3PM1A

Structure of qacr e90q bound to ethidium
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
185
structure length
185
Chain Sequence
LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single acidic residue can guide binding site selection but does not govern QacR cationic-drug affinity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 74
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3pm1A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pm1A02
2DMQA 3HBLA 3KKCA 2IBDA 4DZJA 4A3IJ 3GTMJ 2MW8A 3D1NI 1JKRC 1W0UA 1GV2A 1SANA 5IYBJ 2PBXA 4ME9A 2YS9A 5EG0B 5IOZA 2WGBA 4AF5A 2DJNA 1DU0A 3BR0A 1K61A 2VKEA 2QOPA 1FTTA 1XC5A 3NRGA 3MVPA 5IYDJ 5JLWA 3BHQA 2EZLA 4V2GA 3JRHA 5C3EJ 2R5YB 4A3BJ 3HOYJ 3LJLA 4YZEA 3TW6A 3CWRA 3SJMA 3BT9A 2IAIA 1JUMA 2D5VA 3HOZJ 3JRFA 5D18A 1RESA 2XGCA 1MSFC 2LLKA 2HXOA 5IPAA 3Q3SA 1S7EA 1RKWA 1IGNA 4I76A 1O4XA 1CQTA 2OF7A 3HTAA 3P9TA 5FKKA 3BQZA 2DA6A 3IH2A 1YRNA 3ZQGA 2R5ZB 1QPIA 1ZTRA 2DTZA 3B81A 3LWJA 5HODA 2IEKA 2AO9A 2WUIA 2B63J 3DPJA 3LSPA 1IG7A 4MK6A 5EYRA 1IC8A 4A3JJ 4UUTA 2DA5A 2XB5A 3H3VK 2EZIA 3KZ9A 4MXMA 4A3FJ 1TWGJ 3AQTA 2EBIA 3LSGA 4MIMA 1JJ6C 2ZCXA 2N8GA 3SDGA 1ENHA 2HKUA 1RR7A 1IDZA 3VP5A 2FQ4A 1GV5A 4M3FA 3HM5A 3GZIA 4M3DA 3ZQCA 3G1MA 1IRZA 2XPVA 5EG0A 1I6HJ 2VKVA 1MH3A 2JA5J 4RDUA 3EUPA 2OI8A 1JTXA 3S16J 4W97A 1FEXA 3GEUA 1P7IA 1JUPA 2NS8A 1ZGWA 4EEFG 4C3IJ 3QKXA 4NN1A 2VUMJ 5J3LA 3KKDA 3SFIA 3FRQA 4X6AJ 4HNVA 4BBSJ 4UUSA 3S5RA 3K2AA 5J1YA 2Y30A 1B72B 3AQSA 2R93J 2VPRA 4JNNA 3H0GJ 5E3NA 1Y1WJ 3QBMA 1ETOA 4JL3A 3CJDA 3BRUA 4D7MA 4AC6A 4QIWN 3NARA 1ETVA 1JT6A 3GTQJ 1MBFA 1GVDA 2WB1N 3FK7A 4FE4A 3QQAA 5DS9A 5FKMA 5FKOA 5EGOB 1H8AC 1UI5A 2NOGA 2CQQA 4JX6A 5FKLA 3S1MJ 3M4OJ 5F27A 3JRDA 4AC0A 4IHWA 1QVUA 3ZOBA 5M3FJ 1X2MA 4L5EA 3BTCA 1P7JA 3G56A 2JWTA 5CXGA 1I50J 1JJ8C 2XDNA 3BQYA 2W48A 1H88C 3S15J 1HDPA 3BG9A 1TWHJ 5F04A 5HSZA 3HGYA 2DG7A 2COBA 3OSFA 3PO3J 5IYCJ 5M5YJ 2W53A 2ME6A 3VW2A 1BJZA 1APLC 1A5JA 3RKQA 5M3MJ 1UMQA 3LNQA 4A3KJ 3CDLA 4CGRA 3HDDA 1R9TJ 4FISA 5EDNA 4ICHA 4PXIA 1W0TA 4M3BA 1Q1VA 1MH4A 5E3LA 5D1RA 2ID3A 2X48A 2CU7A 1MSEC 2R0QC 5C4JJ 1JKOC 1F43A 3I4NJ 3ANGA 4AYBN 3BR1A 1MBJA 2V57A 2F07A 1POGA 1SGMA 3FK6A 2KT0A 5E3MA 1NTCA 3ZQFA 2LD5A 2XRLA 2Y31A 2G7GA 3W6VA 2PZ9A 1RKTA 1B72A 3VOXA 4MO7A 1BW6A 2EZHA 2WV1A 2D6YA 3MKLA 2Y2ZA 2Y9ZA 1LE8B 3BG5A 4A3EJ 4MFDA 3BR2A 3G7RA 3G1OA 5GP9A 2YUSA 1AKHA 3WHCA 4ABZA 1DU6A 1ETKA 3CMYA 1ITYA 1VF9A 2ZOZA 2L0KA 2KDZA 1OCPA 3RD3A 2CRGA 3F0CA 1PUFA 2VI6A 3HGGA 3BTIA 1RPWA 2CJJA 1QVTA 3COLA 4JYKA 2HXIA 4IHVA 3GTLJ 5EZGA 4XICA 3DEWA 3JREA 2AHQA 5D19A 1TWCJ 4B4CA 1IV6A 2QCOA 3HB9A 5H9TA 1PUFB 9ANTA 2LKXA 3BR6A 2NP5A 3T6NA 3VIBA 2E2IJ 1JKQC 4DYQA 3S2DJ 2K9QA 2HYTA 3PM1A 4DYRA 2UXPA 1QRYA 4B3AA 4FCYA 3QPSA 1AKHB 2R5ZA 1ZQ3P 4HKUA 4CYCB 1B8IB 2XGDA 1ORKA 1ETWA 4A69C 2QWTA 3BR3A 3OIOA 1UG2A 3JRBA 1ETYA 2MG4A 3S14J 3QPLA 3ZQIA 2NVQJ 4GCLA 4D7NA 4RBOA 1JUSA 4A3CJ 4XK4A 4Y7NJ 3MN2A 1UHSA 2RAEA 5HBUA 2JJ7A 2FX0A 4C3JJ 4XIDA 3A01A 1UI6A 2GLOA 5K58A 4V2FA 4UUSB 4BXXJ 1JKPC 3RH2A 5E3OA 1ZKGA 5F08A 3A03A 2CQXA 4JP0A 1JTYA 2I10A 5AQCA 2JA7J 2ECBA 2G3BA 3M3YJ 5IP6A 1A6IA 3Q0UA 2EH3A 1EF4A 1X58A 2G0EA 3RZOJ 3S2HJ 1XG1A 2XGEA 2EZKA 2FD5A 5FMPA 2O9LA 2IU5A 2LFBA 3PPBA 1MBEA 2REKA 2DN0A 2E2HJ 3GTPJ 2ZCMA 3GBGA 4XRMA 3ON2A 4GCKA 4A3DJ 2G7SA 3NAUA 1TWFJ 3L1PA 2JA8J 5EZHA 2MGQA 1WCMJ 3PASA 2WAQN 3HTHA 1U78A 1WPKA 2DMTA 3CQZJ 2RASA 4QTRA 2DMUA 1K83J 4AUXA 1F36A 2NP3A 4IHYA 2QTQA 1BA5A 1OCTC 5EGOA 3ON4A 4GFBA 5JLXA 1FIAA 2RHAA 3JRCA 3JSJA 3BNIA 3HEFA 1YRNB 3HTIA 2X6OA 3S1QJ 3NI7A 1HOMA 1IDYA 2OPTA 4MFEA 5F0HA 1RETA 3HOVJ 2L7ZA 2E19A 3HOWJ 2FJ1A 2L7MP 3V78A 3GTKJ 3HE0A 4A3LJ 3GTOJ 2H1KA 4JX4A 5K7FA 3LSRA 3S1NJ 2R5YA 1ZR2A 1JT0A 4BKXA 3KNWA 1MNMC 3IH4A 5GPAA 4UDSA 1JGGA 4A3GJ 4Y52J 3RZDJ 2FBQA 3TW7A 3TP0A 2R92J 3C07A 2ID6A 3VPRA 2EQRA 2QF7A 3TP3A 3GTGJ 4B1RA 1LE8A 1LFBA 3IV5A 2NVXJ 4BBRJ 1GDTA 2LK2A 3K7AJ 2QIBA 3E7QA 4JX5A 5IP9J 2H8RA 2LP0A 3HIMA 3NNRA 1ETXA 1TWAJ 4IEJA 2DMNA 2XSDC 2Y0SN 1VNDA 3LSJA 3NPIA 1OJLA 1WH5A 3VW0A 4JKZA 2LR8A 3OSGA 3S17J 3VUQA 3BCGA 4D5FA 2GM4A 2PMZN 2LTPA 2M34A 4I6ZA 4IHXA 2K40A 3ZQLA 1D5YA 1GT0C 2M8GX 1U9OA 1Z77A 2DA1A 3FISA 2E1OA 1B8IA 4ACIA 4CYCA 4A3MJ 4A93J 4GFLA 3LHQA 3G1LA 1HCRA 2P81A 5GPCA 2XPWA 5C44J 1MBGA 4BY7J 2JA6J 1GUUA 1MBHA 3PO2J 3DCFA 3ANPA 2GFNA 2GUHA 1WGXA 5J1RA 2QKOA 2UXUA 1ZR4A 5EF6A 5FLVA 5EFYA 3BJBA 4GCTA 1XS9A 5DTDA 3EGQA 2NVYJ 2G7LA 2Y9YA 3VVXA 4XRSA 5IP7J 2XB0X 2X9DA 1H89C 3O8GA 1OFCX 2YU9J 3BR5A 2L9RA 5C4XJ 1U9NA 2Q24A 2CUEA 1LFUP 1Z0XA 2MSYA 5IOYA 3C2BA 1IJWC 3IUVA 5F0FA 1WH7A 3HKZN 3ZQHA 3NXCA 2O7TA 2HQ5A 1ZK8A 2DA7A 3TEDA 4DYCA 3A01B 1BL0A 2HDDA 2JN6A 2NVTJ 2HOSA 1AU7A 4L62A 2JMWA 4XRSG 3JR9A 3B6CA 2M0CA 3V6GA 4QSHA 3HTJA 2UXIA 1WI3A 5FHPA 1NK3P 4M6VA 4MLOA 2ECCA 2ELKA 3JRIA 2ZCNA 3LOCA 1HDDC 2OERA 2GBYA 4DZPA 2ME0A 1VFCA 1BW5A 1IUFA 2ZOYA 2YVHA 3E7LA 4LOCA 4G12A 3VVZA 1NK2P 3BTLA 4NELA 2HOTA 1MBKA 5F0CA 3BTJA 2TCTA 5M5WJ 1E3OC 2ZB9A 2E2JJ 4C2MJ 4DW6A 1FJLA 2CUFA 3A02A 4FTHA 2M9HA 3O8HA 5EEAA 2DA3A 2UXOA 1HLVA 3B6AA 3VVYA 3UKGA 2UXHA 1I3QJ 4BY1J 5J1UA 1FTZA 3BG3A 4FE7A 3FIWA 5F1JA 1U8BA 5CW8A 3JRGA 1T56A 3FKIJ 2HYJA 3GTJJ 3HOXJ 1ETQA 3HOUJ 3F1BA 3IH3A 5FJ8J 1HF0A 2NS7A 2R7ZJ 2GENA 3VOKA 2XPUA 5FKNA 3OOUA 1Y1VJ 2K9SA 2DMPA 4X1EA 3I4MJ 1SFOJ 5BNGA 2YVEA 4J19A 3MNLA 1TC3C 2DA2A 2DG8A 2O8KA 3VW1A 5FLMJ 3RQIA 3Q0WA 2JK3A 1FIPA 4GFKA 4S0HB 5M5XJ 2L7FP 5FGLA 4W1UA 5K7HA 5K7ZA 2TRTA 1VI0A 3S1RJ 5C4YA 3CRJA 3CCYA 5DAJA 5HAWA 4M3GA 1X2NA 1T33A 2HOAA 1AHDP 3O60A 4M3EA 4C3HJ 2O7OA 2HI3A 4D5CA 4NDLA 3JRAA 5CXIA 1G2HA 3WHBA 2LVSA 4KWAA 2LY9A 2K9NA 2M2EA 2DA4A 2NX4A 3Q0VA
chains in the Genus database with same CATH superfamily
2WY7Q 1T8IA 3V8KA 3KKCA 2IBDA 4DZJA 3GTMJ 5A2QZ 3D1NI 3IWFA 1JKRC 2YS9A 1S7AA 5IOZA 2WGBA 4YIFA 2VKEA 1DGRM 1U8RA 3HHHA 1I3AA 1QQIA 1QZEA 1RZ4A 1UHWA 1Y6IA 3FXMA 4RLQA 3FMRA 3MVPA 3S3MA 1SC7A 3FBIB 3BHQA 3SZPA 1FC3A 5HS9A 3LJLA 3TW6A 4A0XA 2X6XA 3SJMA 3BT9A 5GAGJ 3F3XA 3J80K 3JRFA 4E7LA 2FBKA 3LSMA 2LLKA 2HXOA 5H20A 3G6EI 1S7EA 1KZHA 2IS4A 3A4CA 4I76A 4MQVA 5LFAA 3LL7A 5DEQA 3P9TA 2OQGA 3IH2A 4K2EA 2DTZA 3MQ0A 2E1MC 2K27A 1YS7A 4M74A 2B63J 4NQWB 2QEXI 2F4OB 3WTSC 4PDKA 4UUTA 1R6RA 3KZ9A 2HS5A 3K4KA 4MXMA 1YLFA 2OZUA 3I4PA 2DOFA 3AQTA 2EBIA 3LSGA 1BI0A 4MIMA 1JE8A 2L02A 1K78B 2HKUA 3SZTA 1IDZA 4KITB 3VP5A 2FQ4A 2NNNA 1GV5A 4M3DA 1W7PA 2P5LC 4QPQA 3G1MA 1IRZA 5EG0A 1I6HJ 2JA5J 3GFJA 3G3ZA 1IXRC 4XR6A 3J81K 2YX4A 1FOXA 2KHMA 5B5EC 2OBPA 2OC6A 4W97A 3HRSA 4O5VA 1G4DA 3COAC 4B43A 3GEUA 2DYRH 2NS8A 1PP8F 2V6EA 4EEFG 3QKXA 1I5ZA 1BR1A 2ACJA 2EJRA 3C2HA 4PSWA 3PJRA 2VJ5A 3KKDA 2B0LA 1AWCA 3S5RA 3K2AA 3GUDA 4R8HA 4EM1A 1I39A 4N9IA 2R93J 3DTKA 3FM5A 4HNTA 2KIFA 4BGDA 1B59A 1G59A 2V79A 2VASA 4GYIA 1Z7UA 1FPQA 5GADJ 5LEJA 4L0ZB 3M1CA 3I0TA 2EPFA 1LB2A 2WB1N 1GVDA 1UFMA 4XKCA 3FK7A 1R71A 1X1AA 2KISA 4CA0A 4CYDA 2O6GE 2R7XA 2NOGA 3S1MJ 5K5OA 1VQNI 2CUZA 4AC0A 2VLAA 3DV8A 5EJCA 1HW2A 4IHWA 3ZOBA 5M3FJ 3BWGA 1O7LA 2ZJQF 2PI0A 2VQGA 2CFXA 1P7JA 3FXUA 2JWTA 4NC6A 1I50J 3BC8A 1ZYRF 2G7HA 3KYDB 2W48A 4II3A 5E1ZB 2XDNA 1KYWA 3GWZA 1TWHJ 5F04A 1IF1A 5HSZA 3HGYA 1IAWA 3PQKA 2CGPA 2COBA 4IRGA 1OISA 1UG0A 3PO3J 4RMNA 3NWTA 5HLTA 1MMDA 3RQ4A 2M4KA 2ELJA 2MH2A 1V55H 3CCQI 2F5EA 5DUKA 3ZXSA 2Q2EB 2M30A 4CGRA 1QBJA 5E8GA 4PXIA 3PIPF 2QBYA 3GW2A 2QKLB 4L9NA 3SQNA 4EM0B 1F1ZA 1MDMA 1IZ1A 4B8XA 4UV8A 5C4JJ 1XCVA 3ECHA 2VE9A 1J7KA 3BR1A 2F5CA 2OCEA 1YW8A 2ZJRF 3PNVA 3LAJA 1V5FA 1XPXA 3ZQFA 2PEXA 3M7GA 3FM3A 1YHQI 3VOXA 1BW6A 2VJIA 2WV1A 5CQGA 1LE8B 2Y2ZA 2Y9ZA 2D6YA 3E5QA 4HSRA 3BR2A 4A3EJ 2EFOA 4ENNA 4HZFA 1S5LC 2VXDA 3R0AA 1AKHA 4PGHA 2BW3A 1EH8A 3Q0VA 1STZA 3IWZA 4L5IA 2JUCA 1VF9A 4PK4A 2BVMA 2GA2A 3F8FA 3H5RA 3HOSA 2CRGA 2KL4A 4GDFA 1QVTA 3COLA 4JYKA 4IHVA 1A6QA 3FHZA 2B9SA 5EZGA 4XICA 5BPIA 1T0FC 4CZZA 1XD7A 4JBAA 4P9FA 2J5OA 4AIKA 3HB9A 5CVUA 2FMLA 3OYGA 4BE2A 5FLXK 3CCUI 3HOTA 1T98A 2DOEA 3BR6A 5JVTA 2W00A 5GTIC 2EILH 3L09A 5FROA 1Y0UA 2M4GA 3SYTA 2E2IJ 2VL8A 2K9QA 1RI7A 1S72I 4EQQA 4BHCA 4EJTA 5E1WA 3QPSA 4DJAA 2XF6A 3QOEA 2NXNB 3E5XA 4KUMA 4HKUA 2QYOA 1B8IB 2XGDA 1ORKA 3D0SA 1XN7A 4A69C 1K6OA 1L0OC 3OIOA 3R61A 4LB5A 2RN7A 1UG2A 4P96A 2CW0F 2O03A 4B44A 3I59B 4KMUX 4RGXA 1XMKA 3I55I 2HPIA 3KZYA 1XSXA 1WVRA 1BR4A 3KZIC 2RAEA 1WI9A 2MC4A 2FX0A 4XM3A 3A01A 3LFUA 1ZGJA 5K58A 2A05A 2VQHA 3CCLI 1ZKGA 2CQXA 3WGIA 2ZMEC 2IA1A 3WG9A 1E0EA 4KFCA 5IT9K 4NC8A 4F55A 1VQLI 2XKPA 5JI6A 4GGGA 1X58A 4NBQA 2VT2A 4ENMA 1FP2A 1SVOA 2XRNA 4PZJA 2FD5A 1SAUA 4A6EA 2LFBA 1W7PB 1MBEA 2REKA 2DN0A 3QAHA 1S3JA 4B09A 3N97A 3ON2A 4GCKA 2HZDA 4KIGA 2EFWA 3RPUA 4KA4A 5B3SH 4G94A 3PFYA 3PASA 3GEZA 3CJTB 1SVLA 2A6HF 5D6FA 2RASA 2DMTA 2A3SA 1X4PA 1K83J 2DT7B 1LEBA 1A35A 3F9KA 1F36A 5JVGF 5LGNA 2AXLA 3CJNA 5L3CA 2QTQA 2WB1A 1WKMA 2RV8A 5EGOA 5JLXA 3OWTA 1VZ0A 2RHAA 3OL4A 4ZC3A 3JRCA 1RC9A 1MMAA 3HEFA 3HTIA 2X6OA 1HOMA 3ECOA 1FT9A 1ACIA 3HOWJ 1HSJA 3U21A 4E7IA 2X1EA 1YX5A 5GTHC 2F48A 3IKTA 3GX4X 3DLAA 3S1NJ 1XCBA 1Z05A 2V7FA 4BKXA 4UV9A 2PFVA 1XMAA 5GPAA 3GCMA 1IRFA 3TKYA 3W2VA 4DGWB 4CCJA 4Y52J 2ZMEB 3HJEA 1X3UA 3TW7A 3BDDA 4EJOA 1P2FA 2QF7A 3TP3A 2AQFA 2FUG2 3N05A 3H35A 4B1RA 1D1CA 1XSDA 2KIUA 4AVPA 1YFHA 3EUHC 4YEJA 1GDTA 2LK2A 2GXBA 1S7OA 3E7QA 2LP0A 2R7SA 3TO7A 3NNRA 1ETXA 2CG4A 2MD0A 1TWAJ 1D5VA 1T39A 3TOAA 3LSJA 2CFOA 5DM6F 1BI1A 1OJLA 1WH5A 5D5WB 3VW0A 1PVEA 1P6RA 3PIOF 3KEOA 4F7ZA 2LTPA 2M34A 4I6ZA 3OYLA 2V9KA 4U7BA 1D5YA 1GT0C 2M8GX 4LK1F 2ZO4A 2KRCA 3Q5FA 2BY2A 1Z77A 2DA1A 1P4AA 1O3TA 4IF4A 3D5RC 5ERIA 1HBXG 1ZG5A 1P4WA 2P81A 1GVJA 1FZPB 4BY7J 2STTA 3PO2J 2IW5A 2GFNA 4FX4A 2FMYA 2F2EA 4OAZA 3PNYA 3WE2A 5FLVA 2JT1A 2QZ8A 2XHKA 3CTAA 3EGQA 2LDUA 2NVYJ 3VVXA 2V1XA 5ILVA 4XRSA 1YJNI 2E7WA 2VN2A 2HQAA 2CSOA 2M7AA 2NYXA 5C4XJ 2QLZA 5B66C 2CUEA 3ZCOA 1Z0XA 1IJWC 3KEQA 2DAOA 3VB2A 4HNUA 1MNDA 1FLIA 2LY2A 1MIJA 3VFZA 2DA7A 4LD5A 2F5FA 5ICCA 2VPLA 5ILUA 3A01B 4EMSA 3CP2A 2DFEA 2HDDA 4U87A 2JMWA 1KYZA 1F5TA 2M0CA 4CZCA 3V6GA 3ERMA 1WI3A 3JSPA 2W85A 2XKOA 3CLOA 3HSEA 3KP2A 2ECCA 1HDDC 5CPRB 2GZWA 2ME0A 1OR7A 3L2CA 1IUFA 4ZYDA 1IW7F 2IJLA 3KYCB 3FDYA 3BTJA 4DVYP 4EV0A 1E3OC 4QLCU 2ZB9A 2P6SA 2E2JJ 5L3BA 1Z9CA 1CF7A 2DFIA 1FSHA 1FBQA 4BJ6C 2LKPA 2X6WA 1TL8A 1HLVA 5HLHA 2PJRB 1I3QJ 3BG3A 1LVKA 5J40A 3G73A 1YTYA 3K2ZA 1D8KA 1YO5C 2H09A 1FY7A 5D6EA 4HLXA 3HOXJ 3HOUJ 3AG2H 3CMMA 2K02A 1HF0A 4FETA 2GENA 4A12A 5FKNA 4F92B 3KE2A 1UCRA 4II2A 4X1EA 5H2FC 3CCEI 5L3FA 1FBSA 1HW5A 3QPTA 4YRVA 3RJPA 1BR2A 4J19A 2Y75A 3F23A 2DA2A 2DG8A 1J0RA 2K9MA 3ZMDA 3E6DA 1ZG1A 1KA8A 4AU7A 4HF0A 5DUIA 3KETA 4HX8A 4W1UA 3ASNH 5K7HA 1OYWA 2ZCWA 3I71A 3DEUA 4HF1A 3DPTA 3OYFA 3CCYA 1NH3A 2HOAA 2O3FA 4RS8A 1AHDP 3WTXC 3CO7C 2IPQX 4L9JA 2Z2SB 4C3HJ 2M8EA 5CVVA 3JRAA 5CXIA 4OMZA 4OOIA 3SWHA 4OD5A 1RIOH 2OQRA 4IRIA 2HWVA 3ZMVA 5D4SA 4ESBA 2E1NA 3HL2A 1HW1A 2GXAA 2F4MB 2RREA 1K6YA 5KK1A 2PBXA 2JPCA 4ESJA 2M0MA 4AF5A 4Z2YA 5JR3A 2MLKA 1K61A 4BH9A 1XC5A 1N77A 2GQQA 3KPHA 4U9LA 3ELKA 3P5JA 4Q4ZF 5JHUA 1H9GA 1N25A 4WXCA 2K5CA 1K4TA 2MYSA 3H92A 3ZPLA 1NG7A 1SEUA 2K4JA 2DYSH 2CV1A 2VOPA 4ZYAA 3CWRA 2KJCA 2R7RA 2D5VA 3HOZJ 1RESA 4A2UA 1X1DA 5EEGA 5LGTA 3RKXA 3Q3SA 1RKWA 3HTUA 1K78A 2OF7A 1O57A 5FKKA 3BQZA 1K79A 3ZQGA 1R1VA 1ZTRA 1U5TB 3LWJA 5HODA 2WUIA 3CMAI 4M72A 1FOWA 1IG7A 5EYRA 1VQ9I 4A3JJ 3KZZA 3MKZA 3HPGA 1BC8C 3V4GA 3H3VK 1R7JA 1KU7A 1EV7A 2QSGX 3K69A 3CZ6A 2E36A 5E20A 2X0LA 4RAGA 3F21A 1DDNA 4XMYA 4M3FA 2DODA 4IO9F 3ZQCA 2XPVA 2ZY9A 4RDUA 1LEAA 2OI8A 5K5QA 4HAMA 1W7PD 4Q47A 2IGMA 2NRAC 4ZZDA 3S16J 4G7OF 3DKWA 1SD7A 2HYGD 3C18A 5BS6A 2PJPA 1FEXA 2KLOA 2NS0A 2HNHA 3UR3C 3ZRGA 1P7IA 4FASD 5HDKA 3SFIA 5DM7F 3CMEI 4UUSA 2W1OA 2WTEA 2XGXA 4NUBA 4JNNA 4KT6A 3ZMUA 3ONQA 4OIPF 1D8JA 4BQOA 1QNTA 5FD5A 4L0YB 1OCZH 1ZREA 1R5ID 3NARA 1PJRA 2VJ4A 3LMMA 5FKMA 5EGOB 2IRFG 2Q8KA 4JX6A 5F27A 3JRDA 2OA4A 2DQRA 1XGOA 1QVUA 3FHNA 4C9YA 1ZGAA 4KN4X 4L5EA 3ML6A 5IY5H 1QA6A 3BQYA 4LLLA 3S15J 1W1WE 3HRUA 1HDPA 3BG9A 3KP6A 2EV6A 2M1BA 5IYCJ 5M5YJ 2W53A 1J2XA 4UHTA 5E1XA 3VW2A 4O3MA 4LFUA 5CVJA 1BJZA 4LG0A 5M3MJ 2KIQA 3AKZA 5F64A 1I6XA 3OIPA 3LNQA 3LWFA 1R58A 2XAFA 3HDDA 4ZJZA 2X1DA 3VYUB 1LNWA 4ICHA 4M3BA 3L2WA 3GZNB 5E3LA 5D1RA 2ID3A 1MSEC 3O6BB 4PJLA 1JKOC 1J9IA 1F43A 2BW3B 4AYBN 3F8MA 1MBJA 4UVBA 4MNUA 3DXJF 3OMYA 2QQ8A 1TQPA 1ON1A 2XC7A 2OUMA 2DLLA 4U0VA 4OWRB 4WF2A 2KT0A 5E3MA 2LD5A 2GIZA 2IGKA 2XRLA 3SHFA 4GRIA 3W6VA 2PZ9A 1RKTA 3M8JA 2EZHA 3JTGA 1T2KA 3BG5A 3K4NA 3P9IA 3D5SC 1YG2A 3G1OA 3OS2A 3OL3A 3WHCA 4ABZA 3LFKA 3W6JB 1DU6A 4KDPA 1FMVA 1ETKA 2VONA 1MDMB 3M1EA 3CMYA 3TGNA 2ZOZA 3VTIA 4KNYA 2CW7A 1T08B 4XLEA 2KDZA 1OCPA 5B1AH 4LMYA 1PUFA 3RD3A 2ZSHB 2VI6A 5E18F 4WCGA 2ZKZA 2CJJA 2BEOA 1TQIA 3GXOA 2HZTA 1Z7LA 4NC7A 4CCOA 1X1BA 5ICEA 5LRRA 3DEWA 5B1BH 5A2QK 4ZYEA 1Z67A 3MFKA 5D19A 1W4MA 1TWCJ 4U7DA 4B4CA 4ZYHA 2FBIA 3QOPA 2VKDA 5H9TA 4LLNA 5DYMA 4LIUA 1X1PA 5D8LB 2NP5A 1HA8A 4HQMA 3VIBA 3I58A 3F72A 4DYQA 2HYFA 3I3LA 4BYYA 4KJZA 1X19A 3RIRA 3E5UA 5D5XB 2IS6A 2KZGA 5AIQA 2L2OA 1YQAA 1U5TC 1ETWA 1R49A 3K70D 2RDPA 3D5LA 4ANJA 1XGNA 3RPQA 3WTYC 4G6QA 3GLXA 3QPLA 4GCLA 1MJ9A 4D7NA 3ZMTA 4UY8I 1G6NA 1Z6TA 3ZP5A 2PG4A 3MN2A 5J4VA 3OYBA 5H6RA 3DPUA 2R7QA 5CVIA 1SFEA 5HBUA 2KQRA 3BJOA 4C3JJ 4ZTFA 1UI6A 4P55A 3OYJA 4UUSB 3PL8A 3RH2A 4MQ9F 2A5YB 2KMUA 2LBFA 1JTYA 2I10A 3K4MA 4E6KG 2HR3A 4E7HA 4AVZA 2JA7J 1G3SA 2JRTA 4MGRA 2ISZA 5BQTA 3Q0UA 3BY6A 4XONA 1EF4A 4HQEA 3BROA 2G0EA 2PX9A 3LA2A 1V4RA 2EZKA 3DFGA 3CP8A 5FMPA 1LVAA 2FRHA 3P9KA 1HXDA 3K70C 2GAUA 2ZCMA 4RA2A 2IS2A 3HKZA 1ZLKA 2KP6A 2QWWA 4A3DJ 3K0LA 3NAUA 4F3QA 3L1PA 3VODA 5BOXA 2WWYA 1WCMJ 5FFXA 2WAQN 4IHTA 3J7AY 1WPKA 3ZQQA 1BIAA 4QTRA 2DMUA 1W5TA 3G4SI 2EFQA 3NQOA 2NP3A 2COMA 1M1EB 4GFBA 2O8XA 4AIHA 3QYFA 1FIAA 3GVAA 4HF2A 3AL0B 3BNIA 4R1HA 4CHUA 1FOYA 2HU9A 3S1QJ 1VQ8I 2VBYA 1EH7A 3NI7A 2L4AA 5DCFA 3HOVJ 2R7WA 2RGVA 3SEZA 4P9UA 3BJ6A 4TV7A 3GTKJ 3HE0A 4A3LJ 3PSFA 3GTOJ 2H1KA 4BJTA 2V26A 3ERED 3V7RA 5KVRA 4L5JA 3KNWA 1JT0A 1KU9A 4RLFA 1MD0A 5KNLA 1JGGA 4IRVA 1WSUA 2JA2A 1UELB 3DKYA 1R1TA 2YSRA 4MTEA 1VTNC 3AG1H 1HSTA 4XNFA 2WA0A 2R92J 3L9FA 3T5XA 2IP2A 2ID6A 2GA1A 2R7FA 3VPRA 2EQRA 1XDSA 3ABMH 2P5VA 4YIRX 2HTJA 4PFOA 3DP7A 2DDAA 2PQ8A 1B6AA 2VB6A 3NEUA 4M9ZA 4BBRJ 4E70A 2FOKA 2AXTC 4H4KC 1G3TA 2DMNA 3CJRB 1VNDA 3CF2A 1ZH5A 1KU2A 2QENA 2VC1A 1R4NB 4JKZA 2LY1A 5LEKA 3BCGA 5CVRA 4M6YA 3ZQLA 2V1DA 3DKXA 4XLAA 1SFKA 4XL9A 2R7TA 3RKWA 3E6CC 2E1OA 4A0ZA 1B8IA 4OD4A 2QQBA 4A93J 2Q1ZB 3T8RA 3G1LA 4HPQA 3RPUD 3W2WA 4EJUA 1WJBA 5J8CA 2E5NA 3OYEA 3B02A 1GUUA 5D8KB 3VWBA 3ANPA 3IKVA 1ZAOA 1QGPA 3ROUA 1WJFA 3TOBA 2GUHA 2QKOA 3LA7A 3TL4X 1TW2A 3MEXA 3N4MA 2UXUA 3M9AA 1BJAA 5EFYA 2QGUA 3BJBA 4GCTA 2G7LA 2Y9YA 1DP7P 3K1PA 2WBMA 4IZZA 2X9DA 2H6BA 3O8GA 4KIFA 3BR5A 2VOOA 2L9RA 4BHPA 2Q24A 4QWQA 1S29A 4UVCA 1CF7B 3C2BA 3IUVA 1WH7A 3H3ZA 3S93A 1UAAA 4HRIA 2O7TA 4ZH4F 3BZKA 1XSVA 4XRFA 2ETHA 3CCVI 2XF7A 2R7OA 2ZXIA 1BL0A 1YJWI 5CLSA 4XN3A 5LHHA 2NVTJ 2HOSA 4L62A 1ZLJA 4XRSG 4XLFA 1IXSB 2M5WA 4QSHA 1ZHFA 1KONA 3K1MA 2KJBA 3JRIA 1F9NA 2F4IA 3LOCA 3OYAA 2OERA 3ABTA 2LF7A 3EUKL 3FXLA 3HG9A 1LUJB 3FZVA 2HOTA 5M5WJ 3GFIA 5JHFA 2CUFA 3A02A 3AG4H 2CUJA 2M9HA 2UXOA 3CC7I 1FMWA 3B6AA 3UKGA 3LSTA 5FGMA 5L3EA 3DPLC 4FE7A 1U8BA 5F1JA 3CLQA 5CW8A 2I5UA 1C0WA 3GTJJ 4IVNA 3F1BA 1ETQA 3CESA 1SMYF 1RRJA 2BVLA 1KQ8A 3VOKA 3G2BA 2XPUA 3KEYA 3OOUA 2LREA 1Y1VJ 3CUQC 2K9SA 2DMPA 4BEHA 1SFOJ 4Q5SF 5BNGA 2Z99A 3WGGA 2TDXA 1OCOH 1E3HA 3MNLA 5FO5A 1TC3C 3C2GA 1RR8C 3VW1A 3I54A 5FLMJ 2ZFWA 1XX5A 1ON2A 5F1RA 3I9V2 4S0HB 5M5XJ 3FXOA 3WG7H 2F5DA 1TNSA 5L3DA 4NHJA 4G7HF 2ZC2A 2CQ7A 4L9TA 4XKVA 3CF5F 2KZVA 3LSHA 5HAWA 1X2NA 3ABUA 3O60A 4M3EA 2BXZA 2GIVA 3K4CA 1LFPA 4C2MA 2HQNA 3HSRA 2ADUA 3WHBA 1RUOA 5LBQA 3OR1C 2DQLA 2LY9A 4IHSA 3KP3A 3TO9A 2PMHA 2DA4A 5E79C 2M45A 3OYCA 2OCCH 3EDPA 5LGUA 4CCLA 5GAEJ 2YX7A 2K3FA 4XLCA 5IYBJ 1R22A 3HTSB 1LDDA 4HV5A 5EG0B 2DJNA 5ICGA 1DU0A 4LG0B 2A5WA 2QOPA 3NRGA 1BN5A 3JW4A 3W6KB 5LLQA 1EH6A 4X0GA 1W36C 3EYIA 4F93B 2O5RA 1B9MA 4V2GA 4JOMA 4A3BJ 3HOYJ 5HOOA 3JSOA 2IAIA 1QO0D 2XGCA 2A69F 1BI3A 1MSFC 4NQWA 2EFPA 1YIJI 4YFNF 2BHZA 1O4XA 2EA4A 3VSKA 2IA0A 2JVHA 2KRFA 3HTAA 2VIXA 2EINH 3MWMA 4M71A 1YRNA 2WY8Q 3ZGKA 1OYIA 1IRXA 2QVOA 1S8NA 3GZ5A 2LF8A 2IEKA 3IUOA 4UUVA 2AO9A 4PCQA 2WC2A 2F5VA 3DPJA 3LSPA 3WTUC 1Z1DA 4MK6A 1Z6RA 1ZELA 3TBIA 2DA5A 2XB5A 1IRGA 2EZIA 4A3FJ 1TWGJ 4N4NB 3JTHA 4PJ0C 4BE0A 2MC3A 1OPCA 3QYBA 3SDGA 1ENHA 1YI2I 4P5OA 1OCRH 4KIBA 3IRQA 3FMSA 3HM5A 3HYIA 2XVCA 4ESFA 2QKMB 3SXYA 3BOQA 2MFZA 4M6XA 3SZGA 4XLHA 3BLYA 1MH3A 1SFXA 3SEQA 5J4YA 2DJIA 2MA3A 3EUPA 2G9WA 2UXNA 1WHUA 1SAXA 4ZDOA 4A5NA 4ZYGA 1P9QC 3P7NA 4KICA 3PFIA 4IL6C 4MHGA 1GHCA 1ZGWA 4NN1A 1MMGA 4HX4A 1Z21A 5J3LA 3A0HC 3LAPA 2VUMJ 3FRQA 2H8WA 5FLXZ 4HLYA 4FX0A 1X4OA 3VEPA 2Y30A 3AQSA 4H0EA 2VPRA 2ZNYA 1N78A 3KFWX 3MMYB 2HOEA 2QQ9A 3H0GJ 2DTRA 4E7JA 2RQPA 3FXRA 3QBMA 3OYHA 1BC7C 4JL3A 2QUFA 3BRUA 3ABLH 1ETVA 4L18B 4OIRF 1W5CC 4FE4A 2XV4S 5HDNA 3TDZC 3KLOA 2KPMA 1ONVA 1VQ7I 2H6CA 3CCJI 5E17F 1D0YA 4BAYA 5JFRA 1U2WA 4XN0A 4C2TA 1YITI 4BJ5C 1Y39A 3CDHA 3ZMSA 2HDWA 2J5PA 2O0YA 4HEA2 5CXGA 1JJ8C 2FA5A 3CUQB 1KQ9A 1T6SA 3KYLA 4M73A 1GXQA 4P1WA 3RI4A 2H94A 3VYRB 5LD2C 2DG7A 1W36D 4E7SA 3OSFA 3FF5A 2ZJ2A 3OS1A 2CV2A 1B1BA 1YX3A 2UUZA 2PJRA 3WODF 1BOAA 1MNEA 1APLC 1A5JA 2IS1A 1R5HA 1UMQA 4HOBA 3E97A 2LBFB 4OIQF 5EDNA 1W0TA 1Q1VA 1JGSA 2X48A 2R0QC 4AYBA 3HSFA 3I4NJ 3WTTC 1S9HA 2L4MA 3AG3H 3AL0C 2E34A 1V5EA 4HW0A 4IX7A 4OIOF 4LITA 2F07A 1O3QA 1POGA 1KGSA 3FK6A 4NB5A 1TNTA 3FMQA 4UB8C 2W57A 5L3GA 2BZTA 4MO7A 1MMSA 3R0JA 5TGTA 4KT5C 2MBFA 1NHAA 1SD6A 1YW9A 4F91B 4MFDA 3G7RA 5GP9A 1E2XA 2A6EF 1J59A 5GAHJ 2CH0A 4GCVA 2FJI1 4BXUA 3FWEA 2XROA 2C6YA 3HHGA 4ZDPA 2HVSA 4O6JA 3F0CA 2CS3A 3HGGA 3BTIA 1RPWA 4BEHB 2DCEA 3LSIA 2VXZA 1T0FA 2EB7A 2HXIA 2QSFX 2X4HA 2X51A 3OYMA 2X85A 2XAUA 1U3EM 4UNOA 3GTLJ 2BOLA 3JREA 4BL0B 4I09A 2DT6A 5HLIA 2KKOA 1D1BA 1PUFB 4ZTJA 9ANTA 3WU1B 2V6CA 1LKXA 1CGPA 4A6DA 3RTRA 4ZDLA 3S2DJ 2V9VA 1JKQC 3A1YA 2HYTA 3PM1A 1JI8A 2DT5A 4DNCA 1A31A 2E1CA 1QRYA 3E6MA 4FCYA 2A68F 4CUGA 1U5TA 1W5SA 3ULQB 2R5ZA 2LMDA 2NOJB 2OAZA 1ZQ3P 2B3WA 4Y3OA 2CV0A 3UNGC 3CUOA 3J81Z 3IC7A 2FSWA 3GZ6A 1ETYA 2FE3A 1X3ZB 3C7JA 4D9JA 5HVQC 5KAFC 3IP4B 2EIMH 2DPUA 2NVQJ 1XDUA 1YS6A 1JUSA 1ZN2A 4XK4A 2A07F 2XAQA 2RVCA 1LPQA 5J6XA 1G8XA 2GLOA 3K4JA 1QZYA 3OOPA 1JKPC 2L9VA 4RB2C 5E3OA 1AOYA 3MKWB 4JP0A 1UZCA 3JCUC 3QU6A 5AQCA 1BIBA 3QODA 1PP7U 1XGSA 3HRTA 2G3BA 1FSEA 2PN6A 3TDUC 3M3YJ 1Z3YA 5IP6A 1TT5B 5J8FA 1Y8QB 4ZZLA 2EH3A 2DU9A 3K6GA 3CJQB 2R7UA 3S2HJ 5FFZA 1XG1A 2O9LA 2IU5A 1WZ2A 4XOPA 3PPBA 4B47A 1WQ2A 4EATA 2E2HJ 3GTPJ 3L2UA 5IT3A 2L5QA 4XRMA 1LDKB 2XUBA 3CUQA 3DU6A 4XKWA 1IN4A 2FNAA 3LA3A 3W3CA 1TWFJ 5EZHA 1I27A 1R1UA 2MGQA 4KN7X 1BM9A 3J7YJ 2BGCA 1U78A 3CQZJ 3MAJA 3PUBA 3VSLA 1Y0NA 2XAJA 2DK8A 2ICWG 4LGWA 1OCTC 1HQCA 3HIFA 2HPMA 2LH9A 4Y4RA 2WAFA 3M8FA 4WX9A 3I64A 4E7KA 5F6FA 1O3RA 3RYRA 2ELHA 4GXOA 2OPTA 4MFEA 5F0HA 1RETA 1XGMA 2BV6A 4RB1A 1BI2A 3A0BC 4GO1A 1YOVB 2FJ1A 4MTDA 3L7WA 3LSRA 4B48A 2ZXJA 1RNLA 2BE5F 3LQQA 5BMZA 3H36A 3IH4A 4JQFA 4UDSA 1YJ9I 4A3GJ 3RZDJ 2ISYA 1DPUA 2FBQA 3TP0A 1DP3A 3C07A 2M87A 3HUGB 3GTGJ 4YFXF 2JPBA 3ZMZA 1LE8A 4I0BA 3IV5A 2NVXJ 3DWLE 3K7AJ 3S3OA 4JX5A 5IP9J 2H8RA 3IHUA 1OCCH 3HIMA 2ZSIB 2Z16A 1HC8A 2CWEA 4PJNA 2Y0SA 2Y0MA 4C2UA 3KP7A 4DQ2A 4I01A 2XSDC 2Y0SN 4J00A 2D45A 2W24A 2M3AA 4FQGA 2DI3A 2LR8A 4DOZA 3OSGA 4BDZA 3FXJA 4D5FA 3S17J 2CQNA 4IHXA 3JAMK 3BPVA 4Y15A 2DW4A 1U9OA 2P8TA 3BCAA 2K7LA 2P4WA 3DU5A 3FISA 2FQ3A 1O7FA 3V7SA 4A3MJ 2STWA 1HCRA 5ED4A 5GPCA 2GOMA 1MBGA 1Y8RB 3ZQ7A 2JA6J 3K8PC 3MKYB 1MBHA 3DCFA 1LDJA 2Q0OA 4XOTA 2BBYA 5J1RA 1ZR4A 2KIMA 1DGWY 3O3KA 4N9HA 1XS9A 2I8DA 5IP7J 1HKSA 3NRVA 2JTVA 3GFMA 1LFUP 3MZYA 2MSYA 3MZ8A 4WWCA 1IN8A 5IOYA 1L3LA 5F0FA 3OIQA 3HKZN 1WJEA 2L9SA 2HVQA 3NXCA 2HQ5A 2LKSA 3GYHX 4A5MA 2LC2A 3I56I 3E6BA 1IO2A 4DYCA 3J7AO 3V7CA 3H5NA 4OMYA 2HEOA 4N4OB 3L2QA 2Y48A 1AU7A 4IQ4A 4RM3A 1VQ6I 3U2RA 2V1UA 2MABA 2XIGA 1ERDA 2UXIA 3BZ6A 2K85A 4AIDA 5TRDA 3GF2A 4RAYA 2RNJA 2R7VA 3P9CA 2DFHA 4MLOA 1OKRA 2ELKA 2ZCNA 5DD8A 2GBYA 1FYLA 2OU2A 4XBFA 3I5UA 4LJZF 2ZNZA 1SD5A 1VFCA 1BW5A 2ZOYA 3E7LA 4LOCA 3VVZA 1NK2P 3BTLA 3HUGA 2TCTA 1DUXC 1MJBA 2XAGA 4PJMA 4DW6A 4KYWA 2P5KA 4G8XA 1R23A 1H9TA 3RCOA 2DA3A 1B9NA 2Z3YA 3K9TA 2RC4A 5LHGA 3VVYA 1WJAA 4BY1J 1FTZA 1V54H 2E60A 3FIWA 3JRGA 3SFZA 3FKIJ 2D1VA 3GFLA 3REOA 2L3DA 1JHFA 3E3VA 2A61A 1PUEE 2NS7A 3WTWC 3QYEA 2OV7A 2PBIA 3PSIA 3BZCA 2HQRA 2L7KA 4XSZF 4IXAA 5EEHA 2ZJPF 2YVEA 4RB3C 3U9GA 2A2FX 4ENKA 2O8KA 3QU3A 2CMPA 1P4XA 3Q0WA 4YIIA 4AM3A 2JK3A 4LLGF 4GFKA 3EUHA 2L7FP 3K4LA 2ESNA 2V9PA 1A04A 4CCKA 4DBQA 4CSWA 5K7ZA 2TRTA 2V4JC 1SFUA 1VI0A 3S1RJ 5C4YA 1YE9A 3G71I 3RDIA 1T38A 1T33A 1IUYA 3ISPA 2XAHA 3CCRI 1MMNA 2HKXA 4HV6A 3M07A 2O7OA 4D5CA 3CCSI 2WV0A 3T1BA 4NDLA 2KDOA 4RGSA 1G2HA 3MZHA 2FF4A 2V1NA 4IOCF 2E7XA 3KP4A 2K9NA 2AS5F 2LSOA 3C3WA 3KLNA 4D0PA 2NX4A 3H9JA 5HS8A 1GLNA 2HFHA 1AA7A 3K4BA 2NVUB 1G3YA 2DMQA 3HBLA 5D5VB 4A3IJ 2L54A 3KP5A 2H1LA 4RAZA 2MW8A 1A36A 2B7EA 1W0UA 2BY3A 1GV2A 1SANA 4ME9A 2JZYA 3KIOA 3BR0A 1FTTA 3JAMZ 1ZG3A 3M8EA 2EV5A 5CJ9A 4RGRA 5IYDJ 3J7ZI 4XQFA 5JLWA 2EZLA 3BPXA 3JRHA 5C3EJ 2R5YB 3W2AA 2K9LA 4YZEA 3QWLA 2HVRA 3OYNA 3RKYA 3E0JB 1JUMA 5D18A 3I59A 3WU0A 3T8TA 3QPHA 5IPAA 1IGNA 3U1DA 2Z9OA 1ZRFA 1CQTA 2X1CA 2JRMA 4MEYF 1V5GA 2AQEA 4HSTA 2DA6A 3CO6C 3EYYA 1PDNC 2R5ZB 3BP8A 1QPIA 3B81A 2DK5A 3WTZA 5AIPA 2PMZA 2UXXA 2DBBA 2CW8A 4BE1A 1FBUA 2D2WA 1IC8A 5H6QA 1D3YA 4HG2A 4OAYA 4S05A 2RKHA 1FOKA 1YIOA 4PFPA 2JSCA 5ICFA 3ZN1A 3OYDA 1E17A 2GXGA 1JJ6C 2ZCXA 2N8GA 2BY1A 1MZBA 1R5GA 4D1QA 2W25A 1RR7A 3LQRA 2WADA 1ZRCA 3GZIA 5DCMB 1QU3A 2VKVA 2YPRA 2X6YA 2L9NA 4F52A 5K5RA 4G6TB 2OTLI 1JTXA 1OLTA 4HBLA 4I2OA 1FX7A 1JUPA 4C3IJ 2VBZA 5HDGA 2BHYA 4E7ZA 4WXHA 1VQKI 3OS0A 4X6AJ 4HNVA 3FKJA 4BBSJ 1E3PA 1I1GA 2VBXA 1TQMA 4ASNA 5J1YA 1B72B 3U1KA 2ZFUA 1Y56A 1HKQA 1D0XA 3ZN0A 5E3NA 2Z1DA 2GOXB 5ILSA 2P7CB 4IPAA 1Y1WJ 3CCMI 2K3PA 1QHGA 1XB4A 1ETOA 1K4SA 1TBXA 3CJDA 4D7MA 4AC6A 4QIWN 1Q1HA 4XLPF 1MJAA 1JT6A 3GTQJ 4XORA 1MBFA 2BY0A 3ESWB 3QQAA 5FKOA 5LHIA 5DS9A 2FEZA 1H8AC 2IGOA 1UI5A 3LSKA 2CQQA 4U88A 5FKLA 1R4MB 3J80Z 1VQOI 3M4OJ 2KRHA 3DTIA 1LJ9A 3GMEA 2ESHA 5DV5A 3WTVC 3KX2A 1XTAA 2WAEA 3OV8A 1X2MA 3HZJA 1FYMA 3T0YA 3BTCA 1R00A 5CQEA 3OR2C 4S04A 1FWZA 3G56A 2QSHX 1H88C 2DOAA 3RSNA 1U0JA 3OY9A 3SDBA 1OYYA 4PGGA 5KAIC 1IXCA 5TJJA 2ME6A 1QHHD 2HKOA 2KFDA 2OD5A 3RKQA 4LG3A 1ULYA 2IVMA 4A3KJ 3CDLA 4JK1X 2CO5A 1VQ5I 2IGNA 3H9GA 1BBYA 4I98B 3EETA 3B73A 3PUFA 4FISA 3QRFF 1R9TJ 4OINF 1MH4A 5FRNA 2W84A 2PFBA 2XASA 3DF8A 1EA3A 2CU7A 5KHDA 4RGUA 1SMTA 1JXSA 3ANGA 1H0MA 4CCNA 1X1CA 4PJJA 1N75A 2V57A 4ON0A 3F8NA 1SGMA 3PQJA 4IOAF 1NTCA 2DDBA 4HDUA 2Y31A 2EWNA 2MH9A 2G7GA 2IXSA 3H3UA 1B72A 3MKLA 1MW7A 2G7UA 2H27A 2P7VB 2YUSA 3DBRB 3CDIA 4BHBA 1KQ0A 4FHTA 6PAXA 1ITYA 2D1HA 2FU4A 2L0KA 1F4KA 2Y69H 4LIVA 1KU3A 3MD2A 2JVGA 2R3SA 3EPZA 1HKTA 4Y33A 1P92A 5J47A 1Z91A 3BJAA 2NAZA 3L2VA 2AHQA 4M9XA 4UB6C 4YELA 2LG4A 2EV0A 4OU0A 4HYEA 1MGTA 1I1SA 1NG6A 1IV6A 1BOBA 2QCOA 3FXKA 5K1YA 4BQAA 2XF5A 4IQJA 1J09A 5CYVA 1WJDA 2VQLA 2LKXA 3CD6I 3S2WA 3F6OA 4LK0F 3X2QH 3T6NA 1EJ9A 3Q9SA 2UXPA 4DYRA 4GYGA 3K1NA 1TLHB 4B3AA 4WIBA 1AKHB 1OMIA 3F22A 3L2RA 1OR7C 4CYCB 4G9YA 4CCMA 4I02A 2W7NA 4EGYA 4HX7A 2QWTA 3BR3A 2E1MB 3JRBA 4U0YA 2MG4A 3S14J 1DPRA 4EGZA 3ZQIA 2VJJA 2W4SA 3DBLB 4HA8A 4RBOA 4A3CJ 4Y7NJ 4BQNA 2XDVA 4CXFA 1UHSA 3NS4A 2JJ7A 3FBNB 3C1DA 4CDGA 5HNFA 4XIDA 2QM3A 3BG7A 1XMXA 2B1EA 4V2FA 4BXXJ 2P0WA 5F08A 2VE8A 3A03A 3QP5A 3IL2A 4BDYA 2FOWA 2Q2EA 4I7HA 4RAFA 1ZARA 2ECBA 4RM2A 3R4KA 1DQUA 3HPHA 4RB0A 4L9VA 3L00A 3OYIA 1A6IA 1OQYA 4BU2A 3RZOJ 4UXNA 2XGEA 4XLNF 2M7BA 4I0AA 4CICA 2LOOA 2HDCA 3TO6A 4BQQA 1FYKA 3GBGA 1B4AA 2E35A 3WGHA 4U9NA 2W82A 3S8PA 4AD9A 4BUPA 2G7SA 3H9QA 2JA8J 1VQPI 4AWXB 3V8JA 3WE3A 2YVXA 3VYSB 1FNNA 5D5UB 5FRMA 3HTHA 3DBHB 2FBHA 4BXFA 4AUXA 1VQMI 2VC0A 4KMFA 4BS9A 4YFKF 4IHYA 1BA5A 3ON4A 1K7AA 3O2PE 2F6CA 4CH7A 5D4RA 3IAS2 3JSJA 3HXLA 1EKEA 2OZ6A 4FT8A 1YRNB 2DPDA 3A2KA 3DTEA 3I53A 1IDYA 2BXYA 2L7ZA 2E19A 4U0WA 2L7MP 2QQAA 3V78A 3VYTB 1TT0A 2JQ7A 2VQCA 2R4GA 4JX4A 4M9SA 5K7FA 2R5YA 1ZR2A 1UHMA 1WWXA 1MNMC 1IN5A 4I99C 1O3SA 3HC7A 4Y17A 1V3FA 1ODDA 3F8BA 3IRRA 5FD6A 2HGCA 3CC2I 2UZKA 1TTYA 2EFNA 4DIQA 4EJWA 4J01A 4WK8F 4Y13A 3FXQA 1J75A 2E5ZA 4Z6YA 1LFBA 1TZLA 2QIBA 3R6SA 2MD5A 5E8IA 1UJ8A 3DLLF 3TQNA 2LNBA 2JSPA 4IEJA 5DD4A 2HTSA 2ZBKA 4E4HA 1ZRDA 3NPIA 3H5AA 2EIJH 2VKHA 4CGZA 3VUQA 2CQKA 2GM4A 2PMZN 2Z33A 2K40A 3E1SA 1IN6A 4G6DA 2DFFA 5HNHA 4MEXF 3GLLA 4ACIA 4CYCA 4GFLA 4LB6B 2ZXHA 3AFHA 3R60A 3LHQA 5C44J 2XPWA 1VQ4I 4R79A 2PMUA 4PUSA 3PNTA 3H0DA 2FXAA 1WGXA 1U6GA 4ENJA 1X3WB 2VBWA 5LRSA 5EF6A 1Z3XA 3VDXA 1S6LA 4EJVA 1TP4A 1QZZA 5DTDA 3FX3A 5IT9Z 4CO8A 2XB0X 3Q9VA 2LRDA 1H89C 1REPC 1OFCX 4XKBA 3K10A 1D0ZA 2YU9J 1U9NA 4IKFA 2EA2A 3DQVC 2IT0A 2K4BA 1QPMA 3ZQHA 4C30A 4G7ZF 1SD4A 2CYYA 3ASOH 3WU2C 2GWRA 2EIKH 1ZK8A 3TEDA 2PLYA 2JN6A 2XSJC 2P6TA 3H1CA 3JR9A 3B6CA 2O61A 1PYVA 3HTJA 1WJCA 5CKTA 1USSA 5FHPA 1NK3P 4M6VA 4ITVA 2LYCA 1LQ1A 5FB2A 2VT3A 4DZPA 4WXDA 5TISC 3TMOA 1IN7A 2OTJI 1RUNA 2YVHA 4G12A 4XSXF 4BACA 1YYVA 4NELA 1MBKA 3KCCA 5F0CA 4HDVA 4QPOA 4YG2F 4C2MJ 1FJLA 3S3NA 2VODA 4FTHA 1TW3A 3V8LA 5KCMA 1SVMA 3O8HA 4UVAA 3F6VA 2ZMEA 5EEAA 4EM2A 2QBYB 2UXHA 2UV1A 4V19K 5J1UA 1J5YA 1WFXA 4BNCA 4PSXA 2RNGA 4KISA 1T56A 3GO5A 1FP1D 2HYJA 5DCMA 2DO7A 2JUGA 4B3XA 3IH3A 4A0YA 5FJ8J 3V42A 2ZXWH 5AONA 3EQLF 2NNYA 2R7ZJ 3CC4I 4EVIA 1JHHA 3AAFA 2QA4I 5BPDA 1G3WA 3I4MJ 2L01A 5DDGA 2YR2A 3HRMA 2DXIA 2YU3A 3BCBA 1USTA 3MCZA 3QP6A 5HLGA 4Q48A 1GXPA 3IAM2 3ZR8X 4DBRA 3F8CA 3RQIA 2OJED 1R36A 4IRHA 1FIPA 3VOEA 4ETSA 1IV8A 5HS7A 2E71A 5FGLA 2A6TA 2IA2A 3S32A 2Z5UA 3OYKA 1WJ5A 1UB9A 4IJAA 4N0BA 1T95A 2MLGA 3EUAA 3CRJA 4AIJA 2FNPA 1WRJA 4M3GA 3BG6A 5DAJA 2WAQA 1MKMA 3RYPA 2R7DA 2BYVE 4NNJA 2HI3A 2K86A 3DEEA 2UWMA 2RQQA 2EK5A 1YW7A 2LVSA 4KWAA 1D1AA 3ABKH 3NWSA 2M2EA
chains in the Genus database with same CATH topology
2DMQA 3HBLA 3KKCA 2IBDA 4DZJA 4A3IJ 3GTMJ 2MW8A 3D1NI 1JKRC 1W0UA 1GV2A 1SANA 5IYBJ 2PBXA 4ME9A 2YS9A 5EG0B 5IOZA 2WGBA 4AF5A 2DJNA 1DU0A 3BR0A 1K61A 2VKEA 2QOPA 1FTTA 1XC5A 3NRGA 3MVPA 5IYDJ 5JLWA 3BHQA 2EZLA 4V2GA 3JRHA 5C3EJ 2R5YB 4A3BJ 3HOYJ 3LJLA 4YZEA 3TW6A 3CWRA 3SJMA 3BT9A 2IAIA 1JUMA 2D5VA 3HOZJ 3JRFA 5D18A 1RESA 2XGCA 1MSFC 2LLKA 2HXOA 5IPAA 3Q3SA 1S7EA 1RKWA 1IGNA 4I76A 1O4XA 1CQTA 2OF7A 3HTAA 3P9TA 5FKKA 3BQZA 2DA6A 3IH2A 1YRNA 3ZQGA 2R5ZB 1QPIA 1ZTRA 2DTZA 3B81A 3LWJA 5HODA 2IEKA 2AO9A 2WUIA 2B63J 3DPJA 3LSPA 1IG7A 4MK6A 5EYRA 1IC8A 4A3JJ 4UUTA 2DA5A 2XB5A 3H3VK 2EZIA 3KZ9A 4MXMA 4A3FJ 1TWGJ 3AQTA 2EBIA 3LSGA 4MIMA 1JJ6C 2ZCXA 2N8GA 3SDGA 1ENHA 2HKUA 1RR7A 1IDZA 3VP5A 2FQ4A 1GV5A 4M3FA 3HM5A 3GZIA 4M3DA 3ZQCA 3G1MA 1IRZA 2XPVA 5EG0A 1I6HJ 2VKVA 1MH3A 2JA5J 4RDUA 3EUPA 2OI8A 1JTXA 3S16J 4W97A 1FEXA 3GEUA 1P7IA 1JUPA 2NS8A 1ZGWA 4EEFG 4C3IJ 3QKXA 4NN1A 2VUMJ 5J3LA 3KKDA 3SFIA 3FRQA 4X6AJ 4HNVA 4BBSJ 4UUSA 3S5RA 3K2AA 5J1YA 2Y30A 1B72B 3AQSA 2R93J 2VPRA 4JNNA 3H0GJ 5E3NA 1Y1WJ 3QBMA 1ETOA 4JL3A 3CJDA 3BRUA 4D7MA 4AC6A 4QIWN 3NARA 1ETVA 1JT6A 3GTQJ 1MBFA 1GVDA 2WB1N 3FK7A 4FE4A 3QQAA 5DS9A 5FKMA 5FKOA 5EGOB 1H8AC 1UI5A 2NOGA 2CQQA 4JX6A 5FKLA 3S1MJ 3M4OJ 5F27A 3JRDA 4AC0A 4IHWA 1QVUA 3ZOBA 5M3FJ 1X2MA 4L5EA 3BTCA 1P7JA 3G56A 2JWTA 5CXGA 1I50J 1JJ8C 2XDNA 3BQYA 2W48A 1H88C 3S15J 1HDPA 3BG9A 1TWHJ 5F04A 5HSZA 3HGYA 2DG7A 2COBA 3OSFA 3PO3J 5IYCJ 5M5YJ 2W53A 2ME6A 3VW2A 1BJZA 1APLC 1A5JA 3RKQA 5M3MJ 1UMQA 3LNQA 4A3KJ 3CDLA 4CGRA 3HDDA 1R9TJ 4FISA 5EDNA 4ICHA 4PXIA 1W0TA 4M3BA 1Q1VA 1MH4A 5E3LA 5D1RA 2ID3A 2X48A 2CU7A 1MSEC 2R0QC 5C4JJ 1JKOC 1F43A 3I4NJ 3ANGA 4AYBN 3BR1A 1MBJA 2V57A 2F07A 1POGA 1SGMA 3FK6A 2KT0A 5E3MA 1NTCA 3ZQFA 2LD5A 2XRLA 2Y31A 2G7GA 3W6VA 2PZ9A 1RKTA 1B72A 3VOXA 4MO7A 1BW6A 2EZHA 2WV1A 2D6YA 3MKLA 2Y2ZA 2Y9ZA 1LE8B 3BG5A 4A3EJ 4MFDA 3BR2A 3G7RA 3G1OA 5GP9A 2YUSA 1AKHA 3WHCA 4ABZA 1DU6A 1ETKA 3CMYA 1ITYA 1VF9A 2ZOZA 2L0KA 2KDZA 1OCPA 3RD3A 2CRGA 3F0CA 1PUFA 2VI6A 3HGGA 3BTIA 1RPWA 2CJJA 1QVTA 3COLA 4JYKA 2HXIA 4IHVA 3GTLJ 5EZGA 4XICA 3DEWA 3JREA 2AHQA 5D19A 1TWCJ 4B4CA 1IV6A 2QCOA 3HB9A 5H9TA 1PUFB 9ANTA 2LKXA 3BR6A 2NP5A 3T6NA 3VIBA 2E2IJ 1JKQC 4DYQA 3S2DJ 2K9QA 2HYTA 3PM1A 4DYRA 2UXPA 1QRYA 4B3AA 4FCYA 3QPSA 1AKHB 2R5ZA 1ZQ3P 4HKUA 4CYCB 1B8IB 2XGDA 1ORKA 1ETWA 4A69C 2QWTA 3BR3A 3OIOA 1UG2A 3JRBA 1ETYA 2MG4A 3S14J 3QPLA 3ZQIA 2NVQJ 4GCLA 4D7NA 4RBOA 1JUSA 4A3CJ 4XK4A 4Y7NJ 3MN2A 1UHSA 2RAEA 5HBUA 2JJ7A 2FX0A 4C3JJ 4XIDA 3A01A 1UI6A 2GLOA 5K58A 4V2FA 4UUSB 4BXXJ 1JKPC 3RH2A 5E3OA 1ZKGA 5F08A 3A03A 2CQXA 4JP0A 1JTYA 2I10A 5AQCA 2JA7J 2ECBA 2G3BA 3M3YJ 5IP6A 1A6IA 3Q0UA 2EH3A 1EF4A 1X58A 2G0EA 3RZOJ 3S2HJ 1XG1A 2XGEA 2EZKA 2FD5A 5FMPA 2O9LA 2IU5A 2LFBA 3PPBA 1MBEA 2REKA 2DN0A 2E2HJ 3GTPJ 2ZCMA 3GBGA 4XRMA 3ON2A 4GCKA 4A3DJ 2G7SA 3NAUA 1TWFJ 3L1PA 2JA8J 5EZHA 2MGQA 1WCMJ 3PASA 2WAQN 3HTHA 1U78A 1WPKA 2DMTA 3CQZJ 2RASA 4QTRA 2DMUA 1K83J 4AUXA 1F36A 2NP3A 4IHYA 2QTQA 1BA5A 1OCTC 5EGOA 3ON4A 4GFBA 5JLXA 1FIAA 2RHAA 3JRCA 3JSJA 3BNIA 3HEFA 1YRNB 3HTIA 2X6OA 3S1QJ 3NI7A 1HOMA 1IDYA 2OPTA 4MFEA 5F0HA 1RETA 3HOVJ 2L7ZA 2E19A 3HOWJ 2FJ1A 2L7MP 3V78A 3GTKJ 3HE0A 4A3LJ 3GTOJ 2H1KA 4JX4A 5K7FA 3LSRA 3S1NJ 2R5YA 1ZR2A 1JT0A 4BKXA 3KNWA 1MNMC 3IH4A 5GPAA 4UDSA 1JGGA 4A3GJ 4Y52J 3RZDJ 2FBQA 3TW7A 3TP0A 2R92J 3C07A 2ID6A 3VPRA 2EQRA 2QF7A 3TP3A 3GTGJ 4B1RA 1LE8A 1LFBA 3IV5A 2NVXJ 4BBRJ 1GDTA 2LK2A 3K7AJ 2QIBA 3E7QA 4JX5A 5IP9J 2H8RA 2LP0A 3HIMA 3NNRA 1ETXA 1TWAJ 4IEJA 2DMNA 2XSDC 2Y0SN 1VNDA 3LSJA 3NPIA 1OJLA 1WH5A 3VW0A 4JKZA 2LR8A 3OSGA 3S17J 3VUQA 3BCGA 4D5FA 2GM4A 2PMZN 2LTPA 2M34A 4I6ZA 4IHXA 2K40A 3ZQLA 1D5YA 1GT0C 2M8GX 1U9OA 1Z77A 2DA1A 3FISA 2E1OA 1B8IA 4ACIA 4CYCA 4A3MJ 4A93J 4GFLA 3LHQA 3G1LA 1HCRA 2P81A 5GPCA 2XPWA 5C44J 1MBGA 4BY7J 2JA6J 1GUUA 1MBHA 3PO2J 3DCFA 3ANPA 2GFNA 2GUHA 1WGXA 5J1RA 2QKOA 2UXUA 1ZR4A 5EF6A 5FLVA 5EFYA 3BJBA 4GCTA 1XS9A 5DTDA 3EGQA 2NVYJ 2G7LA 2Y9YA 3VVXA 4XRSA 5IP7J 2XB0X 2X9DA 1H89C 3O8GA 1OFCX 2YU9J 3BR5A 2L9RA 5C4XJ 1U9NA 2Q24A 2CUEA 1LFUP 1Z0XA 2MSYA 5IOYA 3C2BA 1IJWC 3IUVA 5F0FA 1WH7A 3HKZN 3ZQHA 3NXCA 2O7TA 2HQ5A 1ZK8A 2DA7A 3TEDA 4DYCA 3A01B 1BL0A 2HDDA 2JN6A 2NVTJ 2HOSA 1AU7A 4L62A 2JMWA 4XRSG 3JR9A 3B6CA 2M0CA 3V6GA 4QSHA 3HTJA 2UXIA 1WI3A 5FHPA 1NK3P 4M6VA 4MLOA 2ECCA 2ELKA 3JRIA 2ZCNA 3LOCA 1HDDC 2OERA 2GBYA 4DZPA 2ME0A 1VFCA 1BW5A 1IUFA 2ZOYA 2YVHA 3E7LA 4LOCA 4G12A 3VVZA 1NK2P 3BTLA 4NELA 2HOTA 1MBKA 5F0CA 3BTJA 2TCTA 5M5WJ 1E3OC 2ZB9A 2E2JJ 4C2MJ 4DW6A 1FJLA 2CUFA 3A02A 4FTHA 2M9HA 3O8HA 5EEAA 2DA3A 2UXOA 1HLVA 3B6AA 3VVYA 3UKGA 2UXHA 1I3QJ 4BY1J 5J1UA 1FTZA 3BG3A 4FE7A 3FIWA 5F1JA 1U8BA 5CW8A 3JRGA 1T56A 3FKIJ 2HYJA 3GTJJ 3HOXJ 1ETQA 3HOUJ 3F1BA 3IH3A 5FJ8J 1HF0A 2NS7A 2R7ZJ 2GENA 3VOKA 2XPUA 5FKNA 3OOUA 1Y1VJ 2K9SA 2DMPA 4X1EA 3I4MJ 1SFOJ 5BNGA 2YVEA 4J19A 3MNLA 1TC3C 2DA2A 2DG8A 2O8KA 3VW1A 5FLMJ 3RQIA 3Q0WA 2JK3A 1FIPA 4GFKA 4S0HB 5M5XJ 2L7FP 5FGLA 4W1UA 5K7HA 5K7ZA 2TRTA 1VI0A 3S1RJ 5C4YA 3CRJA 3CCYA 5DAJA 5HAWA 4M3GA 1X2NA 1T33A 2HOAA 1AHDP 3O60A 4M3EA 4C3HJ 2O7OA 2HI3A 4D5CA 4NDLA 3JRAA 5CXIA 1G2HA 3WHBA 2LVSA 4KWAA 2LY9A 2K9NA 2M2EA 2DA4A 2NX4A 3Q0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMQ A;  3HBL A;  3KKC A;  2IBD A;  4DZJ A;  4A3I J;  3GTM J;  2MW8 A;  3D1N I;  1JKR C;  1W0U A;  1GV2 A;  1SAN A;  5IYB J;  2PBX A;  4ME9 A;  2YS9 A;  5EG0 B;  5IOZ A;  2WGB A;  4AF5 A;  2DJN A;  1DU0 A;  3BR0 A;  1K61 A;  2VKE A;  2QOP A;  1FTT A;  1XC5 A;  3NRG A;  3MVP A;  5IYD J;  5JLW A;  3BHQ A;  2EZL A;  4V2G A;  3JRH A;  5C3E J;  2R5Y B;  4A3B J;  3HOY J;  3LJL A;  4YZE A;  3TW6 A;  3CWR A;  3SJM A;  3BT9 A;  2IAI A;  1JUM A;  2D5V A;  3HOZ J;  3JRF A;  5D18 A;  1RES A;  2XGC A;  1MSF C;  2LLK A;  2HXO A;  5IPA A;  3Q3S A;  1S7E A;  1RKW A;  1IGN A;  4I76 A;  1O4X A;  1CQT A;  2OF7 A;  3HTA A;  3P9T A;  5FKK A;  3BQZ A;  2DA6 A;  3IH2 A;  1YRN A;  3ZQG A;  2R5Z B;  1QPI A;  1ZTR A;  2DTZ A;  3B81 A;  3LWJ A;  5HOD A;  2IEK A;  2AO9 A;  2WUI A;  2B63 J;  3DPJ A;  3LSP A;  1IG7 A;  4MK6 A;  5EYR A;  1IC8 A;  4A3J J;  4UUT A;  2DA5 A;  2XB5 A;  3H3V K;  2EZI A;  3KZ9 A;  4MXM A;  4A3F J;  1TWG J;  3AQT A;  2EBI A;  3LSG A;  4MIM A;  1JJ6 C;  2ZCX A;  2N8G A;  3SDG A;  1ENH A;  2HKU A;  1RR7 A;  1IDZ A;  3VP5 A;  2FQ4 A;  1GV5 A;  4M3F A;  3HM5 A;  3GZI A;  4M3D A;  3ZQC A;  3G1M A;  1IRZ A;  2XPV A;  5EG0 A;  1I6H J;  2VKV A;  1MH3 A;  2JA5 J;  4RDU A;  3EUP A;  2OI8 A;  1JTX A;  3S16 J;  4W97 A;  1FEX A;  3GEU A;  1P7I A;  1JUP A;  2NS8 A;  1ZGW A;  4EEF G;  4C3I J;  3QKX A;  4NN1 A;  2VUM J;  5J3L A;  3KKD A;  3SFI A;  3FRQ A;  4X6A J;  4HNV A;  4BBS J;  4UUS A;  3S5R A;  3K2A A;  5J1Y A;  2Y30 A;  1B72 B;  3AQS A;  2R93 J;  2VPR A;  4JNN A;  3H0G J;  5E3N A;  1Y1W J;  3QBM A;  1ETO A;  4JL3 A;  3CJD A;  3BRU A;  4D7M A;  4AC6 A;  4QIW N;  3NAR A;  1ETV A;  1JT6 A;  3GTQ J;  1MBF A;  1GVD A;  2WB1 N;  3FK7 A;  4FE4 A;  3QQA A;  5DS9 A;  5FKM A;  5FKO A;  5EGO B;  1H8A C;  1UI5 A;  2NOG A;  2CQQ A;  4JX6 A;  5FKL A;  3S1M J;  3M4O J;  5F27 A;  3JRD A;  4AC0 A;  4IHW A;  1QVU A;  3ZOB A;  5M3F J;  1X2M A;  4L5E A;  3BTC A;  1P7J A;  3G56 A;  2JWT A;  5CXG A;  1I50 J;  1JJ8 C;  2XDN A;  3BQY A;  2W48 A;  1H88 C;  3S15 J;  1HDP A;  3BG9 A;  1TWH J;  5F04 A;  5HSZ A;  3HGY A;  2DG7 A;  2COB A;  3OSF A;  3PO3 J;  5IYC J;  5M5Y J;  2W53 A;  2ME6 A;  3VW2 A;  1BJZ A;  1APL C;  1A5J A;  3RKQ A;  5M3M J;  1UMQ A;  3LNQ A;  4A3K J;  3CDL A;  4CGR A;  3HDD A;  1R9T J;  4FIS A;  5EDN A;  4ICH A;  4PXI A;  1W0T A;  4M3B A;  1Q1V A;  1MH4 A;  5E3L A;  5D1R A;  2ID3 A;  2X48 A;  2CU7 A;  1MSE C;  2R0Q C;  5C4J J;  1JKO C;  1F43 A;  3I4N J;  3ANG A;  4AYB N;  3BR1 A;  1MBJ A;  2V57 A;  2F07 A;  1POG A;  1SGM A;  3FK6 A;  2KT0 A;  5E3M A;  1NTC A;  3ZQF A;  2LD5 A;  2XRL A;  2Y31 A;  2G7G A;  3W6V A;  2PZ9 A;  1RKT A;  1B72 A;  3VOX A;  4MO7 A;  1BW6 A;  2EZH A;  2WV1 A;  2D6Y A;  3MKL A;  2Y2Z A;  2Y9Z A;  1LE8 B;  3BG5 A;  4A3E J;  4MFD A;  3BR2 A;  3G7R A;  3G1O A;  5GP9 A;  2YUS A;  1AKH A;  3WHC A;  4ABZ A;  1DU6 A;  1ETK A;  3CMY A;  1ITY A;  1VF9 A;  2ZOZ A;  2L0K A;  2KDZ A;  1OCP A;  3RD3 A;  2CRG A;  3F0C A;  1PUF A;  2VI6 A;  3HGG A;  3BTI A;  1RPW A;  2CJJ A;  1QVT A;  3COL A;  4JYK A;  2HXI A;  4IHV A;  3GTL J;  5EZG A;  4XIC A;  3DEW A;  3JRE A;  2AHQ A;  5D19 A;  1TWC J;  4B4C A;  1IV6 A;  2QCO A;  3HB9 A;  5H9T A;  1PUF B;  9ANT A;  2LKX A;  3BR6 A;  2NP5 A;  3T6N A;  3VIB A;  2E2I J;  1JKQ C;  4DYQ A;  3S2D J;  2K9Q A;  2HYT A;  3PM1 A;  4DYR A;  2UXP A;  1QRY A;  4B3A A;  4FCY A;  3QPS A;  1AKH B;  2R5Z A;  1ZQ3 P;  4HKU A;  4CYC B;  1B8I B;  2XGD A;  1ORK A;  1ETW A;  4A69 C;  2QWT A;  3BR3 A;  3OIO A;  1UG2 A;  3JRB A;  1ETY A;  2MG4 A;  3S14 J;  3QPL A;  3ZQI A;  2NVQ J;  4GCL A;  4D7N A;  4RBO A;  1JUS A;  4A3C J;  4XK4 A;  4Y7N J;  3MN2 A;  1UHS A;  2RAE A;  5HBU A;  2JJ7 A;  2FX0 A;  4C3J J;  4XID A;  3A01 A;  1UI6 A;  2GLO A;  5K58 A;  4V2F A;  4UUS B;  4BXX J;  1JKP C;  3RH2 A;  5E3O A;  1ZKG A;  5F08 A;  3A03 A;  2CQX A;  4JP0 A;  1JTY A;  2I10 A;  5AQC A;  2JA7 J;  2ECB A;  2G3B A;  3M3Y J;  5IP6 A;  1A6I A;  3Q0U A;  2EH3 A;  1EF4 A;  1X58 A;  2G0E A;  3RZO J;  3S2H J;  1XG1 A;  2XGE A;  2EZK A;  2FD5 A;  5FMP A;  2O9L A;  2IU5 A;  2LFB A;  3PPB A;  1MBE A;  2REK A;  2DN0 A;  2E2H J;  3GTP J;  2ZCM A;  3GBG A;  4XRM A;  3ON2 A;  4GCK A;  4A3D J;  2G7S A;  3NAU A;  1TWF J;  3L1P A;  2JA8 J;  5EZH A;  2MGQ A;  1WCM J;  3PAS A;  2WAQ N;  3HTH A;  1U78 A;  1WPK A;  2DMT A;  3CQZ J;  2RAS A;  4QTR A;  2DMU A;  1K83 J;  4AUX A;  1F36 A;  2NP3 A;  4IHY A;  2QTQ A;  1BA5 A;  1OCT C;  5EGO A;  3ON4 A;  4GFB A;  5JLX A;  1FIA A;  2RHA A;  3JRC A;  3JSJ A;  3BNI A;  3HEF A;  1YRN B;  3HTI A;  2X6O A;  3S1Q J;  3NI7 A;  1HOM A;  1IDY A;  2OPT A;  4MFE A;  5F0H A;  1RET A;  3HOV J;  2L7Z A;  2E19 A;  3HOW J;  2FJ1 A;  2L7M P;  3V78 A;  3GTK J;  3HE0 A;  4A3L J;  3GTO J;  2H1K A;  4JX4 A;  5K7F A;  3LSR A;  3S1N J;  2R5Y A;  1ZR2 A;  1JT0 A;  4BKX A;  3KNW A;  1MNM C;  3IH4 A;  5GPA A;  4UDS A;  1JGG A;  4A3G J;  4Y52 J;  3RZD J;  2FBQ A;  3TW7 A;  3TP0 A;  2R92 J;  3C07 A;  2ID6 A;  3VPR A;  2EQR A;  2QF7 A;  3TP3 A;  3GTG J;  4B1R A;  1LE8 A;  1LFB A;  3IV5 A;  2NVX J;  4BBR J;  1GDT A;  2LK2 A;  3K7A J;  2QIB A;  3E7Q A;  4JX5 A;  5IP9 J;  2H8R A;  2LP0 A;  3HIM A;  3NNR A;  1ETX A;  1TWA J;  4IEJ A;  2DMN A;  2XSD C;  2Y0S N;  1VND A;  3LSJ A;  3NPI A;  1OJL A;  1WH5 A;  3VW0 A;  4JKZ A;  2LR8 A;  3OSG A;  3S17 J;  3VUQ A;  3BCG A;  4D5F A;  2GM4 A;  2PMZ N;  2LTP A;  2M34 A;  4I6Z A;  4IHX A;  2K40 A;  3ZQL A;  1D5Y A;  1GT0 C;  2M8G X;  1U9O A;  1Z77 A;  2DA1 A;  3FIS A;  2E1O A;  1B8I A;  4ACI A;  4CYC A;  4A3M J;  4A93 J;  4GFL A;  3LHQ A;  3G1L A;  1HCR A;  2P81 A;  5GPC A;  2XPW A;  5C44 J;  1MBG A;  4BY7 J;  2JA6 J;  1GUU A;  1MBH A;  3PO2 J;  3DCF A;  3ANP A;  2GFN A;  2GUH A;  1WGX A;  5J1R A;  2QKO A;  2UXU A;  1ZR4 A;  5EF6 A;  5FLV A;  5EFY A;  3BJB A;  4GCT A;  1XS9 A;  5DTD A;  3EGQ A;  2NVY J;  2G7L A;  2Y9Y A;  3VVX A;  4XRS A;  5IP7 J;  2XB0 X;  2X9D A;  1H89 C;  3O8G A;  1OFC X;  2YU9 J;  3BR5 A;  2L9R A;  5C4X J;  1U9N A;  2Q24 A;  2CUE A;  1LFU P;  1Z0X A;  2MSY A;  5IOY A;  3C2B A;  1IJW C;  3IUV A;  5F0F A;  1WH7 A;  3HKZ N;  3ZQH A;  3NXC A;  2O7T A;  2HQ5 A;  1ZK8 A;  2DA7 A;  3TED A;  4DYC A;  3A01 B;  1BL0 A;  2HDD A;  2JN6 A;  2NVT J;  2HOS A;  1AU7 A;  4L62 A;  2JMW A;  4XRS G;  3JR9 A;  3B6C A;  2M0C A;  3V6G A;  4QSH A;  3HTJ A;  2UXI A;  1WI3 A;  5FHP A;  1NK3 P;  4M6V A;  4MLO A;  2ECC A;  2ELK A;  3JRI A;  2ZCN A;  3LOC A;  1HDD C;  2OER A;  2GBY A;  4DZP A;  2ME0 A;  1VFC A;  1BW5 A;  1IUF A;  2ZOY A;  2YVH A;  3E7L A;  4LOC A;  4G12 A;  3VVZ A;  1NK2 P;  3BTL A;  4NEL A;  2HOT A;  1MBK A;  5F0C A;  3BTJ A;  2TCT A;  5M5W J;  1E3O C;  2ZB9 A;  2E2J J;  4C2M J;  4DW6 A;  1FJL A;  2CUF A;  3A02 A;  4FTH A;  2M9H A;  3O8H A;  5EEA A;  2DA3 A;  2UXO A;  1HLV A;  3B6A A;  3VVY A;  3UKG A;  2UXH A;  1I3Q J;  4BY1 J;  5J1U A;  1FTZ A;  3BG3 A;  4FE7 A;  3FIW A;  5F1J A;  1U8B A;  5CW8 A;  3JRG A;  1T56 A;  3FKI J;  2HYJ A;  3GTJ J;  3HOX J;  1ETQ A;  3HOU J;  3F1B A;  3IH3 A;  5FJ8 J;  1HF0 A;  2NS7 A;  2R7Z J;  2GEN A;  3VOK A;  2XPU A;  5FKN A;  3OOU A;  1Y1V J;  2K9S A;  2DMP A;  4X1E A;  3I4M J;  1SFO J;  5BNG A;  2YVE A;  4J19 A;  3MNL A;  1TC3 C;  2DA2 A;  2DG8 A;  2O8K A;  3VW1 A;  5FLM J;  3RQI A;  3Q0W A;  2JK3 A;  1FIP A;  4GFK A;  4S0H B;  5M5X J;  2L7F P;  5FGL A;  4W1U A;  5K7H A;  5K7Z A;  2TRT A;  1VI0 A;  3S1R J;  5C4Y A;  3CRJ A;  3CCY A;  5DAJ A;  5HAW A;  4M3G A;  1X2N A;  1T33 A;  2HOA A;  1AHD P;  3O60 A;  4M3E A;  4C3H J;  2O7O A;  2HI3 A;  4D5C A;  4NDL A;  3JRA A;  5CXI A;  1G2H A;  3WHB A;  2LVS A;  4KWA A;  2LY9 A;  2K9N A;  2M2E A;  2DA4 A;  2NX4 A;  3Q0V A; 
#chains in the Genus database with same CATH topology
 2WY7 Q;  1T8I A;  3V8K A;  3KKC A;  2IBD A;  4DZJ A;  3GTM J;  5A2Q Z;  3D1N I;  3IWF A;  1JKR C;  2YS9 A;  1S7A A;  5IOZ A;  2WGB A;  4YIF A;  2VKE A;  1DGR M;  1U8R A;  3HHH A;  1I3A A;  1QQI A;  1QZE A;  1RZ4 A;  1UHW A;  1Y6I A;  3FXM A;  4RLQ A;  3FMR A;  3MVP A;  3S3M A;  1SC7 A;  3FBI B;  3BHQ A;  3SZP A;  1FC3 A;  5HS9 A;  3LJL A;  3TW6 A;  4A0X A;  2X6X A;  3SJM A;  3BT9 A;  5GAG J;  3F3X A;  3J80 K;  3JRF A;  4E7L A;  2FBK A;  3LSM A;  2LLK A;  2HXO A;  5H20 A;  3G6E I;  1S7E A;  1KZH A;  2IS4 A;  3A4C A;  4I76 A;  4MQV A;  5LFA A;  3LL7 A;  5DEQ A;  3P9T A;  2OQG A;  3IH2 A;  4K2E A;  2DTZ A;  3MQ0 A;  2E1M C;  2K27 A;  1YS7 A;  4M74 A;  2B63 J;  4NQW B;  2QEX I;  2F4O B;  3WTS C;  4PDK A;  4UUT A;  1R6R A;  3KZ9 A;  2HS5 A;  3K4K A;  4MXM A;  1YLF A;  2OZU A;  3I4P A;  2DOF A;  3AQT A;  2EBI A;  3LSG A;  1BI0 A;  4MIM A;  1JE8 A;  2L02 A;  1K78 B;  2HKU A;  3SZT A;  1IDZ A;  4KIT B;  3VP5 A;  2FQ4 A;  2NNN A;  1GV5 A;  4M3D A;  1W7P A;  2P5L C;  4QPQ A;  3G1M A;  1IRZ A;  5EG0 A;  1I6H J;  2JA5 J;  3GFJ A;  3G3Z A;  1IXR C;  4XR6 A;  3J81 K;  2YX4 A;  1FOX A;  2KHM A;  5B5E C;  2OBP A;  2OC6 A;  4W97 A;  3HRS A;  4O5V A;  1G4D A;  3COA C;  4B43 A;  3GEU A;  2DYR H;  2NS8 A;  1PP8 F;  2V6E A;  4EEF G;  3QKX A;  1I5Z A;  1BR1 A;  2ACJ A;  2EJR A;  3C2H A;  4PSW A;  3PJR A;  2VJ5 A;  3KKD A;  2B0L A;  1AWC A;  3S5R A;  3K2A A;  3GUD A;  4R8H A;  4EM1 A;  1I39 A;  4N9I A;  2R93 J;  3DTK A;  3FM5 A;  4HNT A;  2KIF A;  4BGD A;  1B59 A;  1G59 A;  2V79 A;  2VAS A;  4GYI A;  1Z7U A;  1FPQ A;  5GAD J;  5LEJ A;  4L0Z B;  3M1C A;  3I0T A;  2EPF A;  1LB2 A;  2WB1 N;  1GVD A;  1UFM A;  4XKC A;  3FK7 A;  1R71 A;  1X1A A;  2KIS A;  4CA0 A;  4CYD A;  2O6G E;  2R7X A;  2NOG A;  3S1M J;  5K5O A;  1VQN I;  2CUZ A;  4AC0 A;  2VLA A;  3DV8 A;  5EJC A;  1HW2 A;  4IHW A;  3ZOB A;  5M3F J;  3BWG A;  1O7L A;  2ZJQ F;  2PI0 A;  2VQG A;  2CFX A;  1P7J A;  3FXU A;  2JWT A;  4NC6 A;  1I50 J;  3BC8 A;  1ZYR F;  2G7H A;  3KYD B;  2W48 A;  4II3 A;  5E1Z B;  2XDN A;  1KYW A;  3GWZ A;  1TWH J;  5F04 A;  1IF1 A;  5HSZ A;  3HGY A;  1IAW A;  3PQK A;  2CGP A;  2COB A;  4IRG A;  1OIS A;  1UG0 A;  3PO3 J;  4RMN A;  3NWT A;  5HLT A;  1MMD A;  3RQ4 A;  2M4K A;  2ELJ A;  2MH2 A;  1V55 H;  3CCQ I;  2F5E A;  5DUK A;  3ZXS A;  2Q2E B;  2M30 A;  4CGR A;  1QBJ A;  5E8G A;  4PXI A;  3PIP F;  2QBY A;  3GW2 A;  2QKL B;  4L9N A;  3SQN A;  4EM0 B;  1F1Z A;  1MDM A;  1IZ1 A;  4B8X A;  4UV8 A;  5C4J J;  1XCV A;  3ECH A;  2VE9 A;  1J7K A;  3BR1 A;  2F5C A;  2OCE A;  1YW8 A;  2ZJR F;  3PNV A;  3LAJ A;  1V5F A;  1XPX A;  3ZQF A;  2PEX A;  3M7G A;  3FM3 A;  1YHQ I;  3VOX A;  1BW6 A;  2VJI A;  2WV1 A;  5CQG A;  1LE8 B;  2Y2Z A;  2Y9Z A;  2D6Y A;  3E5Q A;  4HSR A;  3BR2 A;  4A3E J;  2EFO A;  4ENN A;  4HZF A;  1S5L C;  2VXD A;  3R0A A;  1AKH A;  4PGH A;  2BW3 A;  1EH8 A;  3Q0V A;  1STZ A;  3IWZ A;  4L5I A;  2JUC A;  1VF9 A;  4PK4 A;  2BVM A;  2GA2 A;  3F8F A;  3H5R A;  3HOS A;  2CRG A;  2KL4 A;  4GDF A;  1QVT A;  3COL A;  4JYK A;  4IHV A;  1A6Q A;  3FHZ A;  2B9S A;  5EZG A;  4XIC A;  5BPI A;  1T0F C;  4CZZ A;  1XD7 A;  4JBA A;  4P9F A;  2J5O A;  4AIK A;  3HB9 A;  5CVU A;  2FML A;  3OYG A;  4BE2 A;  5FLX K;  3CCU I;  3HOT A;  1T98 A;  2DOE A;  3BR6 A;  5JVT A;  2W00 A;  5GTI C;  2EIL H;  3L09 A;  5FRO A;  1Y0U A;  2M4G A;  3SYT A;  2E2I J;  2VL8 A;  2K9Q A;  1RI7 A;  1S72 I;  4EQQ A;  4BHC A;  4EJT A;  5E1W A;  3QPS A;  4DJA A;  2XF6 A;  3QOE A;  2NXN B;  3E5X A;  4KUM A;  4HKU A;  2QYO A;  1B8I B;  2XGD A;  1ORK A;  3D0S A;  1XN7 A;  4A69 C;  1K6O A;  1L0O C;  3OIO A;  3R61 A;  4LB5 A;  2RN7 A;  1UG2 A;  4P96 A;  2CW0 F;  2O03 A;  4B44 A;  3I59 B;  4KMU X;  4RGX A;  1XMK A;  3I55 I;  2HPI A;  3KZY A;  1XSX A;  1WVR A;  1BR4 A;  3KZI C;  2RAE A;  1WI9 A;  2MC4 A;  2FX0 A;  4XM3 A;  3A01 A;  3LFU A;  1ZGJ A;  5K58 A;  2A05 A;  2VQH A;  3CCL I;  1ZKG A;  2CQX A;  3WGI A;  2ZME C;  2IA1 A;  3WG9 A;  1E0E A;  4KFC A;  5IT9 K;  4NC8 A;  4F55 A;  1VQL I;  2XKP A;  5JI6 A;  4GGG A;  1X58 A;  4NBQ A;  2VT2 A;  4ENM A;  1FP2 A;  1SVO A;  2XRN A;  4PZJ A;  2FD5 A;  1SAU A;  4A6E A;  2LFB A;  1W7P B;  1MBE A;  2REK A;  2DN0 A;  3QAH A;  1S3J A;  4B09 A;  3N97 A;  3ON2 A;  4GCK A;  2HZD A;  4KIG A;  2EFW A;  3RPU A;  4KA4 A;  5B3S H;  4G94 A;  3PFY A;  3PAS A;  3GEZ A;  3CJT B;  1SVL A;  2A6H F;  5D6F A;  2RAS A;  2DMT A;  2A3S A;  1X4P A;  1K83 J;  2DT7 B;  1LEB A;  1A35 A;  3F9K A;  1F36 A;  5JVG F;  5LGN A;  2AXL A;  3CJN A;  5L3C A;  2QTQ A;  2WB1 A;  1WKM A;  2RV8 A;  5EGO A;  5JLX A;  3OWT A;  1VZ0 A;  2RHA A;  3OL4 A;  4ZC3 A;  3JRC A;  1RC9 A;  1MMA A;  3HEF A;  3HTI A;  2X6O A;  1HOM A;  3ECO A;  1FT9 A;  1ACI A;  3HOW J;  1HSJ A;  3U21 A;  4E7I A;  2X1E A;  1YX5 A;  5GTH C;  2F48 A;  3IKT A;  3GX4 X;  3DLA A;  3S1N J;  1XCB A;  1Z05 A;  2V7F A;  4BKX A;  4UV9 A;  2PFV A;  1XMA A;  5GPA A;  3GCM A;  1IRF A;  3TKY A;  3W2V A;  4DGW B;  4CCJ A;  4Y52 J;  2ZME B;  3HJE A;  1X3U A;  3TW7 A;  3BDD A;  4EJO A;  1P2F A;  2QF7 A;  3TP3 A;  2AQF A;  2FUG 2;  3N05 A;  3H35 A;  4B1R A;  1D1C A;  1XSD A;  2KIU A;  4AVP A;  1YFH A;  3EUH C;  4YEJ A;  1GDT A;  2LK2 A;  2GXB A;  1S7O A;  3E7Q A;  2LP0 A;  2R7S A;  3TO7 A;  3NNR A;  1ETX A;  2CG4 A;  2MD0 A;  1TWA J;  1D5V A;  1T39 A;  3TOA A;  3LSJ A;  2CFO A;  5DM6 F;  1BI1 A;  1OJL A;  1WH5 A;  5D5W B;  3VW0 A;  1PVE A;  1P6R A;  3PIO F;  3KEO A;  4F7Z A;  2LTP A;  2M34 A;  4I6Z A;  3OYL A;  2V9K A;  4U7B A;  1D5Y A;  1GT0 C;  2M8G X;  4LK1 F;  2ZO4 A;  2KRC A;  3Q5F A;  2BY2 A;  1Z77 A;  2DA1 A;  1P4A A;  1O3T A;  4IF4 A;  3D5R C;  5ERI A;  1HBX G;  1ZG5 A;  1P4W A;  2P81 A;  1GVJ A;  1FZP B;  4BY7 J;  2STT A;  3PO2 J;  2IW5 A;  2GFN A;  4FX4 A;  2FMY A;  2F2E A;  4OAZ A;  3PNY A;  3WE2 A;  5FLV A;  2JT1 A;  2QZ8 A;  2XHK A;  3CTA A;  3EGQ A;  2LDU A;  2NVY J;  3VVX A;  2V1X A;  5ILV A;  4XRS A;  1YJN I;  2E7W A;  2VN2 A;  2HQA A;  2CSO A;  2M7A A;  2NYX A;  5C4X J;  2QLZ A;  5B66 C;  2CUE A;  3ZCO A;  1Z0X A;  1IJW C;  3KEQ A;  2DAO A;  3VB2 A;  4HNU A;  1MND A;  1FLI A;  2LY2 A;  1MIJ A;  3VFZ A;  2DA7 A;  4LD5 A;  2F5F A;  5ICC A;  2VPL A;  5ILU A;  3A01 B;  4EMS A;  3CP2 A;  2DFE A;  2HDD A;  4U87 A;  2JMW A;  1KYZ A;  1F5T A;  2M0C A;  4CZC A;  3V6G A;  3ERM A;  1WI3 A;  3JSP A;  2W85 A;  2XKO A;  3CLO A;  3HSE A;  3KP2 A;  2ECC A;  1HDD C;  5CPR B;  2GZW A;  2ME0 A;  1OR7 A;  3L2C A;  1IUF A;  4ZYD A;  1IW7 F;  2IJL A;  3KYC B;  3FDY A;  3BTJ A;  4DVY P;  4EV0 A;  1E3O C;  4QLC U;  2ZB9 A;  2P6S A;  2E2J J;  5L3B A;  1Z9C A;  1CF7 A;  2DFI A;  1FSH A;  1FBQ A;  4BJ6 C;  2LKP A;  2X6W A;  1TL8 A;  1HLV A;  5HLH A;  2PJR B;  1I3Q J;  3BG3 A;  1LVK A;  5J40 A;  3G73 A;  1YTY A;  3K2Z A;  1D8K A;  1YO5 C;  2H09 A;  1FY7 A;  5D6E A;  4HLX A;  3HOX J;  3HOU J;  3AG2 H;  3CMM A;  2K02 A;  1HF0 A;  4FET A;  2GEN A;  4A12 A;  5FKN A;  4F92 B;  3KE2 A;  1UCR A;  4II2 A;  4X1E A;  5H2F C;  3CCE I;  5L3F A;  1FBS A;  1HW5 A;  3QPT A;  4YRV A;  3RJP A;  1BR2 A;  4J19 A;  2Y75 A;  3F23 A;  2DA2 A;  2DG8 A;  1J0R A;  2K9M A;  3ZMD A;  3E6D A;  1ZG1 A;  1KA8 A;  4AU7 A;  4HF0 A;  5DUI A;  3KET A;  4HX8 A;  4W1U A;  3ASN H;  5K7H A;  1OYW A;  2ZCW A;  3I71 A;  3DEU A;  4HF1 A;  3DPT A;  3OYF A;  3CCY A;  1NH3 A;  2HOA A;  2O3F A;  4RS8 A;  1AHD P;  3WTX C;  3CO7 C;  2IPQ X;  4L9J A;  2Z2S B;  4C3H J;  2M8E A;  5CVV A;  3JRA A;  5CXI A;  4OMZ A;  4OOI A;  3SWH A;  4OD5 A;  1RIO H;  2OQR A;  4IRI A;  2HWV A;  3ZMV A;  5D4S A;  4ESB A;  2E1N A;  3HL2 A;  1HW1 A;  2GXA A;  2F4M B;  2RRE A;  1K6Y A;  5KK1 A;  2PBX A;  2JPC A;  4ESJ A;  2M0M A;  4AF5 A;  4Z2Y A;  5JR3 A;  2MLK A;  1K61 A;  4BH9 A;  1XC5 A;  1N77 A;  2GQQ A;  3KPH A;  4U9L A;  3ELK A;  3P5J A;  4Q4Z F;  5JHU A;  1H9G A;  1N25 A;  4WXC A;  2K5C A;  1K4T A;  2MYS A;  3H92 A;  3ZPL A;  1NG7 A;  1SEU A;  2K4J A;  2DYS H;  2CV1 A;  2VOP A;  4ZYA A;  3CWR A;  2KJC A;  2R7R A;  2D5V A;  3HOZ J;  1RES A;  4A2U A;  1X1D A;  5EEG A;  5LGT A;  3RKX A;  3Q3S A;  1RKW A;  3HTU A;  1K78 A;  2OF7 A;  1O57 A;  5FKK A;  3BQZ A;  1K79 A;  3ZQG A;  1R1V A;  1ZTR A;  1U5T B;  3LWJ A;  5HOD A;  2WUI A;  3CMA I;  4M72 A;  1FOW A;  1IG7 A;  5EYR A;  1VQ9 I;  4A3J J;  3KZZ A;  3MKZ A;  3HPG A;  1BC8 C;  3V4G A;  3H3V K;  1R7J A;  1KU7 A;  1EV7 A;  2QSG X;  3K69 A;  3CZ6 A;  2E36 A;  5E20 A;  2X0L A;  4RAG A;  3F21 A;  1DDN A;  4XMY A;  4M3F A;  2DOD A;  4IO9 F;  3ZQC A;  2XPV A;  2ZY9 A;  4RDU A;  1LEA A;  2OI8 A;  5K5Q A;  4HAM A;  1W7P D;  4Q47 A;  2IGM A;  2NRA C;  4ZZD A;  3S16 J;  4G7O F;  3DKW A;  1SD7 A;  2HYG D;  3C18 A;  5BS6 A;  2PJP A;  1FEX A;  2KLO A;  2NS0 A;  2HNH A;  3UR3 C;  3ZRG A;  1P7I A;  4FAS D;  5HDK A;  3SFI A;  5DM7 F;  3CME I;  4UUS A;  2W1O A;  2WTE A;  2XGX A;  4NUB A;  4JNN A;  4KT6 A;  3ZMU A;  3ONQ A;  4OIP F;  1D8J A;  4BQO A;  1QNT A;  5FD5 A;  4L0Y B;  1OCZ H;  1ZRE A;  1R5I D;  3NAR A;  1PJR A;  2VJ4 A;  3LMM A;  5FKM A;  5EGO B;  2IRF G;  2Q8K A;  4JX6 A;  5F27 A;  3JRD A;  2OA4 A;  2DQR A;  1XGO A;  1QVU A;  3FHN A;  4C9Y A;  1ZGA A;  4KN4 X;  4L5E A;  3ML6 A;  5IY5 H;  1QA6 A;  3BQY A;  4LLL A;  3S15 J;  1W1W E;  3HRU A;  1HDP A;  3BG9 A;  3KP6 A;  2EV6 A;  2M1B A;  5IYC J;  5M5Y J;  2W53 A;  1J2X A;  4UHT A;  5E1X A;  3VW2 A;  4O3M A;  4LFU A;  5CVJ A;  1BJZ A;  4LG0 A;  5M3M J;  2KIQ A;  3AKZ A;  5F64 A;  1I6X A;  3OIP A;  3LNQ A;  3LWF A;  1R58 A;  2XAF A;  3HDD A;  4ZJZ A;  2X1D A;  3VYU B;  1LNW A;  4ICH A;  4M3B A;  3L2W A;  3GZN B;  5E3L A;  5D1R A;  2ID3 A;  1MSE C;  3O6B B;  4PJL A;  1JKO C;  1J9I A;  1F43 A;  2BW3 B;  4AYB N;  3F8M A;  1MBJ A;  4UVB A;  4MNU A;  3DXJ F;  3OMY A;  2QQ8 A;  1TQP A;  1ON1 A;  2XC7 A;  2OUM A;  2DLL A;  4U0V A;  4OWR B;  4WF2 A;  2KT0 A;  5E3M A;  2LD5 A;  2GIZ A;  2IGK A;  2XRL A;  3SHF A;  4GRI A;  3W6V A;  2PZ9 A;  1RKT A;  3M8J A;  2EZH A;  3JTG A;  1T2K A;  3BG5 A;  3K4N A;  3P9I A;  3D5S C;  1YG2 A;  3G1O A;  3OS2 A;  3OL3 A;  3WHC A;  4ABZ A;  3LFK A;  3W6J B;  1DU6 A;  4KDP A;  1FMV A;  1ETK A;  2VON A;  1MDM B;  3M1E A;  3CMY A;  3TGN A;  2ZOZ A;  3VTI A;  4KNY A;  2CW7 A;  1T08 B;  4XLE A;  2KDZ A;  1OCP A;  5B1A H;  4LMY A;  1PUF A;  3RD3 A;  2ZSH B;  2VI6 A;  5E18 F;  4WCG A;  2ZKZ A;  2CJJ A;  2BEO A;  1TQI A;  3GXO A;  2HZT A;  1Z7L A;  4NC7 A;  4CCO A;  1X1B A;  5ICE A;  5LRR A;  3DEW A;  5B1B H;  5A2Q K;  4ZYE A;  1Z67 A;  3MFK A;  5D19 A;  1W4M A;  1TWC J;  4U7D A;  4B4C A;  4ZYH A;  2FBI A;  3QOP A;  2VKD A;  5H9T A;  4LLN A;  5DYM A;  4LIU A;  1X1P A;  5D8L B;  2NP5 A;  1HA8 A;  4HQM A;  3VIB A;  3I58 A;  3F72 A;  4DYQ A;  2HYF A;  3I3L A;  4BYY A;  4KJZ A;  1X19 A;  3RIR A;  3E5U A;  5D5X B;  2IS6 A;  2KZG A;  5AIQ A;  2L2O A;  1YQA A;  1U5T C;  1ETW A;  1R49 A;  3K70 D;  2RDP A;  3D5L A;  4ANJ A;  1XGN A;  3RPQ A;  3WTY C;  4G6Q A;  3GLX A;  3QPL A;  4GCL A;  1MJ9 A;  4D7N A;  3ZMT A;  4UY8 I;  1G6N A;  1Z6T A;  3ZP5 A;  2PG4 A;  3MN2 A;  5J4V A;  3OYB A;  5H6R A;  3DPU A;  2R7Q A;  5CVI A;  1SFE A;  5HBU A;  2KQR A;  3BJO A;  4C3J J;  4ZTF A;  1UI6 A;  4P55 A;  3OYJ A;  4UUS B;  3PL8 A;  3RH2 A;  4MQ9 F;  2A5Y B;  2KMU A;  2LBF A;  1JTY A;  2I10 A;  3K4M A;  4E6K G;  2HR3 A;  4E7H A;  4AVZ A;  2JA7 J;  1G3S A;  2JRT A;  4MGR A;  2ISZ A;  5BQT A;  3Q0U A;  3BY6 A;  4XON A;  1EF4 A;  4HQE A;  3BRO A;  2G0E A;  2PX9 A;  3LA2 A;  1V4R A;  2EZK A;  3DFG A;  3CP8 A;  5FMP A;  1LVA A;  2FRH A;  3P9K A;  1HXD A;  3K70 C;  2GAU A;  2ZCM A;  4RA2 A;  2IS2 A;  3HKZ A;  1ZLK A;  2KP6 A;  2QWW A;  4A3D J;  3K0L A;  3NAU A;  4F3Q A;  3L1P A;  3VOD A;  5BOX A;  2WWY A;  1WCM J;  5FFX A;  2WAQ N;  4IHT A;  3J7A Y;  1WPK A;  3ZQQ A;  1BIA A;  4QTR A;  2DMU A;  1W5T A;  3G4S I;  2EFQ A;  3NQO A;  2NP3 A;  2COM A;  1M1E B;  4GFB A;  2O8X A;  4AIH A;  3QYF A;  1FIA A;  3GVA A;  4HF2 A;  3AL0 B;  3BNI A;  4R1H A;  4CHU A;  1FOY A;  2HU9 A;  3S1Q J;  1VQ8 I;  2VBY A;  1EH7 A;  3NI7 A;  2L4A A;  5DCF A;  3HOV J;  2R7W A;  2RGV A;  3SEZ A;  4P9U A;  3BJ6 A;  4TV7 A;  3GTK J;  3HE0 A;  4A3L J;  3PSF A;  3GTO J;  2H1K A;  4BJT A;  2V26 A;  3ERE D;  3V7R A;  5KVR A;  4L5J A;  3KNW A;  1JT0 A;  1KU9 A;  4RLF A;  1MD0 A;  5KNL A;  1JGG A;  4IRV A;  1WSU A;  2JA2 A;  1UEL B;  3DKY A;  1R1T A;  2YSR A;  4MTE A;  1VTN C;  3AG1 H;  1HST A;  4XNF A;  2WA0 A;  2R92 J;  3L9F A;  3T5X A;  2IP2 A;  2ID6 A;  2GA1 A;  2R7F A;  3VPR A;  2EQR A;  1XDS A;  3ABM H;  2P5V A;  4YIR X;  2HTJ A;  4PFO A;  3DP7 A;  2DDA A;  2PQ8 A;  1B6A A;  2VB6 A;  3NEU A;  4M9Z A;  4BBR J;  4E70 A;  2FOK A;  2AXT C;  4H4K C;  1G3T A;  2DMN A;  3CJR B;  1VND A;  3CF2 A;  1ZH5 A;  1KU2 A;  2QEN A;  2VC1 A;  1R4N B;  4JKZ A;  2LY1 A;  5LEK A;  3BCG A;  5CVR A;  4M6Y A;  3ZQL A;  2V1D A;  3DKX A;  4XLA A;  1SFK A;  4XL9 A;  2R7T A;  3RKW A;  3E6C C;  2E1O A;  4A0Z A;  1B8I A;  4OD4 A;  2QQB A;  4A93 J;  2Q1Z B;  3T8R A;  3G1L A;  4HPQ A;  3RPU D;  3W2W A;  4EJU A;  1WJB A;  5J8C A;  2E5N A;  3OYE A;  3B02 A;  1GUU A;  5D8K B;  3VWB A;  3ANP A;  3IKV A;  1ZAO A;  1QGP A;  3ROU A;  1WJF A;  3TOB A;  2GUH A;  2QKO A;  3LA7 A;  3TL4 X;  1TW2 A;  3MEX A;  3N4M A;  2UXU A;  3M9A A;  1BJA A;  5EFY A;  2QGU A;  3BJB A;  4GCT A;  2G7L A;  2Y9Y A;  1DP7 P;  3K1P A;  2WBM A;  4IZZ A;  2X9D A;  2H6B A;  3O8G A;  4KIF A;  3BR5 A;  2VOO A;  2L9R A;  4BHP A;  2Q24 A;  4QWQ A;  1S29 A;  4UVC A;  1CF7 B;  3C2B A;  3IUV A;  1WH7 A;  3H3Z A;  3S93 A;  1UAA A;  4HRI A;  2O7T A;  4ZH4 F;  3BZK A;  1XSV A;  4XRF A;  2ETH A;  3CCV I;  2XF7 A;  2R7O A;  2ZXI A;  1BL0 A;  1YJW I;  5CLS A;  4XN3 A;  5LHH A;  2NVT J;  2HOS A;  4L62 A;  1ZLJ A;  4XRS G;  4XLF A;  1IXS B;  2M5W A;  4QSH A;  1ZHF A;  1KON A;  3K1M A;  2KJB A;  3JRI A;  1F9N A;  2F4I A;  3LOC A;  3OYA A;  2OER A;  3ABT A;  2LF7 A;  3EUK L;  3FXL A;  3HG9 A;  1LUJ B;  3FZV A;  2HOT A;  5M5W J;  3GFI A;  5JHF A;  2CUF A;  3A02 A;  3AG4 H;  2CUJ A;  2M9H A;  2UXO A;  3CC7 I;  1FMW A;  3B6A A;  3UKG A;  3LST A;  5FGM A;  5L3E A;  3DPL C;  4FE7 A;  1U8B A;  5F1J A;  3CLQ A;  5CW8 A;  2I5U A;  1C0W A;  3GTJ J;  4IVN A;  3F1B A;  1ETQ A;  3CES A;  1SMY F;  1RRJ A;  2BVL A;  1KQ8 A;  3VOK A;  3G2B A;  2XPU A;  3KEY A;  3OOU A;  2LRE A;  1Y1V J;  3CUQ C;  2K9S A;  2DMP A;  4BEH A;  1SFO J;  4Q5S F;  5BNG A;  2Z99 A;  3WGG A;  2TDX A;  1OCO H;  1E3H A;  3MNL A;  5FO5 A;  1TC3 C;  3C2G A;  1RR8 C;  3VW1 A;  3I54 A;  5FLM J;  2ZFW A;  1XX5 A;  1ON2 A;  5F1R A;  3I9V 2;  4S0H B;  5M5X J;  3FXO A;  3WG7 H;  2F5D A;  1TNS A;  5L3D A;  4NHJ A;  4G7H F;  2ZC2 A;  2CQ7 A;  4L9T A;  4XKV A;  3CF5 F;  2KZV A;  3LSH A;  5HAW A;  1X2N A;  3ABU A;  3O60 A;  4M3E A;  2BXZ A;  2GIV A;  3K4C A;  1LFP A;  4C2M A;  2HQN A;  3HSR A;  2ADU A;  3WHB A;  1RUO A;  5LBQ A;  3OR1 C;  2DQL A;  2LY9 A;  4IHS A;  3KP3 A;  3TO9 A;  2PMH A;  2DA4 A;  5E79 C;  2M45 A;  3OYC A;  2OCC H;  3EDP A;  5LGU A;  4CCL A;  5GAE J;  2YX7 A;  2K3F A;  4XLC A;  5IYB J;  1R22 A;  3HTS B;  1LDD A;  4HV5 A;  5EG0 B;  2DJN A;  5ICG A;  1DU0 A;  4LG0 B;  2A5W A;  2QOP A;  3NRG A;  1BN5 A;  3JW4 A;  3W6K B;  5LLQ A;  1EH6 A;  4X0G A;  1W36 C;  3EYI A;  4F93 B;  2O5R A;  1B9M A;  4V2G A;  4JOM A;  4A3B J;  3HOY J;  5HOO A;  3JSO A;  2IAI A;  1QO0 D;  2XGC A;  2A69 F;  1BI3 A;  1MSF C;  4NQW A;  2EFP A;  1YIJ I;  4YFN F;  2BHZ A;  1O4X A;  2EA4 A;  3VSK A;  2IA0 A;  2JVH A;  2KRF A;  3HTA A;  2VIX A;  2EIN H;  3MWM A;  4M71 A;  1YRN A;  2WY8 Q;  3ZGK A;  1OYI A;  1IRX A;  2QVO A;  1S8N A;  3GZ5 A;  2LF8 A;  2IEK A;  3IUO A;  4UUV A;  2AO9 A;  4PCQ A;  2WC2 A;  2F5V A;  3DPJ A;  3LSP A;  3WTU C;  1Z1D A;  4MK6 A;  1Z6R A;  1ZEL A;  3TBI A;  2DA5 A;  2XB5 A;  1IRG A;  2EZI A;  4A3F J;  1TWG J;  4N4N B;  3JTH A;  4PJ0 C;  4BE0 A;  2MC3 A;  1OPC A;  3QYB A;  3SDG A;  1ENH A;  1YI2 I;  4P5O A;  1OCR H;  4KIB A;  3IRQ A;  3FMS A;  3HM5 A;  3HYI A;  2XVC A;  4ESF A;  2QKM B;  3SXY A;  3BOQ A;  2MFZ A;  4M6X A;  3SZG A;  4XLH A;  3BLY A;  1MH3 A;  1SFX A;  3SEQ A;  5J4Y A;  2DJI A;  2MA3 A;  3EUP A;  2G9W A;  2UXN A;  1WHU A;  1SAX A;  4ZDO A;  4A5N A;  4ZYG A;  1P9Q C;  3P7N A;  4KIC A;  3PFI A;  4IL6 C;  4MHG A;  1GHC A;  1ZGW A;  4NN1 A;  1MMG A;  4HX4 A;  1Z21 A;  5J3L A;  3A0H C;  3LAP A;  2VUM J;  3FRQ A;  2H8W A;  5FLX Z;  4HLY A;  4FX0 A;  1X4O A;  3VEP A;  2Y30 A;  3AQS A;  4H0E A;  2VPR A;  2ZNY A;  1N78 A;  3KFW X;  3MMY B;  2HOE A;  2QQ9 A;  3H0G J;  2DTR A;  4E7J A;  2RQP A;  3FXR A;  3QBM A;  3OYH A;  1BC7 C;  4JL3 A;  2QUF A;  3BRU A;  3ABL H;  1ETV A;  4L18 B;  4OIR F;  1W5C C;  4FE4 A;  2XV4 S;  5HDN A;  3TDZ C;  3KLO A;  2KPM A;  1ONV A;  1VQ7 I;  2H6C A;  3CCJ I;  5E17 F;  1D0Y A;  4BAY A;  5JFR A;  1U2W A;  4XN0 A;  4C2T A;  1YIT I;  4BJ5 C;  1Y39 A;  3CDH A;  3ZMS A;  2HDW A;  2J5P A;  2O0Y A;  4HEA 2;  5CXG A;  1JJ8 C;  2FA5 A;  3CUQ B;  1KQ9 A;  1T6S A;  3KYL A;  4M73 A;  1GXQ A;  4P1W A;  3RI4 A;  2H94 A;  3VYR B;  5LD2 C;  2DG7 A;  1W36 D;  4E7S A;  3OSF A;  3FF5 A;  2ZJ2 A;  3OS1 A;  2CV2 A;  1B1B A;  1YX3 A;  2UUZ A;  2PJR A;  3WOD F;  1BOA A;  1MNE A;  1APL C;  1A5J A;  2IS1 A;  1R5H A;  1UMQ A;  4HOB A;  3E97 A;  2LBF B;  4OIQ F;  5EDN A;  1W0T A;  1Q1V A;  1JGS A;  2X48 A;  2R0Q C;  4AYB A;  3HSF A;  3I4N J;  3WTT C;  1S9H A;  2L4M A;  3AG3 H;  3AL0 C;  2E34 A;  1V5E A;  4HW0 A;  4IX7 A;  4OIO F;  4LIT A;  2F07 A;  1O3Q A;  1POG A;  1KGS A;  3FK6 A;  4NB5 A;  1TNT A;  3FMQ A;  4UB8 C;  2W57 A;  5L3G A;  2BZT A;  4MO7 A;  1MMS A;  3R0J A;  5TGT A;  4KT5 C;  2MBF A;  1NHA A;  1SD6 A;  1YW9 A;  4F91 B;  4MFD A;  3G7R A;  5GP9 A;  1E2X A;  2A6E F;  1J59 A;  5GAH J;  2CH0 A;  4GCV A;  2FJI 1;  4BXU A;  3FWE A;  2XRO A;  2C6Y A;  3HHG A;  4ZDP A;  2HVS A;  4O6J A;  3F0C A;  2CS3 A;  3HGG A;  3BTI A;  1RPW A;  4BEH B;  2DCE A;  3LSI A;  2VXZ A;  1T0F A;  2EB7 A;  2HXI A;  2QSF X;  2X4H A;  2X51 A;  3OYM A;  2X85 A;  2XAU A;  1U3E M;  4UNO A;  3GTL J;  2BOL A;  3JRE A;  4BL0 B;  4I09 A;  2DT6 A;  5HLI A;  2KKO A;  1D1B A;  1PUF B;  4ZTJ A;  9ANT A;  3WU1 B;  2V6C A;  1LKX A;  1CGP A;  4A6D A;  3RTR A;  4ZDL A;  3S2D J;  2V9V A;  1JKQ C;  3A1Y A;  2HYT A;  3PM1 A;  1JI8 A;  2DT5 A;  4DNC A;  1A31 A;  2E1C A;  1QRY A;  3E6M A;  4FCY A;  2A68 F;  4CUG A;  1U5T A;  1W5S A;  3ULQ B;  2R5Z A;  2LMD A;  2NOJ B;  2OAZ A;  1ZQ3 P;  2B3W A;  4Y3O A;  2CV0 A;  3UNG C;  3CUO A;  3J81 Z;  3IC7 A;  2FSW A;  3GZ6 A;  1ETY A;  2FE3 A;  1X3Z B;  3C7J A;  4D9J A;  5HVQ C;  5KAF C;  3IP4 B;  2EIM H;  2DPU A;  2NVQ J;  1XDU A;  1YS6 A;  1JUS A;  1ZN2 A;  4XK4 A;  2A07 F;  2XAQ A;  2RVC A;  1LPQ A;  5J6X A;  1G8X A;  2GLO A;  3K4J A;  1QZY A;  3OOP A;  1JKP C;  2L9V A;  4RB2 C;  5E3O A;  1AOY A;  3MKW B;  4JP0 A;  1UZC A;  3JCU C;  3QU6 A;  5AQC A;  1BIB A;  3QOD A;  1PP7 U;  1XGS A;  3HRT A;  2G3B A;  1FSE A;  2PN6 A;  3TDU C;  3M3Y J;  1Z3Y A;  5IP6 A;  1TT5 B;  5J8F A;  1Y8Q B;  4ZZL A;  2EH3 A;  2DU9 A;  3K6G A;  3CJQ B;  2R7U A;  3S2H J;  5FFZ A;  1XG1 A;  2O9L A;  2IU5 A;  1WZ2 A;  4XOP A;  3PPB A;  4B47 A;  1WQ2 A;  4EAT A;  2E2H J;  3GTP J;  3L2U A;  5IT3 A;  2L5Q A;  4XRM A;  1LDK B;  2XUB A;  3CUQ A;  3DU6 A;  4XKW A;  1IN4 A;  2FNA A;  3LA3 A;  3W3C A;  1TWF J;  5EZH A;  1I27 A;  1R1U A;  2MGQ A;  4KN7 X;  1BM9 A;  3J7Y J;  2BGC A;  1U78 A;  3CQZ J;  3MAJ A;  3PUB A;  3VSL A;  1Y0N A;  2XAJ A;  2DK8 A;  2ICW G;  4LGW A;  1OCT C;  1HQC A;  3HIF A;  2HPM A;  2LH9 A;  4Y4R A;  2WAF A;  3M8F A;  4WX9 A;  3I64 A;  4E7K A;  5F6F A;  1O3R A;  3RYR A;  2ELH A;  4GXO A;  2OPT A;  4MFE A;  5F0H A;  1RET A;  1XGM A;  2BV6 A;  4RB1 A;  1BI2 A;  3A0B C;  4GO1 A;  1YOV B;  2FJ1 A;  4MTD A;  3L7W A;  3LSR A;  4B48 A;  2ZXJ A;  1RNL A;  2BE5 F;  3LQQ A;  5BMZ A;  3H36 A;  3IH4 A;  4JQF A;  4UDS A;  1YJ9 I;  4A3G J;  3RZD J;  2ISY A;  1DPU A;  2FBQ A;  3TP0 A;  1DP3 A;  3C07 A;  2M87 A;  3HUG B;  3GTG J;  4YFX F;  2JPB A;  3ZMZ A;  1LE8 A;  4I0B A;  3IV5 A;  2NVX J;  3DWL E;  3K7A J;  3S3O A;  4JX5 A;  5IP9 J;  2H8R A;  3IHU A;  1OCC H;  3HIM A;  2ZSI B;  2Z16 A;  1HC8 A;  2CWE A;  4PJN A;  2Y0S A;  2Y0M A;  4C2U A;  3KP7 A;  4DQ2 A;  4I01 A;  2XSD C;  2Y0S N;  4J00 A;  2D45 A;  2W24 A;  2M3A A;  4FQG A;  2DI3 A;  2LR8 A;  4DOZ A;  3OSG A;  4BDZ A;  3FXJ A;  4D5F A;  3S17 J;  2CQN A;  4IHX A;  3JAM K;  3BPV A;  4Y15 A;  2DW4 A;  1U9O A;  2P8T A;  3BCA A;  2K7L A;  2P4W A;  3DU5 A;  3FIS A;  2FQ3 A;  1O7F A;  3V7S A;  4A3M J;  2STW A;  1HCR A;  5ED4 A;  5GPC A;  2GOM A;  1MBG A;  1Y8R B;  3ZQ7 A;  2JA6 J;  3K8P C;  3MKY B;  1MBH A;  3DCF A;  1LDJ A;  2Q0O A;  4XOT A;  2BBY A;  5J1R A;  1ZR4 A;  2KIM A;  1DGW Y;  3O3K A;  4N9H A;  1XS9 A;  2I8D A;  5IP7 J;  1HKS A;  3NRV A;  2JTV A;  3GFM A;  1LFU P;  3MZY A;  2MSY A;  3MZ8 A;  4WWC A;  1IN8 A;  5IOY A;  1L3L A;  5F0F A;  3OIQ A;  3HKZ N;  1WJE A;  2L9S A;  2HVQ A;  3NXC A;  2HQ5 A;  2LKS A;  3GYH X;  4A5M A;  2LC2 A;  3I56 I;  3E6B A;  1IO2 A;  4DYC A;  3J7A O;  3V7C A;  3H5N A;  4OMY A;  2HEO A;  4N4O B;  3L2Q A;  2Y48 A;  1AU7 A;  4IQ4 A;  4RM3 A;  1VQ6 I;  3U2R A;  2V1U A;  2MAB A;  2XIG A;  1ERD A;  2UXI A;  3BZ6 A;  2K85 A;  4AID A;  5TRD A;  3GF2 A;  4RAY A;  2RNJ A;  2R7V A;  3P9C A;  2DFH A;  4MLO A;  1OKR A;  2ELK A;  2ZCN A;  5DD8 A;  2GBY A;  1FYL A;  2OU2 A;  4XBF A;  3I5U A;  4LJZ F;  2ZNZ A;  1SD5 A;  1VFC A;  1BW5 A;  2ZOY A;  3E7L A;  4LOC A;  3VVZ A;  1NK2 P;  3BTL A;  3HUG A;  2TCT A;  1DUX C;  1MJB A;  2XAG A;  4PJM A;  4DW6 A;  4KYW A;  2P5K A;  4G8X A;  1R23 A;  1H9T A;  3RCO A;  2DA3 A;  1B9N A;  2Z3Y A;  3K9T A;  2RC4 A;  5LHG A;  3VVY A;  1WJA A;  4BY1 J;  1FTZ A;  1V54 H;  2E60 A;  3FIW A;  3JRG A;  3SFZ A;  3FKI J;  2D1V A;  3GFL A;  3REO A;  2L3D A;  1JHF A;  3E3V A;  2A61 A;  1PUE E;  2NS7 A;  3WTW C;  3QYE A;  2OV7 A;  2PBI A;  3PSI A;  3BZC A;  2HQR A;  2L7K A;  4XSZ F;  4IXA A;  5EEH A;  2ZJP F;  2YVE A;  4RB3 C;  3U9G A;  2A2F X;  4ENK A;  2O8K A;  3QU3 A;  2CMP A;  1P4X A;  3Q0W A;  4YII A;  4AM3 A;  2JK3 A;  4LLG F;  4GFK A;  3EUH A;  2L7F P;  3K4L A;  2ESN A;  2V9P A;  1A04 A;  4CCK A;  4DBQ A;  4CSW A;  5K7Z A;  2TRT A;  2V4J C;  1SFU A;  1VI0 A;  3S1R J;  5C4Y A;  1YE9 A;  3G71 I;  3RDI A;  1T38 A;  1T33 A;  1IUY A;  3ISP A;  2XAH A;  3CCR I;  1MMN A;  2HKX A;  4HV6 A;  3M07 A;  2O7O A;  4D5C A;  3CCS I;  2WV0 A;  3T1B A;  4NDL A;  2KDO A;  4RGS A;  1G2H A;  3MZH A;  2FF4 A;  2V1N A;  4IOC F;  2E7X A;  3KP4 A;  2K9N A;  2AS5 F;  2LSO A;  3C3W A;  3KLN A;  4D0P A;  2NX4 A;  3H9J A;  5HS8 A;  1GLN A;  2HFH A;  1AA7 A;  3K4B A;  2NVU B;  1G3Y A;  2DMQ A;  3HBL A;  5D5V B;  4A3I J;  2L54 A;  3KP5 A;  2H1L A;  4RAZ A;  2MW8 A;  1A36 A;  2B7E A;  1W0U A;  2BY3 A;  1GV2 A;  1SAN A;  4ME9 A;  2JZY A;  3KIO A;  3BR0 A;  1FTT A;  3JAM Z;  1ZG3 A;  3M8E A;  2EV5 A;  5CJ9 A;  4RGR A;  5IYD J;  3J7Z I;  4XQF A;  5JLW A;  2EZL A;  3BPX A;  3JRH A;  5C3E J;  2R5Y B;  3W2A A;  2K9L A;  4YZE A;  3QWL A;  2HVR A;  3OYN A;  3RKY A;  3E0J B;  1JUM A;  5D18 A;  3I59 A;  3WU0 A;  3T8T A;  3QPH A;  5IPA A;  1IGN A;  3U1D A;  2Z9O A;  1ZRF A;  1CQT A;  2X1C A;  2JRM A;  4MEY F;  1V5G A;  2AQE A;  4HST A;  2DA6 A;  3CO6 C;  3EYY A;  1PDN C;  2R5Z B;  3BP8 A;  1QPI A;  3B81 A;  2DK5 A;  3WTZ A;  5AIP A;  2PMZ A;  2UXX A;  2DBB A;  2CW8 A;  4BE1 A;  1FBU A;  2D2W A;  1IC8 A;  5H6Q A;  1D3Y A;  4HG2 A;  4OAY A;  4S05 A;  2RKH A;  1FOK A;  1YIO A;  4PFP A;  2JSC A;  5ICF A;  3ZN1 A;  3OYD A;  1E17 A;  2GXG A;  1JJ6 C;  2ZCX A;  2N8G A;  2BY1 A;  1MZB A;  1R5G A;  4D1Q A;  2W25 A;  1RR7 A;  3LQR A;  2WAD A;  1ZRC A;  3GZI A;  5DCM B;  1QU3 A;  2VKV A;  2YPR A;  2X6Y A;  2L9N A;  4F52 A;  5K5R A;  4G6T B;  2OTL I;  1JTX A;  1OLT A;  4HBL A;  4I2O A;  1FX7 A;  1JUP A;  4C3I J;  2VBZ A;  5HDG A;  2BHY A;  4E7Z A;  4WXH A;  1VQK I;  3OS0 A;  4X6A J;  4HNV A;  3FKJ A;  4BBS J;  1E3P A;  1I1G A;  2VBX A;  1TQM A;  4ASN A;  5J1Y A;  1B72 B;  3U1K A;  2ZFU A;  1Y56 A;  1HKQ A;  1D0X A;  3ZN0 A;  5E3N A;  2Z1D A;  2GOX B;  5ILS A;  2P7C B;  4IPA A;  1Y1W J;  3CCM I;  2K3P A;  1QHG A;  1XB4 A;  1ETO A;  1K4S A;  1TBX A;  3CJD A;  4D7M A;  4AC6 A;  4QIW N;  1Q1H A;  4XLP F;  1MJA A;  1JT6 A;  3GTQ J;  4XOR A;  1MBF A;  2BY0 A;  3ESW B;  3QQA A;  5FKO A;  5LHI A;  5DS9 A;  2FEZ A;  1H8A C;  2IGO A;  1UI5 A;  3LSK A;  2CQQ A;  4U88 A;  5FKL A;  1R4M B;  3J80 Z;  1VQO I;  3M4O J;  2KRH A;  3DTI A;  1LJ9 A;  3GME A;  2ESH A;  5DV5 A;  3WTV C;  3KX2 A;  1XTA A;  2WAE A;  3OV8 A;  1X2M A;  3HZJ A;  1FYM A;  3T0Y A;  3BTC A;  1R00 A;  5CQE A;  3OR2 C;  4S04 A;  1FWZ A;  3G56 A;  2QSH X;  1H88 C;  2DOA A;  3RSN A;  1U0J A;  3OY9 A;  3SDB A;  1OYY A;  4PGG A;  5KAI C;  1IXC A;  5TJJ A;  2ME6 A;  1QHH D;  2HKO A;  2KFD A;  2OD5 A;  3RKQ A;  4LG3 A;  1ULY A;  2IVM A;  4A3K J;  3CDL A;  4JK1 X;  2CO5 A;  1VQ5 I;  2IGN A;  3H9G A;  1BBY A;  4I98 B;  3EET A;  3B73 A;  3PUF A;  4FIS A;  3QRF F;  1R9T J;  4OIN F;  1MH4 A;  5FRN A;  2W84 A;  2PFB A;  2XAS A;  3DF8 A;  1EA3 A;  2CU7 A;  5KHD A;  4RGU A;  1SMT A;  1JXS A;  3ANG A;  1H0M A;  4CCN A;  1X1C A;  4PJJ A;  1N75 A;  2V57 A;  4ON0 A;  3F8N A;  1SGM A;  3PQJ A;  4IOA F;  1NTC A;  2DDB A;  4HDU A;  2Y31 A;  2EWN A;  2MH9 A;  2G7G A;  2IXS A;  3H3U A;  1B72 A;  3MKL A;  1MW7 A;  2G7U A;  2H27 A;  2P7V B;  2YUS A;  3DBR B;  3CDI A;  4BHB A;  1KQ0 A;  4FHT A;  6PAX A;  1ITY A;  2D1H A;  2FU4 A;  2L0K A;  1F4K A;  2Y69 H;  4LIV A;  1KU3 A;  3MD2 A;  2JVG A;  2R3S A;  3EPZ A;  1HKT A;  4Y33 A;  1P92 A;  5J47 A;  1Z91 A;  3BJA A;  2NAZ A;  3L2V A;  2AHQ A;  4M9X A;  4UB6 C;  4YEL A;  2LG4 A;  2EV0 A;  4OU0 A;  4HYE A;  1MGT A;  1I1S A;  1NG6 A;  1IV6 A;  1BOB A;  2QCO A;  3FXK A;  5K1Y A;  4BQA A;  2XF5 A;  4IQJ A;  1J09 A;  5CYV A;  1WJD A;  2VQL A;  2LKX A;  3CD6 I;  3S2W A;  3F6O A;  4LK0 F;  3X2Q H;  3T6N A;  1EJ9 A;  3Q9S A;  2UXP A;  4DYR A;  4GYG A;  3K1N A;  1TLH B;  4B3A A;  4WIB A;  1AKH B;  1OMI A;  3F22 A;  3L2R A;  1OR7 C;  4CYC B;  4G9Y A;  4CCM A;  4I02 A;  2W7N A;  4EGY A;  4HX7 A;  2QWT A;  3BR3 A;  2E1M B;  3JRB A;  4U0Y A;  2MG4 A;  3S14 J;  1DPR A;  4EGZ A;  3ZQI A;  2VJJ A;  2W4S A;  3DBL B;  4HA8 A;  4RBO A;  4A3C J;  4Y7N J;  4BQN A;  2XDV A;  4CXF A;  1UHS A;  3NS4 A;  2JJ7 A;  3FBN B;  3C1D A;  4CDG A;  5HNF A;  4XID A;  2QM3 A;  3BG7 A;  1XMX A;  2B1E A;  4V2F A;  4BXX J;  2P0W A;  5F08 A;  2VE8 A;  3A03 A;  3QP5 A;  3IL2 A;  4BDY A;  2FOW A;  2Q2E A;  4I7H A;  4RAF A;  1ZAR A;  2ECB A;  4RM2 A;  3R4K A;  1DQU A;  3HPH A;  4RB0 A;  4L9V A;  3L00 A;  3OYI A;  1A6I A;  1OQY A;  4BU2 A;  3RZO J;  4UXN A;  2XGE A;  4XLN F;  2M7B A;  4I0A A;  4CIC A;  2LOO A;  2HDC A;  3TO6 A;  4BQQ A;  1FYK A;  3GBG A;  1B4A A;  2E35 A;  3WGH A;  4U9N A;  2W82 A;  3S8P A;  4AD9 A;  4BUP A;  2G7S A;  3H9Q A;  2JA8 J;  1VQP I;  4AWX B;  3V8J A;  3WE3 A;  2YVX A;  3VYS B;  1FNN A;  5D5U B;  5FRM A;  3HTH A;  3DBH B;  2FBH A;  4BXF A;  4AUX A;  1VQM I;  2VC0 A;  4KMF A;  4BS9 A;  4YFK F;  4IHY A;  1BA5 A;  3ON4 A;  1K7A A;  3O2P E;  2F6C A;  4CH7 A;  5D4R A;  3IAS 2;  3JSJ A;  3HXL A;  1EKE A;  2OZ6 A;  4FT8 A;  1YRN B;  2DPD A;  3A2K A;  3DTE A;  3I53 A;  1IDY A;  2BXY A;  2L7Z A;  2E19 A;  4U0W A;  2L7M P;  2QQA A;  3V78 A;  3VYT B;  1TT0 A;  2JQ7 A;  2VQC A;  2R4G A;  4JX4 A;  4M9S A;  5K7F A;  2R5Y A;  1ZR2 A;  1UHM A;  1WWX A;  1MNM C;  1IN5 A;  4I99 C;  1O3S A;  3HC7 A;  4Y17 A;  1V3F A;  1ODD A;  3F8B A;  3IRR A;  5FD6 A;  2HGC A;  3CC2 I;  2UZK A;  1TTY A;  2EFN A;  4DIQ A;  4EJW A;  4J01 A;  4WK8 F;  4Y13 A;  3FXQ A;  1J75 A;  2E5Z A;  4Z6Y A;  1LFB A;  1TZL A;  2QIB A;  3R6S A;  2MD5 A;  5E8I A;  1UJ8 A;  3DLL F;  3TQN A;  2LNB A;  2JSP A;  4IEJ A;  5DD4 A;  2HTS A;  2ZBK A;  4E4H A;  1ZRD A;  3NPI A;  3H5A A;  2EIJ H;  2VKH A;  4CGZ A;  3VUQ A;  2CQK A;  2GM4 A;  2PMZ N;  2Z33 A;  2K40 A;  3E1S A;  1IN6 A;  4G6D A;  2DFF A;  5HNH A;  4MEX F;  3GLL A;  4ACI A;  4CYC A;  4GFL A;  4LB6 B;  2ZXH A;  3AFH A;  3R60 A;  3LHQ A;  5C44 J;  2XPW A;  1VQ4 I;  4R79 A;  2PMU A;  4PUS A;  3PNT A;  3H0D A;  2FXA A;  1WGX A;  1U6G A;  4ENJ A;  1X3W B;  2VBW A;  5LRS A;  5EF6 A;  1Z3X A;  3VDX A;  1S6L A;  4EJV A;  1TP4 A;  1QZZ A;  5DTD A;  3FX3 A;  5IT9 Z;  4CO8 A;  2XB0 X;  3Q9V A;  2LRD A;  1H89 C;  1REP C;  1OFC X;  4XKB A;  3K10 A;  1D0Z A;  2YU9 J;  1U9N A;  4IKF A;  2EA2 A;  3DQV C;  2IT0 A;  2K4B A;  1QPM A;  3ZQH A;  4C30 A;  4G7Z F;  1SD4 A;  2CYY A;  3ASO H;  3WU2 C;  2GWR A;  2EIK H;  1ZK8 A;  3TED A;  2PLY A;  2JN6 A;  2XSJ C;  2P6T A;  3H1C A;  3JR9 A;  3B6C A;  2O61 A;  1PYV A;  3HTJ A;  1WJC A;  5CKT A;  1USS A;  5FHP A;  1NK3 P;  4M6V A;  4ITV A;  2LYC A;  1LQ1 A;  5FB2 A;  2VT3 A;  4DZP A;  4WXD A;  5TIS C;  3TMO A;  1IN7 A;  2OTJ I;  1RUN A;  2YVH A;  4G12 A;  4XSX F;  4BAC A;  1YYV A;  4NEL A;  1MBK A;  3KCC A;  5F0C A;  4HDV A;  4QPO A;  4YG2 F;  4C2M J;  1FJL A;  3S3N A;  2VOD A;  4FTH A;  1TW3 A;  3V8L A;  5KCM A;  1SVM A;  3O8H A;  4UVA A;  3F6V A;  2ZME A;  5EEA A;  4EM2 A;  2QBY B;  2UXH A;  2UV1 A;  4V19 K;  5J1U A;  1J5Y A;  1WFX A;  4BNC A;  4PSX A;  2RNG A;  4KIS A;  1T56 A;  3GO5 A;  1FP1 D;  2HYJ A;  5DCM A;  2DO7 A;  2JUG A;  4B3X A;  3IH3 A;  4A0Y A;  5FJ8 J;  3V42 A;  2ZXW H;  5AON A;  3EQL F;  2NNY A;  2R7Z J;  3CC4 I;  4EVI A;  1JHH A;  3AAF A;  2QA4 I;  5BPD A;  1G3W A;  3I4M J;  2L01 A;  5DDG A;  2YR2 A;  3HRM A;  2DXI A;  2YU3 A;  3BCB A;  1UST A;  3MCZ A;  3QP6 A;  5HLG A;  4Q48 A;  1GXP A;  3IAM 2;  3ZR8 X;  4DBR A;  3F8C A;  3RQI A;  2OJE D;  1R36 A;  4IRH A;  1FIP A;  3VOE A;  4ETS A;  1IV8 A;  5HS7 A;  2E71 A;  5FGL A;  2A6T A;  2IA2 A;  3S32 A;  2Z5U A;  3OYK A;  1WJ5 A;  1UB9 A;  4IJA A;  4N0B A;  1T95 A;  2MLG A;  3EUA A;  3CRJ A;  4AIJ A;  2FNP A;  1WRJ A;  4M3G A;  3BG6 A;  5DAJ A;  2WAQ A;  1MKM A;  3RYP A;  2R7D A;  2BYV E;  4NNJ A;  2HI3 A;  2K86 A;  3DEE A;  2UWM A;  2RQQ A;  2EK5 A;  1YW7 A;  2LVS A;  4KWA A;  1D1A A;  3ABK H;  3NWS A;  2M2E A; 
#chains in the Genus database with same CATH homology
 2DMQ A;  3HBL A;  3KKC A;  2IBD A;  4DZJ A;  4A3I J;  3GTM J;  2MW8 A;  3D1N I;  1JKR C;  1W0U A;  1GV2 A;  1SAN A;  5IYB J;  2PBX A;  4ME9 A;  2YS9 A;  5EG0 B;  5IOZ A;  2WGB A;  4AF5 A;  2DJN A;  1DU0 A;  3BR0 A;  1K61 A;  2VKE A;  2QOP A;  1FTT A;  1XC5 A;  3NRG A;  3MVP A;  5IYD J;  5JLW A;  3BHQ A;  2EZL A;  4V2G A;  3JRH A;  5C3E J;  2R5Y B;  4A3B J;  3HOY J;  3LJL A;  4YZE A;  3TW6 A;  3CWR A;  3SJM A;  3BT9 A;  2IAI A;  1JUM A;  2D5V A;  3HOZ J;  3JRF A;  5D18 A;  1RES A;  2XGC A;  1MSF C;  2LLK A;  2HXO A;  5IPA A;  3Q3S A;  1S7E A;  1RKW A;  1IGN A;  4I76 A;  1O4X A;  1CQT A;  2OF7 A;  3HTA A;  3P9T A;  5FKK A;  3BQZ A;  2DA6 A;  3IH2 A;  1YRN A;  3ZQG A;  2R5Z B;  1QPI A;  1ZTR A;  2DTZ A;  3B81 A;  3LWJ A;  5HOD A;  2IEK A;  2AO9 A;  2WUI A;  2B63 J;  3DPJ A;  3LSP A;  1IG7 A;  4MK6 A;  5EYR A;  1IC8 A;  4A3J J;  4UUT A;  2DA5 A;  2XB5 A;  3H3V K;  2EZI A;  3KZ9 A;  4MXM A;  4A3F J;  1TWG J;  3AQT A;  2EBI A;  3LSG A;  4MIM A;  1JJ6 C;  2ZCX A;  2N8G A;  3SDG A;  1ENH A;  2HKU A;  1RR7 A;  1IDZ A;  3VP5 A;  2FQ4 A;  1GV5 A;  4M3F A;  3HM5 A;  3GZI A;  4M3D A;  3ZQC A;  3G1M A;  1IRZ A;  2XPV A;  5EG0 A;  1I6H J;  2VKV A;  1MH3 A;  2JA5 J;  4RDU A;  3EUP A;  2OI8 A;  1JTX A;  3S16 J;  4W97 A;  1FEX A;  3GEU A;  1P7I A;  1JUP A;  2NS8 A;  1ZGW A;  4EEF G;  4C3I J;  3QKX A;  4NN1 A;  2VUM J;  5J3L A;  3KKD A;  3SFI A;  3FRQ A;  4X6A J;  4HNV A;  4BBS J;  4UUS A;  3S5R A;  3K2A A;  5J1Y A;  2Y30 A;  1B72 B;  3AQS A;  2R93 J;  2VPR A;  4JNN A;  3H0G J;  5E3N A;  1Y1W J;  3QBM A;  1ETO A;  4JL3 A;  3CJD A;  3BRU A;  4D7M A;  4AC6 A;  4QIW N;  3NAR A;  1ETV A;  1JT6 A;  3GTQ J;  1MBF A;  1GVD A;  2WB1 N;  3FK7 A;  4FE4 A;  3QQA A;  5DS9 A;  5FKM A;  5FKO A;  5EGO B;  1H8A C;  1UI5 A;  2NOG A;  2CQQ A;  4JX6 A;  5FKL A;  3S1M J;  3M4O J;  5F27 A;  3JRD A;  4AC0 A;  4IHW A;  1QVU A;  3ZOB A;  5M3F J;  1X2M A;  4L5E A;  3BTC A;  1P7J A;  3G56 A;  2JWT A;  5CXG A;  1I50 J;  1JJ8 C;  2XDN A;  3BQY A;  2W48 A;  1H88 C;  3S15 J;  1HDP A;  3BG9 A;  1TWH J;  5F04 A;  5HSZ A;  3HGY A;  2DG7 A;  2COB A;  3OSF A;  3PO3 J;  5IYC J;  5M5Y J;  2W53 A;  2ME6 A;  3VW2 A;  1BJZ A;  1APL C;  1A5J A;  3RKQ A;  5M3M J;  1UMQ A;  3LNQ A;  4A3K J;  3CDL A;  4CGR A;  3HDD A;  1R9T J;  4FIS A;  5EDN A;  4ICH A;  4PXI A;  1W0T A;  4M3B A;  1Q1V A;  1MH4 A;  5E3L A;  5D1R A;  2ID3 A;  2X48 A;  2CU7 A;  1MSE C;  2R0Q C;  5C4J J;  1JKO C;  1F43 A;  3I4N J;  3ANG A;  4AYB N;  3BR1 A;  1MBJ A;  2V57 A;  2F07 A;  1POG A;  1SGM A;  3FK6 A;  2KT0 A;  5E3M A;  1NTC A;  3ZQF A;  2LD5 A;  2XRL A;  2Y31 A;  2G7G A;  3W6V A;  2PZ9 A;  1RKT A;  1B72 A;  3VOX A;  4MO7 A;  1BW6 A;  2EZH A;  2WV1 A;  2D6Y A;  3MKL A;  2Y2Z A;  2Y9Z A;  1LE8 B;  3BG5 A;  4A3E J;  4MFD A;  3BR2 A;  3G7R A;  3G1O A;  5GP9 A;  2YUS A;  1AKH A;  3WHC A;  4ABZ A;  1DU6 A;  1ETK A;  3CMY A;  1ITY A;  1VF9 A;  2ZOZ A;  2L0K A;  2KDZ A;  1OCP A;  3RD3 A;  2CRG A;  3F0C A;  1PUF A;  2VI6 A;  3HGG A;  3BTI A;  1RPW A;  2CJJ A;  1QVT A;  3COL A;  4JYK A;  2HXI A;  4IHV A;  3GTL J;  5EZG A;  4XIC A;  3DEW A;  3JRE A;  2AHQ A;  5D19 A;  1TWC J;  4B4C A;  1IV6 A;  2QCO A;  3HB9 A;  5H9T A;  1PUF B;  9ANT A;  2LKX A;  3BR6 A;  2NP5 A;  3T6N A;  3VIB A;  2E2I J;  1JKQ C;  4DYQ A;  3S2D J;  2K9Q A;  2HYT A;  3PM1 A;  4DYR A;  2UXP A;  1QRY A;  4B3A A;  4FCY A;  3QPS A;  1AKH B;  2R5Z A;  1ZQ3 P;  4HKU A;  4CYC B;  1B8I B;  2XGD A;  1ORK A;  1ETW A;  4A69 C;  2QWT A;  3BR3 A;  3OIO A;  1UG2 A;  3JRB A;  1ETY A;  2MG4 A;  3S14 J;  3QPL A;  3ZQI A;  2NVQ J;  4GCL A;  4D7N A;  4RBO A;  1JUS A;  4A3C J;  4XK4 A;  4Y7N J;  3MN2 A;  1UHS A;  2RAE A;  5HBU A;  2JJ7 A;  2FX0 A;  4C3J J;  4XID A;  3A01 A;  1UI6 A;  2GLO A;  5K58 A;  4V2F A;  4UUS B;  4BXX J;  1JKP C;  3RH2 A;  5E3O A;  1ZKG A;  5F08 A;  3A03 A;  2CQX A;  4JP0 A;  1JTY A;  2I10 A;  5AQC A;  2JA7 J;  2ECB A;  2G3B A;  3M3Y J;  5IP6 A;  1A6I A;  3Q0U A;  2EH3 A;  1EF4 A;  1X58 A;  2G0E A;  3RZO J;  3S2H J;  1XG1 A;  2XGE A;  2EZK A;  2FD5 A;  5FMP A;  2O9L A;  2IU5 A;  2LFB A;  3PPB A;  1MBE A;  2REK A;  2DN0 A;  2E2H J;  3GTP J;  2ZCM A;  3GBG A;  4XRM A;  3ON2 A;  4GCK A;  4A3D J;  2G7S A;  3NAU A;  1TWF J;  3L1P A;  2JA8 J;  5EZH A;  2MGQ A;  1WCM J;  3PAS A;  2WAQ N;  3HTH A;  1U78 A;  1WPK A;  2DMT A;  3CQZ J;  2RAS A;  4QTR A;  2DMU A;  1K83 J;  4AUX A;  1F36 A;  2NP3 A;  4IHY A;  2QTQ A;  1BA5 A;  1OCT C;  5EGO A;  3ON4 A;  4GFB A;  5JLX A;  1FIA A;  2RHA A;  3JRC A;  3JSJ A;  3BNI A;  3HEF A;  1YRN B;  3HTI A;  2X6O A;  3S1Q J;  3NI7 A;  1HOM A;  1IDY A;  2OPT A;  4MFE A;  5F0H A;  1RET A;  3HOV J;  2L7Z A;  2E19 A;  3HOW J;  2FJ1 A;  2L7M P;  3V78 A;  3GTK J;  3HE0 A;  4A3L J;  3GTO J;  2H1K A;  4JX4 A;  5K7F A;  3LSR A;  3S1N J;  2R5Y A;  1ZR2 A;  1JT0 A;  4BKX A;  3KNW A;  1MNM C;  3IH4 A;  5GPA A;  4UDS A;  1JGG A;  4A3G J;  4Y52 J;  3RZD J;  2FBQ A;  3TW7 A;  3TP0 A;  2R92 J;  3C07 A;  2ID6 A;  3VPR A;  2EQR A;  2QF7 A;  3TP3 A;  3GTG J;  4B1R A;  1LE8 A;  1LFB A;  3IV5 A;  2NVX J;  4BBR J;  1GDT A;  2LK2 A;  3K7A J;  2QIB A;  3E7Q A;  4JX5 A;  5IP9 J;  2H8R A;  2LP0 A;  3HIM A;  3NNR A;  1ETX A;  1TWA J;  4IEJ A;  2DMN A;  2XSD C;  2Y0S N;  1VND A;  3LSJ A;  3NPI A;  1OJL A;  1WH5 A;  3VW0 A;  4JKZ A;  2LR8 A;  3OSG A;  3S17 J;  3VUQ A;  3BCG A;  4D5F A;  2GM4 A;  2PMZ N;  2LTP A;  2M34 A;  4I6Z A;  4IHX A;  2K40 A;  3ZQL A;  1D5Y A;  1GT0 C;  2M8G X;  1U9O A;  1Z77 A;  2DA1 A;  3FIS A;  2E1O A;  1B8I A;  4ACI A;  4CYC A;  4A3M J;  4A93 J;  4GFL A;  3LHQ A;  3G1L A;  1HCR A;  2P81 A;  5GPC A;  2XPW A;  5C44 J;  1MBG A;  4BY7 J;  2JA6 J;  1GUU A;  1MBH A;  3PO2 J;  3DCF A;  3ANP A;  2GFN A;  2GUH A;  1WGX A;  5J1R A;  2QKO A;  2UXU A;  1ZR4 A;  5EF6 A;  5FLV A;  5EFY A;  3BJB A;  4GCT A;  1XS9 A;  5DTD A;  3EGQ A;  2NVY J;  2G7L A;  2Y9Y A;  3VVX A;  4XRS A;  5IP7 J;  2XB0 X;  2X9D A;  1H89 C;  3O8G A;  1OFC X;  2YU9 J;  3BR5 A;  2L9R A;  5C4X J;  1U9N A;  2Q24 A;  2CUE A;  1LFU P;  1Z0X A;  2MSY A;  5IOY A;  3C2B A;  1IJW C;  3IUV A;  5F0F A;  1WH7 A;  3HKZ N;  3ZQH A;  3NXC A;  2O7T A;  2HQ5 A;  1ZK8 A;  2DA7 A;  3TED A;  4DYC A;  3A01 B;  1BL0 A;  2HDD A;  2JN6 A;  2NVT J;  2HOS A;  1AU7 A;  4L62 A;  2JMW A;  4XRS G;  3JR9 A;  3B6C A;  2M0C A;  3V6G A;  4QSH A;  3HTJ A;  2UXI A;  1WI3 A;  5FHP A;  1NK3 P;  4M6V A;  4MLO A;  2ECC A;  2ELK A;  3JRI A;  2ZCN A;  3LOC A;  1HDD C;  2OER A;  2GBY A;  4DZP A;  2ME0 A;  1VFC A;  1BW5 A;  1IUF A;  2ZOY A;  2YVH A;  3E7L A;  4LOC A;  4G12 A;  3VVZ A;  1NK2 P;  3BTL A;  4NEL A;  2HOT A;  1MBK A;  5F0C A;  3BTJ A;  2TCT A;  5M5W J;  1E3O C;  2ZB9 A;  2E2J J;  4C2M J;  4DW6 A;  1FJL A;  2CUF A;  3A02 A;  4FTH A;  2M9H A;  3O8H A;  5EEA A;  2DA3 A;  2UXO A;  1HLV A;  3B6A A;  3VVY A;  3UKG A;  2UXH A;  1I3Q J;  4BY1 J;  5J1U A;  1FTZ A;  3BG3 A;  4FE7 A;  3FIW A;  5F1J A;  1U8B A;  5CW8 A;  3JRG A;  1T56 A;  3FKI J;  2HYJ A;  3GTJ J;  3HOX J;  1ETQ A;  3HOU J;  3F1B A;  3IH3 A;  5FJ8 J;  1HF0 A;  2NS7 A;  2R7Z J;  2GEN A;  3VOK A;  2XPU A;  5FKN A;  3OOU A;  1Y1V J;  2K9S A;  2DMP A;  4X1E A;  3I4M J;  1SFO J;  5BNG A;  2YVE A;  4J19 A;  3MNL A;  1TC3 C;  2DA2 A;  2DG8 A;  2O8K A;  3VW1 A;  5FLM J;  3RQI A;  3Q0W A;  2JK3 A;  1FIP A;  4GFK A;  4S0H B;  5M5X J;  2L7F P;  5FGL A;  4W1U A;  5K7H A;  5K7Z A;  2TRT A;  1VI0 A;  3S1R J;  5C4Y A;  3CRJ A;  3CCY A;  5DAJ A;  5HAW A;  4M3G A;  1X2N A;  1T33 A;  2HOA A;  1AHD P;  3O60 A;  4M3E A;  4C3H J;  2O7O A;  2HI3 A;  4D5C A;  4NDL A;  3JRA A;  5CXI A;  1G2H A;  3WHB A;  2LVS A;  4KWA A;  2LY9 A;  2K9N A;  2M2E A;  2DA4 A;  2NX4 A;  3Q0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...