 A;  3HTH A;  4G12 A;  2X9D A;  2NVQ J;  3VVX A;  3G1L A;  3A03 A;  5F1J A;  2GM4 A;  4GCL A;  4XID A;  3VVY A;  1ETO A;  3RQI A;  1WGX A;  1RPW A;  1MSE C;  2OI8 A;  3ANP A;  3HOV J;  1TWH J;  2LD5 A;  5AQC A;  1SAN A;  4C3H J;  2Y30 A;  5IP9 J;  1B72 B;  2RAE A;  4JL3 A;  5FLV A;  3KNW A;  2TCT A;  1IGN A;  1IRZ A;  2XGE A;  2HYJ A;  1ZK8 A;  5EZG A;  2LR8 A;  3I4M J;  1BA5 A;  2ZCM A;  2LFB A;  3HE0 A;  3PO3 J;  1ZGW A;  1WCM J;  4V2F A;  2L7Z A;  2NP3 A;  2WB1 N;  3SJM A;  1P7I A;  5M3F J;  3CJD A;  1TC3 C;  4B3A A;  2CJJ A;  2Y9Y A;  3C07 A;  4NN1 A;  1JUP A;  3BTL A;  3ZQG A;  1H8A C;  2ME0 A;  1QVU A;  3LWJ A;  2DMP A;  2UXP A;  1OCP A;  2HI3 A;  5HOD A;  3CMY A;  2QKO A;  4ABZ A;  3S1N J;  3GTM J;  3IH3 A;  2HDD A;  1UI5 A;  4BBR J;  2LY9 A;  4UUS A;  3JRB A;  2E2I J;  2L0K A;  4A3C J;  4M3G A;  2W48 A;  2QOP A;  3W6V A;  3MKL A;  5M5W J;  2VUM J;  4L5E A;  1U9O A;  3BR2 A;  2MG4 A;  2L7M P;  2H1K A;  3VIB A;  1GVD A;  4MXM A;  2ID3 A;  4A3D J;  3S17 J;  3LJL A;  1D5Y A;  4JP0 A;  3FRQ A;  4IEJ A;  2MW8 A;  1ETQ A;  3HOY J;  4XK4 A;  2PBX A;  4CYC B;  4KWA A;  1I6H J;  2G0E A;  3PO2 J;  4GCK A;  2PZ9 A;  1RKW A;  4A3J J;  3ZQL A;  3PAS A;  4M3E A;  1NTC A;  3JRH A;  2GUH A;  3KZ9 A;  2R5Y B;  3AQS A;  4YZE A;  2K9Q A;  1WPK A;  3TED A;  5F04 A;  4ME9 A;  2R7Z J;  2WGB A;  1BL0 A;  2XDN A;  1NK2 P;  2QCO A;  3S1M J;  2D5V A;  3HBL A;  1B8I A;  2GEN A;  4DW6 A;  4A93 J;  2LKX A;  4QIW N;  3LHQ A;  4X6A J;  4Y7N J;  2UXU A;  4D7M A;  3JRA A;  3K2A A;  1APL C;  1MBE A;  4XRS G;  3BG3 A;  2NS7 A;  4DZJ A;  3GEU A;  2DTZ A;  2ME6 A;  2HOS A;  4AF5 A;  4C3J J;  3A01 B;  1S7E A;  3Q0W A;  5IP6 A;  2E2H J;  2MGQ A;  1JKP C;  4IHV A;  2X6O A;  1NK3 P;  2DMQ A;  4XRM A;  1AHD P;  5M5X J;  5IYD J;  2HXI A;  3DEW A;  4C2M J;  2UXI A;  1DU6 A;  3LOC A;  4A3E J;  5FKM A;  3FK7 A;  3HM5 A;  1LFU P;  3NAU A;  3FKI J;  1G2H A;  3BR0 A;  4DZP A;  1MSF C;  4JX4 A;  3GTG J;  2Q24 A;  3NXC A;  2XGC A;  1XC5 A;  3LSG A;  1K61 A;  3BRU A;  5D18 A;  2COB A;  2DMT A;  2M2E A;  5J1U A;  4A3B J;  2NVY J;  2YUS A;  4A3F J;  3MVP A;  5K58 A;  3BT9 A;  9ANT A;  3HTJ A;  4RDU A;  1P7J A;  5E3L A;  4FE4 A;  2HKU A;  2K40 A;  3NAR A;  2HXO A;  4Y52 J;  1T56 A;  5HSZ A;  1FIP A;  5FGL A;  3ANG A;  3DPJ A;  2ZB9 A;  1QVT A;  2HOA A;  4GFB A;  1BW6 A;  5K7H A;  2QIB A;  3B6A A;  1PUF B;  1FJL A;  1JT6 A;  2TRT A;  1ZTR A;  2M9H A;  4B1R A;  2ECC A;  1B8I B;  4JX5 A;  2E2J J;  3H3V K;  3VUQ A;  2G7S A;  3QBM A;  4I76 A;  1JKQ C;  4QSH A;  1WI3 A;  1ZR2 A;  1WH7 A;  1I50 J;  2DA1 A;  2ECB A;  3ZOB A;  2JA7 J;  1X2M A;  2B63 J;  4ACI A;  1JUS A;  4A3I J;  2EZK A;  5F0H A;  1LFB A;  3HGY A;  4NDL A;  2NP5 A;  2DG8 A;  3CQZ J;  2FJ1 A;  5EF6 A;  2AO9 A;  1JKO C;  3GTP J;  3T6N A;  5C4Y A;  1Y1V J;  1QRY A;  3BR5 A;  5EEA A;  2JWT A;  1GUU A;  1GV2 A;  3BCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...