3PM1A

Structure of qacr e90q bound to ethidium
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
185
structure length
185
Chain Sequence
LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single acidic residue can guide binding site selection but does not govern QacR cationic-drug affinity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 74
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3pm1A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pm1A02
2DTZA 1MBKA 2V57A 2N8GA 4A3LJ 1TWAJ 2VUMJ 2DMUA 3IH3A 1WPKA 3JRGA 2ZCNA 4JL3A 1GV2A 4JKZA 1JTYA 2M0CA 1O4XA 1B72A 2IU5A 1HLVA 1Y1WJ 5IP9J 3OSGA 3NAUA 3WHBA 1IJWC 3IUVA 3V6GA 2K9QA 3B6AA 1A6IA 3HOVJ 3HDDA 2G7LA 4W1UA 3M3YJ 2LP0A 5FKKA 4A3FJ 4FTHA 4AUXA 1H88C 1UG2A 1ORKA 2WB1N 5EDNA 3MN2A 4Y52J 3LOCA 3S2DJ 1CQTA 5E3MA 3OOUA 1FIPA 1IC8A 3GTKJ 3QPLA 5E3LA 4XK4A 2YVHA 3GTGJ 4JYKA 2R93J 4C3JJ 4S0HB 1EF4A 4V2FA 3VPRA 1LE8B 1JKOC 4DYQA 3K7AJ 2VPRA 2CQQA 1WI3A 5FKNA 4MIMA 1DU6A 2DA4A 1VI0A 3V78A 2WGBA 1GV5A 3BRUA 2H1KA 3KKDA 4M3GA 4A69C 3BR5A 3NRGA 3QKXA 2NP5A 5K7FA 3TEDA 2Q24A 3FIWA 4A3EJ 2HKUA 2YVEA 2E2JJ 3BJBA 3HTJA 3GBGA 1PUFA 1ETQA 1B8IB 1ENHA 2NVTJ 2KT0A 1BL0A 4G12A 1U78A 1ZKGA 5K58A 1FJLA 1WH7A 4BBSJ 2ZOYA 1AKHA 1FEXA 1AHDP 2XB5A 5IOYA 3BG9A 3E7QA 3TP3A 2EQRA 2E19A 2YUSA 3A03A 3FK6A 4XICA 2LK2A 2DMNA 1MBGA 5EF6A 2JWTA 1QVTA 1OJLA 3SJMA 4IHYA 4ACIA 4C2MJ 3BQZA 3LSPA 2TCTA 5EZGA 1D5YA 5C4XJ 3HTAA 2YS9A 1IDYA 2R5ZB 3KKCA 4GFKA 4MK6A 2NOGA 1BW6A 3GTQJ 2L7MP 1WCMJ 4I76A 5M5WJ 2ID3A 3B6CA 2M34A 2UXHA 4A3JJ 3PM1A 4AYBN 2PBXA 1WGXA 1YRNB 2NS7A 3BT9A 2QWTA 4AC0A 4BKXA 3DCFA 2LFBA 3BTLA 2CQXA 2TRTA 2XSDC 3ON4A 2Y2ZA 2CU7A 2DMTA 3EUPA 3PPBA 1S7EA 2ELKA 3BG5A 4BY7J 2FJ1A 1W0TA 4BY1J 1FIAA 5DAJA 1JJ6C 1TWHJ 3HTIA 1MBHA 4IHXA 4UUSB 1JT6A 3QBMA 1OCTC 1UI6A 4RDUA 3S1QJ 2ECBA 1IG7A 5FLMJ 1GT0C 3HEFA 2RAEA 1JKRC 1ZQ3P 1HDPA 3GTPJ 2HOTA 2DMQA 2ME6A 3MKLA 5CXIA 1MBFA 2VKVA 2DA5A 3L1PA 3O60A 1TWGJ 5FKOA 2KDZA 1IV6A 4FE4A 2H8RA 1ITYA 5EGOB 1RKWA 1ETYA 3FISA 2IEKA 4DZJA 1TWFJ 1Y1VJ 3F1BA 2DMPA 2OERA 1I50J 3ZOBA 4D5CA 1BW5A 3CJDA 2GBYA 1GVDA 2EZIA 2Y30A 5FKMA 3JRCA 4A93J 3DEWA 3NNRA 3CWRA 3JR9A 3ZQGA 1JUPA 2DA3A 1BA5A 3ANPA 1H89C 1Q1VA 3CMYA 1QRYA 2HI3A 2FX0A 2DA7A 4AF5A 1TWCJ 5IPAA 4A3GJ 1QVUA 4CGRA 1IGNA 1P7IA 2AHQA 1DU0A 3CQZJ 2LKXA 1MNMC 3S1RJ 2EZHA 4B4CA 3LNQA 1LFUP 5IYBJ 2D6YA 4KWAA 3HBLA 5EG0A 3HKZN 1ZGWA 2DA6A 3GZIA 3HM5A 5M5YJ 1JKPC 2FD5A 1HDDC 3KZ9A 3WHCA 4MO7A 3O8HA 4M3FA 2L0KA 2M2EA 3JRHA 3FRQA 3G1MA 4XRMA 2XGDA 5F27A 2K9NA 5M5XJ 2L9RA 2CJJA 2HDDA 1RPWA 2CRGA 2NX4A 4A3CJ 3Q0VA 2JA5J 5FJ8J 3S1NJ 4FE7A 5D19A 2LVSA 5BNGA 5C3EJ 2JJ7A 4QTRA 5DTDA 2L7ZA 4ICHA 1RESA 4XRSG 3PO3J 2YU9J 3CRJA 4DYCA 3FK7A 2EH3A 3CDLA 2Y9ZA 3JRDA 3PO2J 5J1UA 3ZQIA 2L7FP 2ME0A 3ZQHA 5M3MJ 2M9HA 2D5VA 3BTIA 2I10A 1RR7A 4LOCA 3D1NI 1VNDA 2G7SA 3VP5A 1JUMA 3BQYA 3Q0WA 1MBEA 3HB9A 3BR2A 2ID6A 1MH3A 3JRIA 2R5ZA 1ETKA 2EBIA 3C2BA 1JJ8C 3AQSA 3LWJA 4GCKA 3RH2A 3VIBA 4HKUA 2NVXJ 2WV1A 2DN0A 3BR1A 1HOMA 3S17J 2B63J 3G7RA 4A3KJ 5D18A 2WAQN 3RZOJ 5DS9A 3IH4A 3HGYA 3JREA 3LJLA 4YZEA 3HIMA 4XIDA 3LSGA 2O9LA 1JTXA 2F07A 2ZOZA 1ZK8A 3HOZJ 1F43A 4AC6A 3GTMJ 3BR3A 1XG1A 1IDZA 3JRAA 2ECCA 2QCOA 3BTCA 1QPIA 3M4OJ 3MVPA 3I4MJ 3ANGA 4FCYA 2UXUA 3BR0A 2XDNA 3RD3A 5J1RA 2OPTA 1K61A 5HSZA 5E3OA 3W6VA 4BXXJ 1OCPA 3ZQLA 4FISA 5HBUA 2HYTA 1UMQA 1YRNA 3PASA 2W53A 3VVZA 3DPJA 1IUFA 4EEFG 4A3MJ 4JP0A 4I6ZA 1HF0A 5JLXA 1P7JA 5C4JJ 1WH5A 2QOPA 4HNVA 4A3IJ 3UKGA 2NVYJ 3AQTA 4V2GA 3Q0UA 3GEUA 5D1RA 3BNIA 2WUIA 2ZCXA 2DA2A 2VI6A 9ANTA 2R0QC 1VFCA 1ETXA 2ZB9A 3BR6A 4GCLA 3T6NA 2W48A 3RQIA 5HAWA 1LE8A 4IHWA 1SGMA 1W0UA 3E7LA 4MFEA 5EEAA 2PMZN 4JNNA 3VW0A 1MH4A 3ON2A 2HQ5A 2DJNA 3LSRA 1U9OA 1AU7A 1AKHB 2HXIA 1XC5A 1ZR4A 2FQ4A 4D7NA 2NS8A 3TP0A 1XS9A 4CYCB 2QKOA 3SDGA 3VVYA 2OF7A 5IOZA 2XPUA 1JKQC 3COLA 3JRBA 1FTZA 1ZR2A 5EG0B 2XGCA 3P9TA 2P81A 3JRFA 2JMWA 5F04A 1B8IA 3EGQA 3S1MJ 1U9NA 2EZKA 2XRLA 3IH2A 3A01B 1H8AC 4PXIA 4NDLA 2EZLA 3SFIA 3NPIA 3VW1A 2JK3A 3CCYA 2LLKA 4ABZA 1UI5A 3ZQFA 5J1YA 5GPCA 3GTLJ 5FMPA 2HYJA 1MBJA 2MG4A 5E3NA 2GENA 1UHSA 3B81A 3JSJA 2GLOA 1Z0XA 3G1OA 1NTCA 3NARA 4IHVA 2RASA 5F0HA 4A3DJ 1ZTRA 3LHQA 2LY9A 3BCGA 4UUTA 3VUQA 1POGA 2XPWA 1RKTA 2HOAA 4C3IJ 4RBOA 4M3DA 2LD5A 3S15J 2K40A 4GFLA 1ETVA 1I6HJ 4X6AJ 4W97A 1JGGA 1K83J 5IYCJ 1HCRA 5F08A 4L5EA 2GUHA 2IBDA 4DZPA 3FKIJ 2FBQA 4JX4A 2HXOA 2XB0X 2G7GA 1T33A 3BHQA 3VOKA 5FHPA 2PZ9A 3RZDJ 1PUFB 4MLOA 1JUSA 5FKLA 2NVQJ 4NN1A 2GFNA 2QF7A 4D7MA 3HE0A 1MSFC 1MSEC 2E2HJ 2UXPA 1BJZA 3HGGA 4DYRA 2RHAA 4L62A 2UXIA 1X58A 4X1EA 2O7OA 2Y0SN 3G56A 2JA8J 2QIBA 3MNLA 5EZHA 3IV5A 5IYDJ 1X2NA 3HOYJ 3G1LA 3QPSA 4NELA 4MFDA 2CUEA 1ETWA 3A02A 5C44J 2XGEA 2O7TA 5EFYA 4J19A 1TC3C 3C07A 3KNWA 3H3VK 4UUSA 2X9DA 1OFCX 3K2AA 3HOXJ 3OSFA 1R9TJ 5H9TA 3HOWJ 2OI8A 1SANA 5FGLA 5F0FA 3NI7A 2G0EA 3F0CA 5F0CA 2R5YA 1E3OC 1GDTA 5C4YA 4B3AA 1T56A 3S2HJ 2REKA 1IRZA 1F36A 3VVXA 4MXMA 2M8GX 2UXOA 2MGQA 4IEJA 3RKQA 3TW7A 1U8BA 5IP7J 1NK2P 5J3LA 2HOSA 4M3EA 1I3QJ 3Q3SA 3VOXA 4D5FA 4QSHA 2GM4A 1FTTA 2MSYA 5K7HA 5GPAA 2R92J 4Y7NJ 4XRSA 3ZQCA 2COBA 4M3BA 5F1JA 5JLWA 2R5YB 3BG3A 2DG8A 5IP6A 3LSJA 2R7ZJ 2IAIA 3I4NJ 2Y31A 4B1RA 3HOUJ 4UDSA 3BTJA 2DA1A 5HODA 4JX5A 2VKEA 5AQCA 5CXGA 2E2IJ 3NXCA 4BBRJ 2MW8A 2JA6J 3S5RA 1LFBA 2G3BA 5EGOA 2XPVA 2Y9YA 1G2HA 2K9SA 5EYRA 2X6OA 2QTQA 1Z77A 2JN6A 3OIOA 4M6VA 4C3HJ 5FLVA 2LTPA 4GCTA 1NK3P 2DG7A 3TW6A 1VF9A 2X48A 1X2MA 2O8KA 2ZCMA 3VW2A 1A5JA 4DW6A 3QQAA 3S16J 1B72B 3GTOJ 4QIWN 1SFOJ 1APLC 2E1OA 4CYCA 2JA7J 3S14J 4ME9A 3O8GA 4A3BJ 2AO9A 3H0GJ 4GFBA 3A01A 1ETOA 1RETA 3HTHA 2CUFA 2LR8A 4JX6A 5M3FJ 1JT0A 1GUUA 5CW8A 2NP3A 5K7ZA 5GP9A 3GTJJ
chains in the Genus database with same CATH superfamily
3TO7A 2DTZA 3BROA 2V57A 1SMTA 2K3PA 4BACA 4HSTA 2M7BA 3O3KA 4JL3A 4OOIA 1GV2A 3JTHA 2M0CA 1B72A 3SWHA 1HLVA 5IP9J 3OSGA 3GX4X 1MJ9A 2XF6A 1WJBA 4WCGA 3I59B 3SZPA 3DPTA 2G7LA 1WJDA 1PYVA 3LSKA 5DV5A 5DD4A 5FGMA 2E1CA 2KJCA 2ZXJA 1FOWA 3JSOA 1CQTA 3S2DJ 2X1CA 3BCBA 1ZRDA 1OYIA 1IC8A 2DU9A 1H0MA 1Y0UA 5E18F 5CVUA 3GEZA 3LQRA 3E3VA 3ULQB 3C3WA 2H94A 3L7WA 4JYKA 4S0HB 1EF4A 3A4CA 2L9VA 4V2FA 1QU3A 3D5RC 3VPRA 2GIVA 1YJNI 3K7AJ 1R49A 1WI3A 3DP7A 4MIMA 5KAFC 3A0HC 3GLLA 1DU6A 1Z3XA 4S05A 3V78A 1W5TA 4M3GA 3NRGA 4IQJA 4AVZA 3UR3C 2OCCH 3TEDA 4A3EJ 4Q4ZF 2E2JJ 4BAYA 3BJBA 3HTJA 1ENHA 4CCJA 2CQ7A 3DTIA 4OINF 2W00A 1ZKGA 1FJLA 2IA0A 4BBSJ 5D6FA 1FEXA 3S32A 2KFDA 2JQ7A 1T0FA 4MEXF 1B59A 4P96A 4HLXA 1HW2A 4RGRA 2EQRA 5FROA 3LSIA 1TL8A 5EF6A 4RLFA 3F21A 3SJMA 4ACIA 5HDGA 5EZGA 1LKXA 4MNUA 1O7LA 3TO9A 2P5LC 4C30A 5HDKA 2NOGA 1KONA 1VQMI 1WVRA 3K4JA 1J2XA 3T0YA 4UB8C 4PCQA 2UXHA 1TLHB 4WXHA 2YX7A 2MABA 3J7ZI 1J09A 4ZYGA 4J00A 4L0ZB 2NS7A 4ZDLA 3NS4A 4AC0A 4Y15A 2LFBA 2XAGA 5DCFA 1R58A 1X3ZB 1S7EA 2DYRH 3ABUA 3DKXA 2V1DA 3ABKH 3EUHC 5DAJA 3ASNH 2ZSHB 1JJ6C 3HTIA 2LY1A 2XAHA 3SDBA 4PDKA 3CCSI 1FOXA 1JT6A 1MNDA 5B3SH 3ZMUA 3FM3A 1FP2A 3I59A 1JKRC 5FD6A 5F6FA 2CFOA 3KP6A 5ICCA 1SD6A 2ME6A 3K4KA 4QPOA 1VQ4I 1U0JA 4M73A 1IV6A 1B4AA 2LYCA 2M0MA 4FE4A 2M1BA 2EFWA 2B0LA 1RKWA 2XKPA 2OU2A 3TDZC 1IRFA 1X1AA 3I64A 3W6JB 4DZJA 1TW3A 2DMPA 4OIQF 5BOXA 1BW5A 3KP3A 4E7IA 5CQGA 4HLYA 4PSWA 2OZUA 3ASOH 3L2CA 3DEWA 1H9GA 1ON2A 2XAUA 2PX9A 3ZQGA 4FX4A 1JUPA 1X1DA 3ANPA 1WJEA 3AAFA 4A0ZA 1U5TB 4FHTA 3RI4A 4A3GJ 2RKHA 2OJED 1TP4A 5HOOA 1T39A 4LIUA 2D45A 2AHQA 1FYMA 4BNCA 4GYGA 2CW0F 4KDPA 2ZNYA 5DCMA 3OYMA 4B4CA 1JHHA 4XRFA 3LNQA 3CCVI 3HC7A 2E5NA 5GTIC 2DFHA 1ZGWA 4EJWA 4Y33A 5LEJA 5H20A 3K4NA 2DK5A 5M5YJ 5BPDA 2BW3B 1P2FA 1YYVA 3WHCA 2VE9A 3K6GA 2M2EA 3W2AA 4XRMA 3EYIA 4NC7A 2ZMEB 2HDDA 3F22A 4M9ZA 2VQCA 2CRGA 1QPMA 3BWGA 4RAFA 4JQFA 2WV0A 2CG4A 5FJ8J 4FE7A 4NHJA 2EIJH 5BNGA 4BHCA 5C3EJ 2E1MC 4QTRA 3DKWA 3JW4A 1IAWA 1EH8A 3PO3J 1IV8A 3GMEA 3QWLA 3ELKA 3CRJA 1KQ8A 3PSIA 2KZVA 2Q1ZB 1K78A 4IX7A 1O3SA 4HV5A 4CCNA 2I10A 1XMAA 1VQKI 3E6BA 4BDZA 2WC2A 4BJ6C 1KQ0A 2VC0A 2R5ZA 2GXAA 2L9SA 2PJPA 4GCKA 2HWVA 1TQMA 3CUQC 3ECHA 3DBRB 2Y48A 3QYEA 4E7KA 3IHUA 4AM3A 1VZ0A 3S17J 3CJTB 2LG4A 5D18A 1S29A 1JXSA 1BI3A 5HVQC 2EFOA 3LJLA 4YZEA 4A5MA 3L00A 4IXAA 5EEHA 2CV0A 1TQPA 2DT6A 3SEZA 2KLOA 2Z16A 1ZK8A 2PMUA 2UUZA 4KICA 4AC6A 3GTMJ 3CD6I 4L9NA 3JRAA 2ECCA 1C0WA 2L4AA 1HXDA 3M4OJ 3MVPA 4IJAA 3PJRA 2L5QA 1R36A 2QZ8A 3ANGA 1IXCA 4M74A 2PI0A 1SFEA 3FXLA 3RD3A 5LEKA 2OPTA 3TOAA 2WBMA 2VJ4A 1VQLI 1G3SA 2R7UA 1W7PD 3K2ZA 2HYTA 1B1BA 2ZXHA 1WSUA 3QYBA 3FF5A 3ZMDA 4EJOA 1FOKA 4YIRX 2XSJC 4KT5C 1IO2A 5CVRA 5FRNA 2K7LA 1Z21A 4K2EA 4F7ZA 2BXYA 1XTAA 2VI6A 3ZRGA 2ZCWA 2GXGA 5LHIA 3I0TA 1QNTA 2M7AA 2OTLI 2VE8A 5CJ9A 2HQAA 5KAIC 2ETHA 3S3OA 4IHWA 1SGMA 4MFEA 1A6QA 5EEAA 1Y39A 4JNNA 5CVVA 1STZA 5CLSA 3H5NA 2DJNA 2DOAA 1LVAA 1U9OA 2DTRA 3FXOA 3IP4B 2FQ4A 2CQNA 3TP0A 1XS9A 1BJAA 2E7XA 1E17A 1G3TA 2K4BA 3WU0A 3JRBA 2KJBA 3FXRA 3IWFA 1FC3A 3DLAA 2P81A 2FMLA 1QZYA 1K4SA 5F04A 2WY8Q 2Y0MA 2XHKA 3IRRA 3GUDA 3S1MJ 3IH2A 3F8MA 4PXIA 2LOOA 4UV9A 3VW1A 3H9GA 4JK1X 5ED4A 3ZQFA 4IRHA 5FMPA 4PFPA 2ISZA 3BJOA 3WE3A 5CVIA 3M1CA 1IF1A 3L2RA 4ZTFA 2ESHA 3KYCB 2R4GA 2GLOA 1Z0XA 1R6RA 1GXQA 2BY2A 4XBFA 3EETA 4IHVA 1X3UA 2HU9A 1U8RA 1VQ9I 3QAHA 5F0HA 2X51A 4HQEA 3G6EI 3LSTA 1WZ2A 2KIQA 2LD5A 2M3AA 2O3FA 3ONQA 4UVCA 3TDUC 2QUFA 3KETA 2VN2A 2MD0A 4DNCA 4CYDA 3VODA 4W97A 3P9IA 1QGPA 5F08A 1HCRA 2IBDA 4DZPA 2EV6A 3CLOA 2R7VA 2HXOA 2XB0X 4OD5A 2G7GA 3PQJA 3LMMA 4IF4A 3AG2H 3KZIC 2QBYB 1PUFB 5FKLA 3CMMA 3QPTA 3ESWB 3HKZA 3QOEA 2QSHX 4LGWA 2GFNA 3GZ6A 2KRHA 4A12A 4EV0A 3HE0A 4Z6YA 1MSEC 2MLKA 1Y6IA 4L62A 2DYSH 3K69A 3CCRI 3REOA 1HQCA 1OISA 2NYXA 2O7OA 2Y0SN 4OWRB 2H8WA 2ZY9A 3V4GA 1OCRH 2M8EA 3IV5A 2BBYA 5GAEJ 3OS1A 1X2NA 3HOYJ 1FSEA 5E8IA 4E7SA 5DD8A 4RAYA 4NELA 1Z3YA 3A02A 2QQBA 3AG3H 2EIKH 4HX8A 3RTRA 1Z91A 1XSDA 3KNWA 1P4WA 3H3VK 3OYHA 3H36A 2X9DA 4RGUA 1SFXA 2NNNA 1R9TJ 1EV7A 1S8NA 4HG2A 4KYWA 5D5VB 4RA2A 5F0FA 2F5FA 3F0CA 5F0CA 3MD2A 1GXPA 1GDTA 3LA2A 2REKA 2G9WA 3WGIA 1F36A 2O61A 3VVXA 3DPUA 4XLFA 4NQWB 4FASD 1TNTA 4J01A 2JT1A 1XMXA 3DV8A 1R1VA 1YIOA 4IL6C 1WHUA 3CJNA 3K4CA 4GRIA 5J3LA 1I3QJ 2LF8A 3VOXA 1HW1A 4QSHA 5FO5A 4LMYA 3RKXA 3ZCOA 2QYOA 3KEOA 4ASNA 3CCEI 3ZP5A 2ZKZA 2GM4A 1FTTA 2V9KA 1IN8A 2XUBA 4LG0A 3ZQCA 4EJVA 5F1JA 1YHQI 3KFWX 3KE2A 5E20A 3RQ4A 2IAIA 2W24A 3IC7A 2MC4A 4IZZA 3E5QA 3ZR8X 3HSFA 1UG0A 2M30A 4A0XA 2COMA 5CXGA 3TQNA 2RREA 3ZN1A 2JA6J 4U87A 1J59A 3KP2A 2UWMA 1LFBA 3CF2A 3NWSA 4XLCA 4DBRA 1IN4A 4BL0B 4Q5SF 2Y9YA 1P6RA 2X6OA 2QQ8A 3GO5A 1FYLA 4UB6C 3OIOA 1FY7A 2KDOA 4CCMA 2LTPA 3CMAI 5GTHC 4GCTA 4KT6A 3TW6A 2IVMA 2STWA 1VF9A 5AIPA 5K5QA 1D0ZA 1FP1D 2L4MA 5D8LB 1X2MA 2O8KA 1B6AA 5D4SA 2ZCMA 1J7KA 1A5JA 1Z9CA 3HPGA 3QQAA 3ZQQA 4DW6A 4GGGA 2ELHA 4ESBA 3GTOJ 4IVNA 1SFOJ 1OCZH 1APLC 1R1UA 3J7AY 1K6YA 4CYCA 2JA7J 3M8FA 4I98B 5J47A 4ME9A 5B1BH 3V8LA 3CUOA 4M72A 2LR8A 2BE5F 4JX6A 5KNLA 1GUUA 5CW8A 1WJAA 4CDGA 1MMSA 5GP9A 2PJRA 2HVQA 2NVUB 4E70A 4ANJA 2N8GA 4A3LJ 3QP5A 2V1NA 2IGKA 3PQKA 2BGCA 2VUMJ 2DMUA 3LA3A 2ZCNA 1BI2A 4JKZA 1JTYA 2QQ9A 5D5XB 2BZTA 1G4DA 3ERMA 3WHBA 1IJWC 4RS8A 1OR7A 2O5RA 3BPVA 1XN7A 3I55I 3H0DA 1O3QA 2DPDA 3GYHX 2QKLB 4O6JA 5K1YA 4W1UA 3M3YJ 1FBUA 4U0WA 1EA3A 5FKKA 4FTHA 4A3FJ 1H88C 3UNGC 1UG2A 1ORKA 2WB1N 3CDHA 3MN2A 3V7CA 5EDNA 4G6DA 2K9MA 3QODA 3LOCA 2ZJ2A 3R0AA 3P5JA 2VOPA 2LREA 2GA1A 3OOUA 4OMZA 4OIOF 3GTKJ 2M4GA 4RB1A 1KA8A 5E3LA 2CFXA 3O2PE 4XK4A 2YVHA 4CCKA 4EATA 1XDSA 3FX3A 2DCEA 3GTGJ 2EJRA 2ZJRF 4C3JJ 3I4PA 2HTJA 5FLXZ 4P5OA 2CW7A 4R1HA 3SQNA 4LJZF 4CZZA 1LE8B 1JKOC 2MH2A 2OA4A 3P9CA 4PFOA 4LG3A 5HS7A 1YG2A 2LBFA 1Y56A 3E5XA 2FMYA 3BDDA 2FEZA 3KKDA 3BR5A 1VQ5I 3QKXA 3F8CA 3NRVA 3E6DA 2D2WA 1T08B 3WTZA 3DLLF 4M9SA 1BIAA 3FIWA 3LL7A 3G4SI 1PUFA 2EA2A 3EUKL 1BL0A 1BIBA 3L2WA 4YEJA 1RRJA 5K58A 1G59A 1BM9A 1WH7A 3KYDB 1Z67A 2GZWA 2XB5A 5E79C 3BG9A 2F5DA 3E7QA 4HF0A 2YUSA 4MGRA 3I5UA 2IA1A 2DOFA 2KP6A 2XGXA 1BOBA 3CDIA 4MQVA 4C2MJ 3G2BA 1FMWA 2V9PA 2DFEA 2XV4S 5ICFA 2PLYA 3PNYA 2YS9A 4RGSA 3KKCA 3D5LA 2BY3A 1BW6A 3GTQJ 4LG0B 2L7MP 1WCMJ 4I76A 5M5WJ 1I27A 2ID3A 1ACIA 2DAOA 3U1DA 4Y3OA 2K9LA 3PM1A 4AYBN 1ZRCA 3FXKA 1ZH5A 2B1EA 2PBXA 1WGXA 3KZYA 1RUNA 1XSVA 1YRNB 3AG1H 1FX7A 2V6EA 2BOLA 1S5LC 3BTLA 4H4KC 3COAC 2ZFUA 1MMDA 3ON4A 1QHGA 2MD5A 5IT3A 2X6WA 1FT9A 4KN4X 2FJ1A 2IS6A 4XONA 4WK8F 1LVKA 3BZ6A 3JSPA 1MBHA 2LF7A 2QKMB 1V5FA 4ESJA 1N77A 3QBMA 2K5CA 1UI6A 2MYSA 1RUOA 4G7HF 5DCMB 2A6HF 3CP2A 3KP5A 3U9GA 3S1QJ 5BPIA 4BQOA 3HEFA 3TKYA 4BJ5C 3O6BB 1I1SA 3J7AO 4NUBA 3MKLA 5CXIA 5DYMA 2MLGA 3L1PA 2VT2A 3PUFA 4FT8A 2OTJI 2Q2EA 2R7WA 3H5RA 3MKZA 1ETYA 3HJEA 3VFZA 3HOTA 2GOXB 1DDNA 3F1BA 1Y1VJ 2E7WA 3OR1C 3ZOBA 2OERA 2LC2A 4M9XA 1SMYF 2EZIA 4UNOA 1MMGA 1TBXA 4A5NA 4A6EA 3CWRA 1UFMA 2BV6A 2V4JC 1PP8F 1Q1VA 3GFIA 1QRYA 1TTYA 2FX0A 1BBYA 3OYBA 2DFIA 4IRVA 4I01A 3AG4H 2XAFA 1TWCJ 5LRRA 1RNLA 4BH9A 1HSJA 3I53A 2YPRA 2P7VB 4PGHA 3CLQA 1I1GA 2F5VA 4LITA 3GCMA 1OYWA 3RPUA 3S1RJ 2EZHA 4OIPF 4X0GA 3CC4I 5TJJA 5IYBJ 2D6YA 4LLNA 3HBLA 5EG0A 3HTSB 2RQQA 2DA6A 2UXXA 2XF5A 2ELJA 3QOPA 1PJRA 3FXMA 4G7OF 1JKPC 1HDDC 1DP3A 3OL3A 3FHNA 1ZRFA 2Z99A 3B73A 4L5IA 3JRHA 2VPLA 2OQGA 3N97A 4RM2A 2M4KA 2DT7B 1A04A 4HF2A 1RPWA 2X6XA 1HA8A 2NX4A 3KEYA 4PJJA 2X0LA 1RC9A 5HDNA 1K79A 2JA5J 2LBFB 1ERDA 5D19A 2G7HA 2NS0A 4HA8A 4YIIA 3VYRB 3SEQA 2JJ7A 5K5RA 5DTDA 2L7ZA 4BEHB 4DYCA 2IGOA 3NQOA 4LFUA 1B9MA 2Y9ZA 4YG2F 4WXCA 3ZQIA 3TL4X 3BTIA 4L5JA 4CUGA 1LUJB 1VNDA 4KIFA 3IL2A 2WWYA 3VP5A 2CV1A 2X6YA 1MH3A 3J7YJ 4FX0A 5FFXA 2LKSA 3JRIA 2YVXA 4H0EA 3C2BA 3HRTA 3AQSA 2CGPA 1F9NA 4CICA 2KPMA 4HKUA 2WV1A 2DN0A 4I7HA 4AIDA 3HYIA 1IN7A 2GOMA 2MC3A 2Z2SB 2V6CA 5DS9A 1REPC 2DODA 3L2QA 2LDUA 4I99C 2VBZA 2KMUA 1DQUA 2A61A 3ZXSA 2ZOZA 2ESNA 1IN6A 2XASA 3OL4A 1UAAA 1F43A 3BR3A 4XLPF 3BZCA 5CVJA 5FLXK 1IDZA 1Z05A 3LA7A 4L9VA 2VT3A 4EM0B 1O57A 2ZMEA 1FYKA 3I4MJ 1YS7A 2XF7A 2UXUA 3P9KA 3CUQA 1WKMA 3OYDA 1LDDA 1LEBA 1K61A 5HSZA 2HYFA 5JR3A 5E3OA 1D5VA 4BXXJ 4C2MA 5HBUA 1UMQA 2VC1A 3DPJA 1NH3A 4XLHA 3E6CC 4JP0A 5JLXA 1P7JA 1XD7A 5C4JJ 1VQNI 3F23A 2QOPA 2XKOA 1KU3A 4HNVA 1FMVA 2LNBA 2NVYJ 5D1RA 1IXSB 4V2GA 3MQ0A 2WB1A 1R71A 3SHFA 3NWTA 2WUIA 2W84A 2IPQX 3BR6A 5F64A 2P5KA 3T6NA 1P9QC 2DK8A 1R1TA 4L18B 3PFYA 1MH4A 5LGNA 2UV1A 5FD5A 3SFZA 4U7BA 2HQ5A 2V9VA 3T5XA 4OU0A 4ZYHA 3ABTA 4DJAA 3LWFA 1ZR4A 3HRUA 3K4BA 3K1NA 1E0EA 4EJUA 4V19K 2QKOA 2DI3A 1T95A 3F8FA 1BI0A 3K1PA 3KLNA 4UVBA 1FTZA 3C2GA 2V7FA 4ZH4F 2R7SA 3BG6A 2KIFA 1TT5B 1B8IA 3W3CA 4XLEA 2XRLA 1HKTA 1ZGJA 3V8KA 3ZMZA 4I02A 3H9JA 5J1YA 2XAJA 5GPCA 2HYJA 2MG4A 3QPHA 2H1LA 1MZBA 3M8EA 1ZELA 1Q1HA 3B81A 4HOBA 3JSJA 4P55A 2IRFG 4OAYA 3G1OA 1NTCA 3NARA 1YTYA 4WIBA 3DQVC 2PMHA 2AQFA 2CUJA 1OLTA 1FLIA 1L3LA 5BQTA 4C3IJ 4Z2YA 5D5UB 2EK5A 1U5TA 4N0BA 1I6HJ 1JGGA 1J9IA 4L5EA 2WAEA 5ERIA 4E7LA 3RPQA 4ETSA 2DDBA 2WA0A 2HS5A 4FETA 1T33A 2OAZA 5L3GA 4AIHA 2PZ9A 3RZDJ 3JTGA 3CTAA 5ICEA 4MLOA 4NN1A 2ZSIB 4M6YA 3RJPA 4LK1F 3ZMVA 4IOAF 5CKTA 1BJZA 3HRMA 2UXIA 2ZC2A 5JI6A 2PBIA 5E1XA 1YJ9I 3G56A 1HW5A 2QIBA 5EZHA 2ZMEC 4XORA 5CPRB 4UUVA 5LHGA 2CSOA 3CZ6A 4BHPA 2PFVA 1ZG5A 4MFDA 1LNWA 3K0LA 2P7CB 5C44J 1R4MB 5H6QA 3ZMSA 4XN3A 1TC3C 2CUZA 3RDIA 4G8XA 4HRIA 3DBLB 3QU3A 3DKYA 5L3BA 3HOXJ 3OSFA 2UXNA 2NOJB 2HPIA 5FGLA 3NI7A 1W1WE 2NAZA 3VYSB 3H9QA 3G3ZA 5IY5H 2V79A 2NRAC 1SD7A 1LDJA 5DM7F 2DFFA 1U8BA 5IP7J 1NK2P 2RN7A 2O0YA 2X1DA 4IQ4A 4M3EA 3EQLF 1S7AA 3MEXA 3S93A 4HX7A 3AFHA 5EEGA 5AONA 2MSYA 3W2WA 4WXDA 3OYLA 3VB2A 2EWNA 5GPAA 4Y7NJ 2L9NA 5TISC 3KP7A 1SD4A 5JLWA 2DOEA 1JI8A 4XOPA 3CC2I 1O3RA 3A1YA 1PVEA 5IP6A 3PIPF 3LSJA 1R7JA 1H9TA 2R7ZJ 1MKMA 4B1RA 4F3QA 3WGGA 2HDCA 1X1PA 4JX5A 5AQCA 3NXCA 4BBRJ 4MTDA 2P4WA 2MW8A 3GXOA 4BE0A 4LIVA 5TRDA 3S5RA 3E6MA 2DO7A 2G3BA 5EGOA 5FB2A 2IS1A 3K10A 1E3HA 3E5UA 1U5TC 4HNTA 4Q48A 1Y8RB 2ZO4A 4HW0A 2HTSA 1I6XA 1YW8A 2JN6A 2K27A 4GCVA 4M6VA 4RGXA 3OYAA 1NK3P 4WWCA 2IJLA 3OIQA 3BLYA 5H6RA 3Q5FA 2JUCA 3EUHA 2D1VA 2RQPA 5DDGA 2BEOA 1MDMA 2FNPA 2QWWA 3S14J 2M45A 3J81Z 1EH6A 3JAMZ 4A3BJ 1X4PA 2BVLA 4GFBA 3CCLI 2KZGA 3F6OA 1RETA 1AA7A 2P6TA 4R79A 2CV2A 1RI7A 4MQ9F 1JT0A 2ZNZA 5K7ZA 3FDYA 3R61A 3GTJJ 2NP3A 3M1EA 4BYYA 2A69F 3ERED 1TWAJ 3DBHB 2EV0A 1WPKA 3JRGA 1DPUA 3V8JA 1XGMA 3F3XA 1O4XA 1Y1WJ 1HSTA 5FFZA 3NAUA 3GZ5A 2CMPA 1VQ7I 2QQAA 4UHTA 3IRQA 2JSPA 3VTIA 2K9QA 4DVYP 1A6IA 2G7UA 5J6XA 3KLOA 3T1BA 1J75A 3KIOA 2LP0A 4LLLA 2B3WA 2KRFA 4AUXA 1IUYA 2VBYA 3RKWA 3E97A 2GXBA 2ZXIA 4PGGA 2WTEA 3KZZA 1FIPA 3QPLA 4O3MA 3JCUC 2FXAA 1E2XA 3IWZA 1L0OC 1PP7U 1V5EA 4XQFA 3V7RA 2EFNA 4N4OB 4LLGF 1SFUA 1KZHA 4DYQA 1ZARA 4EGYA 1T38A 4B3XA 3MZYA 1X1BA 1OYYA 1F1ZA 5L3DA 3WU1B 3G71I 4BDYA 1YX5A 4ZTJA 2H1KA 2BY1A 2F5CA 2OZ6A 4HAMA 3HPHA 1Y0NA 4GDFA 2Q24A 2JUGA 1I3AA 5KK1A 3IAM2 2LMDA 4AYBA 1ETQA 1O3TA 4KMFA 3HRSA 2KT0A 4G12A 1BR4A 1XCVA 1BN5A 1X19A 2L02A 2FOKA 4AVPA 1AKHA 1J0RA 2OV7A 2E1NA 3GW2A 5IOYA 5E17F 3TP3A 4ZYAA 2E19A 3A03A 4XICA 1LEAA 1YW9A 2FBIA 2LK2A 3OYEA 2JWTA 1QVTA 1TW2A 4IHYA 2KKOA 1W4MA 4CCLA 5DUIA 3BQZA 4LK0F 4PK4A 1D5YA 3FBIB 5C4XJ 3HTAA 4GFKA 1IDYA 2R5ZB 1D1AA 1SAUA 3ABLH 2HKXA 3WTWC 3WTYC 2EILH 5JVGF 2QLZA 1OKRA 3B6CA 1VQOI 2M34A 5LGTA 3KYLA 1R00A 4IRIA 2GIZA 4CA0A 2QWTA 5HLGA 4XM3A 4BKXA 4NBQA 1R4NB 4OMYA 1R22A 2CQXA 1MGTA 4L9TA 3OWTA 3WE2A 4CH7A 3WTXC 2FNAA 3EUPA 4BY7J 2ELKA 3BG5A 1RZ4A 2VODA 3M7GA 4BY1J 2AXTC 1FIAA 4NB5A 1TWHJ 1XX5A 2WAQA 2R3SA 2E60A 1D8JA 2VKHA 3JAMK 2LRDA 3RIRA 2ECBA 6PAXA 4KA4A 1IG7A 5HNFA 5D8KB 2LH9A 4XKCA 1WJFA 2DMQA 1W5SA 2LSOA 2BXZA 1CGPA 2RNJA 1CF7A 1BC7C 2ZJQF 1MBFA 3D0SA 2I5UA 1D0XA 1TWGJ 2ADUA 3X2QH 2L7KA 5ILUA 3FMQA 1AWCA 3BY6A 2H8RA 3MMYB 2HYGD 2VKDA 2WY7Q 3HHHA 5EGOB 4II3A 3FISA 2K86A 4KNYA 3DU6A 1TWFJ 2W1OA 1BR2A 3PL8A 5JHFA 1I50J 4C2UA 1WFXA 3CJDA 2I8DA 4HNUA 2GBYA 1FBSA 1GVDA 5FKMA 2FSWA 5HS9A 3NNRA 2JTVA 3PNVA 2DDAA 2Z33A 2F4IA 2A6TA 5D4RA 1LPQA 3JR9A 4YRVA 1S6LA 4HF1A 4S04A 2DA3A 3ZQ7A 1H89C 3CMYA 5BS6A 2QSGX 2DA7A 4P9UA 4AF5A 1KU9A 3ISPA 2VL8A 1QVUA 3RYRA 4CGRA 1IGNA 2DXIA 3DEUA 2LKXA 1MNMC 3BCAA 4JOMA 1UELB 4B09A 1LFUP 4KWAA 2ICWG 3HKZN 1EKEA 2AXLA 4BE1A 5ICGA 3GZIA 2H09A 3HM5A 1ZLJA 1YFHA 2FD5A 1SVLA 4NC6A 3IKVA 4M3FA 4HYEA 1QHHD 3G1MA 4XKWA 2XGDA 5F27A 2DPUA 2L9RA 4HDUA 2CJJA 3WTSC 1K6OA 4AWXB 1U6GA 5DM6F 4U0YA 4PUSA 1XMKA 5KHDA 1MIJA 4TV7A 2HQNA 4MTEA 1W5CC 2RDPA 5HS8A 2QA4I 1K7AA 3S1NJ 2LVSA 3H35A 2MH9A 4ICHA 1LQ1A 3OS0A 3GFJA 4XRSG 4EMSA 1HC8A 4XKBA 2A5WA 2IA2A 1FSHA 2EH3A 3JRDA 3PO2J 5M3MJ 2ME0A 2D5VA 2Y69H 2VJIA 2L2OA 4ON0A 3D1NI 1XGNA 5CQEA 3VDXA 3Q0WA 1MBEA 1WI9A 3BR2A 4D1QA 2ID6A 4RM3A 4QWQA 2F2EA 1JJ8C 1BC8C 3LWJA 3RH2A 3GLXA 3VIBA 2JRMA 4QPQA 2X85A 2HDWA 4XMYA 1HOMA 3KP4A 5IT9Z 1ON1A 3FBNB 5ILSA 3G7RA 4A3KJ 5E1ZB 3LAJA 2KISA 1ZHFA 2JPCA 1R5HA 2BHZA 3FWEA 3VWBA 4B44A 3ROUA 2OQRA 4XIDA 1AOYA 3LSGA 2E34A 1VQ6I 4B48A 1USTA 2F07A 2Z9OA 1XGOA 2L01A 4HDVA 1OMIA 1XG1A 2M5WA 3H3UA 4KUMA 3A0BC 1BR1A 3BTCA 1QPIA 3BC8A 4HPQA 2CW8A 4FCYA 1G8XA 3BR0A 2RNGA 5J1RA 1N78A 1Z6RA 3W6VA 1OCPA 3ZQLA 1YRNA 3KEQA 4HV6A 4N4NB 4AIKA 3VVZA 1IUFA 3MWMA 1GVJA 3F8NA 4A3MJ 1HF0A 3AL0B 3VYUB 4A3IJ 2JSCA 4UY8I 1DUXC 3AQTA 2GA2A 3Q0UA 3GEUA 2BY0A 2WAFA 3BNIA 2ZCXA 3LSHA 2ACJA 1D1BA 2FBHA 3ML6A 2EB7A 3IAS2 4CXFA 3WTTC 1O7FA 1WJCA 1W7PB 2R0QC 1VFCA 4IHTA 1ETXA 4GCLA 2QENA 3RQIA 4HSRA 1OCOH 3SZGA 1LE8A 3E7LA 2GQQA 3VW0A 3ON2A 2E1MB 1WJ5A 4BJTA 3LSRA 2HXIA 2B7EA 4YFKF 1KQ9A 1W36D 1V4RA 4CGZA 3C7JA 4OD4A 2VOOA 1ODDA 2EINH 3SDGA 3VVYA 5IOZA 3DWLE 3N4MA 1I5ZA 1JKQC 3COLA 1LFPA 2IW5A 3I9V2 4QLCU 4B47A 1KU7A 2XGCA 3P9TA 2CH0A 2VXZA 2BVMA 1GHCA 4AU7A 3CUQB 2O8XA 3EGQA 2FA5A 2EZKA 1H8AC 1Z7UA 1D3YA 4NDLA 2EZLA 3SFIA 3NPIA 3K4LA 3IUOA 3CCYA 1DGWY 3WODF 2LLKA 4ABZA 4YIFA 3GTLJ 4E6KG 2PEXA 3ECOA 5HLTA 1UHMA 1LDKB 4II2A 4ENMA 1UHSA 3DPLC 3Q9SA 2EPFA 5LFAA 3DXJF 3WTUC 3T8RA 4YELA 1KYWA 2NXNB 1QZEA 4KIGA 5EJCA 4C9YA 2JZYA 3VSKA 2RASA 4A3DJ 1PUEE 1IRXA 3LHQA 2LY9A 3BCGA 1LJ9A 4UUTA 2IXSA 4RBOA 4IOCF 3VUQA 2HGCA 2XC7A 2K40A 1XPXA 4B43A 3KX2A 1BI1A 3KPHA 1FPQA 2OD5A 1BOAA 3FKIJ 5H2FC 3H5AA 1CF7B 1MJBA 1XDUA 1YOVB 3BHQA 3VOKA 1Y8QB 4ZDPA 1JUSA 5HLHA 2K4JA 2QEXI 2QF7A 4I2OA 4CHUA 4E7ZA 2UXPA 3HGGA 4OAZA 2E5ZA 2UZKA 4JBAA 3CO6C 1YIJI 1OCCH 5IYDJ 3BJAA 3M9AA 3G1LA 2F5EA 2X4HA 2V1UA 2CUEA 1ETWA 4YFXF 2XGEA 2O7TA 1NG6A 2VXDA 3TBIA 4M71A 5A2QK 3HOSA 4WF2A 4UUSA 3M8JA 3K2AA 5LHHA 4YFNF 3MZ8A 5H9TA 1ZN2A 1TQIA 2V26A 4LB6B 2G0EA 2EFPA 2R5YA 2W25A 5C4YA 2C6YA 2W57A 3I3LA 1EJ9A 3S2HJ 3DEEA 4XL9A 2HOEA 2FE3A 2Q0OA 2M8GX 2O03A 5J4VA 3OYFA 4MXMA 1VQPI 3TW7A 4UV8A 4CO8A 5HLIA 4BU2A 2HOSA 3Q3SA 2VONA 2ZXWH 4L9JA 4Y17A 4D5FA 2VJJA 2R7XA 5K7HA 1ZAOA 2KRCA 4F55A 2IT0A 5GAHJ 1F4KA 4XRSA 3I56I 3BG3A 2ZJPF 2DG8A 1UHWA 3IKTA 3I4NJ 2HNHA 4HEA2 3HOUJ 4UDSA 3BTJA 2XRNA 3N05A 2VKEA 4G94A 2QVOA 1FWZA 2RC4A 2E2IJ 4HQMA 1MMAA 2YU3A 2ZFWA 2AS5F 4RAZA 3U1KA 3Q9VA 1MMNA 2GWRA 3H92A 1KU2A 3SZTA 2XPVA 3I58A 3OR2C 4ZDOA 2K9SA 1KYZA 3ZMTA 1J5YA 1Z77A 5FLVA 5LLQA 2CO5A 3QYFA 2DG7A 3E0JB 3R4KA 3L2UA 1S7OA 2P6SA 4N9HA 2X48A 2CQKA 3FMSA 4DQ2A 1UZCA 4IPAA 3VW2A 1ZYRF 3OYGA 3S16J 1B72B 1W7PA 4QIWN 2E1OA 4RB0A 5J8FA 4Q47A 1X4OA 3O8GA 4EM1A 1D8KA 1PDNC 2F6CA 1ZLKA 3A01A 1ETOA 1A36A 3FMRA 3HTHA 2CUFA 1I39A 5M3FJ 4ZZLA 3HL2A 1G6NA 1YO5C 4WX9A 1T8IA 1MBKA 1YLFA 2E36A 5D6EA 3OYCA 4FQGA 4E7HA 3IH3A 2HEOA 3OV8A 4BQAA 1TT0A 2R7OA 4D9JA 2IU5A 4EJTA 3H3ZA 3IUVA 3V6GA 3LFUA 3B6AA 3G73A 1ZGAA 3HOVJ 3HDDA 5GADJ 2DW4A 3BP8A 2PFBA 3K70C 4Y52J 1XSXA 4RLQA 1KGSA 3PNTA 3T8TA 3V7SA 5E3MA 3HSRA 1XB4A 2EIMH 3S8PA 2XDVA 4ZYEA 4XR6A 3LAPA 4I0BA 2XVCA 2DQLA 3R60A 5LBQA 4RB3C 2R93J 1DPRA 1MD0A 2IS4A 3WU2C 4UXNA 3KCCA 1G3WA 4N9IA 4BEHA 4DOZA 2JA2A 1B9NA 2Y75A 1SEUA 2VPRA 4U0VA 2CQQA 3CCMI 3K1MA 5FKNA 4NNJA 2DA4A 4U88A 2LY2A 1VI0A 1EH7A 2MFZA 3ZGKA 1GV5A 1QQIA 5L3EA 2WGBA 2VQGA 4A69C 2PQ8A 3BRUA 2R7RA 1Z1DA 4RAGA 2NP5A 3M07A 5K7FA 2HKUA 2YVEA 5A2QZ 4R8HA 3GBGA 1ZG1A 4A2UA 1B8IB 2NVTJ 3C1DA 2R7DA 2DBBA 5KCMA 3OYNA 1U78A 1W36C 3F72A 4Y4RA 2ZOYA 4KISA 2STTA 1AHDP 5LGUA 4PSXA 4ENNA 4HX4A 2AQEA 2FF4A 3FK6A 4F52A 4RB2C 1U2WA 2DMNA 1MBGA 3BOQA 1OJLA 1FBQA 1P4XA 3V42A 1U3EM 3LSPA 3GF2A 2TCTA 5B1AH 2JVGA 1IN5A 1ZG3A 4AD9A 2FQ3A 4MK6A 1N25A 3MCZA 1XCBA 4EVIA 1HKQA 4ENKA 1HKSA 2O6GE 4OIRF 1FOYA 1QO0D 1UB9A 1YJWI 3MZHA 4A3JJ 2HVRA 3BPXA 2E71A 1Z6TA 3BT9A 2J5OA 5GAGJ 5BMZA 2H6CA 2HR3A 1T98A 3LSMA 4BGDA 3DCFA 2LKPA 2TRTA 2XSDC 3HUGA 2H6BA 3PIOF 5FRMA 2Y2ZA 2CU7A 2DMTA 2QSFX 3PPBA 3LFKA 1W0TA 3OMYA 4XKVA 1M1EB 1K4TA 2IS2A 4P1WA 3HIFA 4IHXA 3I54A 4UUSB 1OCTC 4RDUA 2ZBKA 3R0JA 1NHAA 1R23A 2JVHA 2XAQA 2W7NA 4L0YB 4O5VA 5FLMJ 1S3JA 2FOWA 2RAEA 4BE2A 4MEYF 1HDPA 3TOBA 1GT0C 1ZQ3P 2HOTA 2PJRB 3GTPJ 4A6DA 3DTKA 2GAUA 2DA5A 2VKVA 4E4HA 3O60A 5FKOA 2KDZA 2FU4A 1WWXA 2OC6A 1ITYA 3H1CA 3DTEA 3GZNB 1UCRA 2J5PA 2Z5UA 3OOPA 2IEKA 4LB5A 2A07F 1MNEA 1VQ8I 4GYIA 1RR8C 4BQQA 4D5CA 2R7QA 5B66C 4U9NA 2BYVE 1K78B 3JRCA 2Y30A 4CZCA 4A93J 5K5OA 3FHZA 3GWZA 2KQRA 4P9FA 4DGWB 3CMEI 2R7TA 1BA5A 2HI3A 3E1SA 2VLAA 4E7JA 3SXYA 2K3FA 5IPAA 3WGHA 2RV8A 3J81K 1YQAA 1P7IA 1DU0A 2HKOA 3CQZJ 2QGUA 5E8GA 1V3FA 2HVSA 1GLNA 2CWEA 3EDPA 4PJMA 4NQWA 5L3CA 2VQLA 3BJ6A 2Q2EB 4I0AA 1QZZA 3J80K 4HBLA 1G3YA 2P5VA 3KZ9A 4MO7A 2E35A 3CCUI 3O8HA 4BS9A 2L0KA 3FRQA 2TDXA 2K9NA 5M5XJ 1SVOA 3PFIA 5J40A 3W6KB 2A05A 1QBJA 1T0FC 4A3CJ 3F6VA 3Q0VA 5TGTA 3K70D 4GO1A 3S2WA 4PJ0C 2VBXA 1RESA 5KVRA 1YW7A 4D0PA 2YU9J 2EFQA 2VQHA 3FK7A 2KL4A 3CDLA 2IP2A 1A35A 3HG9A 1ZREA 5J1UA 2L7FP 3WG9A 3ZQHA 2M9HA 4LOCA 1RR7A 1TZLA 2G7SA 3F9KA 1JUMA 3BQYA 2NNYA 3HB9A 4XLNF 4IKFA 5ILVA 3DU5A 5B5EC 3I71A 1ETKA 2EBIA 2HZTA 3OIPA 4F93B 3S3MA 2NVXJ 3FZVA 3BR1A 4G6QA 2EV5A 3OS2A 2B63J 3WTVC 2WAQN 3RZOJ 3L9FA 3EYYA 4IO9F 3IH4A 1SD5A 3HGYA 5F1RA 1YX3A 3JREA 1SVMA 3GFMA 3HIMA 3LQQA 4RMNA 3HHGA 2O9LA 2F48A 1JTXA 3BG7A 2F4MB 3HOZJ 3L09A 2KIUA 2MBFA 3MAJA 3VYTB 2H27A 2QCOA 1NG7A 3CJQB 1IZ1A 3S3NA 4XOTA 1V54H 4U9LA 4EQQA 3WG7H 2XDNA 3RSNA 3SYTA 3CESA 3PUBA 4GXOA 1WRJA 4FISA 2MA3A 3PASA 2W53A 4EEFG 2M87A 3RPUD 4I6ZA 3B02A 2XROA 1E3PA 1WH5A 4KJZA 5E1WA 4ENJA 3FXQA 4I09A 4ITVA 3UKGA 1X3WB 4ZYDA 2A5YB 4G7ZF 1R5ID 2DA2A 5LRSA 5J4YA 3D5SC 4UVAA 9ANTA 1QA6A 1YE9A 2ZB9A 2CS3A 2W48A 2KIMA 4BHBA 2RGVA 5L3FA 2WADA 5HAWA 3QU6A 2YX4A 1W0UA 2PMZN 3CCJI 3FKJA 1V55H 1AU7A 1AKHB 5LD2C 4U7DA 2IGMA 1XC5A 2A6EF 3CF5F 4D7NA 1USSA 2NS8A 1P92A 3GFLA 4CYCB 2HZDA 2R7FA 2OF7A 2V1XA 3ABMH 1S9HA 2XPUA 3GVAA 1S72I 1Z7LA 1N75A 2FRHA 4PJNA 4PZJA 2KHMA 1ZR2A 5EG0B 3PSFA 3ZPLA 2QM3A 3C18A 3JRFA 2JMWA 2VBWA 1JGSA 3QRFF 1U9NA 1UJ8A 4PJLA 2OCEA 3A01B 3OYJA 2F4OB 2JK3A 2HPMA 4A0YA 3K4MA 1UI5A 4AIJA 4F91B 3HXLA 1D1CA 1MBJA 5E3NA 1JHFA 2K02A 4C2TA 2GENA 3F8BA 2D1HA 1MJAA 4ZC3A 4F92B 3K8PC 2XIGA 2Y0SA 1OQYA 2L54A 1P4AA 4KMUX 4NC8A 2JRTA 4EGZA 1ZTRA 1VTNC 1POGA 2XPWA 1RKTA 2HOAA 3S15J 4M3DA 2OBPA 1ETVA 4GFLA 4Y13A 2BHYA 5DEQA 1YI2I 1YITI 2PG4A 3HTUA 4X6AJ 1DGRM 1RIOH 1K83J 1X1CA 3P7NA 1OR7C 5IYCJ 2GUHA 2OUMA 4DBQA 4DIQA 4G6TB 2FBQA 4KFCA 4JX4A 4G9YA 4XSZF 3VOEA 3MKWB 2DJIA 5IT9K 3OY9A 1FZPB 1MW7A 5FHPA 3K9TA 3RKYA 4XLAA 4ZZDA 4M6XA 3QP6A 4EM2A 2NVQJ 3NEUA 4IRGA 3VEPA 3DFGA 5CYVA 4D7MA 1MSFC 5JVTA 1F5TA 2E2HJ 4DYRA 2RHAA 2W82A 4CCOA 1X58A 4X1EA 3U2RA 4KITB 2JA8J 3MNLA 3TGNA 2Z1DA 3QPSA 2P8TA 3R6SA 1DP7P 4BXFA 3EPZA 2JPBA 2IGNA 2HQRA 2P0WA 2X1EA 3RCOA 3TO6A 4BQNA 2W4SA 5EFYA 2W85A 2B9SA 4J19A 3CO7C 3C07A 1IRGA 1YS6A 1ONVA 3RYPA 2ISYA 1OFCX 3FXJA 1OPCA 2HFHA 1A31A 3HOWJ 5JFRA 3EUAA 1SANA 2OI8A 3OYKA 2DQRA 4XNFA 1E3OC 2FJI1 4B3AA 1T56A 5AIQA 2PMZA 3CC7I 2K85A 3TMOA 1IRZA 4XN0A 3DF8A 1IW7F 2UXOA 2L3DA 2YR2A 2MGQA 2A3SA 3HZJA 4IEJA 4B8XA 3RKQA 1D0YA 2RVCA 2A2FX 1T2KA 2Q8KA 3BZKA 4MHGA 3FM5A 2VIXA 5J8CA 4BXUA 2R92J 1TNSA 2BW3A 3VSLA 2VASA 1MDMB 4KN7X 2COBA 4M3BA 1ULYA 2R5YB 3MFKA 1T6SA 2Y31A 4ESFA 2DA1A 5HODA 1XGSA 3ZN0A 3CCQI 1SC7A 3OYIA 1WQ2A 1G2HA 1LB2A 5EYRA 4LD5A 5HNHA 3CJRB 2QTQA 1FNNA 4XSXF 4IHSA 1V5GA 4C3HJ 2DT5A 1IXRC 2FBKA 3HUGB 3AL0C 2DLLA 3W2VA 3J80Z 1SFKA 4CSWA 2YSRA 1JE8A 2PN6A 3HSEA 4HZFA 4KIBA 2CYYA 3A2KA 1R5GA 4BUPA 3U21A 5D5WB 2EA4A 3AKZA 2VB6A 2A68F 3CP8A 1HBXG 2FUG2 2VJ5A 2AO9A 1SAXA 3H0GJ 5DUKA 3C2HA 3FXUA 5JHUA 3L2VA 3MKYB 2QBYA 4ZJZA 2Z3YA
chains in the Genus database with same CATH topology
2DTZA 1MBKA 2V57A 2N8GA 4A3LJ 1TWAJ 2VUMJ 2DMUA 3IH3A 1WPKA 3JRGA 2ZCNA 4JL3A 1GV2A 4JKZA 1JTYA 2M0CA 1O4XA 1B72A 2IU5A 1HLVA 1Y1WJ 5IP9J 3OSGA 3NAUA 3WHBA 1IJWC 3IUVA 3V6GA 2K9QA 3B6AA 1A6IA 3HOVJ 3HDDA 2G7LA 4W1UA 3M3YJ 2LP0A 5FKKA 4A3FJ 4FTHA 4AUXA 1H88C 1UG2A 1ORKA 2WB1N 5EDNA 3MN2A 4Y52J 3LOCA 3S2DJ 1CQTA 5E3MA 3OOUA 1FIPA 1IC8A 3GTKJ 3QPLA 5E3LA 4XK4A 2YVHA 3GTGJ 4JYKA 2R93J 4C3JJ 4S0HB 1EF4A 4V2FA 3VPRA 1LE8B 1JKOC 4DYQA 3K7AJ 2VPRA 2CQQA 1WI3A 5FKNA 4MIMA 1DU6A 2DA4A 1VI0A 3V78A 2WGBA 1GV5A 3BRUA 2H1KA 3KKDA 4M3GA 4A69C 3BR5A 3NRGA 3QKXA 2NP5A 5K7FA 3TEDA 2Q24A 3FIWA 4A3EJ 2HKUA 2YVEA 2E2JJ 3BJBA 3HTJA 3GBGA 1PUFA 1ETQA 1B8IB 1ENHA 2NVTJ 2KT0A 1BL0A 4G12A 1U78A 1ZKGA 5K58A 1FJLA 1WH7A 4BBSJ 2ZOYA 1AKHA 1FEXA 1AHDP 2XB5A 5IOYA 3BG9A 3E7QA 3TP3A 2EQRA 2E19A 2YUSA 3A03A 3FK6A 4XICA 2LK2A 2DMNA 1MBGA 5EF6A 2JWTA 1QVTA 1OJLA 3SJMA 4IHYA 4ACIA 4C2MJ 3BQZA 3LSPA 2TCTA 5EZGA 1D5YA 5C4XJ 3HTAA 2YS9A 1IDYA 2R5ZB 3KKCA 4GFKA 4MK6A 2NOGA 1BW6A 3GTQJ 2L7MP 1WCMJ 4I76A 5M5WJ 2ID3A 3B6CA 2M34A 2UXHA 4A3JJ 3PM1A 4AYBN 2PBXA 1WGXA 1YRNB 2NS7A 3BT9A 2QWTA 4AC0A 4BKXA 3DCFA 2LFBA 3BTLA 2CQXA 2TRTA 2XSDC 3ON4A 2Y2ZA 2CU7A 2DMTA 3EUPA 3PPBA 1S7EA 2ELKA 3BG5A 4BY7J 2FJ1A 1W0TA 4BY1J 1FIAA 5DAJA 1JJ6C 1TWHJ 3HTIA 1MBHA 4IHXA 4UUSB 1JT6A 3QBMA 1OCTC 1UI6A 4RDUA 3S1QJ 2ECBA 1IG7A 5FLMJ 1GT0C 3HEFA 2RAEA 1JKRC 1ZQ3P 1HDPA 3GTPJ 2HOTA 2DMQA 2ME6A 3MKLA 5CXIA 1MBFA 2VKVA 2DA5A 3L1PA 3O60A 1TWGJ 5FKOA 2KDZA 1IV6A 4FE4A 2H8RA 1ITYA 5EGOB 1RKWA 1ETYA 3FISA 2IEKA 4DZJA 1TWFJ 1Y1VJ 3F1BA 2DMPA 2OERA 1I50J 3ZOBA 4D5CA 1BW5A 3CJDA 2GBYA 1GVDA 2EZIA 2Y30A 5FKMA 3JRCA 4A93J 3DEWA 3NNRA 3CWRA 3JR9A 3ZQGA 1JUPA 2DA3A 1BA5A 3ANPA 1H89C 1Q1VA 3CMYA 1QRYA 2HI3A 2FX0A 2DA7A 4AF5A 1TWCJ 5IPAA 4A3GJ 1QVUA 4CGRA 1IGNA 1P7IA 2AHQA 1DU0A 3CQZJ 2LKXA 1MNMC 3S1RJ 2EZHA 4B4CA 3LNQA 1LFUP 5IYBJ 2D6YA 4KWAA 3HBLA 5EG0A 3HKZN 1ZGWA 2DA6A 3GZIA 3HM5A 5M5YJ 1JKPC 2FD5A 1HDDC 3KZ9A 3WHCA 4MO7A 3O8HA 4M3FA 2L0KA 2M2EA 3JRHA 3FRQA 3G1MA 4XRMA 2XGDA 5F27A 2K9NA 5M5XJ 2L9RA 2CJJA 2HDDA 1RPWA 2CRGA 2NX4A 4A3CJ 3Q0VA 2JA5J 5FJ8J 3S1NJ 4FE7A 5D19A 2LVSA 5BNGA 5C3EJ 2JJ7A 4QTRA 5DTDA 2L7ZA 4ICHA 1RESA 4XRSG 3PO3J 2YU9J 3CRJA 4DYCA 3FK7A 2EH3A 3CDLA 2Y9ZA 3JRDA 3PO2J 5J1UA 3ZQIA 2L7FP 2ME0A 3ZQHA 5M3MJ 2M9HA 2D5VA 3BTIA 2I10A 1RR7A 4LOCA 3D1NI 1VNDA 2G7SA 3VP5A 1JUMA 3BQYA 3Q0WA 1MBEA 3HB9A 3BR2A 2ID6A 1MH3A 3JRIA 2R5ZA 1ETKA 2EBIA 3C2BA 1JJ8C 3AQSA 3LWJA 4GCKA 3RH2A 3VIBA 4HKUA 2NVXJ 2WV1A 2DN0A 3BR1A 1HOMA 3S17J 2B63J 3G7RA 4A3KJ 5D18A 2WAQN 3RZOJ 5DS9A 3IH4A 3HGYA 3JREA 3LJLA 4YZEA 3HIMA 4XIDA 3LSGA 2O9LA 1JTXA 2F07A 2ZOZA 1ZK8A 3HOZJ 1F43A 4AC6A 3GTMJ 3BR3A 1XG1A 1IDZA 3JRAA 2ECCA 2QCOA 3BTCA 1QPIA 3M4OJ 3MVPA 3I4MJ 3ANGA 4FCYA 2UXUA 3BR0A 2XDNA 3RD3A 5J1RA 2OPTA 1K61A 5HSZA 5E3OA 3W6VA 4BXXJ 1OCPA 3ZQLA 4FISA 5HBUA 2HYTA 1UMQA 1YRNA 3PASA 2W53A 3VVZA 3DPJA 1IUFA 4EEFG 4A3MJ 4JP0A 4I6ZA 1HF0A 5JLXA 1P7JA 5C4JJ 1WH5A 2QOPA 4HNVA 4A3IJ 3UKGA 2NVYJ 3AQTA 4V2GA 3Q0UA 3GEUA 5D1RA 3BNIA 2WUIA 2ZCXA 2DA2A 2VI6A 9ANTA 2R0QC 1VFCA 1ETXA 2ZB9A 3BR6A 4GCLA 3T6NA 2W48A 3RQIA 5HAWA 1LE8A 4IHWA 1SGMA 1W0UA 3E7LA 4MFEA 5EEAA 2PMZN 4JNNA 3VW0A 1MH4A 3ON2A 2HQ5A 2DJNA 3LSRA 1U9OA 1AU7A 1AKHB 2HXIA 1XC5A 1ZR4A 2FQ4A 4D7NA 2NS8A 3TP0A 1XS9A 4CYCB 2QKOA 3SDGA 3VVYA 2OF7A 5IOZA 2XPUA 1JKQC 3COLA 3JRBA 1FTZA 1ZR2A 5EG0B 2XGCA 3P9TA 2P81A 3JRFA 2JMWA 5F04A 1B8IA 3EGQA 3S1MJ 1U9NA 2EZKA 2XRLA 3IH2A 3A01B 1H8AC 4PXIA 4NDLA 2EZLA 3SFIA 3NPIA 3VW1A 2JK3A 3CCYA 2LLKA 4ABZA 1UI5A 3ZQFA 5J1YA 5GPCA 3GTLJ 5FMPA 2HYJA 1MBJA 2MG4A 5E3NA 2GENA 1UHSA 3B81A 3JSJA 2GLOA 1Z0XA 3G1OA 1NTCA 3NARA 4IHVA 2RASA 5F0HA 4A3DJ 1ZTRA 3LHQA 2LY9A 3BCGA 4UUTA 3VUQA 1POGA 2XPWA 1RKTA 2HOAA 4C3IJ 4RBOA 4M3DA 2LD5A 3S15J 2K40A 4GFLA 1ETVA 1I6HJ 4X6AJ 4W97A 1JGGA 1K83J 5IYCJ 1HCRA 5F08A 4L5EA 2GUHA 2IBDA 4DZPA 3FKIJ 2FBQA 4JX4A 2HXOA 2XB0X 2G7GA 1T33A 3BHQA 3VOKA 5FHPA 2PZ9A 3RZDJ 1PUFB 4MLOA 1JUSA 5FKLA 2NVQJ 4NN1A 2GFNA 2QF7A 4D7MA 3HE0A 1MSFC 1MSEC 2E2HJ 2UXPA 1BJZA 3HGGA 4DYRA 2RHAA 4L62A 2UXIA 1X58A 4X1EA 2O7OA 2Y0SN 3G56A 2JA8J 2QIBA 3MNLA 5EZHA 3IV5A 5IYDJ 1X2NA 3HOYJ 3G1LA 3QPSA 4NELA 4MFDA 2CUEA 1ETWA 3A02A 5C44J 2XGEA 2O7TA 5EFYA 4J19A 1TC3C 3C07A 3KNWA 3H3VK 4UUSA 2X9DA 1OFCX 3K2AA 3HOXJ 3OSFA 1R9TJ 5H9TA 3HOWJ 2OI8A 1SANA 5FGLA 5F0FA 3NI7A 2G0EA 3F0CA 5F0CA 2R5YA 1E3OC 1GDTA 5C4YA 4B3AA 1T56A 3S2HJ 2REKA 1IRZA 1F36A 3VVXA 4MXMA 2M8GX 2UXOA 2MGQA 4IEJA 3RKQA 3TW7A 1U8BA 5IP7J 1NK2P 5J3LA 2HOSA 4M3EA 1I3QJ 3Q3SA 3VOXA 4D5FA 4QSHA 2GM4A 1FTTA 2MSYA 5K7HA 5GPAA 2R92J 4Y7NJ 4XRSA 3ZQCA 2COBA 4M3BA 5F1JA 5JLWA 2R5YB 3BG3A 2DG8A 5IP6A 3LSJA 2R7ZJ 2IAIA 3I4NJ 2Y31A 4B1RA 3HOUJ 4UDSA 3BTJA 2DA1A 5HODA 4JX5A 2VKEA 5AQCA 5CXGA 2E2IJ 3NXCA 4BBRJ 2MW8A 2JA6J 3S5RA 1LFBA 2G3BA 5EGOA 2XPVA 2Y9YA 1G2HA 2K9SA 5EYRA 2X6OA 2QTQA 1Z77A 2JN6A 3OIOA 4M6VA 4C3HJ 5FLVA 2LTPA 4GCTA 1NK3P 2DG7A 3TW6A 1VF9A 2X48A 1X2MA 2O8KA 2ZCMA 3VW2A 1A5JA 4DW6A 3QQAA 3S16J 1B72B 3GTOJ 4QIWN 1SFOJ 1APLC 2E1OA 4CYCA 2JA7J 3S14J 4ME9A 3O8GA 4A3BJ 2AO9A 3H0GJ 4GFBA 3A01A 1ETOA 1RETA 3HTHA 2CUFA 2LR8A 4JX6A 5M3FJ 1JT0A 1GUUA 5CW8A 2NP3A 5K7ZA 5GP9A 3GTJJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTZ A;  1MBK A;  2V57 A;  2N8G A;  4A3L J;  1TWA J;  2VUM J;  2DMU A;  3IH3 A;  1WPK A;  3JRG A;  2ZCN A;  4JL3 A;  1GV2 A;  4JKZ A;  1JTY A;  2M0C A;  1O4X A;  1B72 A;  2IU5 A;  1HLV A;  1Y1W J;  5IP9 J;  3OSG A;  3NAU A;  3WHB A;  1IJW C;  3IUV A;  3V6G A;  2K9Q A;  3B6A A;  1A6I A;  3HOV J;  3HDD A;  2G7L A;  4W1U A;  3M3Y J;  2LP0 A;  5FKK A;  4A3F J;  4FTH A;  4AUX A;  1H88 C;  1UG2 A;  1ORK A;  2WB1 N;  5EDN A;  3MN2 A;  4Y52 J;  3LOC A;  3S2D J;  1CQT A;  5E3M A;  3OOU A;  1FIP A;  1IC8 A;  3GTK J;  3QPL A;  5E3L A;  4XK4 A;  2YVH A;  3GTG J;  4JYK A;  2R93 J;  4C3J J;  4S0H B;  1EF4 A;  4V2F A;  3VPR A;  1LE8 B;  1JKO C;  4DYQ A;  3K7A J;  2VPR A;  2CQQ A;  1WI3 A;  5FKN A;  4MIM A;  1DU6 A;  2DA4 A;  1VI0 A;  3V78 A;  2WGB A;  1GV5 A;  3BRU A;  2H1K A;  3KKD A;  4M3G A;  4A69 C;  3BR5 A;  3NRG A;  3QKX A;  2NP5 A;  5K7F A;  3TED A;  2Q24 A;  3FIW A;  4A3E J;  2HKU A;  2YVE A;  2E2J J;  3BJB A;  3HTJ A;  3GBG A;  1PUF A;  1ETQ A;  1B8I B;  1ENH A;  2NVT J;  2KT0 A;  1BL0 A;  4G12 A;  1U78 A;  1ZKG A;  5K58 A;  1FJL A;  1WH7 A;  4BBS J;  2ZOY A;  1AKH A;  1FEX A;  1AHD P;  2XB5 A;  5IOY A;  3BG9 A;  3E7Q A;  3TP3 A;  2EQR A;  2E19 A;  2YUS A;  3A03 A;  3FK6 A;  4XIC A;  2LK2 A;  2DMN A;  1MBG A;  5EF6 A;  2JWT A;  1QVT A;  1OJL A;  3SJM A;  4IHY A;  4ACI A;  4C2M J;  3BQZ A;  3LSP A;  2TCT A;  5EZG A;  1D5Y A;  5C4X J;  3HTA A;  2YS9 A;  1IDY A;  2R5Z B;  3KKC A;  4GFK A;  4MK6 A;  2NOG A;  1BW6 A;  3GTQ J;  2L7M P;  1WCM J;  4I76 A;  5M5W J;  2ID3 A;  3B6C A;  2M34 A;  2UXH A;  4A3J J;  3PM1 A;  4AYB N;  2PBX A;  1WGX A;  1YRN B;  2NS7 A;  3BT9 A;  2QWT A;  4AC0 A;  4BKX A;  3DCF A;  2LFB A;  3BTL A;  2CQX A;  2TRT A;  2XSD C;  3ON4 A;  2Y2Z A;  2CU7 A;  2DMT A;  3EUP A;  3PPB A;  1S7E A;  2ELK A;  3BG5 A;  4BY7 J;  2FJ1 A;  1W0T A;  4BY1 J;  1FIA A;  5DAJ A;  1JJ6 C;  1TWH J;  3HTI A;  1MBH A;  4IHX A;  4UUS B;  1JT6 A;  3QBM A;  1OCT C;  1UI6 A;  4RDU A;  3S1Q J;  2ECB A;  1IG7 A;  5FLM J;  1GT0 C;  3HEF A;  2RAE A;  1JKR C;  1ZQ3 P;  1HDP A;  3GTP J;  2HOT A;  2DMQ A;  2ME6 A;  3MKL A;  5CXI A;  1MBF A;  2VKV A;  2DA5 A;  3L1P A;  3O60 A;  1TWG J;  5FKO A;  2KDZ A;  1IV6 A;  4FE4 A;  2H8R A;  1ITY A;  5EGO B;  1RKW A;  1ETY A;  3FIS A;  2IEK A;  4DZJ A;  1TWF J;  1Y1V J;  3F1B A;  2DMP A;  2OER A;  1I50 J;  3ZOB A;  4D5C A;  1BW5 A;  3CJD A;  2GBY A;  1GVD A;  2EZI A;  2Y30 A;  5FKM A;  3JRC A;  4A93 J;  3DEW A;  3NNR A;  3CWR A;  3JR9 A;  3ZQG A;  1JUP A;  2DA3 A;  1BA5 A;  3ANP A;  1H89 C;  1Q1V A;  3CMY A;  1QRY A;  2HI3 A;  2FX0 A;  2DA7 A;  4AF5 A;  1TWC J;  5IPA A;  4A3G J;  1QVU A;  4CGR A;  1IGN A;  1P7I A;  2AHQ A;  1DU0 A;  3CQZ J;  2LKX A;  1MNM C;  3S1R J;  2EZH A;  4B4C A;  3LNQ A;  1LFU P;  5IYB J;  2D6Y A;  4KWA A;  3HBL A;  5EG0 A;  3HKZ N;  1ZGW A;  2DA6 A;  3GZI A;  3HM5 A;  5M5Y J;  1JKP C;  2FD5 A;  1HDD C;  3KZ9 A;  3WHC A;  4MO7 A;  3O8H A;  4M3F A;  2L0K A;  2M2E A;  3JRH A;  3FRQ A;  3G1M A;  4XRM A;  2XGD A;  5F27 A;  2K9N A;  5M5X J;  2L9R A;  2CJJ A;  2HDD A;  1RPW A;  2CRG A;  2NX4 A;  4A3C J;  3Q0V A;  2JA5 J;  5FJ8 J;  3S1N J;  4FE7 A;  5D19 A;  2LVS A;  5BNG A;  5C3E J;  2JJ7 A;  4QTR A;  5DTD A;  2L7Z A;  4ICH A;  1RES A;  4XRS G;  3PO3 J;  2YU9 J;  3CRJ A;  4DYC A;  3FK7 A;  2EH3 A;  3CDL A;  2Y9Z A;  3JRD A;  3PO2 J;  5J1U A;  3ZQI A;  2L7F P;  2ME0 A;  3ZQH A;  5M3M J;  2M9H A;  2D5V A;  3BTI A;  2I10 A;  1RR7 A;  4LOC A;  3D1N I;  1VND A;  2G7S A;  3VP5 A;  1JUM A;  3BQY A;  3Q0W A;  1MBE A;  3HB9 A;  3BR2 A;  2ID6 A;  1MH3 A;  3JRI A;  2R5Z A;  1ETK A;  2EBI A;  3C2B A;  1JJ8 C;  3AQS A;  3LWJ A;  4GCK A;  3RH2 A;  3VIB A;  4HKU A;  2NVX J;  2WV1 A;  2DN0 A;  3BR1 A;  1HOM A;  3S17 J;  2B63 J;  3G7R A;  4A3K J;  5D18 A;  2WAQ N;  3RZO J;  5DS9 A;  3IH4 A;  3HGY A;  3JRE A;  3LJL A;  4YZE A;  3HIM A;  4XID A;  3LSG A;  2O9L A;  1JTX A;  2F07 A;  2ZOZ A;  1ZK8 A;  3HOZ J;  1F43 A;  4AC6 A;  3GTM J;  3BR3 A;  1XG1 A;  1IDZ A;  3JRA A;  2ECC A;  2QCO A;  3BTC A;  1QPI A;  3M4O J;  3MVP A;  3I4M J;  3ANG A;  4FCY A;  2UXU A;  3BR0 A;  2XDN A;  3RD3 A;  5J1R A;  2OPT A;  1K61 A;  5HSZ A;  5E3O A;  3W6V A;  4BXX J;  1OCP A;  3ZQL A;  4FIS A;  5HBU A;  2HYT A;  1UMQ A;  1YRN A;  3PAS A;  2W53 A;  3VVZ A;  3DPJ A;  1IUF A;  4EEF G;  4A3M J;  4JP0 A;  4I6Z A;  1HF0 A;  5JLX A;  1P7J A;  5C4J J;  1WH5 A;  2QOP A;  4HNV A;  4A3I J;  3UKG A;  2NVY J;  3AQT A;  4V2G A;  3Q0U A;  3GEU A;  5D1R A;  3BNI A;  2WUI A;  2ZCX A;  2DA2 A;  2VI6 A;  9ANT A;  2R0Q C;  1VFC A;  1ETX A;  2ZB9 A;  3BR6 A;  4GCL A;  3T6N A;  2W48 A;  3RQI A;  5HAW A;  1LE8 A;  4IHW A;  1SGM A;  1W0U A;  3E7L A;  4MFE A;  5EEA A;  2PMZ N;  4JNN A;  3VW0 A;  1MH4 A;  3ON2 A;  2HQ5 A;  2DJN A;  3LSR A;  1U9O A;  1AU7 A;  1AKH B;  2HXI A;  1XC5 A;  1ZR4 A;  2FQ4 A;  4D7N A;  2NS8 A;  3TP0 A;  1XS9 A;  4CYC B;  2QKO A;  3SDG A;  3VVY A;  2OF7 A;  5IOZ A;  2XPU A;  1JKQ C;  3COL A;  3JRB A;  1FTZ A;  1ZR2 A;  5EG0 B;  2XGC A;  3P9T A;  2P81 A;  3JRF A;  2JMW A;  5F04 A;  1B8I A;  3EGQ A;  3S1M J;  1U9N A;  2EZK A;  2XRL A;  3IH2 A;  3A01 B;  1H8A C;  4PXI A;  4NDL A;  2EZL A;  3SFI A;  3NPI A;  3VW1 A;  2JK3 A;  3CCY A;  2LLK A;  4ABZ A;  1UI5 A;  3ZQF A;  5J1Y A;  5GPC A;  3GTL J;  5FMP A;  2HYJ A;  1MBJ A;  2MG4 A;  5E3N A;  2GEN A;  1UHS A;  3B81 A;  3JSJ A;  2GLO A;  1Z0X A;  3G1O A;  1NTC A;  3NAR A;  4IHV A;  2RAS A;  5F0H A;  4A3D J;  1ZTR A;  3LHQ A;  2LY9 A;  3BCG A;  4UUT A;  3VUQ A;  1POG A;  2XPW A;  1RKT A;  2HOA A;  4C3I J;  4RBO A;  4M3D A;  2LD5 A;  3S15 J;  2K40 A;  4GFL A;  1ETV A;  1I6H J;  4X6A J;  4W97 A;  1JGG A;  1K83 J;  5IYC J;  1HCR A;  5F08 A;  4L5E A;  2GUH A;  2IBD A;  4DZP A;  3FKI J;  2FBQ A;  4JX4 A;  2HXO A;  2XB0 X;  2G7G A;  1T33 A;  3BHQ A;  3VOK A;  5FHP A;  2PZ9 A;  3RZD J;  1PUF B;  4MLO A;  1JUS A;  5FKL A;  2NVQ J;  4NN1 A;  2GFN A;  2QF7 A;  4D7M A;  3HE0 A;  1MSF C;  1MSE C;  2E2H J;  2UXP A;  1BJZ A;  3HGG A;  4DYR A;  2RHA A;  4L62 A;  2UXI A;  1X58 A;  4X1E A;  2O7O A;  2Y0S N;  3G56 A;  2JA8 J;  2QIB A;  3MNL A;  5EZH A;  3IV5 A;  5IYD J;  1X2N A;  3HOY J;  3G1L A;  3QPS A;  4NEL A;  4MFD A;  2CUE A;  1ETW A;  3A02 A;  5C44 J;  2XGE A;  2O7T A;  5EFY A;  4J19 A;  1TC3 C;  3C07 A;  3KNW A;  3H3V K;  4UUS A;  2X9D A;  1OFC X;  3K2A A;  3HOX J;  3OSF A;  1R9T J;  5H9T A;  3HOW J;  2OI8 A;  1SAN A;  5FGL A;  5F0F A;  3NI7 A;  2G0E A;  3F0C A;  5F0C A;  2R5Y A;  1E3O C;  1GDT A;  5C4Y A;  4B3A A;  1T56 A;  3S2H J;  2REK A;  1IRZ A;  1F36 A;  3VVX A;  4MXM A;  2M8G X;  2UXO A;  2MGQ A;  4IEJ A;  3RKQ A;  3TW7 A;  1U8B A;  5IP7 J;  1NK2 P;  5J3L A;  2HOS A;  4M3E A;  1I3Q J;  3Q3S A;  3VOX A;  4D5F A;  4QSH A;  2GM4 A;  1FTT A;  2MSY A;  5K7H A;  5GPA A;  2R92 J;  4Y7N J;  4XRS A;  3ZQC A;  2COB A;  4M3B A;  5F1J A;  5JLW A;  2R5Y B;  3BG3 A;  2DG8 A;  5IP6 A;  3LSJ A;  2R7Z J;  2IAI A;  3I4N J;  2Y31 A;  4B1R A;  3HOU J;  4UDS A;  3BTJ A;  2DA1 A;  5HOD A;  4JX5 A;  2VKE A;  5AQC A;  5CXG A;  2E2I J;  3NXC A;  4BBR J;  2MW8 A;  2JA6 J;  3S5R A;  1LFB A;  2G3B A;  5EGO A;  2XPV A;  2Y9Y A;  1G2H A;  2K9S A;  5EYR A;  2X6O A;  2QTQ A;  1Z77 A;  2JN6 A;  3OIO A;  4M6V A;  4C3H J;  5FLV A;  2LTP A;  4GCT A;  1NK3 P;  2DG7 A;  3TW6 A;  1VF9 A;  2X48 A;  1X2M A;  2O8K A;  2ZCM A;  3VW2 A;  1A5J A;  4DW6 A;  3QQA A;  3S16 J;  1B72 B;  3GTO J;  4QIW N;  1SFO J;  1APL C;  2E1O A;  4CYC A;  2JA7 J;  3S14 J;  4ME9 A;  3O8G A;  4A3B J;  2AO9 A;  3H0G J;  4GFB A;  3A01 A;  1ETO A;  1RET A;  3HTH A;  2CUF A;  2LR8 A;  4JX6 A;  5M3F J;  1JT0 A;  1GUU A;  5CW8 A;  2NP3 A;  5K7Z A;  5GP9 A;  3GTJ J; 
#chains in the Genus database with same CATH topology
 3TO7 A;  2DTZ A;  3BRO A;  2V57 A;  1SMT A;  2K3P A;  4BAC A;  4HST A;  2M7B A;  3O3K A;  4JL3 A;  4OOI A;  1GV2 A;  3JTH A;  2M0C A;  1B72 A;  3SWH A;  1HLV A;  5IP9 J;  3OSG A;  3GX4 X;  1MJ9 A;  2XF6 A;  1WJB A;  4WCG A;  3I59 B;  3SZP A;  3DPT A;  2G7L A;  1WJD A;  1PYV A;  3LSK A;  5DV5 A;  5DD4 A;  5FGM A;  2E1C A;  2KJC A;  2ZXJ A;  1FOW A;  3JSO A;  1CQT A;  3S2D J;  2X1C A;  3BCB A;  1ZRD A;  1OYI A;  1IC8 A;  2DU9 A;  1H0M A;  1Y0U A;  5E18 F;  5CVU A;  3GEZ A;  3LQR A;  3E3V A;  3ULQ B;  3C3W A;  2H94 A;  3L7W A;  4JYK A;  4S0H B;  1EF4 A;  3A4C A;  2L9V A;  4V2F A;  1QU3 A;  3D5R C;  3VPR A;  2GIV A;  1YJN I;  3K7A J;  1R49 A;  1WI3 A;  3DP7 A;  4MIM A;  5KAF C;  3A0H C;  3GLL A;  1DU6 A;  1Z3X A;  4S05 A;  3V78 A;  1W5T A;  4M3G A;  3NRG A;  4IQJ A;  4AVZ A;  3UR3 C;  2OCC H;  3TED A;  4A3E J;  4Q4Z F;  2E2J J;  4BAY A;  3BJB A;  3HTJ A;  1ENH A;  4CCJ A;  2CQ7 A;  3DTI A;  4OIN F;  2W00 A;  1ZKG A;  1FJL A;  2IA0 A;  4BBS J;  5D6F A;  1FEX A;  3S32 A;  2KFD A;  2JQ7 A;  1T0F A;  4MEX F;  1B59 A;  4P96 A;  4HLX A;  1HW2 A;  4RGR A;  2EQR A;  5FRO A;  3LSI A;  1TL8 A;  5EF6 A;  4RLF A;  3F21 A;  3SJM A;  4ACI A;  5HDG A;  5EZG A;  1LKX A;  4MNU A;  1O7L A;  3TO9 A;  2P5L C;  4C30 A;  5HDK A;  2NOG A;  1KON A;  1VQM I;  1WVR A;  3K4J A;  1J2X A;  3T0Y A;  4UB8 C;  4PCQ A;  2UXH A;  1TLH B;  4WXH A;  2YX7 A;  2MAB A;  3J7Z I;  1J09 A;  4ZYG A;  4J00 A;  4L0Z B;  2NS7 A;  4ZDL A;  3NS4 A;  4AC0 A;  4Y15 A;  2LFB A;  2XAG A;  5DCF A;  1R58 A;  1X3Z B;  1S7E A;  2DYR H;  3ABU A;  3DKX A;  2V1D A;  3ABK H;  3EUH C;  5DAJ A;  3ASN H;  2ZSH B;  1JJ6 C;  3HTI A;  2LY1 A;  2XAH A;  3SDB A;  4PDK A;  3CCS I;  1FOX A;  1JT6 A;  1MND A;  5B3S H;  3ZMU A;  3FM3 A;  1FP2 A;  3I59 A;  1JKR C;  5FD6 A;  5F6F A;  2CFO A;  3KP6 A;  5ICC A;  1SD6 A;  2ME6 A;  3K4K A;  4QPO A;  1VQ4 I;  1U0J A;  4M73 A;  1IV6 A;  1B4A A;  2LYC A;  2M0M A;  4FE4 A;  2M1B A;  2EFW A;  2B0L A;  1RKW A;  2XKP A;  2OU2 A;  3TDZ C;  1IRF A;  1X1A A;  3I64 A;  3W6J B;  4DZJ A;  1TW3 A;  2DMP A;  4OIQ F;  5BOX A;  1BW5 A;  3KP3 A;  4E7I A;  5CQG A;  4HLY A;  4PSW A;  2OZU A;  3ASO H;  3L2C A;  3DEW A;  1H9G A;  1ON2 A;  2XAU A;  2PX9 A;  3ZQG A;  4FX4 A;  1JUP A;  1X1D A;  3ANP A;  1WJE A;  3AAF A;  4A0Z A;  1U5T B;  4FHT A;  3RI4 A;  4A3G J;  2RKH A;  2OJE D;  1TP4 A;  5HOO A;  1T39 A;  4LIU A;  2D45 A;  2AHQ A;  1FYM A;  4BNC A;  4GYG A;  2CW0 F;  4KDP A;  2ZNY A;  5DCM A;  3OYM A;  4B4C A;  1JHH A;  4XRF A;  3LNQ A;  3CCV I;  3HC7 A;  2E5N A;  5GTI C;  2DFH A;  1ZGW A;  4EJW A;  4Y33 A;  5LEJ A;  5H20 A;  3K4N A;  2DK5 A;  5M5Y J;  5BPD A;  2BW3 B;  1P2F A;  1YYV A;  3WHC A;  2VE9 A;  3K6G A;  2M2E A;  3W2A A;  4XRM A;  3EYI A;  4NC7 A;  2ZME B;  2HDD A;  3F22 A;  4M9Z A;  2VQC A;  2CRG A;  1QPM A;  3BWG A;  4RAF A;  4JQF A;  2WV0 A;  2CG4 A;  5FJ8 J;  4FE7 A;  4NHJ A;  2EIJ H;  5BNG A;  4BHC A;  5C3E J;  2E1M C;  4QTR A;  3DKW A;  3JW4 A;  1IAW A;  1EH8 A;  3PO3 J;  1IV8 A;  3GME A;  3QWL A;  3ELK A;  3CRJ A;  1KQ8 A;  3PSI A;  2KZV A;  2Q1Z B;  1K78 A;  4IX7 A;  1O3S A;  4HV5 A;  4CCN A;  2I10 A;  1XMA A;  1VQK I;  3E6B A;  4BDZ A;  2WC2 A;  4BJ6 C;  1KQ0 A;  2VC0 A;  2R5Z A;  2GXA A;  2L9S A;  2PJP A;  4GCK A;  2HWV A;  1TQM A;  3CUQ C;  3ECH A;  3DBR B;  2Y48 A;  3QYE A;  4E7K A;  3IHU A;  4AM3 A;  1VZ0 A;  3S17 J;  3CJT B;  2LG4 A;  5D18 A;  1S29 A;  1JXS A;  1BI3 A;  5HVQ C;  2EFO A;  3LJL A;  4YZE A;  4A5M A;  3L00 A;  4IXA A;  5EEH A;  2CV0 A;  1TQP A;  2DT6 A;  3SEZ A;  2KLO A;  2Z16 A;  1ZK8 A;  2PMU A;  2UUZ A;  4KIC A;  4AC6 A;  3GTM J;  3CD6 I;  4L9N A;  3JRA A;  2ECC A;  1C0W A;  2L4A A;  1HXD A;  3M4O J;  3MVP A;  4IJA A;  3PJR A;  2L5Q A;  1R36 A;  2QZ8 A;  3ANG A;  1IXC A;  4M74 A;  2PI0 A;  1SFE A;  3FXL A;  3RD3 A;  5LEK A;  2OPT A;  3TOA A;  2WBM A;  2VJ4 A;  1VQL I;  1G3S A;  2R7U A;  1W7P D;  3K2Z A;  2HYT A;  1B1B A;  2ZXH A;  1WSU A;  3QYB A;  3FF5 A;  3ZMD A;  4EJO A;  1FOK A;  4YIR X;  2XSJ C;  4KT5 C;  1IO2 A;  5CVR A;  5FRN A;  2K7L A;  1Z21 A;  4K2E A;  4F7Z A;  2BXY A;  1XTA A;  2VI6 A;  3ZRG A;  2ZCW A;  2GXG A;  5LHI A;  3I0T A;  1QNT A;  2M7A A;  2OTL I;  2VE8 A;  5CJ9 A;  2HQA A;  5KAI C;  2ETH A;  3S3O A;  4IHW A;  1SGM A;  4MFE A;  1A6Q A;  5EEA A;  1Y39 A;  4JNN A;  5CVV A;  1STZ A;  5CLS A;  3H5N A;  2DJN A;  2DOA A;  1LVA A;  1U9O A;  2DTR A;  3FXO A;  3IP4 B;  2FQ4 A;  2CQN A;  3TP0 A;  1XS9 A;  1BJA A;  2E7X A;  1E17 A;  1G3T A;  2K4B A;  3WU0 A;  3JRB A;  2KJB A;  3FXR A;  3IWF A;  1FC3 A;  3DLA A;  2P81 A;  2FML A;  1QZY A;  1K4S A;  5F04 A;  2WY8 Q;  2Y0M A;  2XHK A;  3IRR A;  3GUD A;  3S1M J;  3IH2 A;  3F8M A;  4PXI A;  2LOO A;  4UV9 A;  3VW1 A;  3H9G A;  4JK1 X;  5ED4 A;  3ZQF A;  4IRH A;  5FMP A;  4PFP A;  2ISZ A;  3BJO A;  3WE3 A;  5CVI A;  3M1C A;  1IF1 A;  3L2R A;  4ZTF A;  2ESH A;  3KYC B;  2R4G A;  2GLO A;  1Z0X A;  1R6R A;  1GXQ A;  2BY2 A;  4XBF A;  3EET A;  4IHV A;  1X3U A;  2HU9 A;  1U8R A;  1VQ9 I;  3QAH A;  5F0H A;  2X51 A;  4HQE A;  3G6E I;  3LST A;  1WZ2 A;  2KIQ A;  2LD5 A;  2M3A A;  2O3F A;  3ONQ A;  4UVC A;  3TDU C;  2QUF A;  3KET A;  2VN2 A;  2MD0 A;  4DNC A;  4CYD A;  3VOD A;  4W97 A;  3P9I A;  1QGP A;  5F08 A;  1HCR A;  2IBD A;  4DZP A;  2EV6 A;  3CLO A;  2R7V A;  2HXO A;  2XB0 X;  4OD5 A;  2G7G A;  3PQJ A;  3LMM A;  4IF4 A;  3AG2 H;  3KZI C;  2QBY B;  1PUF B;  5FKL A;  3CMM A;  3QPT A;  3ESW B;  3HKZ A;  3QOE A;  2QSH X;  4LGW A;  2GFN A;  3GZ6 A;  2KRH A;  4A12 A;  4EV0 A;  3HE0 A;  4Z6Y A;  1MSE C;  2MLK A;  1Y6I A;  4L62 A;  2DYS H;  3K69 A;  3CCR I;  3REO A;  1HQC A;  1OIS A;  2NYX A;  2O7O A;  2Y0S N;  4OWR B;  2H8W A;  2ZY9 A;  3V4G A;  1OCR H;  2M8E A;  3IV5 A;  2BBY A;  5GAE J;  3OS1 A;  1X2N A;  3HOY J;  1FSE A;  5E8I A;  4E7S A;  5DD8 A;  4RAY A;  4NEL A;  1Z3Y A;  3A02 A;  2QQB A;  3AG3 H;  2EIK H;  4HX8 A;  3RTR A;  1Z91 A;  1XSD A;  3KNW A;  1P4W A;  3H3V K;  3OYH A;  3H36 A;  2X9D A;  4RGU A;  1SFX A;  2NNN A;  1R9T J;  1EV7 A;  1S8N A;  4HG2 A;  4KYW A;  5D5V B;  4RA2 A;  5F0F A;  2F5F A;  3F0C A;  5F0C A;  3MD2 A;  1GXP A;  1GDT A;  3LA2 A;  2REK A;  2G9W A;  3WGI A;  1F36 A;  2O61 A;  3VVX A;  3DPU A;  4XLF A;  4NQW B;  4FAS D;  1TNT A;  4J01 A;  2JT1 A;  1XMX A;  3DV8 A;  1R1V A;  1YIO A;  4IL6 C;  1WHU A;  3CJN A;  3K4C A;  4GRI A;  5J3L A;  1I3Q J;  2LF8 A;  3VOX A;  1HW1 A;  4QSH A;  5FO5 A;  4LMY A;  3RKX A;  3ZCO A;  2QYO A;  3KEO A;  4ASN A;  3CCE I;  3ZP5 A;  2ZKZ A;  2GM4 A;  1FTT A;  2V9K A;  1IN8 A;  2XUB A;  4LG0 A;  3ZQC A;  4EJV A;  5F1J A;  1YHQ I;  3KFW X;  3KE2 A;  5E20 A;  3RQ4 A;  2IAI A;  2W24 A;  3IC7 A;  2MC4 A;  4IZZ A;  3E5Q A;  3ZR8 X;  3HSF A;  1UG0 A;  2M30 A;  4A0X A;  2COM A;  5CXG A;  3TQN A;  2RRE A;  3ZN1 A;  2JA6 J;  4U87 A;  1J59 A;  3KP2 A;  2UWM A;  1LFB A;  3CF2 A;  3NWS A;  4XLC A;  4DBR A;  1IN4 A;  4BL0 B;  4Q5S F;  2Y9Y A;  1P6R A;  2X6O A;  2QQ8 A;  3GO5 A;  1FYL A;  4UB6 C;  3OIO A;  1FY7 A;  2KDO A;  4CCM A;  2LTP A;  3CMA I;  5GTH C;  4GCT A;  4KT6 A;  3TW6 A;  2IVM A;  2STW A;  1VF9 A;  5AIP A;  5K5Q A;  1D0Z A;  1FP1 D;  2L4M A;  5D8L B;  1X2M A;  2O8K A;  1B6A A;  5D4S A;  2ZCM A;  1J7K A;  1A5J A;  1Z9C A;  3HPG A;  3QQA A;  3ZQQ A;  4DW6 A;  4GGG A;  2ELH A;  4ESB A;  3GTO J;  4IVN A;  1SFO J;  1OCZ H;  1APL C;  1R1U A;  3J7A Y;  1K6Y A;  4CYC A;  2JA7 J;  3M8F A;  4I98 B;  5J47 A;  4ME9 A;  5B1B H;  3V8L A;  3CUO A;  4M72 A;  2LR8 A;  2BE5 F;  4JX6 A;  5KNL A;  1GUU A;  5CW8 A;  1WJA A;  4CDG A;  1MMS A;  5GP9 A;  2PJR A;  2HVQ A;  2NVU B;  4E70 A;  4ANJ A;  2N8G A;  4A3L J;  3QP5 A;  2V1N A;  2IGK A;  3PQK A;  2BGC A;  2VUM J;  2DMU A;  3LA3 A;  2ZCN A;  1BI2 A;  4JKZ A;  1JTY A;  2QQ9 A;  5D5X B;  2BZT A;  1G4D A;  3ERM A;  3WHB A;  1IJW C;  4RS8 A;  1OR7 A;  2O5R A;  3BPV A;  1XN7 A;  3I55 I;  3H0D A;  1O3Q A;  2DPD A;  3GYH X;  2QKL B;  4O6J A;  5K1Y A;  4W1U A;  3M3Y J;  1FBU A;  4U0W A;  1EA3 A;  5FKK A;  4FTH A;  4A3F J;  1H88 C;  3UNG C;  1UG2 A;  1ORK A;  2WB1 N;  3CDH A;  3MN2 A;  3V7C A;  5EDN A;  4G6D A;  2K9M A;  3QOD A;  3LOC A;  2ZJ2 A;  3R0A A;  3P5J A;  2VOP A;  2LRE A;  2GA1 A;  3OOU A;  4OMZ A;  4OIO F;  3GTK J;  2M4G A;  4RB1 A;  1KA8 A;  5E3L A;  2CFX A;  3O2P E;  4XK4 A;  2YVH A;  4CCK A;  4EAT A;  1XDS A;  3FX3 A;  2DCE A;  3GTG J;  2EJR A;  2ZJR F;  4C3J J;  3I4P A;  2HTJ A;  5FLX Z;  4P5O A;  2CW7 A;  4R1H A;  3SQN A;  4LJZ F;  4CZZ A;  1LE8 B;  1JKO C;  2MH2 A;  2OA4 A;  3P9C A;  4PFO A;  4LG3 A;  5HS7 A;  1YG2 A;  2LBF A;  1Y56 A;  3E5X A;  2FMY A;  3BDD A;  2FEZ A;  3KKD A;  3BR5 A;  1VQ5 I;  3QKX A;  3F8C A;  3NRV A;  3E6D A;  2D2W A;  1T08 B;  3WTZ A;  3DLL F;  4M9S A;  1BIA A;  3FIW A;  3LL7 A;  3G4S I;  1PUF A;  2EA2 A;  3EUK L;  1BL0 A;  1BIB A;  3L2W A;  4YEJ A;  1RRJ A;  5K58 A;  1G59 A;  1BM9 A;  1WH7 A;  3KYD B;  1Z67 A;  2GZW A;  2XB5 A;  5E79 C;  3BG9 A;  2F5D A;  3E7Q A;  4HF0 A;  2YUS A;  4MGR A;  3I5U A;  2IA1 A;  2DOF A;  2KP6 A;  2XGX A;  1BOB A;  3CDI A;  4MQV A;  4C2M J;  3G2B A;  1FMW A;  2V9P A;  2DFE A;  2XV4 S;  5ICF A;  2PLY A;  3PNY A;  2YS9 A;  4RGS A;  3KKC A;  3D5L A;  2BY3 A;  1BW6 A;  3GTQ J;  4LG0 B;  2L7M P;  1WCM J;  4I76 A;  5M5W J;  1I27 A;  2ID3 A;  1ACI A;  2DAO A;  3U1D A;  4Y3O A;  2K9L A;  3PM1 A;  4AYB N;  1ZRC A;  3FXK A;  1ZH5 A;  2B1E A;  2PBX A;  1WGX A;  3KZY A;  1RUN A;  1XSV A;  1YRN B;  3AG1 H;  1FX7 A;  2V6E A;  2BOL A;  1S5L C;  3BTL A;  4H4K C;  3COA C;  2ZFU A;  1MMD A;  3ON4 A;  1QHG A;  2MD5 A;  5IT3 A;  2X6W A;  1FT9 A;  4KN4 X;  2FJ1 A;  2IS6 A;  4XON A;  4WK8 F;  1LVK A;  3BZ6 A;  3JSP A;  1MBH A;  2LF7 A;  2QKM B;  1V5F A;  4ESJ A;  1N77 A;  3QBM A;  2K5C A;  1UI6 A;  2MYS A;  1RUO A;  4G7H F;  5DCM B;  2A6H F;  3CP2 A;  3KP5 A;  3U9G A;  3S1Q J;  5BPI A;  4BQO A;  3HEF A;  3TKY A;  4BJ5 C;  3O6B B;  1I1S A;  3J7A O;  4NUB A;  3MKL A;  5CXI A;  5DYM A;  2MLG A;  3L1P A;  2VT2 A;  3PUF A;  4FT8 A;  2OTJ I;  2Q2E A;  2R7W A;  3H5R A;  3MKZ A;  1ETY A;  3HJE A;  3VFZ A;  3HOT A;  2GOX B;  1DDN A;  3F1B A;  1Y1V J;  2E7W A;  3OR1 C;  3ZOB A;  2OER A;  2LC2 A;  4M9X A;  1SMY F;  2EZI A;  4UNO A;  1MMG A;  1TBX A;  4A5N A;  4A6E A;  3CWR A;  1UFM A;  2BV6 A;  2V4J C;  1PP8 F;  1Q1V A;  3GFI A;  1QRY A;  1TTY A;  2FX0 A;  1BBY A;  3OYB A;  2DFI A;  4IRV A;  4I01 A;  3AG4 H;  2XAF A;  1TWC J;  5LRR A;  1RNL A;  4BH9 A;  1HSJ A;  3I53 A;  2YPR A;  2P7V B;  4PGH A;  3CLQ A;  1I1G A;  2F5V A;  4LIT A;  3GCM A;  1OYW A;  3RPU A;  3S1R J;  2EZH A;  4OIP F;  4X0G A;  3CC4 I;  5TJJ A;  5IYB J;  2D6Y A;  4LLN A;  3HBL A;  5EG0 A;  3HTS B;  2RQQ A;  2DA6 A;  2UXX A;  2XF5 A;  2ELJ A;  3QOP A;  1PJR A;  3FXM A;  4G7O F;  1JKP C;  1HDD C;  1DP3 A;  3OL3 A;  3FHN A;  1ZRF A;  2Z99 A;  3B73 A;  4L5I A;  3JRH A;  2VPL A;  2OQG A;  3N97 A;  4RM2 A;  2M4K A;  2DT7 B;  1A04 A;  4HF2 A;  1RPW A;  2X6X A;  1HA8 A;  2NX4 A;  3KEY A;  4PJJ A;  2X0L A;  1RC9 A;  5HDN A;  1K79 A;  2JA5 J;  2LBF B;  1ERD A;  5D19 A;  2G7H A;  2NS0 A;  4HA8 A;  4YII A;  3VYR B;  3SEQ A;  2JJ7 A;  5K5R A;  5DTD A;  2L7Z A;  4BEH B;  4DYC A;  2IGO A;  3NQO A;  4LFU A;  1B9M A;  2Y9Z A;  4YG2 F;  4WXC A;  3ZQI A;  3TL4 X;  3BTI A;  4L5J A;  4CUG A;  1LUJ B;  1VND A;  4KIF A;  3IL2 A;  2WWY A;  3VP5 A;  2CV1 A;  2X6Y A;  1MH3 A;  3J7Y J;  4FX0 A;  5FFX A;  2LKS A;  3JRI A;  2YVX A;  4H0E A;  3C2B A;  3HRT A;  3AQS A;  2CGP A;  1F9N A;  4CIC A;  2KPM A;  4HKU A;  2WV1 A;  2DN0 A;  4I7H A;  4AID A;  3HYI A;  1IN7 A;  2GOM A;  2MC3 A;  2Z2S B;  2V6C A;  5DS9 A;  1REP C;  2DOD A;  3L2Q A;  2LDU A;  4I99 C;  2VBZ A;  2KMU A;  1DQU A;  2A61 A;  3ZXS A;  2ZOZ A;  2ESN A;  1IN6 A;  2XAS A;  3OL4 A;  1UAA A;  1F43 A;  3BR3 A;  4XLP F;  3BZC A;  5CVJ A;  5FLX K;  1IDZ A;  1Z05 A;  3LA7 A;  4L9V A;  2VT3 A;  4EM0 B;  1O57 A;  2ZME A;  1FYK A;  3I4M J;  1YS7 A;  2XF7 A;  2UXU A;  3P9K A;  3CUQ A;  1WKM A;  3OYD A;  1LDD A;  1LEB A;  1K61 A;  5HSZ A;  2HYF A;  5JR3 A;  5E3O A;  1D5V A;  4BXX J;  4C2M A;  5HBU A;  1UMQ A;  2VC1 A;  3DPJ A;  1NH3 A;  4XLH A;  3E6C C;  4JP0 A;  5JLX A;  1P7J A;  1XD7 A;  5C4J J;  1VQN I;  3F23 A;  2QOP A;  2XKO A;  1KU3 A;  4HNV A;  1FMV A;  2LNB A;  2NVY J;  5D1R A;  1IXS B;  4V2G A;  3MQ0 A;  2WB1 A;  1R71 A;  3SHF A;  3NWT A;  2WUI A;  2W84 A;  2IPQ X;  3BR6 A;  5F64 A;  2P5K A;  3T6N A;  1P9Q C;  2DK8 A;  1R1T A;  4L18 B;  3PFY A;  1MH4 A;  5LGN A;  2UV1 A;  5FD5 A;  3SFZ A;  4U7B A;  2HQ5 A;  2V9V A;  3T5X A;  4OU0 A;  4ZYH A;  3ABT A;  4DJA A;  3LWF A;  1ZR4 A;  3HRU A;  3K4B A;  3K1N A;  1E0E A;  4EJU A;  4V19 K;  2QKO A;  2DI3 A;  1T95 A;  3F8F A;  1BI0 A;  3K1P A;  3KLN A;  4UVB A;  1FTZ A;  3C2G A;  2V7F A;  4ZH4 F;  2R7S A;  3BG6 A;  2KIF A;  1TT5 B;  1B8I A;  3W3C A;  4XLE A;  2XRL A;  1HKT A;  1ZGJ A;  3V8K A;  3ZMZ A;  4I02 A;  3H9J A;  5J1Y A;  2XAJ A;  5GPC A;  2HYJ A;  2MG4 A;  3QPH A;  2H1L A;  1MZB A;  3M8E A;  1ZEL A;  1Q1H A;  3B81 A;  4HOB A;  3JSJ A;  4P55 A;  2IRF G;  4OAY A;  3G1O A;  1NTC A;  3NAR A;  1YTY A;  4WIB A;  3DQV C;  2PMH A;  2AQF A;  2CUJ A;  1OLT A;  1FLI A;  1L3L A;  5BQT A;  4C3I J;  4Z2Y A;  5D5U B;  2EK5 A;  1U5T A;  4N0B A;  1I6H J;  1JGG A;  1J9I A;  4L5E A;  2WAE A;  5ERI A;  4E7L A;  3RPQ A;  4ETS A;  2DDB A;  2WA0 A;  2HS5 A;  4FET A;  1T33 A;  2OAZ A;  5L3G A;  4AIH A;  2PZ9 A;  3RZD J;  3JTG A;  3CTA A;  5ICE A;  4MLO A;  4NN1 A;  2ZSI B;  4M6Y A;  3RJP A;  4LK1 F;  3ZMV A;  4IOA F;  5CKT A;  1BJZ A;  3HRM A;  2UXI A;  2ZC2 A;  5JI6 A;  2PBI A;  5E1X A;  1YJ9 I;  3G56 A;  1HW5 A;  2QIB A;  5EZH A;  2ZME C;  4XOR A;  5CPR B;  4UUV A;  5LHG A;  2CSO A;  3CZ6 A;  4BHP A;  2PFV A;  1ZG5 A;  4MFD A;  1LNW A;  3K0L A;  2P7C B;  5C44 J;  1R4M B;  5H6Q A;  3ZMS A;  4XN3 A;  1TC3 C;  2CUZ A;  3RDI A;  4G8X A;  4HRI A;  3DBL B;  3QU3 A;  3DKY A;  5L3B A;  3HOX J;  3OSF A;  2UXN A;  2NOJ B;  2HPI A;  5FGL A;  3NI7 A;  1W1W E;  2NAZ A;  3VYS B;  3H9Q A;  3G3Z A;  5IY5 H;  2V79 A;  2NRA C;  1SD7 A;  1LDJ A;  5DM7 F;  2DFF A;  1U8B A;  5IP7 J;  1NK2 P;  2RN7 A;  2O0Y A;  2X1D A;  4IQ4 A;  4M3E A;  3EQL F;  1S7A A;  3MEX A;  3S93 A;  4HX7 A;  3AFH A;  5EEG A;  5AON A;  2MSY A;  3W2W A;  4WXD A;  3OYL A;  3VB2 A;  2EWN A;  5GPA A;  4Y7N J;  2L9N A;  5TIS C;  3KP7 A;  1SD4 A;  5JLW A;  2DOE A;  1JI8 A;  4XOP A;  3CC2 I;  1O3R A;  3A1Y A;  1PVE A;  5IP6 A;  3PIP F;  3LSJ A;  1R7J A;  1H9T A;  2R7Z J;  1MKM A;  4B1R A;  4F3Q A;  3WGG A;  2HDC A;  1X1P A;  4JX5 A;  5AQC A;  3NXC A;  4BBR J;  4MTD A;  2P4W A;  2MW8 A;  3GXO A;  4BE0 A;  4LIV A;  5TRD A;  3S5R A;  3E6M A;  2DO7 A;  2G3B A;  5EGO A;  5FB2 A;  2IS1 A;  3K10 A;  1E3H A;  3E5U A;  1U5T C;  4HNT A;  4Q48 A;  1Y8R B;  2ZO4 A;  4HW0 A;  2HTS A;  1I6X A;  1YW8 A;  2JN6 A;  2K27 A;  4GCV A;  4M6V A;  4RGX A;  3OYA A;  1NK3 P;  4WWC A;  2IJL A;  3OIQ A;  3BLY A;  5H6R A;  3Q5F A;  2JUC A;  3EUH A;  2D1V A;  2RQP A;  5DDG A;  2BEO A;  1MDM A;  2FNP A;  2QWW A;  3S14 J;  2M45 A;  3J81 Z;  1EH6 A;  3JAM Z;  4A3B J;  1X4P A;  2BVL A;  4GFB A;  3CCL I;  2KZG A;  3F6O A;  1RET A;  1AA7 A;  2P6T A;  4R79 A;  2CV2 A;  1RI7 A;  4MQ9 F;  1JT0 A;  2ZNZ A;  5K7Z A;  3FDY A;  3R61 A;  3GTJ J;  2NP3 A;  3M1E A;  4BYY A;  2A69 F;  3ERE D;  1TWA J;  3DBH B;  2EV0 A;  1WPK A;  3JRG A;  1DPU A;  3V8J A;  1XGM A;  3F3X A;  1O4X A;  1Y1W J;  1HST A;  5FFZ A;  3NAU A;  3GZ5 A;  2CMP A;  1VQ7 I;  2QQA A;  4UHT A;  3IRQ A;  2JSP A;  3VTI A;  2K9Q A;  4DVY P;  1A6I A;  2G7U A;  5J6X A;  3KLO A;  3T1B A;  1J75 A;  3KIO A;  2LP0 A;  4LLL A;  2B3W A;  2KRF A;  4AUX A;  1IUY A;  2VBY A;  3RKW A;  3E97 A;  2GXB A;  2ZXI A;  4PGG A;  2WTE A;  3KZZ A;  1FIP A;  3QPL A;  4O3M A;  3JCU C;  2FXA A;  1E2X A;  3IWZ A;  1L0O C;  1PP7 U;  1V5E A;  4XQF A;  3V7R A;  2EFN A;  4N4O B;  4LLG F;  1SFU A;  1KZH A;  4DYQ A;  1ZAR A;  4EGY A;  1T38 A;  4B3X A;  3MZY A;  1X1B A;  1OYY A;  1F1Z A;  5L3D A;  3WU1 B;  3G71 I;  4BDY A;  1YX5 A;  4ZTJ A;  2H1K A;  2BY1 A;  2F5C A;  2OZ6 A;  4HAM A;  3HPH A;  1Y0N A;  4GDF A;  2Q24 A;  2JUG A;  1I3A A;  5KK1 A;  3IAM 2;  2LMD A;  4AYB A;  1ETQ A;  1O3T A;  4KMF A;  3HRS A;  2KT0 A;  4G12 A;  1BR4 A;  1XCV A;  1BN5 A;  1X19 A;  2L02 A;  2FOK A;  4AVP A;  1AKH A;  1J0R A;  2OV7 A;  2E1N A;  3GW2 A;  5IOY A;  5E17 F;  3TP3 A;  4ZYA A;  2E19 A;  3A03 A;  4XIC A;  1LEA A;  1YW9 A;  2FBI A;  2LK2 A;  3OYE A;  2JWT A;  1QVT A;  1TW2 A;  4IHY A;  2KKO A;  1W4M A;  4CCL A;  5DUI A;  3BQZ A;  4LK0 F;  4PK4 A;  1D5Y A;  3FBI B;  5C4X J;  3HTA A;  4GFK A;  1IDY A;  2R5Z B;  1D1A A;  1SAU A;  3ABL H;  2HKX A;  3WTW C;  3WTY C;  2EIL H;  5JVG F;  2QLZ A;  1OKR A;  3B6C A;  1VQO I;  2M34 A;  5LGT A;  3KYL A;  1R00 A;  4IRI A;  2GIZ A;  4CA0 A;  2QWT A;  5HLG A;  4XM3 A;  4BKX A;  4NBQ A;  1R4N B;  4OMY A;  1R22 A;  2CQX A;  1MGT A;  4L9T A;  3OWT A;  3WE2 A;  4CH7 A;  3WTX C;  2FNA A;  3EUP A;  4BY7 J;  2ELK A;  3BG5 A;  1RZ4 A;  2VOD A;  3M7G A;  4BY1 J;  2AXT C;  1FIA A;  4NB5 A;  1TWH J;  1XX5 A;  2WAQ A;  2R3S A;  2E60 A;  1D8J A;  2VKH A;  3JAM K;  2LRD A;  3RIR A;  2ECB A;  6PAX A;  4KA4 A;  1IG7 A;  5HNF A;  5D8K B;  2LH9 A;  4XKC A;  1WJF A;  2DMQ A;  1W5S A;  2LSO A;  2BXZ A;  1CGP A;  2RNJ A;  1CF7 A;  1BC7 C;  2ZJQ F;  1MBF A;  3D0S A;  2I5U A;  1D0X A;  1TWG J;  2ADU A;  3X2Q H;  2L7K A;  5ILU A;  3FMQ A;  1AWC A;  3BY6 A;  2H8R A;  3MMY B;  2HYG D;  2VKD A;  2WY7 Q;  3HHH A;  5EGO B;  4II3 A;  3FIS A;  2K86 A;  4KNY A;  3DU6 A;  1TWF J;  2W1O A;  1BR2 A;  3PL8 A;  5JHF A;  1I50 J;  4C2U A;  1WFX A;  3CJD A;  2I8D A;  4HNU A;  2GBY A;  1FBS A;  1GVD A;  5FKM A;  2FSW A;  5HS9 A;  3NNR A;  2JTV A;  3PNV A;  2DDA A;  2Z33 A;  2F4I A;  2A6T A;  5D4R A;  1LPQ A;  3JR9 A;  4YRV A;  1S6L A;  4HF1 A;  4S04 A;  2DA3 A;  3ZQ7 A;  1H89 C;  3CMY A;  5BS6 A;  2QSG X;  2DA7 A;  4P9U A;  4AF5 A;  1KU9 A;  3ISP A;  2VL8 A;  1QVU A;  3RYR A;  4CGR A;  1IGN A;  2DXI A;  3DEU A;  2LKX A;  1MNM C;  3BCA A;  4JOM A;  1UEL B;  4B09 A;  1LFU P;  4KWA A;  2ICW G;  3HKZ N;  1EKE A;  2AXL A;  4BE1 A;  5ICG A;  3GZI A;  2H09 A;  3HM5 A;  1ZLJ A;  1YFH A;  2FD5 A;  1SVL A;  4NC6 A;  3IKV A;  4M3F A;  4HYE A;  1QHH D;  3G1M A;  4XKW A;  2XGD A;  5F27 A;  2DPU A;  2L9R A;  4HDU A;  2CJJ A;  3WTS C;  1K6O A;  4AWX B;  1U6G A;  5DM6 F;  4U0Y A;  4PUS A;  1XMK A;  5KHD A;  1MIJ A;  4TV7 A;  2HQN A;  4MTE A;  1W5C C;  2RDP A;  5HS8 A;  2QA4 I;  1K7A A;  3S1N J;  2LVS A;  3H35 A;  2MH9 A;  4ICH A;  1LQ1 A;  3OS0 A;  3GFJ A;  4XRS G;  4EMS A;  1HC8 A;  4XKB A;  2A5W A;  2IA2 A;  1FSH A;  2EH3 A;  3JRD A;  3PO2 J;  5M3M J;  2ME0 A;  2D5V A;  2Y69 H;  2VJI A;  2L2O A;  4ON0 A;  3D1N I;  1XGN A;  5CQE A;  3VDX A;  3Q0W A;  1MBE A;  1WI9 A;  3BR2 A;  4D1Q A;  2ID6 A;  4RM3 A;  4QWQ A;  2F2E A;  1JJ8 C;  1BC8 C;  3LWJ A;  3RH2 A;  3GLX A;  3VIB A;  2JRM A;  4QPQ A;  2X85 A;  2HDW A;  4XMY A;  1HOM A;  3KP4 A;  5IT9 Z;  1ON1 A;  3FBN B;  5ILS A;  3G7R A;  4A3K J;  5E1Z B;  3LAJ A;  2KIS A;  1ZHF A;  2JPC A;  1R5H A;  2BHZ A;  3FWE A;  3VWB A;  4B44 A;  3ROU A;  2OQR A;  4XID A;  1AOY A;  3LSG A;  2E34 A;  1VQ6 I;  4B48 A;  1UST A;  2F07 A;  2Z9O A;  1XGO A;  2L01 A;  4HDV A;  1OMI A;  1XG1 A;  2M5W A;  3H3U A;  4KUM A;  3A0B C;  1BR1 A;  3BTC A;  1QPI A;  3BC8 A;  4HPQ A;  2CW8 A;  4FCY A;  1G8X A;  3BR0 A;  2RNG A;  5J1R A;  1N78 A;  1Z6R A;  3W6V A;  1OCP A;  3ZQL A;  1YRN A;  3KEQ A;  4HV6 A;  4N4N B;  4AIK A;  3VVZ A;  1IUF A;  3MWM A;  1GVJ A;  3F8N A;  4A3M J;  1HF0 A;  3AL0 B;  3VYU B;  4A3I J;  2JSC A;  4UY8 I;  1DUX C;  3AQT A;  2GA2 A;  3Q0U A;  3GEU A;  2BY0 A;  2WAF A;  3BNI A;  2ZCX A;  3LSH A;  2ACJ A;  1D1B A;  2FBH A;  3ML6 A;  2EB7 A;  3IAS 2;  4CXF A;  3WTT C;  1O7F A;  1WJC A;  1W7P B;  2R0Q C;  1VFC A;  4IHT A;  1ETX A;  4GCL A;  2QEN A;  3RQI A;  4HSR A;  1OCO H;  3SZG A;  1LE8 A;  3E7L A;  2GQQ A;  3VW0 A;  3ON2 A;  2E1M B;  1WJ5 A;  4BJT A;  3LSR A;  2HXI A;  2B7E A;  4YFK F;  1KQ9 A;  1W36 D;  1V4R A;  4CGZ A;  3C7J A;  4OD4 A;  2VOO A;  1ODD A;  2EIN H;  3SDG A;  3VVY A;  5IOZ A;  3DWL E;  3N4M A;  1I5Z A;  1JKQ C;  3COL A;  1LFP A;  2IW5 A;  3I9V 2;  4QLC U;  4B47 A;  1KU7 A;  2XGC A;  3P9T A;  2CH0 A;  2VXZ A;  2BVM A;  1GHC A;  4AU7 A;  3CUQ B;  2O8X A;  3EGQ A;  2FA5 A;  2EZK A;  1H8A C;  1Z7U A;  1D3Y A;  4NDL A;  2EZL A;  3SFI A;  3NPI A;  3K4L A;  3IUO A;  3CCY A;  1DGW Y;  3WOD F;  2LLK A;  4ABZ A;  4YIF A;  3GTL J;  4E6K G;  2PEX A;  3ECO A;  5HLT A;  1UHM A;  1LDK B;  4II2 A;  4ENM A;  1UHS A;  3DPL C;  3Q9S A;  2EPF A;  5LFA A;  3DXJ F;  3WTU C;  3T8R A;  4YEL A;  1KYW A;  2NXN B;  1QZE A;  4KIG A;  5EJC A;  4C9Y A;  2JZY A;  3VSK A;  2RAS A;  4A3D J;  1PUE E;  1IRX A;  3LHQ A;  2LY9 A;  3BCG A;  1LJ9 A;  4UUT A;  2IXS A;  4RBO A;  4IOC F;  3VUQ A;  2HGC A;  2XC7 A;  2K40 A;  1XPX A;  4B43 A;  3KX2 A;  1BI1 A;  3KPH A;  1FPQ A;  2OD5 A;  1BOA A;  3FKI J;  5H2F C;  3H5A A;  1CF7 B;  1MJB A;  1XDU A;  1YOV B;  3BHQ A;  3VOK A;  1Y8Q B;  4ZDP A;  1JUS A;  5HLH A;  2K4J A;  2QEX I;  2QF7 A;  4I2O A;  4CHU A;  4E7Z A;  2UXP A;  3HGG A;  4OAZ A;  2E5Z A;  2UZK A;  4JBA A;  3CO6 C;  1YIJ I;  1OCC H;  5IYD J;  3BJA A;  3M9A A;  3G1L A;  2F5E A;  2X4H A;  2V1U A;  2CUE A;  1ETW A;  4YFX F;  2XGE A;  2O7T A;  1NG6 A;  2VXD A;  3TBI A;  4M71 A;  5A2Q K;  3HOS A;  4WF2 A;  4UUS A;  3M8J A;  3K2A A;  5LHH A;  4YFN F;  3MZ8 A;  5H9T A;  1ZN2 A;  1TQI A;  2V26 A;  4LB6 B;  2G0E A;  2EFP A;  2R5Y A;  2W25 A;  5C4Y A;  2C6Y A;  2W57 A;  3I3L A;  1EJ9 A;  3S2H J;  3DEE A;  4XL9 A;  2HOE A;  2FE3 A;  2Q0O A;  2M8G X;  2O03 A;  5J4V A;  3OYF A;  4MXM A;  1VQP I;  3TW7 A;  4UV8 A;  4CO8 A;  5HLI A;  4BU2 A;  2HOS A;  3Q3S A;  2VON A;  2ZXW H;  4L9J A;  4Y17 A;  4D5F A;  2VJJ A;  2R7X A;  5K7H A;  1ZAO A;  2KRC A;  4F55 A;  2IT0 A;  5GAH J;  1F4K A;  4XRS A;  3I56 I;  3BG3 A;  2ZJP F;  2DG8 A;  1UHW A;  3IKT A;  3I4N J;  2HNH A;  4HEA 2;  3HOU J;  4UDS A;  3BTJ A;  2XRN A;  3N05 A;  2VKE A;  4G94 A;  2QVO A;  1FWZ A;  2RC4 A;  2E2I J;  4HQM A;  1MMA A;  2YU3 A;  2ZFW A;  2AS5 F;  4RAZ A;  3U1K A;  3Q9V A;  1MMN A;  2GWR A;  3H92 A;  1KU2 A;  3SZT A;  2XPV A;  3I58 A;  3OR2 C;  4ZDO A;  2K9S A;  1KYZ A;  3ZMT A;  1J5Y A;  1Z77 A;  5FLV A;  5LLQ A;  2CO5 A;  3QYF A;  2DG7 A;  3E0J B;  3R4K A;  3L2U A;  1S7O A;  2P6S A;  4N9H A;  2X48 A;  2CQK A;  3FMS A;  4DQ2 A;  1UZC A;  4IPA A;  3VW2 A;  1ZYR F;  3OYG A;  3S16 J;  1B72 B;  1W7P A;  4QIW N;  2E1O A;  4RB0 A;  5J8F A;  4Q47 A;  1X4O A;  3O8G A;  4EM1 A;  1D8K A;  1PDN C;  2F6C A;  1ZLK A;  3A01 A;  1ETO A;  1A36 A;  3FMR A;  3HTH A;  2CUF A;  1I39 A;  5M3F J;  4ZZL A;  3HL2 A;  1G6N A;  1YO5 C;  4WX9 A;  1T8I A;  1MBK A;  1YLF A;  2E36 A;  5D6E A;  3OYC A;  4FQG A;  4E7H A;  3IH3 A;  2HEO A;  3OV8 A;  4BQA A;  1TT0 A;  2R7O A;  4D9J A;  2IU5 A;  4EJT A;  3H3Z A;  3IUV A;  3V6G A;  3LFU A;  3B6A A;  3G73 A;  1ZGA A;  3HOV J;  3HDD A;  5GAD J;  2DW4 A;  3BP8 A;  2PFB A;  3K70 C;  4Y52 J;  1XSX A;  4RLQ A;  1KGS A;  3PNT A;  3T8T A;  3V7S A;  5E3M A;  3HSR A;  1XB4 A;  2EIM H;  3S8P A;  2XDV A;  4ZYE A;  4XR6 A;  3LAP A;  4I0B A;  2XVC A;  2DQL A;  3R60 A;  5LBQ A;  4RB3 C;  2R93 J;  1DPR A;  1MD0 A;  2IS4 A;  3WU2 C;  4UXN A;  3KCC A;  1G3W A;  4N9I A;  4BEH A;  4DOZ A;  2JA2 A;  1B9N A;  2Y75 A;  1SEU A;  2VPR A;  4U0V A;  2CQQ A;  3CCM I;  3K1M A;  5FKN A;  4NNJ A;  2DA4 A;  4U88 A;  2LY2 A;  1VI0 A;  1EH7 A;  2MFZ A;  3ZGK A;  1GV5 A;  1QQI A;  5L3E A;  2WGB A;  2VQG A;  4A69 C;  2PQ8 A;  3BRU A;  2R7R A;  1Z1D A;  4RAG A;  2NP5 A;  3M07 A;  5K7F A;  2HKU A;  2YVE A;  5A2Q Z;  4R8H A;  3GBG A;  1ZG1 A;  4A2U A;  1B8I B;  2NVT J;  3C1D A;  2R7D A;  2DBB A;  5KCM A;  3OYN A;  1U78 A;  1W36 C;  3F72 A;  4Y4R A;  2ZOY A;  4KIS A;  2STT A;  1AHD P;  5LGU A;  4PSX A;  4ENN A;  4HX4 A;  2AQE A;  2FF4 A;  3FK6 A;  4F52 A;  4RB2 C;  1U2W A;  2DMN A;  1MBG A;  3BOQ A;  1OJL A;  1FBQ A;  1P4X A;  3V42 A;  1U3E M;  3LSP A;  3GF2 A;  2TCT A;  5B1A H;  2JVG A;  1IN5 A;  1ZG3 A;  4AD9 A;  2FQ3 A;  4MK6 A;  1N25 A;  3MCZ A;  1XCB A;  4EVI A;  1HKQ A;  4ENK A;  1HKS A;  2O6G E;  4OIR F;  1FOY A;  1QO0 D;  1UB9 A;  1YJW I;  3MZH A;  4A3J J;  2HVR A;  3BPX A;  2E71 A;  1Z6T A;  3BT9 A;  2J5O A;  5GAG J;  5BMZ A;  2H6C A;  2HR3 A;  1T98 A;  3LSM A;  4BGD A;  3DCF A;  2LKP A;  2TRT A;  2XSD C;  3HUG A;  2H6B A;  3PIO F;  5FRM A;  2Y2Z A;  2CU7 A;  2DMT A;  2QSF X;  3PPB A;  3LFK A;  1W0T A;  3OMY A;  4XKV A;  1M1E B;  1K4T A;  2IS2 A;  4P1W A;  3HIF A;  4IHX A;  3I54 A;  4UUS B;  1OCT C;  4RDU A;  2ZBK A;  3R0J A;  1NHA A;  1R23 A;  2JVH A;  2XAQ A;  2W7N A;  4L0Y B;  4O5V A;  5FLM J;  1S3J A;  2FOW A;  2RAE A;  4BE2 A;  4MEY F;  1HDP A;  3TOB A;  1GT0 C;  1ZQ3 P;  2HOT A;  2PJR B;  3GTP J;  4A6D A;  3DTK A;  2GAU A;  2DA5 A;  2VKV A;  4E4H A;  3O60 A;  5FKO A;  2KDZ A;  2FU4 A;  1WWX A;  2OC6 A;  1ITY A;  3H1C A;  3DTE A;  3GZN B;  1UCR A;  2J5P A;  2Z5U A;  3OOP A;  2IEK A;  4LB5 A;  2A07 F;  1MNE A;  1VQ8 I;  4GYI A;  1RR8 C;  4BQQ A;  4D5C A;  2R7Q A;  5B66 C;  4U9N A;  2BYV E;  1K78 B;  3JRC A;  2Y30 A;  4CZC A;  4A93 J;  5K5O A;  3FHZ A;  3GWZ A;  2KQR A;  4P9F A;  4DGW B;  3CME I;  2R7T A;  1BA5 A;  2HI3 A;  3E1S A;  2VLA A;  4E7J A;  3SXY A;  2K3F A;  5IPA A;  3WGH A;  2RV8 A;  3J81 K;  1YQA A;  1P7I A;  1DU0 A;  2HKO A;  3CQZ J;  2QGU A;  5E8G A;  1V3F A;  2HVS A;  1GLN A;  2CWE A;  3EDP A;  4PJM A;  4NQW A;  5L3C A;  2VQL A;  3BJ6 A;  2Q2E B;  4I0A A;  1QZZ A;  3J80 K;  4HBL A;  1G3Y A;  2P5V A;  3KZ9 A;  4MO7 A;  2E35 A;  3CCU I;  3O8H A;  4BS9 A;  2L0K A;  3FRQ A;  2TDX A;  2K9N A;  5M5X J;  1SVO A;  3PFI A;  5J40 A;  3W6K B;  2A05 A;  1QBJ A;  1T0F C;  4A3C J;  3F6V A;  3Q0V A;  5TGT A;  3K70 D;  4GO1 A;  3S2W A;  4PJ0 C;  2VBX A;  1RES A;  5KVR A;  1YW7 A;  4D0P A;  2YU9 J;  2EFQ A;  2VQH A;  3FK7 A;  2KL4 A;  3CDL A;  2IP2 A;  1A35 A;  3HG9 A;  1ZRE A;  5J1U A;  2L7F P;  3WG9 A;  3ZQH A;  2M9H A;  4LOC A;  1RR7 A;  1TZL A;  2G7S A;  3F9K A;  1JUM A;  3BQY A;  2NNY A;  3HB9 A;  4XLN F;  4IKF A;  5ILV A;  3DU5 A;  5B5E C;  3I71 A;  1ETK A;  2EBI A;  2HZT A;  3OIP A;  4F93 B;  3S3M A;  2NVX J;  3FZV A;  3BR1 A;  4G6Q A;  2EV5 A;  3OS2 A;  2B63 J;  3WTV C;  2WAQ N;  3RZO J;  3L9F A;  3EYY A;  4IO9 F;  3IH4 A;  1SD5 A;  3HGY A;  5F1R A;  1YX3 A;  3JRE A;  1SVM A;  3GFM A;  3HIM A;  3LQQ A;  4RMN A;  3HHG A;  2O9L A;  2F48 A;  1JTX A;  3BG7 A;  2F4M B;  3HOZ J;  3L09 A;  2KIU A;  2MBF A;  3MAJ A;  3VYT B;  2H27 A;  2QCO A;  1NG7 A;  3CJQ B;  1IZ1 A;  3S3N A;  4XOT A;  1V54 H;  4U9L A;  4EQQ A;  3WG7 H;  2XDN A;  3RSN A;  3SYT A;  3CES A;  3PUB A;  4GXO A;  1WRJ A;  4FIS A;  2MA3 A;  3PAS A;  2W53 A;  4EEF G;  2M87 A;  3RPU D;  4I6Z A;  3B02 A;  2XRO A;  1E3P A;  1WH5 A;  4KJZ A;  5E1W A;  4ENJ A;  3FXQ A;  4I09 A;  4ITV A;  3UKG A;  1X3W B;  4ZYD A;  2A5Y B;  4G7Z F;  1R5I D;  2DA2 A;  5LRS A;  5J4Y A;  3D5S C;  4UVA A;  9ANT A;  1QA6 A;  1YE9 A;  2ZB9 A;  2CS3 A;  2W48 A;  2KIM A;  4BHB A;  2RGV A;  5L3F A;  2WAD A;  5HAW A;  3QU6 A;  2YX4 A;  1W0U A;  2PMZ N;  3CCJ I;  3FKJ A;  1V55 H;  1AU7 A;  1AKH B;  5LD2 C;  4U7D A;  2IGM A;  1XC5 A;  2A6E F;  3CF5 F;  4D7N A;  1USS A;  2NS8 A;  1P92 A;  3GFL A;  4CYC B;  2HZD A;  2R7F A;  2OF7 A;  2V1X A;  3ABM H;  1S9H A;  2XPU A;  3GVA A;  1S72 I;  1Z7L A;  1N75 A;  2FRH A;  4PJN A;  4PZJ A;  2KHM A;  1ZR2 A;  5EG0 B;  3PSF A;  3ZPL A;  2QM3 A;  3C18 A;  3JRF A;  2JMW A;  2VBW A;  1JGS A;  3QRF F;  1U9N A;  1UJ8 A;  4PJL A;  2OCE A;  3A01 B;  3OYJ A;  2F4O B;  2JK3 A;  2HPM A;  4A0Y A;  3K4M A;  1UI5 A;  4AIJ A;  4F91 B;  3HXL A;  1D1C A;  1MBJ A;  5E3N A;  1JHF A;  2K02 A;  4C2T A;  2GEN A;  3F8B A;  2D1H A;  1MJA A;  4ZC3 A;  4F92 B;  3K8P C;  2XIG A;  2Y0S A;  1OQY A;  2L54 A;  1P4A A;  4KMU X;  4NC8 A;  2JRT A;  4EGZ A;  1ZTR A;  1VTN C;  1POG A;  2XPW A;  1RKT A;  2HOA A;  3S15 J;  4M3D A;  2OBP A;  1ETV A;  4GFL A;  4Y13 A;  2BHY A;  5DEQ A;  1YI2 I;  1YIT I;  2PG4 A;  3HTU A;  4X6A J;  1DGR M;  1RIO H;  1K83 J;  1X1C A;  3P7N A;  1OR7 C;  5IYC J;  2GUH A;  2OUM A;  4DBQ A;  4DIQ A;  4G6T B;  2FBQ A;  4KFC A;  4JX4 A;  4G9Y A;  4XSZ F;  3VOE A;  3MKW B;  2DJI A;  5IT9 K;  3OY9 A;  1FZP B;  1MW7 A;  5FHP A;  3K9T A;  3RKY A;  4XLA A;  4ZZD A;  4M6X A;  3QP6 A;  4EM2 A;  2NVQ J;  3NEU A;  4IRG A;  3VEP A;  3DFG A;  5CYV A;  4D7M A;  1MSF C;  5JVT A;  1F5T A;  2E2H J;  4DYR A;  2RHA A;  2W82 A;  4CCO A;  1X58 A;  4X1E A;  3U2R A;  4KIT B;  2JA8 J;  3MNL A;  3TGN A;  2Z1D A;  3QPS A;  2P8T A;  3R6S A;  1DP7 P;  4BXF A;  3EPZ A;  2JPB A;  2IGN A;  2HQR A;  2P0W A;  2X1E A;  3RCO A;  3TO6 A;  4BQN A;  2W4S A;  5EFY A;  2W85 A;  2B9S A;  4J19 A;  3CO7 C;  3C07 A;  1IRG A;  1YS6 A;  1ONV A;  3RYP A;  2ISY A;  1OFC X;  3FXJ A;  1OPC A;  2HFH A;  1A31 A;  3HOW J;  5JFR A;  3EUA A;  1SAN A;  2OI8 A;  3OYK A;  2DQR A;  4XNF A;  1E3O C;  2FJI 1;  4B3A A;  1T56 A;  5AIQ A;  2PMZ A;  3CC7 I;  2K85 A;  3TMO A;  1IRZ A;  4XN0 A;  3DF8 A;  1IW7 F;  2UXO A;  2L3D A;  2YR2 A;  2MGQ A;  2A3S A;  3HZJ A;  4IEJ A;  4B8X A;  3RKQ A;  1D0Y A;  2RVC A;  2A2F X;  1T2K A;  2Q8K A;  3BZK A;  4MHG A;  3FM5 A;  2VIX A;  5J8C A;  4BXU A;  2R92 J;  1TNS A;  2BW3 A;  3VSL A;  2VAS A;  1MDM B;  4KN7 X;  2COB A;  4M3B A;  1ULY A;  2R5Y B;  3MFK A;  1T6S A;  2Y31 A;  4ESF A;  2DA1 A;  5HOD A;  1XGS A;  3ZN0 A;  3CCQ I;  1SC7 A;  3OYI A;  1WQ2 A;  1G2H A;  1LB2 A;  5EYR A;  4LD5 A;  5HNH A;  3CJR B;  2QTQ A;  1FNN A;  4XSX F;  4IHS A;  1V5G A;  4C3H J;  2DT5 A;  1IXR C;  2FBK A;  3HUG B;  3AL0 C;  2DLL A;  3W2V A;  3J80 Z;  1SFK A;  4CSW A;  2YSR A;  1JE8 A;  2PN6 A;  3HSE A;  4HZF A;  4KIB A;  2CYY A;  3A2K A;  1R5G A;  4BUP A;  3U21 A;  5D5W B;  2EA4 A;  3AKZ A;  2VB6 A;  2A68 F;  3CP8 A;  1HBX G;  2FUG 2;  2VJ5 A;  2AO9 A;  1SAX A;  3H0G J;  5DUK A;  3C2H A;  3FXU A;  5JHU A;  3L2V A;  3MKY B;  2QBY A;  4ZJZ A;  2Z3Y A; 
#chains in the Genus database with same CATH homology
 2DTZ A;  1MBK A;  2V57 A;  2N8G A;  4A3L J;  1TWA J;  2VUM J;  2DMU A;  3IH3 A;  1WPK A;  3JRG A;  2ZCN A;  4JL3 A;  1GV2 A;  4JKZ A;  1JTY A;  2M0C A;  1O4X A;  1B72 A;  2IU5 A;  1HLV A;  1Y1W J;  5IP9 J;  3OSG A;  3NAU A;  3WHB A;  1IJW C;  3IUV A;  3V6G A;  2K9Q A;  3B6A A;  1A6I A;  3HOV J;  3HDD A;  2G7L A;  4W1U A;  3M3Y J;  2LP0 A;  5FKK A;  4A3F J;  4FTH A;  4AUX A;  1H88 C;  1UG2 A;  1ORK A;  2WB1 N;  5EDN A;  3MN2 A;  4Y52 J;  3LOC A;  3S2D J;  1CQT A;  5E3M A;  3OOU A;  1FIP A;  1IC8 A;  3GTK J;  3QPL A;  5E3L A;  4XK4 A;  2YVH A;  3GTG J;  4JYK A;  2R93 J;  4C3J J;  4S0H B;  1EF4 A;  4V2F A;  3VPR A;  1LE8 B;  1JKO C;  4DYQ A;  3K7A J;  2VPR A;  2CQQ A;  1WI3 A;  5FKN A;  4MIM A;  1DU6 A;  2DA4 A;  1VI0 A;  3V78 A;  2WGB A;  1GV5 A;  3BRU A;  2H1K A;  3KKD A;  4M3G A;  4A69 C;  3BR5 A;  3NRG A;  3QKX A;  2NP5 A;  5K7F A;  3TED A;  2Q24 A;  3FIW A;  4A3E J;  2HKU A;  2YVE A;  2E2J J;  3BJB A;  3HTJ A;  3GBG A;  1PUF A;  1ETQ A;  1B8I B;  1ENH A;  2NVT J;  2KT0 A;  1BL0 A;  4G12 A;  1U78 A;  1ZKG A;  5K58 A;  1FJL A;  1WH7 A;  4BBS J;  2ZOY A;  1AKH A;  1FEX A;  1AHD P;  2XB5 A;  5IOY A;  3BG9 A;  3E7Q A;  3TP3 A;  2EQR A;  2E19 A;  2YUS A;  3A03 A;  3FK6 A;  4XIC A;  2LK2 A;  2DMN A;  1MBG A;  5EF6 A;  2JWT A;  1QVT A;  1OJL A;  3SJM A;  4IHY A;  4ACI A;  4C2M J;  3BQZ A;  3LSP A;  2TCT A;  5EZG A;  1D5Y A;  5C4X J;  3HTA A;  2YS9 A;  1IDY A;  2R5Z B;  3KKC A;  4GFK A;  4MK6 A;  2NOG A;  1BW6 A;  3GTQ J;  2L7M P;  1WCM J;  4I76 A;  5M5W J;  2ID3 A;  3B6C A;  2M34 A;  2UXH A;  4A3J J;  3PM1 A;  4AYB N;  2PBX A;  1WGX A;  1YRN B;  2NS7 A;  3BT9 A;  2QWT A;  4AC0 A;  4BKX A;  3DCF A;  2LFB A;  3BTL A;  2CQX A;  2TRT A;  2XSD C;  3ON4 A;  2Y2Z A;  2CU7 A;  2DMT A;  3EUP A;  3PPB A;  1S7E A;  2ELK A;  3BG5 A;  4BY7 J;  2FJ1 A;  1W0T A;  4BY1 J;  1FIA A;  5DAJ A;  1JJ6 C;  1TWH J;  3HTI A;  1MBH A;  4IHX A;  4UUS B;  1JT6 A;  3QBM A;  1OCT C;  1UI6 A;  4RDU A;  3S1Q J;  2ECB A;  1IG7 A;  5FLM J;  1GT0 C;  3HEF A;  2RAE A;  1JKR C;  1ZQ3 P;  1HDP A;  3GTP J;  2HOT A;  2DMQ A;  2ME6 A;  3MKL A;  5CXI A;  1MBF A;  2VKV A;  2DA5 A;  3L1P A;  3O60 A;  1TWG J;  5FKO A;  2KDZ A;  1IV6 A;  4FE4 A;  2H8R A;  1ITY A;  5EGO B;  1RKW A;  1ETY A;  3FIS A;  2IEK A;  4DZJ A;  1TWF J;  1Y1V J;  3F1B A;  2DMP A;  2OER A;  1I50 J;  3ZOB A;  4D5C A;  1BW5 A;  3CJD A;  2GBY A;  1GVD A;  2EZI A;  2Y30 A;  5FKM A;  3JRC A;  4A93 J;  3DEW A;  3NNR A;  3CWR A;  3JR9 A;  3ZQG A;  1JUP A;  2DA3 A;  1BA5 A;  3ANP A;  1H89 C;  1Q1V A;  3CMY A;  1QRY A;  2HI3 A;  2FX0 A;  2DA7 A;  4AF5 A;  1TWC J;  5IPA A;  4A3G J;  1QVU A;  4CGR A;  1IGN A;  1P7I A;  2AHQ A;  1DU0 A;  3CQZ J;  2LKX A;  1MNM C;  3S1R J;  2EZH A;  4B4C A;  3LNQ A;  1LFU P;  5IYB J;  2D6Y A;  4KWA A;  3HBL A;  5EG0 A;  3HKZ N;  1ZGW A;  2DA6 A;  3GZI A;  3HM5 A;  5M5Y J;  1JKP C;  2FD5 A;  1HDD C;  3KZ9 A;  3WHC A;  4MO7 A;  3O8H A;  4M3F A;  2L0K A;  2M2E A;  3JRH A;  3FRQ A;  3G1M A;  4XRM A;  2XGD A;  5F27 A;  2K9N A;  5M5X J;  2L9R A;  2CJJ A;  2HDD A;  1RPW A;  2CRG A;  2NX4 A;  4A3C J;  3Q0V A;  2JA5 J;  5FJ8 J;  3S1N J;  4FE7 A;  5D19 A;  2LVS A;  5BNG A;  5C3E J;  2JJ7 A;  4QTR A;  5DTD A;  2L7Z A;  4ICH A;  1RES A;  4XRS G;  3PO3 J;  2YU9 J;  3CRJ A;  4DYC A;  3FK7 A;  2EH3 A;  3CDL A;  2Y9Z A;  3JRD A;  3PO2 J;  5J1U A;  3ZQI A;  2L7F P;  2ME0 A;  3ZQH A;  5M3M J;  2M9H A;  2D5V A;  3BTI A;  2I10 A;  1RR7 A;  4LOC A;  3D1N I;  1VND A;  2G7S A;  3VP5 A;  1JUM A;  3BQY A;  3Q0W A;  1MBE A;  3HB9 A;  3BR2 A;  2ID6 A;  1MH3 A;  3JRI A;  2R5Z A;  1ETK A;  2EBI A;  3C2B A;  1JJ8 C;  3AQS A;  3LWJ A;  4GCK A;  3RH2 A;  3VIB A;  4HKU A;  2NVX J;  2WV1 A;  2DN0 A;  3BR1 A;  1HOM A;  3S17 J;  2B63 J;  3G7R A;  4A3K J;  5D18 A;  2WAQ N;  3RZO J;  5DS9 A;  3IH4 A;  3HGY A;  3JRE A;  3LJL A;  4YZE A;  3HIM A;  4XID A;  3LSG A;  2O9L A;  1JTX A;  2F07 A;  2ZOZ A;  1ZK8 A;  3HOZ J;  1F43 A;  4AC6 A;  3GTM J;  3BR3 A;  1XG1 A;  1IDZ A;  3JRA A;  2ECC A;  2QCO A;  3BTC A;  1QPI A;  3M4O J;  3MVP A;  3I4M J;  3ANG A;  4FCY A;  2UXU A;  3BR0 A;  2XDN A;  3RD3 A;  5J1R A;  2OPT A;  1K61 A;  5HSZ A;  5E3O A;  3W6V A;  4BXX J;  1OCP A;  3ZQL A;  4FIS A;  5HBU A;  2HYT A;  1UMQ A;  1YRN A;  3PAS A;  2W53 A;  3VVZ A;  3DPJ A;  1IUF A;  4EEF G;  4A3M J;  4JP0 A;  4I6Z A;  1HF0 A;  5JLX A;  1P7J A;  5C4J J;  1WH5 A;  2QOP A;  4HNV A;  4A3I J;  3UKG A;  2NVY J;  3AQT A;  4V2G A;  3Q0U A;  3GEU A;  5D1R A;  3BNI A;  2WUI A;  2ZCX A;  2DA2 A;  2VI6 A;  9ANT A;  2R0Q C;  1VFC A;  1ETX A;  2ZB9 A;  3BR6 A;  4GCL A;  3T6N A;  2W48 A;  3RQI A;  5HAW A;  1LE8 A;  4IHW A;  1SGM A;  1W0U A;  3E7L A;  4MFE A;  5EEA A;  2PMZ N;  4JNN A;  3VW0 A;  1MH4 A;  3ON2 A;  2HQ5 A;  2DJN A;  3LSR A;  1U9O A;  1AU7 A;  1AKH B;  2HXI A;  1XC5 A;  1ZR4 A;  2FQ4 A;  4D7N A;  2NS8 A;  3TP0 A;  1XS9 A;  4CYC B;  2QKO A;  3SDG A;  3VVY A;  2OF7 A;  5IOZ A;  2XPU A;  1JKQ C;  3COL A;  3JRB A;  1FTZ A;  1ZR2 A;  5EG0 B;  2XGC A;  3P9T A;  2P81 A;  3JRF A;  2JMW A;  5F04 A;  1B8I A;  3EGQ A;  3S1M J;  1U9N A;  2EZK A;  2XRL A;  3IH2 A;  3A01 B;  1H8A C;  4PXI A;  4NDL A;  2EZL A;  3SFI A;  3NPI A;  3VW1 A;  2JK3 A;  3CCY A;  2LLK A;  4ABZ A;  1UI5 A;  3ZQF A;  5J1Y A;  5GPC A;  3GTL J;  5FMP A;  2HYJ A;  1MBJ A;  2MG4 A;  5E3N A;  2GEN A;  1UHS A;  3B81 A;  3JSJ A;  2GLO A;  1Z0X A;  3G1O A;  1NTC A;  3NAR A;  4IHV A;  2RAS A;  5F0H A;  4A3D J;  1ZTR A;  3LHQ A;  2LY9 A;  3BCG A;  4UUT A;  3VUQ A;  1POG A;  2XPW A;  1RKT A;  2HOA A;  4C3I J;  4RBO A;  4M3D A;  2LD5 A;  3S15 J;  2K40 A;  4GFL A;  1ETV A;  1I6H J;  4X6A J;  4W97 A;  1JGG A;  1K83 J;  5IYC J;  1HCR A;  5F08 A;  4L5E A;  2GUH A;  2IBD A;  4DZP A;  3FKI J;  2FBQ A;  4JX4 A;  2HXO A;  2XB0 X;  2G7G A;  1T33 A;  3BHQ A;  3VOK A;  5FHP A;  2PZ9 A;  3RZD J;  1PUF B;  4MLO A;  1JUS A;  5FKL A;  2NVQ J;  4NN1 A;  2GFN A;  2QF7 A;  4D7M A;  3HE0 A;  1MSF C;  1MSE C;  2E2H J;  2UXP A;  1BJZ A;  3HGG A;  4DYR A;  2RHA A;  4L62 A;  2UXI A;  1X58 A;  4X1E A;  2O7O A;  2Y0S N;  3G56 A;  2JA8 J;  2QIB A;  3MNL A;  5EZH A;  3IV5 A;  5IYD J;  1X2N A;  3HOY J;  3G1L A;  3QPS A;  4NEL A;  4MFD A;  2CUE A;  1ETW A;  3A02 A;  5C44 J;  2XGE A;  2O7T A;  5EFY A;  4J19 A;  1TC3 C;  3C07 A;  3KNW A;  3H3V K;  4UUS A;  2X9D A;  1OFC X;  3K2A A;  3HOX J;  3OSF A;  1R9T J;  5H9T A;  3HOW J;  2OI8 A;  1SAN A;  5FGL A;  5F0F A;  3NI7 A;  2G0E A;  3F0C A;  5F0C A;  2R5Y A;  1E3O C;  1GDT A;  5C4Y A;  4B3A A;  1T56 A;  3S2H J;  2REK A;  1IRZ A;  1F36 A;  3VVX A;  4MXM A;  2M8G X;  2UXO A;  2MGQ A;  4IEJ A;  3RKQ A;  3TW7 A;  1U8B A;  5IP7 J;  1NK2 P;  5J3L A;  2HOS A;  4M3E A;  1I3Q J;  3Q3S A;  3VOX A;  4D5F A;  4QSH A;  2GM4 A;  1FTT A;  2MSY A;  5K7H A;  5GPA A;  2R92 J;  4Y7N J;  4XRS A;  3ZQC A;  2COB A;  4M3B A;  5F1J A;  5JLW A;  2R5Y B;  3BG3 A;  2DG8 A;  5IP6 A;  3LSJ A;  2R7Z J;  2IAI A;  3I4N J;  2Y31 A;  4B1R A;  3HOU J;  4UDS A;  3BTJ A;  2DA1 A;  5HOD A;  4JX5 A;  2VKE A;  5AQC A;  5CXG A;  2E2I J;  3NXC A;  4BBR J;  2MW8 A;  2JA6 J;  3S5R A;  1LFB A;  2G3B A;  5EGO A;  2XPV A;  2Y9Y A;  1G2H A;  2K9S A;  5EYR A;  2X6O A;  2QTQ A;  1Z77 A;  2JN6 A;  3OIO A;  4M6V A;  4C3H J;  5FLV A;  2LTP A;  4GCT A;  1NK3 P;  2DG7 A;  3TW6 A;  1VF9 A;  2X48 A;  1X2M A;  2O8K A;  2ZCM A;  3VW2 A;  1A5J A;  4DW6 A;  3QQA A;  3S16 J;  1B72 B;  3GTO J;  4QIW N;  1SFO J;  1APL C;  2E1O A;  4CYC A;  2JA7 J;  3S14 J;  4ME9 A;  3O8G A;  4A3B J;  2AO9 A;  3H0G J;  4GFB A;  3A01 A;  1ETO A;  1RET A;  3HTH A;  2CUF A;  2LR8 A;  4JX6 A;  5M3F J;  1JT0 A;  1GUU A;  5CW8 A;  2NP3 A;  5K7Z A;  5GP9 A;  3GTJ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...