3PM1A

Structure of qacr e90q bound to ethidium
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
185
structure length
185
Chain Sequence
b'LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title A single acidic residue can guide binding site selection but does not govern QacR cationic-drug affinity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 74
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3pm1A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pm1A02
3LOCA 5FKMA 4FTHA 1MBGA 1MBEA 3HGYA 1U78A 2KT0A 1WH5A 2O7OA 5HBUA 3TW6A 2XGDA 5EEAA 2K9QA 1X58A 4A3LJ 3VVXA 1BL0A 3DPJA 3TW7A 2XB0X 4B4CA 4JP0A 1Z0XA 3S15J 3WHBA 5C44J 4V2GA 2LFBA 1GDTA 3I4NJ 2YVHA 1ETOA 2WB1N 2XPWA 1R9TJ 3MVPA 1ZR2A 3HTJA 1PUFA 2MSYA 3H3VK 3LSPA 5AQCA 2E19A 3VW2A 4JX6A 3BQZA 1MBJA 3ZQFA 4A3FJ 3PO2J 3RZDJ 3IV5A 4A3CJ 5K58A 4BY7J 1APLC 4GCKA 3JRHA 1I3QJ 2HOSA 2GBYA 3ZQIA 3LSRA 2DA2A 2DMPA 5FLVA 4NELA 1UG2A 4W1UA 2CUFA 2ECCA 2CQXA 2ZB9A 3I4MJ 3ANPA 3P9TA 5FMPA 2ZCMA 1VI0A 4HKUA 2XRLA 2PMZN 3TP0A 4QTRA 1ETKA 5IOZA 2QWTA 2YVEA 4A3JJ 2X48A 3ON2A 4XRSG 3O60A 3HOUJ 3S1NJ 2GUHA 4D7NA 4XIDA 5GPAA 4A3MJ 2D6YA 3VUQA 5C4JJ 1JTYA 2K9SA 2L7FP 1UI6A 3IH3A 1ZK8A 2H1KA 4M3FA 1A6IA 5EFYA 5HAWA 2E2JJ 1TWFJ 3COLA 3HOYJ 3LHQA 3BR1A 3VOKA 1K83J 4IHVA 2JWTA 2EZKA 2XSDC 2AO9A 3JR9A 2XGEA 3B6AA 2NP5A 2K40A 1JKRC 5F1JA 4GFLA 3BR5A 2D5VA 1TWCJ 4CYCB 2F07A 2FD5A 1RKWA 3BNIA 3BT9A 5DTDA 2LLKA 4GCLA 2DTZA 1WH7A 4L62A 1AKHA 4BY1J 1QVTA 3HKZN 1QVUA 1WPKA 1W0TA 4A93J 2JA5J 2ZOZA 1DU0A 1RPWA 4IEJA 1SANA 3VVZA 2FQ4A 2HQ5A 1ZR4A 2DMTA 4UUTA 1VNDA 1IRZA 2ECBA 1D5YA 3G1MA 3A03A 2LVSA 3GTMJ 2G7LA 2CQQA 2W48A 4QIWN 1IDZA 2L9RA 4FE7A 3BG3A 4Y52J 2QF7A 3FK6A 1Y1VJ 4C3IJ 4MFDA 3GTKJ 4ME9A 2ME0A 1VF9A 3IUVA 5FLMJ 1JJ8C 4LOCA 1I50J 4JYKA 3S14J 3GTOJ 5HSZA 5EG0B 3S2DJ 3NRGA 4DYRA 4IHWA 2DJNA 1CQTA 3HOZJ 2EH3A 3HOWJ 1TWAJ 1DU6A 4BKXA 2VKEA 4XK4A 3G7RA 3O8GA 4NDLA 3S1MJ 2EZHA 3JREA 3ZOBA 3TEDA 4BBSJ 1ETQA 3V78A 2IBDA 4A69C 4J19A 3EUPA 2NVQJ 5JLWA 2DG8A 1ETYA 3MN2A 2ZCXA 3HOXJ 3ZQLA 3KZ9A 2LKXA 3JRAA 5H9TA 2QCOA 1F36A 4A3DJ 1A5JA 2QTQA 2XDNA 3EGQA 3HEFA 4FE4A 1HF0A 4W97A 4M6VA 2NVYJ 3DCFA 2XGCA 2RAEA 3S1QJ 1K61A 4A3BJ 1HDPA 3BTLA 3BTCA 5EF6A 2K9NA 1GUUA 2FX0A 1PUFB 4RDUA 4D7MA 5FKOA 4ABZA 5FGLA 5J1RA 4DZJA 1JUPA 2P81A 2I10A 1UMQA 1YRNA 4AF5A 4JNNA 2UXIA 2DA4A 1T56A 2ME6A 5F0CA 3ZQGA 3CMYA 5EGOA 2YU9J 5C3EJ 1B72B 3KKCA 2R5ZA 1JT6A 1WGXA 3F0CA 4AYBN 2XPVA 1O4XA 2WGBA 3VW1A 4G12A 1JJ6C 5E3NA 3QQAA 4V2FA 2VUMJ 1QRYA 2YUSA 5E3LA 3VIBA 3S17J 2X6OA 4BBRJ 1NTCA 3BG9A 5FKKA 1BW6A 3HE0A 5BNGA 4AC0A 2L7ZA 1W0UA 5C4YA 1GV2A 5F27A 2HOTA 2WUIA 4ICHA 3OIOA 1OFCX 4B3AA 2Y0SN 2R7ZJ 5DS9A 1FJLA 2R92J 2ID3A 2JA6J 5IPAA 2MW8A 3NAUA 3VPRA 2DMQA 1P7JA 3BR3A 4UUSA 4EEFG 1IG7A 4JL3A 3F1BA 2VKVA 1RKTA 2ID6A 3NARA 4MO7A 3A01A 2DN0A 3BR6A 9ANTA 3G1OA 1FTZA 5M5YJ 1OJLA 1MH4A 1B8IA 1EF4A 3RKQA 1IGNA 2O8KA 2L7MP 2LD5A 1JTXA 5J3LA 2UXHA 3RH2A 2QKOA 3L1PA 2WV1A 1GVDA 2LTPA 2DA6A 3ZQCA 2ELKA 4RBOA 2HI3A 2LP0A 1WI3A 4DZPA 5E3OA 3T6NA 1MH3A 3JRDA 1FIAA 1NK2P 2JN6A 2M34A 2GLOA 3OOUA 1ZQ3P 3BR2A 3B81A 5K7HA 3HM5A 1U9OA 5J1YA 2LK2A 4GCTA 2DA1A 2NOGA 2DMNA 5J1UA 4GFKA 2CU7A 3TP3A 5EZGA 3RZOJ 4DW6A 2W53A 3NI7A 4M3EA 5M3MJ 3PASA 3GTJJ 2NS8A 1ZGWA 2FJ1A 2DG7A 3BHQA 3CWRA 5FHPA 1LE8B 2VPRA 4A3EJ 1XS9A 2GM4A 1U8BA 3BG5A 4XICA 1ITYA 2HYTA 2UXPA 1IJWC 3AQTA 4GFBA 3HDDA 1HCRA 1ETXA 3BTJA 2EZIA 3CDLA 2CUEA 4HNVA 3BTIA 5C4XJ 3FRQA 1FIPA 2TRTA 2EQRA 2M8GX 4M3GA 2ZCNA 4JKZA 1RR7A 5IYCJ 4S0HB 3JSJA 4M3DA 4Y7NJ 2R5YB 3NNRA 3K7AJ 5D19A 3IH4A 2R93J 3FIWA 2UXOA 1MBFA 3IH2A 1G2HA 3G1LA 3OSFA 2G7SA 5CW8A 3G56A 3ON4A 1TWGJ 2LR8A 2GENA 3HTIA 1HDDC 5FKNA 4FCYA 1IC8A 2DA3A 3LSJA 1H89C 1H88C 2O7TA 1YRNB 3HOVJ 5IYBJ 2E2IJ 2FBQA 2QIBA 1UI5A 2QOPA 3NXCA 3M3YJ 3UKGA 1OCPA 4I6ZA 5M5WJ 4A3IJ 1TC3C 2JA7J 1HLVA 3PPBA 2O9LA 2G7GA 1AHDP 4UDSA 2E2HJ 3BCGA 5EGOB 3Q0VA 2Y9ZA 2NS7A 3FK7A 1MBKA 2VI6A 1MBHA 2R5ZB 2YS9A 4X6AJ 2JJ7A 5F0FA 1GT0C 3GBGA 2X9DA 4MLOA 3VVYA 3LWJA 4NN1A 3OSGA 4D5CA 4BXXJ 1P7IA 5K7FA 1H8AC 3M4OJ 5D1RA 1S7EA 3LJLA 3ANGA 1POGA 2DA7A 3DEWA 2HXIA 3PM1A 5EDNA 2TCTA 3MNLA 5D18A 3VP5A 1XG1A 3Q0WA 1FTTA 1ETWA 3E7LA 4A3KJ 1JKQC 1MNMC 4AC6A 3MKLA 3S5RA 2DMUA 3D1NI 3KNWA 5IP7J 1MSFC 3FKIJ 3RQIA 1U9NA 2IAIA 5IOYA 2OI8A 2CJJA 2HDDA 4UUSB 5CXIA 1JUMA 1Y1WJ 2V57A 3GTQJ 4MIMA 4A3GJ 4MK6A 2JK3A 1IV6A 2NVTJ 4AUXA 2MG4A 2DA5A 5F0HA 3A01B 2HOAA 5M3FJ 2AHQA 3GTLJ 5F04A 4B1RA 2Y30A 3CRJA 1Z77A 2EZLA 2G0EA 3JRFA 1WCMJ 3B6CA 1B8IB 3HIMA 1X2NA 5F08A 5HODA 1JUSA 3HBLA 1AKHB 2MGQA 3HGGA 5E3MA 3SFIA 1OCTC 1BA5A 2XPUA 2NX4A 2NVXJ 3S1RJ 1AU7A 5EYRA 3ZQHA 1F43A 1B72A 2HYJA 3VW0A 4D5FA 3C07A 1JKPC 4C3JJ 3SDGA 5FJ8J 2M2EA 3GEUA 1I6HJ 4FISA 2R0QC 3GTPJ 4IHYA 3Q3SA 2HXOA 4DYCA 3CJDA 5K7ZA 3HTAA 4M3BA 2E1OA 2HKUA 3RD3A 2NP3A 5IP6A 3LNQA 5FKLA 2GFNA 3HTHA 1BW5A 1HOMA 3BRUA 1NK3P 3V6GA 2IU5A 2JMWA 3QPSA 4JX5A 4X1EA 3JRCA 3VOXA 2H8RA 1VFCA 2RHAA 1JT0A 4XRMA 4IHXA 1RESA 3AQSA 3NPIA 2PBXA 4KWAA 1Q1VA 2UXUA 2Y9YA 1ETVA 3CQZJ 1T33A 3JRIA 2REKA 2M0CA 4C2MJ 4XRSA 2Y31A 3K2AA 2WAQN 5GP9A 2EBIA 4CYCA 3Q0UA 1ZKGA 4JX4A 2IEKA 5DAJA 3JRBA 3GZIA 1IDYA 3W6VA 1GV5A 2KDZA 2PZ9A 3S2HJ 4L5EA 1JKOC 1ZTRA 2B63J 3JRGA 1TWHJ 3QBMA 4ACIA 5JLXA 3BR0A 1MSEC 3QPLA 1SGMA 1ENHA 4I76A 3E7QA 4YZEA 3GTGJ 3HB9A 1IUFA 5EZHA 4MXMA 3S16J 2Q24A 5GPCA 5CXGA 1RETA 1SFOJ 1JGGA 5IYDJ 1ORKA 1E3OC 2CRGA 4DYQA 2JA8J 1QPIA 3KKDA 3H0GJ 2XB5A 4MFEA 1LFBA 3A02A 3QKXA 3PO3J 3C2BA 2Y2ZA 1BJZA 5EG0A 3BQYA 2OPTA 1LE8A 2ZOYA 2COBA 5IP9J 3WHCA 2OF7A 2L0KA 1FEXA 2M9HA 3BJBA 1X2MA 2N8GA 4PXIA 2LY9A 5M5XJ 2OERA 3FISA 3LSGA 1LFUP 1XC5A 3SJMA 1UHSA 3CCYA 3O8HA 2RASA 4CGRA 4QSHA 4C3HJ 2R5YA 2G3BA
chains in the Genus database with same CATH superfamily
3LOCA 1KONA 4II2A 3CMAI 4E4HA 3S3OA 2ZFWA 5ICEA 1TLHB 3V42A 3K2ZA 5D5VB 3HGYA 2M4GA 3BZ6A 2HEOA 2KT0A 3WE2A 3QYFA 5D5XB 4OOIA 1QZYA 2LSOA 5CVVA 3R0AA 1X58A 1BL0A 2QWWA 4X0GA 3S15J 3D5SC 1IXCA 2ELJA 4BU2A 3DBLB 4YRVA 2F5FA 1XDSA 4EV0A 4HF1A 2YVHA 1WQ2A 3OL3A 1R9TJ 2XASA 5KHDA 1P4AA 1YYVA 2JZYA 4TV7A 3E1SA 2E19A 4JX6A 3U21A 2UXXA 5DM7F 4A3FJ 1E17A 2DK5A 1UZCA 1APLC 1X3ZB 3GW2A 3LSRA 3O3KA 1TQPA 4W1UA 1S29A 2ECCA 2CQXA 2ZB9A 2CW0F 3P9TA 1I1GA 5FO5A 1J75A 3IHUA 2E5ZA 3QYEA 2DU9A 2V7FA 2XRLA 3TP0A 4QTRA 2YVEA 5IOZA 2QWTA 1W5SA 3I59B 4A3JJ 2V6CA 2DPDA 2DXIA 2GUHA 2QQ9A 4XIDA 3QU6A 4A3MJ 2OZ6A 1JTYA 3IH3A 4M9ZA 1WHUA 1ZK8A 2HZTA 4M3FA 3ZMTA 2O61A 2ZCWA 3HOYJ 2IT0A 2HKXA 1K83J 4IHVA 2EZKA 5D8LB 4OMYA 2MC4A 2LKSA 4BYYA 2K40A 4L0YB 4U0VA 2R7UA 1TWCJ 3NRVA 1BN5A 1OR7C 1RKWA 4MQVA 5DTDA 4N9IA 3Q5FA 5LGUA 1SD7A 3L2CA 1WFXA 3FMSA 4XQFA 1QVTA 2VC1A 2FNAA 1WPKA 5E1XA 3NWTA 2ISZA 5L3CA 4KYWA 5GAGJ 2V26A 3VVZA 1VQOI 1LQ1A 4A0ZA 2FQ4A 1IRZA 3HPHA 2CH0A 3R4KA 4OAYA 4CXFA 1J2XA 4QWQA 2EA2A 2P7CB 1FZPB 1FMVA 2CQQA 2DI3A 3GWZA 4R1HA 4C2MA 1SVMA 3FXQA 1M1EB 3QAHA 3IRQA 2BBYA 2W00A 4Y52J 4MFDA 2QQAA 3X2QH 2XC7A 2F4OB 2AXLA 2W24A 3A1YA 3S14J 1TT0A 3GTOJ 2P5KA 3NRGA 4DYRA 5CVJA 2P7VB 3VB2A 2DJNA 1QHGA 4XMYA 1CQTA 3HOZJ 3K8PC 3LMMA 4HBLA 1BBYA 1TWAJ 3DXJF 1DU6A 1EA3A 5BPDA 1QA6A 1BC7C 3O8GA 4NDLA 3RKYA 4A12A 1E0EA 1R00A 3E6DA 2KQRA 2JVHA 2HPIA 1P92A 3E0JB 3FXMA 1VQ5I 4A69C 3CP2A 3C7JA 3HOXJ 3ZQLA 4P55A 4L18B 2G7UA 2EB7A 1MMGA 2QCOA 2O8XA 4LLNA 4A3DJ 2XDNA 1LDJA 2MD0A 4BJ5C 2K4BA 3JSPA 2UZKA 3VEPA 4W97A 5E1ZB 2RAEA 4WF2A 3CCUI 5F6FA 1K78B 3OR2C 3CUQB 3BZKA 2WC2A 4Q47A 1YE9A 3WTVC 3DEEA 3PUBA 4PZJA 5L3DA 3CMMA 4E7SA 2A5WA 3E5UA 2NAZA 4XOTA 5K1YA 4RDUA 1OYIA 3GF2A 3J7AO 3C2HA 5FKOA 5FGLA 4DZJA 3S3MA 2P81A 3RJPA 5E8IA 1YRNA 1ERDA 1KQ0A 4DVYP 5A2QZ 1UELB 3EYIA 3HXLA 2EV5A 2QM3A 1WWXA 4JNNA 2HU9A 1YW7A 4EJUA 3FDYA 3OMYA 3KP3A 4XSXF 1T0FA 4UVAA 4Y4RA 4BS9A 1MZBA 4UY8I 4P5OA 4G12A 3ULQB 4V2FA 2CFOA 2CSOA 3TOBA 1X1BA 4JQFA 2FOKA 3VIBA 3CUQC 2X6OA 4LLGF 4BBRJ 2HOEA 3TDUC 4C9YA 2VC0A 2LBFB 5FKKA 2HKOA 1FOWA 4XKBA 1QZZA 2WUIA 1FMWA 4KIGA 2QSHX 1OLTA 4B3AA 5DS9A 5JI6A 3K69A 3P9CA 4RLFA 4BE2A 4OD5A 4OD4A 2DMQA 3DTIA 3F8CA 4L9NA 3SHFA 4JL3A 3HG9A 2B1EA 3F1BA 3GLLA 2W84A 3A01A 2B9SA 4L0ZB 2MYSA 4I02A 3BG7A 4OIPF 4IVNA 3M8EA 5M5YJ 4RAZA 3BCBA 1OJLA 1QU3A 1OYYA 2WV0A 3RKQA 2E7XA 1JXSA 2R7QA 2X6XA 1WVRA 3PUFA 3VDXA 3L1PA 2WV1A 2V4JC 3K6GA 2AS5F 5GTIC 2B0LA 5DCMA 4RBOA 1SD4A 2GZWA 2BOLA 3HZJA 4DZPA 1MH3A 3JRDA 1FLIA 2H1LA 3IKVA 2JN6A 2M34A 2VIXA 3KYLA 3K4LA 1OCZH 2PQ8A 3DLAA 3B81A 3B73A 4OWRB 5K7HA 2CS3A 4ENNA 2ESHA 2LK2A 2CMPA 3HHGA 1SAXA 2NOGA 2COMA 5J1UA 5B1AH 4FX0A 2L9VA 3TP3A 3NI7A 2ZNZA 3HUGA 2F5DA 3WTZA 3GTJJ 2CW7A 1O57A 2KJBA 1FOKA 1I6XA 5DV5A 5FHPA 2VPRA 3BG5A 4B48A 4G9YA 3I58A 4M9XA 3EUKL 3BROA 2LY2A 3BTJA 3FMRA 4WWCA 1A04A 3EUHA 1FIPA 4XKVA 2M8GX 4L9JA 4S0HB 2V9PA 3JSJA 4DNCA 5D19A 3K1MA 2NVUB 4AU7A 3N05A 3IH4A 3J7YJ 4KNYA 1MBFA 1G2HA 1TL8A 5H20A 3LQQA 1XB4A 2LR8A 1I5ZA 2GENA 2ZXIA 3AG4H 1WJDA 4M74A 1R5GA 5DYMA 2LY1A 4II3A 1IC8A 3V7CA 2DA3A 1H88C 4F55A 3PQJA 1SFUA 2FBQA 2E2IJ 4MGRA 2X0LA 2QIBA 4MTDA 2LNBA 1RRJA 3M3YJ 3UKGA 2K3FA 2EILH 3V8LA 2GXAA 1ZRCA 1BOBA 2QKLB 2XHKA 5LGTA 4KN4X 3OYNA 4YFKF 5E79C 1RR8C 4S04A 3KP5A 5FLXZ 2R5ZB 1MBHA 3KEYA 3PNVA 5ED4A 2JJ7A 2M4KA 4E6KG 4BJ6C 3CDIA 4NN1A 1IXSB 1SAUA 4D5CA 2VONA 5CLSA 1E2XA 3SZGA 1H8AC 4BXXJ 3M4OJ 2QSGX 2DO7A 3LJLA 5D1RA 3S8PA 2VT3A 5HDKA 5D18A 2TCTA 3HHHA 1USSA 3AL0B 1XG1A 3WGIA 4HV5A 3S5RA 2EV0A 1KQ8A 1GHCA 1H0MA 3RQIA 1MSFC 2KRCA 2CJJA 4AD9A 1JUMA 2OC6A 4MIMA 4A3GJ 2XROA 2MG4A 2DA5A 4PJLA 5F0HA 2HOAA 5M3FJ 3I5UA 3PNTA 2V6EA 2R7TA 2AHQA 1HSTA 4A2UA 1Z77A 3CRJA 5HLHA 1WCMJ 4UB8C 3QYBA 2BEOA 2JTVA 3CCEI 1UFMA 4J00A 3HBLA 4XN3A 2XF5A 3LA7A 2NX4A 4I09A 1WZ2A 3I71A 2NVXJ 1B59A 3ZQHA 5ICCA 3K1NA 5D8KB 2FSWA 1B72A 5GAEJ 2XV4S 1T38A 1TT5B 2F48A 5HS7A 3DTKA 2E7WA 3WTUC 5TRDA 2P6TA 1UJ8A 1XSDA 4WX9A 3IP4B 1ZRDA 1GVJA 3GEUA 3GTPJ 2O0YA 5CQGA 1GLNA 2I8DA 4UV9A 3ZXSA 1S9HA 1D1CA 4DYCA 3CJDA 1YX5A 2HVQA 3LNQA 2GFNA 1BIAA 4CCOA 5BPIA 4ZYEA 2FNPA 3PSFA 4C2UA 3QPSA 4WXDA 4N4OB 2ZXWH 3K4MA 3OYMA 1LEAA 4P9FA 5J40A 4BHPA 5D4SA 1XSXA 2H8RA 5CVRA 1YJNI 3H9JA 1RESA 2PBXA 4YEJA 2ZFUA 4KWAA 1Q1VA 3VYTB 3ZMVA 3CQZJ 1ETVA 2Y75A 1PYVA 1T33A 4HF0A 3JRIA 2M87A 3HRUA 4C2MJ 5E17F 5ERIA 3K2AA 2WAQN 1CF7A 3TO9A 1FWZA 3HSEA 3W2WA 2DT6A 2RNJA 4NBQA 3KPHA 1JKOC 3E3VA 1R49A 2Q0OA 5DM6F 1Y56A 5GTHC 3REOA 4ACIA 3A0BC 3BR0A 1SMYF 3CCRI 4JK1X 3QPLA 1SGMA 1OCRH 4I76A 4BEHA 2ZMEA 3VWBA 5CXGA 1RETA 2XAJA 2BGCA 4RM3A 2HQRA 1YIJI 4L9TA 2JSPA 2KISA 4I99C 2DT5A 4CA0A 3KKDA 1SMTA 3W3CA 3SZTA 3ZN1A 1IZ1A 2XB5A 4AYBA 5CPRB 4UUVA 1BJZA 2OPTA 3G4SI 1LE8A 2HVRA 4E7KA 4IZZA 1FBUA 2L0KA 5AONA 1MJBA 2P0WA 4NHJA 1TNTA 2JSCA 1ZLJA 2LRDA 4B09A 2LY9A 5D4RA 5EEHA 3LSGA 2M7BA 1LFUP 3SJMA 2BXYA 1L0OC 2QQBA 4QSHA 4C3HJ 4CGRA 2Y0SA 3CC2I 1S7OA 3BZCA 3AG3H 4WXHA 4FTHA 5FD6A 5FROA 5JVTA 4KFCA 4CH7A 5HBUA 3QP5A 2CUJA 3I55I 5EEAA 2IGOA 2K9QA 4A3LJ 3T8RA 3DPJA 1KYZA 2OD5A 2XB0X 4ESBA 4JP0A 4ZYGA 2Q2EB 2P5VA 1GDTA 1QO0D 2HFHA 4NQWB 4ON0A 3I4NJ 2JQ7A 1VQPI 3GEZA 3L7WA 2WB1N 2MD5A 3RIRA 2Z99A 4GYIA 1KGSA 4A0XA 1O3QA 1BIBA 5CKTA 1PUFA 3H3VK 3DKXA 3S93A 3CC7I 3ECHA 5LHGA 5AQCA 3BQZA 1MBJA 3ZQFA 4RM2A 2FF4A 3PO2J 2RC4A 4R79A 5J8FA 1T2KA 4A3CJ 4G7OF 2EFNA 4BY7J 3JRHA 4OIRF 2HOSA 3ZQIA 4EM1A 1I39A 5FLVA 4NELA 1TQMA 1STZA 2CUFA 3CDHA 3I4MJ 2EFQA 5FMPA 2ZCMA 2MH2A 2QEXI 1VI0A 1LUJB 2YR2A 4G7HF 1ZRFA 1ETKA 2NYXA 2GA2A 3IWFA 3OWTA 3O2PE 2X48A 3O60A 5AIQA 3HOUJ 1EV7A 3ZMDA 3T8TA 3N4MA 3CP8A 2FMLA 4G6DA 2E1MC 2CO5A 2L7FP 1I27A 1YW8A 2H1KA 3H0DA 1VQ6I 5HAWA 2E2JJ 3RQ4A 2WBMA 3DU6A 4L5JA 4QLCU 2XSDC 4IO9F 2EWNA 2K4JA 3H5RA 2W7NA 4BDZA 4NC6A 3HJEA 4XLPF 4GFLA 3K10A 4BAYA 2HTSA 2JPCA 2D5VA 1FY7A 1N77A 2R7RA 1OMIA 3T5XA 4CYCB 2CV2A 4L62A 2LLKA 2X1EA 1MMDA 4IXAA 1AKHA 1MDMA 5LLQA 4BY1J 3C3WA 1IN4A 2XSJC 3HKZN 4MEYF 3FKJA 2MFZA 3FM3A 1QVUA 3KE2A 2ZOZA 2H27A 3KP4A 2VL8A 3E6BA 4IEJA 4Y33A 1D8KA 3F9KA 2BW3A 2DFFA 4XLCA 6PAXA 4UUTA 1VNDA 3G6EI 4C30A 1XCBA 2Q8KA 2F4IA 1DGWY 2LVSA 3A03A 4LJZF 1SEUA 1RUOA 5KK1A 5KAIC 1IDZA 1R6RA 1YIOA 4AIJA 5LHHA 1LNWA 2QF7A 1Y1VJ 4S05A 4DIQA 3LSKA 1ON2A 3FXOA 2A3SA 4LOCA 1F9NA 2OAZA 1YJ9I 5EG0B 3TL4X 2FRHA 3WTYC 1D5VA 4ITVA 3LSTA 4IHWA 4FT8A 4CHUA 3KLOA 3HOWJ 1QPMA 2A68F 4WK8F 4BKXA 4XK4A 1V5FA 2VBZA 3DU5A 1IN5A 1X19A 2CG4A 3WGHA 3JREA 3TEDA 1LVAA 2DCEA 1ETQA 3MQ0A 2JVGA 2QA4I 1LVKA 1W7PA 5TGTA 5BMZA 3I3LA 4B8XA 1W36D 1QBJA 2DG8A 3ABTA 1ETYA 5JR3A 2DK8A 4KISA 1F36A 3WTSC 2QTQA 4MHGA 2QVOA 3WG9A 2O5RA 3QOPA 3KIOA 3LWFA 2NVYJ 1UAAA 3S1QJ 2KIFA 3BTCA 2UWMA 3OIPA 1G3TA 2K9NA 1GUUA 2DODA 2ZJ2A 1C0WA 2FX0A 1SD6A 2O3FA 2V1XA 3E97A 3I54A 4RA2A 4HG2A 4BL0B 4F52A 5J1RA 1JUPA 5KNLA 2I10A 3TBIA 5L3EA 1KU2A 1NH3A 2FBKA 4G8XA 1XX5A 4LK1F 2VQCA 2XAQA 4RAFA 2ZY9A 1AA7A 3OYEA 1UG0A 1D8JA 3HC7A 4DOZA 1XSVA 4ME9A 2IS2A 2DLLA 1T08B 1U0JA 3JAMZ 2YU9J 5C3EJ 4IQ4A 1V55H 3CTAA 4I7HA 3F0CA 1O4XA 1KU9A 1XMAA 3DLLF 1Z9CA 1QRYA 2PX9A 3ABMH 5E3LA 3UNGC 3A2KA 1NTCA 1Z91A 2X85A 2VJJA 5ILUA 1PUEE 3HE0A 4LD5A 5BNGA 2BZTA 3K4BA 5FRMA 2GXGA 2ZJPF 2VE8A 4HF2A 5C4YA 3OYLA 2R7ZJ 2R92J 1QGPA 2ID3A 3MZ8A 1S7AA 2MW8A 5IPAA 3ERED 3KCCA 1VQMI 3VPRA 2DPUA 2YU3A 2X4HA 4M71A 3BR3A 3QP6A 4OMZA 4EEFG 2FOWA 1P4XA 3QPHA 2BY1A 2VKVA 5IT9K 5DD8A 3WTWC 3EUAA 3ELKA 2X6YA 4PJMA 3R6SA 3FM5A 3I64A 2X1DA 1J5YA 4QPOA 4CCJA 1N75A 4EJTA 1B9MA 2O8KA 2QBYA 1ONVA 5K5OA 2UXHA 1OR7A 3M1CA 1SD5A 2HTJA 3GYHX 1R36A 3L09A 1GVDA 5K5RA 1VQLI 2DA6A 4UV8A 4HDUA 1A36A 1A6QA 4C2TA 3DEUA 4XLAA 2CQNA 2EFOA 1RC9A 2OQRA 3P7NA 3HPGA 1ZELA 3J81Z 4AM3A 5B66C 1TQIA 1U9OA 4PJ0C 2DAOA 2DA1A 4ENJA 4Q5SF 4G6QA 4LLLA 4DW6A 4FETA 4JBAA 4M3EA 5M3MJ 1X3UA 3G2BA 4ETSA 1ZGWA 3TQNA 1TP4A 2KRHA 3CWRA 3RI4A 1U8BA 3P9IA 4IF4A 4XICA 5DDGA 1IJWC 1DPRA 3AQTA 1HCRA 2KL4A 3CDLA 2CUEA 1S6LA 3EYYA 5C4XJ 3FRQA 3V7SA 2X51A 2TRTA 2QUFA 2EQRA 4IQJA 2BXZA 3VYRB 2ZCNA 1BI1A 2STTA 4EJVA 4Y7NJ 2R5YB 3OY9A 3NNRA 2P6SA 3MCZA 1Y0UA 2V1UA 3FIWA 3IL2A 3IH2A 4KUMA 4PJJA 3KYCB 3H3UA 5CVIA 5F64A 3HSRA 3G71I 4BQOA 4XONA 1XMXA 3LSJA 4NB5A 1X1AA 5E18F 1YRNB 3HOVJ 4F92B 3M7GA 4YFNF 2FA5A 1I1SA 1KA8A 1UI5A 3NXCA 2M0MA 2ESNA 3EETA 3F8BA 2O9LA 3GUDA 5FB2A 3BCGA 2VE9A 4G6TB 2MLKA 4RB0A 4X6AJ 2YS9A 1R23A 1Z6TA 3GVAA 2E36A 4MLOA 3RYPA 3VVYA 3MMYB 3SEQA 3MFKA 2CGPA 3PJRA 1YOVB 3ANGA 2MBFA 1LB2A 2DA7A 3DEWA 3PM1A 3MNLA 1XCVA 4KMFA 1R58A 1ETWA 4A3KJ 2QZ8A 4UNOA 2H8WA 1T95A 3FMQA 1CGPA 3DFGA 2V9KA 3QODA 2QYOA 4EQQA 5J6XA 3J80K 2K7LA 4PFPA 1K78A 3ROUA 4HV6A 5HLIA 4KIBA 3KEOA 1VTNC 3GTQJ 4MK6A 3DWLE 2JK3A 4NC8A 2NVTJ 1T0FC 2OCEA 3A01B 2PFBA 1Z3XA 3GTLJ 1MJAA 2Y30A 3CZ6A 3JRFA 2EZLA 4OIOF 1G4DA 5JHFA 3LAJA 1BR2A 4IL6C 4JOMA 2A6EF 1ZN2A 1X2NA 3HRMA 4KN7X 2E60A 3RKWA 5HOOA 2LC2A 2CYYA 3V8JA 4Y3OA 3RCOA 4U9NA 2BY3A 1XN7A 3HGGA 1W36C 1BA5A 4G7ZF 4IOCF 3S1RJ 4QPQA 3EQLF 3DBHB 3FXKA 3M8FA 5DCMB 4PSWA 2D45A 1R4MB 4CZZA 4BXFA 1V5GA 5LHIA 3VW0A 2ZKZA 3SDGA 1P2FA 3I56I 5FJ8J 2DYRH 2PN6A 2LBFA 4GDFA 2PI0A 2R0QC 4BQAA 3Q3SA 4M3BA 2E1OA 1RZ4A 2G7HA 4HX4A 2A6TA 4XNFA 3W2AA 1FYMA 3HUGB 4DBRA 5HNHA 1BW5A 3BRUA 3W2VA 3CO7C 1ULYA 4KIFA 2IS6A 2JPBA 1P6RA 3VOXA 2GWRA 2RHAA 2CV1A 3SXYA 1YJWI 2OZUA 4RB2C 1YHQI 2UXUA 1YW9A 2XIGA 1MW7A 2REKA 1Y39A 3ZP5A 5DUKA 1B1BA 2Z16A 2M0CA 1Z6RA 2DYSH 5HS8A 2MABA 2M3AA 3C2GA 2ZSHB 2EBIA 1H9TA 4EMSA 2IPQX 1ZKGA 2BY2A 1IW7F 2IEKA 2UUZA 3CCMI 3JRBA 2KLOA 4HSRA 1GV5A 2KDZA 2HWVA 2A07F 5HLTA 4L5EA 3J7AY 2B63J 4WXCA 3QBMA 4HRIA 2FE3A 1MSEC 4RGSA 3GTGJ 2Y48A 2XAFA 4IJAA 5EZHA 5GPCA 1Z67A 4U87A 1J7KA 1JGGA 1IF1A 4ZTFA 4XN0A 4CYDA 2XKOA 2VBWA 2CRGA 2UXNA 2NOJB 1QPIA 3H0GJ 3V4GA 1HXDA 2H6BA 3BLYA 2XDVA 1G3YA 2IA0A 4IOAF 4GRIA 3BQYA 2ZOYA 5IP9J 3HSFA 3IAS2 2M1BA 2M9HA 2N8GA 2NNNA 1GXPA 1WKMA 5M5XJ 4O3MA 4Q48A 2LMDA 3IRRA 3IWZA 2RASA 1KQ9A 2NNYA 2YSRA 2L5QA 2G3BA 1MBEA 3BJ6A 3ZQ7A 2VJ5A 2ZC2A 5LRRA 1WH5A 5LEKA 4PSXA 2LYCA 1EH7A 2HYFA 1QZEA 2AXTC 1YITI 1ZLKA 4GO1A 3Q9VA 4B4CA 4HNTA 1HC8A 4XORA 4D1QA 3MVPA 3KP7A 1FSHA 5H2FC 1XDUA 3HTJA 3VW2A 4ZDOA 3F3XA 2XAHA 2P4WA 4ZDPA 3IV5A 1A31A 5K58A 2STWA 2KZGA 3B02A 3DPLC 1MMSA 4LG0B 2O6GE 2IVMA 3H9QA 4RB1A 3AL0C 1FC3A 4GYGA 5FGMA 3ANPA 2Z1DA 2HVSA 2D2WA 3HOSA 4HKUA 2KRFA 4HOBA 2LOOA 3VYUB 3CJNA 5CYVA 1YQAA 3ON2A 3COAC 2A6HF 3S1NJ 2XGXA 3CCVI 3TO6A 4HW0A 1DQUA 3K4KA 1TW3A 4AVZA 1O7FA 3K70D 5GPAA 3VUQA 1KU7A 3CESA 3E5XA 2KMUA 3HYIA 1A6IA 4LFUA 1R5ID 1TWFJ 3LHQA 3D5RC 3U1DA 4B43A 2VQGA 1YI2I 3NWSA 2JWTA 4BUPA 1U5TB 3WU1B 2AO9A 3JR9A 3SZPA 4Z2YA 2NP5A 5F1JA 4IRVA 3BR5A 1VQKI 5CVUA 1Y8RB 2E5NA 3KLNA 1K4SA 2F07A 3L9FA 2FD5A 4V19K 2M7AA 3MD2A 3T1BA 2DTZA 4A0YA 5LGNA 2WTEA 3PQKA 1O7LA 2JA5J 4A93J 1DU0A 3AG2H 3OYBA 2HQ5A 3CF2A 1PDNC 2ZXJA 3QRFF 2ECBA 3G1MA 4BEHB 2PJRA 1OKRA 1B9NA 2ZMEB 1VQ4I 5AIPA 3TKYA 4E70A 1P9QC 2V1DA 4FE7A 3IUOA 3BPVA 3LSHA 3SFZA 3BG3A 3F21A 1U5TC 2E71A 2L9NA 3FK6A 3U1KA 1ACIA 4C3IJ 2H94A 1TZLA 1VF9A 2W1OA 1K4TA 3WGGA 4YIRX 2BVLA 2DQLA 2ICWG 4PJNA 1I50J 4JYKA 5HSZA 3F8NA 3OIQA 3K4CA 4MNUA 1ZGJA 3AKZA 5F1RA 4HNUA 1PP7U 4EJOA 2DBBA 4NC7A 1ZG5A 4A5MA 5EJCA 2VKEA 4I0BA 5L3BA 2K9LA 3OYHA 4L9VA 3G7RA 4RLQA 2RKHA 3R60A 4IPAA 3OS2A 3S1MJ 2EZHA 2O03A 1R1UA 3LFUA 2VKHA 4PFOA 2ZNYA 1YS6A 2F2EA 2EINH 3FHZA 2RNGA 2XAUA 3KZ9A 1LKXA 3FXRA 3JRAA 2LKXA 5H9TA 4CO8A 4LB6B 1A5JA 1HA8A 4ESFA 2OTLI 3GLXA 4FE4A 1HF0A 2OV7A 1J9IA 4M6VA 3PFIA 2IGKA 3DCFA 4A3BJ 1MMAA 1HDPA 3BTLA 1BI3A 1UHMA 3PIOF 3K9TA 5EF6A 4LMYA 1W5TA 2L54A 1PUFB 2YX7A 3TDZC 4E7HA 4ABZA 3PSIA 3KETA 1UCRA 2Z9OA 4PK4A 4HPQA 4HQMA 4XLHA 4AF5A 4DQ2A 1BJAA 2UXIA 2ME6A 1IN6A 5F0CA 1OCOH 4D0PA 2QGUA 3FWEA 3ZQGA 5EGOA 5ILSA 2IS4A 1JHHA 1JT6A 2WGBA 2XPVA 1YS7A 4E7LA 3VW1A 2FBHA 3QQAA 2PMUA 3I9V2 2CW8A 3MZYA 2BE5F 2YUSA 5TJJA 2EIJH 5ICGA 3CLQA 2GOXB 2EIKH 3BG9A 2FJI1 3ZRGA 3CO6C 1NG7A 2L7ZA 3ERMA 1GV2A 5F27A 2HOTA 4LK0F 3OIOA 3LL7A 3L2RA 3J81K 4FX4A 2J5PA 3E6MA 2ACJA 2JA6J 2DQRA 2BV6A 1YO5C 4RAGA 1HSJA 2Q2EA 3L2VA 4A5NA 3FZVA 4NQWA 3K1PA 4UUSA 1R22A 5IT3A 1IG7A 2LG4A 2GXBA 5HDGA 2WAQA 2RGVA 2CUZA 2GA1A 2A5YB 3NARA 1JHFA 2ID6A 2XF7A 3M07A 3H36A 4MO7A 1MDMB 3BJOA 4MTEA 1GXQA 2IGMA 3G1OA 4GCVA 2WADA 5L3GA 1EH8A 4IKFA 1FTZA 2CFXA 1FNNA 2BW3B 5K5QA 1B8IA 2E1NA 1EF4A 1KZHA 1IGNA 5DCFA 1TNSA 1U2WA 3HL2A 2NS0A 5ICFA 1IRXA 1JTXA 4PCQA 5J3LA 3FBNB 2QKOA 1SFEA 3ZMUA 3OYDA 3GZ6A 4UB6C 5LFAA 3ZR8X 2ELKA 1O3TA 2IJLA 2IP2A 4U88A 2E35A 2LP0A 1WI3A 2VXZA 3FX3A 2ZSIB 3OL4A 2LH9A 1FIAA 3D5LA 5E3OA 4MEXF 1IUYA 4HX7A 1XPXA 3KYDB 2MC3A 2P5LC 3OOUA 3BR2A 1R4NB 3K0LA 1MD0A 5J1YA 5DD4A 1ZYRF 1P4WA 4DGWB 2DMNA 2HQAA 2QKMB 2XKPA 5EZGA 3RZOJ 1VQ8I 3F8MA 5D5WB 4IHSA 4GXOA 2D1HA 3MWMA 3OYGA 1ZGAA 5B1BH 2Y0MA 1V54H 2BHZA 1RIOH 3IAM2 5HLGA 2FJ1A 2DG7A 2YX4A 3BHQA 1DUXC 4A3EJ 2EA4A 1FX7A 4EM2A 3ZN0A 1YLFA 3OS0A 2KP6A 1ITYA 2HYTA 2UXPA 3F8FA 2RN7A 3HRTA 5J4VA 1ETXA 4Y13A 3PIPF 2EZIA 3L2UA 1HKQA 3BTIA 5A2QK 1E3HA 2EJRA 3H9GA 4CSWA 2JRTA 2HPMA 5IYCJ 4M3DA 1ZARA 2X1CA 1T98A 4DBQA 2H6CA 4ZJZA 1MJ9A 2R93J 4AIKA 4P9UA 3VTIA 3K70C 5JHUA 3RPUA 5CW8A 3QPTA 3G56A 2CQ7A 3ON4A 1TWGJ 3ASOH 3I53A 2WB1A 4ZYDA 3HTIA 3CJQB 4AIDA 2VPLA 2FMYA 4F3QA 5FKNA 4FCYA 3KX2A 2F5VA 3G3ZA 2O7TA 3RDIA 5IYBJ 4ZC3A 3HIFA 2R7XA 2K02A 5D6EA 4I6ZA 2BYVE 2JA7J 2WAFA 3PFYA 3HRSA 1BOAA 2R7VA 4F91B 4IX7A 4UDSA 1O3RA 4LIVA 4CICA 2Y9ZA 3R61A 4KDPA 1MBKA 2VI6A 2VQLA 3DKWA 3FK7A 3VOEA 5F0FA 3GBGA 3CCSI 3ABUA 4ZYAA 1FT9A 2WA0A 3PNYA 3LWJA 2BHYA 4ZDLA 1P7IA 1F1ZA 2TDXA 1S7EA 4M73A 1BM9A 5EDNA 4BACA 2HXIA 4H4KC 4K2EA 5KAFC 3OS1A 2XUBA 3VP5A 3Q0WA 3BWGA 2DJIA 1XMKA 4AC6A 3RTRA 3MKLA 3L2QA 1WJEA 2DMUA 3D1NI 4HDVA 1Y6IA 5BS6A 2NRAC 1FOYA 3KNWA 1U3EM 2DFEA 1FPQA 4RMNA 1W5CC 2OI8A 2L02A 1Z05A 1HW2A 4A6EA 5J4YA 2V57A 3MAJA 1YTYA 4AUXA 3FXJA 5H6QA 3I0TA 4U0WA 2C6YA 3K4NA 2HGCA 4BJTA 4ZZDA 2V9VA 2KFDA 3HKZA 3DKYA 4B1RA 4YELA 2R3SA 4KT5C 4PGGA 2DFIA 3B6CA 3HIMA 1EH6A 4M6YA 2AQFA 4BXUA 5HODA 3CC4I 2DDAA 4XL9A 2QBYB 1V3FA 3J7ZI 2MGQA 2PEXA 3SFIA 3ISPA 1OCTC 1Y0NA 4NNJA 2GQQA 3DF8A 3JSOA 1F43A 1UB9A 2HYJA 1S72I 5HDNA 5JVGF 4XRFA 3ASNH 4D5FA 1REPC 3C07A 3DPUA 2L4MA 2M2EA 1D3YA 2A69F 1I6HJ 2L4AA 4FISA 1FBQA 1S8NA 1K7AA 3WU2C 4IHYA 1DPUA 2HXOA 4CCLA 2M30A 2FUG2 5J47A 1HW5A 1Z1DA 5LD2C 2NP3A 5IP6A 2VN2A 5FKLA 3N97A 3I59A 2R7WA 1NK3P 2G9WA 2IU5A 3P9KA 2K3PA 1O3SA 4JX5A 4X1EA 3JRCA 1ZREA 2BY0A 3GXOA 3GMEA 3H92A 4KMUX 1VFCA 4ASNA 4XRMA 3NPIA 3KFWX 2M8EA 1RUNA 2Y9YA 1D0ZA 1LEBA 4FHTA 1WJFA 2OTJI 1WRJA 4F7ZA 2PFVA 3Q0UA 4JX4A 5DAJA 3ZQQA 3P5JA 4IRHA 1IDYA 3G73A 5FLXK 4UHTA 2KHMA 4LITA 1I3AA 2PZ9A 1R5HA 3S2HJ 1H9GA 1SFKA 1ZTRA 4ZH4F 2VODA 3JRGA 1TWHJ 1K6YA 1J0RA 3WTXC 4OAZA 2GOMA 4Y17A 1G3WA 3ZPLA 1ENHA 3JCUC 3E7QA 1WI9A 2ZJQF 1LDDA 3RYRA 3AG1H 2HYGD 2XAGA 5E1WA 5IYDJ 1ORKA 3OR1C 5JFRA 2XF6A 1E3OC 3SDBA 3GFLA 3U9GA 3JTHA 2JA8J 4B44A 3OYIA 3QWLA 3LFKA 4MFEA 1LFBA 2PLYA 3A02A 4GGGA 3QKXA 3SWHA 1Z7LA 1J09A 2KZVA 2Y2ZA 3C2BA 4Z6YA 2CV0A 2COBA 2HDCA 3WHCA 3QU3A 4CCNA 4EGZA 1FOXA 1FEXA 2Z33A 3CJTB 3BDDA 3FXLA 3BJBA 4N9HA 1S3JA 2GAUA 5J8CA 3WTTC 4PXIA 1OYWA 2OERA 4OU0A 5EEGA 3KZZA 3LSIA 1XC5A 2OBPA 4XSZF 1LPQA 2PMHA 2R5YA 3A4CA 2FBIA 2VLAA 4LGWA 5FKMA 1R71A 4YIIA 1B4AA 1MBGA 2LKPA 3S32A 1G3SA 3DTEA 1U78A 4PUSA 3M1EA 2O7OA 1IXRC 5D5UB 3TW6A 2W25A 1X1PA 2DFHA 2XGDA 5D6FA 4XLFA 4PDKA 1D0YA 3VVXA 3TW7A 3NS4A 3CD6I 1Z0XA 3WHBA 5C44J 4V2GA 2LFBA 4AIHA 3MEXA 3CUQA 5B3SH 4O6JA 1ETOA 2W85A 2XPWA 2MH9A 3S2WA 1ZR2A 3VFZA 3TMOA 2MSYA 2FQ3A 3LSPA 1N78A 1FBSA 3VODA 2VOOA 3MKWB 5HNFA 2OA4A 5CJ9A 2E1CA 1IRFA 4XBFA 1EJ9A 3RZDJ 1JGSA 1FSEA 2ZXHA 4GCKA 2W82A 1I3QJ 1Y8QB 2DOAA 3W6JB 2GBYA 4P96A 4B47A 2DA2A 2DMPA 1UG2A 2IRFG 3WG7H 1D1AA 4E7IA 3LA3A 3OYFA 2Z5UA 1OCCH 2F4MB 2PMZN 4BDYA 4XM3A 4XLNF 3ONQA 3Q9SA 5DEQA 4XRSG 2HQNA 3DBRB 3U2RA 4D7NA 2D6YA 3CJRB 5C4JJ 1NHAA 2K9SA 4PGHA 4R8HA 1UI6A 2KIQA 5EFYA 1MNEA 3CLOA 3COLA 4BQQA 3BR1A 4HLXA 4O5VA 3VOKA 2ZO4A 3OV8A 2XGEA 2A2FX 2R7DA 3B6AA 4NUBA 3GX4X 1JKRC 1FP1D 2K85A 1XGOA 4UXNA 3BNIA 3BT9A 4BH9A 3F72A 1G6NA 5E8GA 1WH7A 4GCLA 4M9SA 2HDWA 4EM0B 4CZCA 1PJRA 2DOFA 4EGYA 4EJWA 1LJ9A 1W0TA 2K86A 1RPWA 4BHCA 1SANA 2Z3YA 4RS8A 2B7EA 5FRNA 1VQ9I 3KEQA 4L5IA 4U7DA 1ZR4A 2DMTA 2WY8Q 2UV1A 1D5YA 2PBIA 5LRSA 3GTMJ 2G7LA 3RSNA 4HLYA 2W48A 4QIWN 3DP7A 3KP6A 2L9RA 4CCMA 4CUGA 2CWEA 4BNCA 1T39A 3GFIA 1W4MA 2MA3A 2VJ4A 3EDPA 2CQKA 3FHNA 2ME0A 3KZYA 4XR6A 3HTSB 3GTKJ 2PJPA 3IUVA 5FLMJ 1JJ8C 1IAWA 3CCQI 2WY7Q 1KYWA 3S2DJ 1T6SA 2M5WA 3KP2A 3VSLA 2YPRA 2EH3A 3EUHC 3RPQA 3ZMZA 4F93B 3E6CC 4CDGA 3HTUA 3GZNB 2IS1A 4BBSJ 3D0SA 3ZOBA 4EVIA 4XKCA 1NG6A 1MGTA 2Z2SB 4A6DA 1K79A 3FF5A 3CUOA 3V78A 3CF5F 2IBDA 3C1DA 4YIFA 1A35A 4J19A 4OINF 1DDNA 3EUPA 2NVQJ 5JLWA 3ABKH 2ZCXA 3MN2A 3ZGKA 3OYKA 2OCCH 2EPFA 3WODF 1XD7A 2A61A 3EGQA 5FFXA 1L3LA 3HEFA 2L2OA 2IGNA 3H3ZA 3BJAA 1JE8A 2XGCA 4AWXB 1K61A 2KKOA 4KT6A 1ODDA 2DDBA 1MKMA 2W4SA 4CCKA 4RGRA 2ELHA 1K6OA 1ZAOA 5BOXA 1SVOA 2A05A 3BC8A 4D7MA 1Q1HA 3NQOA 4I98B 4RAYA 2KIMA 3S3NA 1UMQA 1BR1A 5LEJA 1Z7UA 2ADUA 2PMZA 2DA4A 1T56A 1FYKA 4XKWA 1TBXA 1LDKB 1YFHA 4N0BA 3CMYA 1WSUA 3BOQA 1B72B 1QNTA 2R5ZA 3KKCA 1WGXA 2NXNB 2IXSA 3AFHA 4AYBN 1JJ6C 5E3NA 4ZTJA 2VUMJ 2ZBKA 1IV8A 3S17J 4H0EA 1D1BA 3OYAA 1VQ7I 1BW6A 4AC0A 4KITB 1W0UA 2VKDA 3SYTA 3LSMA 4ICHA 1OFCX 3DPTA 2Y0SN 1Z3YA 2RVCA 4LIUA 1FJLA 2EFWA 1U8RA 1USTA 2M45A 3NAUA 1SVLA 3KZIC 2E34A 1X4PA 1P7JA 1VZ0A 3L2WA 2XRNA 5GADJ 1X1DA 3VSKA 4KJZA 4Q4ZF 1RKTA 2VB6A 2GIZA 2LDUA 2DN0A 3BR6A 4DJAA 9ANTA 4HEA2 4IHTA 3K4JA 4B3XA 1QQIA 5H6RA 1AOYA 4UVBA 5HS9A 2B3WA 3GFJA 4WIBA 2F5CA 1MH4A 1W7PD 2V79A 1BC8C 2DW4A 3H5NA 1F5TA 1CF7B 4HYEA 2L7MP 4BQNA 2OJED 2LD5A 3MZHA 1MNDA 4LG0A 1OPCA 3RPUD 3GCMA 1IN7A 4ANJA 2PJRB 3RH2A 3FBIB 3J80Z 2LTPA 5IT9Z 3ZQCA 2KIUA 1D0XA 3SEZA 4RB3C 2K9MA 1DGRM 2HI3A 1BI2A 3T6NA 3VYSB 1NK2P 3GFMA 2GLOA 1B6AA 3M9AA 5HVQC 2OQGA 3NEUA 2QENA 1XGMA 2DTRA 2ZJRF 1EKEA 1ZQ3P 1DP3A 3HM5A 3OOPA 2ISYA 1X1CA 4GCTA 2QQ8A 4UVCA 3M8JA 3R0JA 1MIJA 3BG6A 5E20A 1DP7P 4GFKA 2CU7A 2JUCA 2X6WA 2W53A 3ESWB 3ZCOA 4I0AA 4LG3A 1U5TA 1UHWA 2VBYA 5KCMA 3PASA 2NS8A 3BPXA 1LE8B 4N4NB 1XS9A 2HNHA 2QLZA 4HQEA 1PVEA 2GM4A 4GFBA 3HDDA 1PP8F 2FXAA 3F22A 4HNVA 3FXUA 1V4RA 1RI7A 2R7OA 2JUGA 3ML6A 4M3GA 1SC7A 1WJCA 4JKZA 1RR7A 1W1WE 3V8KA 2RREA 3K7AJ 2K5CA 1RNLA 1WJBA 2ZMEC 2KDOA 3EPZA 2UXOA 2EFPA 3MKYB 4E7JA 4ZZLA 3JW4A 3JAMK 4I01A 1R1VA 3G1LA 3OSFA 4IRGA 2G7SA 4G94A 1AWCA 4U7BA 3L00A 4ESJA 2DT7B 2IA1A 5ILVA 1HDDC 4BGDA 4U9LA 4ENKA 2XVCA 3IC7A 1H89C 4E7ZA 1KU3A 4EATA 1WJAA 3DV8A 3OYCA 2QOPA 2EIMH 3BY6A 3T0YA 1OCPA 3OYJA 2OUMA 1VQNI 5M5WJ 4A3IJ 4CGZA 1TC3C 1HLVA 3PPBA 1FYLA 2G7GA 1SFXA 2HZDA 1AHDP 2E2HJ 5EGOB 3Q0VA 4XLEA 3LQRA 2NS7A 3V7RA 1GT0C 1ON1A 2X9DA 3F6VA 3A0HC 4P1WA 3LAPA 3OSGA 5K7FA 1T8IA 1X3WB 1POGA 4I2OA 2VBXA 3PL8A 1FTTA 2IA2A 2MLGA 1ZHFA 4ZYHA 3E7LA 4KICA 1JKQC 1MNMC 2L01A 3TO7A 1XGSA 5GAHJ 2R4GA 2V1NA 5IP7J 5CQEA 3FKIJ 1U9NA 2IAIA 4HSTA 5IOYA 1IO2A 1V5EA 2IW5A 3WE3A 3IKTA 3CCLI 2RQPA 2WWYA 2HDDA 4UUSB 5CXIA 1Y1WJ 4J01A 2D1VA 3H1CA 3MKZA 5TISC 3H35A 1IV6A 1IRGA 1U6GA 2E1MB 3BCAA 3WU0A 2KJCA 1BI0A 3TOAA 3H5AA 2LREA 2RDPA 3ZMSA 5F04A 2G0EA 1HW1A 2HR3A 2JT1A 1B8IB 1S5LC 2I5UA 5F08A 3DQVC 2AQEA 1JUSA 2FEZA 1AKHB 3ECOA 5E3MA 1XTAA 2XPUA 1N25A 2FU4A 4YFXF 4KA4A 3UR3C 1LFPA 2KPMA 4Y15A 5EYRA 4RGUA 1AU7A 3QOEA 4AVPA 2W57A 2RV8A 3RKXA 4LB5A 1JKPC 4C3JJ 3ABLH 1OISA 3BP8A 4RGXA 2JA2A 4FQGA 5IY5H 1HQCA 4BE0A 4BHBA 3HTAA 5K7ZA 2HKUA 2LF8A 4D9JA 2ETHA 3RD3A 1G59A 4HX8A 3O6BB 3HTHA 1E3PA 1HOMA 2EV6A 3V6GA 2BVMA 2JMWA 1ZG1A 1TTYA 1BR4A 1J59A 1Z21A 4HZFA 4U0YA 3F23A 3CCJI 3CMEI 4OIQF 1IN8A 1MMNA 1JT0A 4XOPA 4IHXA 3AQSA 1ZG3A 3GO5A 1G8XA 2HS5A 4IRIA 4BE1A 1XGNA 3LA2A 3AAFA 2Y69H 2PG4A 4XRSA 1JI8A 2Y31A 2RQQA 2J5OA 5B5EC 4CYCA 5GP9A 1W7PB 1YG2A 2YVXA 2WAEA 2GIVA 5LBQA 3GZIA 2DOEA 3TGNA 3W6VA 3E5QA 2VXDA 4M72A 1R1TA 1WJ5A 1F4KA 2LF7A 3F6OA 2R7SA 5DUIA 4FASD 1OQYA 5JLXA 3GZ5A 4HAMA 2EK5A 1ZH5A 1HBXG 1R7JA 2VASA 3JTGA 4YZEA 2VOPA 2R7FA 3HB9A 1IUFA 2F6CA 4MXMA 3S16J 4YG2F 2Q24A 1SFOJ 5FFZA 1QHHD 2OU2A 2F5EA 2L3DA 2K27A 1X4OA 4DYQA 5KVRA 2H09A 2L7KA 2VJIA 4ENMA 4HA8A 3I4PA 2VQHA 2VT2A 3SQNA 4WCGA 5L3FA 3PO3J 2L9SA 5EG0A 1TW2A 2JRMA 2P8TA 3W6KB 2OF7A 1FP2A 4MQ9F 4M6XA 2Q1ZB 1X2MA 1HKTA 5BQTA 1HKSA 3FISA 3HOTA 3C18A 1UHSA 3CCYA 3O8HA 1YX3A 5FD5A 2QSFX
chains in the Genus database with same CATH topology
3LOCA 5FKMA 4FTHA 1MBGA 1MBEA 3HGYA 1U78A 2KT0A 1WH5A 2O7OA 5HBUA 3TW6A 2XGDA 5EEAA 2K9QA 1X58A 4A3LJ 3VVXA 1BL0A 3DPJA 3TW7A 2XB0X 4B4CA 4JP0A 1Z0XA 3S15J 3WHBA 5C44J 4V2GA 2LFBA 1GDTA 3I4NJ 2YVHA 1ETOA 2WB1N 2XPWA 1R9TJ 3MVPA 1ZR2A 3HTJA 1PUFA 2MSYA 3H3VK 3LSPA 5AQCA 2E19A 3VW2A 4JX6A 3BQZA 1MBJA 3ZQFA 4A3FJ 3PO2J 3RZDJ 3IV5A 4A3CJ 5K58A 4BY7J 1APLC 4GCKA 3JRHA 1I3QJ 2HOSA 2GBYA 3ZQIA 3LSRA 2DA2A 2DMPA 5FLVA 4NELA 1UG2A 4W1UA 2CUFA 2ECCA 2CQXA 2ZB9A 3I4MJ 3ANPA 3P9TA 5FMPA 2ZCMA 1VI0A 4HKUA 2XRLA 2PMZN 3TP0A 4QTRA 1ETKA 5IOZA 2QWTA 2YVEA 4A3JJ 2X48A 3ON2A 4XRSG 3O60A 3HOUJ 3S1NJ 2GUHA 4D7NA 4XIDA 5GPAA 4A3MJ 2D6YA 3VUQA 5C4JJ 1JTYA 2K9SA 2L7FP 1UI6A 3IH3A 1ZK8A 2H1KA 4M3FA 1A6IA 5EFYA 5HAWA 2E2JJ 1TWFJ 3COLA 3HOYJ 3LHQA 3BR1A 3VOKA 1K83J 4IHVA 2JWTA 2EZKA 2XSDC 2AO9A 3JR9A 2XGEA 3B6AA 2NP5A 2K40A 1JKRC 5F1JA 4GFLA 3BR5A 2D5VA 1TWCJ 4CYCB 2F07A 2FD5A 1RKWA 3BNIA 3BT9A 5DTDA 2LLKA 4GCLA 2DTZA 1WH7A 4L62A 1AKHA 4BY1J 1QVTA 3HKZN 1QVUA 1WPKA 1W0TA 4A93J 2JA5J 2ZOZA 1DU0A 1RPWA 4IEJA 1SANA 3VVZA 2FQ4A 2HQ5A 1ZR4A 2DMTA 4UUTA 1VNDA 1IRZA 2ECBA 1D5YA 3G1MA 3A03A 2LVSA 3GTMJ 2G7LA 2CQQA 2W48A 4QIWN 1IDZA 2L9RA 4FE7A 3BG3A 4Y52J 2QF7A 3FK6A 1Y1VJ 4C3IJ 4MFDA 3GTKJ 4ME9A 2ME0A 1VF9A 3IUVA 5FLMJ 1JJ8C 4LOCA 1I50J 4JYKA 3S14J 3GTOJ 5HSZA 5EG0B 3S2DJ 3NRGA 4DYRA 4IHWA 2DJNA 1CQTA 3HOZJ 2EH3A 3HOWJ 1TWAJ 1DU6A 4BKXA 2VKEA 4XK4A 3G7RA 3O8GA 4NDLA 3S1MJ 2EZHA 3JREA 3ZOBA 3TEDA 4BBSJ 1ETQA 3V78A 2IBDA 4A69C 4J19A 3EUPA 2NVQJ 5JLWA 2DG8A 1ETYA 3MN2A 2ZCXA 3HOXJ 3ZQLA 3KZ9A 2LKXA 3JRAA 5H9TA 2QCOA 1F36A 4A3DJ 1A5JA 2QTQA 2XDNA 3EGQA 3HEFA 4FE4A 1HF0A 4W97A 4M6VA 2NVYJ 3DCFA 2XGCA 2RAEA 3S1QJ 1K61A 4A3BJ 1HDPA 3BTLA 3BTCA 5EF6A 2K9NA 1GUUA 2FX0A 1PUFB 4RDUA 4D7MA 5FKOA 4ABZA 5FGLA 5J1RA 4DZJA 1JUPA 2P81A 2I10A 1UMQA 1YRNA 4AF5A 4JNNA 2UXIA 2DA4A 1T56A 2ME6A 5F0CA 3ZQGA 3CMYA 5EGOA 2YU9J 5C3EJ 1B72B 3KKCA 2R5ZA 1JT6A 1WGXA 3F0CA 4AYBN 2XPVA 1O4XA 2WGBA 3VW1A 4G12A 1JJ6C 5E3NA 3QQAA 4V2FA 2VUMJ 1QRYA 2YUSA 5E3LA 3VIBA 3S17J 2X6OA 4BBRJ 1NTCA 3BG9A 5FKKA 1BW6A 3HE0A 5BNGA 4AC0A 2L7ZA 1W0UA 5C4YA 1GV2A 5F27A 2HOTA 2WUIA 4ICHA 3OIOA 1OFCX 4B3AA 2Y0SN 2R7ZJ 5DS9A 1FJLA 2R92J 2ID3A 2JA6J 5IPAA 2MW8A 3NAUA 3VPRA 2DMQA 1P7JA 3BR3A 4UUSA 4EEFG 1IG7A 4JL3A 3F1BA 2VKVA 1RKTA 2ID6A 3NARA 4MO7A 3A01A 2DN0A 3BR6A 9ANTA 3G1OA 1FTZA 5M5YJ 1OJLA 1MH4A 1B8IA 1EF4A 3RKQA 1IGNA 2O8KA 2L7MP 2LD5A 1JTXA 5J3LA 2UXHA 3RH2A 2QKOA 3L1PA 2WV1A 1GVDA 2LTPA 2DA6A 3ZQCA 2ELKA 4RBOA 2HI3A 2LP0A 1WI3A 4DZPA 5E3OA 3T6NA 1MH3A 3JRDA 1FIAA 1NK2P 2JN6A 2M34A 2GLOA 3OOUA 1ZQ3P 3BR2A 3B81A 5K7HA 3HM5A 1U9OA 5J1YA 2LK2A 4GCTA 2DA1A 2NOGA 2DMNA 5J1UA 4GFKA 2CU7A 3TP3A 5EZGA 3RZOJ 4DW6A 2W53A 3NI7A 4M3EA 5M3MJ 3PASA 3GTJJ 2NS8A 1ZGWA 2FJ1A 2DG7A 3BHQA 3CWRA 5FHPA 1LE8B 2VPRA 4A3EJ 1XS9A 2GM4A 1U8BA 3BG5A 4XICA 1ITYA 2HYTA 2UXPA 1IJWC 3AQTA 4GFBA 3HDDA 1HCRA 1ETXA 3BTJA 2EZIA 3CDLA 2CUEA 4HNVA 3BTIA 5C4XJ 3FRQA 1FIPA 2TRTA 2EQRA 2M8GX 4M3GA 2ZCNA 4JKZA 1RR7A 5IYCJ 4S0HB 3JSJA 4M3DA 4Y7NJ 2R5YB 3NNRA 3K7AJ 5D19A 3IH4A 2R93J 3FIWA 2UXOA 1MBFA 3IH2A 1G2HA 3G1LA 3OSFA 2G7SA 5CW8A 3G56A 3ON4A 1TWGJ 2LR8A 2GENA 3HTIA 1HDDC 5FKNA 4FCYA 1IC8A 2DA3A 3LSJA 1H89C 1H88C 2O7TA 1YRNB 3HOVJ 5IYBJ 2E2IJ 2FBQA 2QIBA 1UI5A 2QOPA 3NXCA 3M3YJ 3UKGA 1OCPA 4I6ZA 5M5WJ 4A3IJ 1TC3C 2JA7J 1HLVA 3PPBA 2O9LA 2G7GA 1AHDP 4UDSA 2E2HJ 3BCGA 5EGOB 3Q0VA 2Y9ZA 2NS7A 3FK7A 1MBKA 2VI6A 1MBHA 2R5ZB 2YS9A 4X6AJ 2JJ7A 5F0FA 1GT0C 3GBGA 2X9DA 4MLOA 3VVYA 3LWJA 4NN1A 3OSGA 4D5CA 4BXXJ 1P7IA 5K7FA 1H8AC 3M4OJ 5D1RA 1S7EA 3LJLA 3ANGA 1POGA 2DA7A 3DEWA 2HXIA 3PM1A 5EDNA 2TCTA 3MNLA 5D18A 3VP5A 1XG1A 3Q0WA 1FTTA 1ETWA 3E7LA 4A3KJ 1JKQC 1MNMC 4AC6A 3MKLA 3S5RA 2DMUA 3D1NI 3KNWA 5IP7J 1MSFC 3FKIJ 3RQIA 1U9NA 2IAIA 5IOYA 2OI8A 2CJJA 2HDDA 4UUSB 5CXIA 1JUMA 1Y1WJ 2V57A 3GTQJ 4MIMA 4A3GJ 4MK6A 2JK3A 1IV6A 2NVTJ 4AUXA 2MG4A 2DA5A 5F0HA 3A01B 2HOAA 5M3FJ 2AHQA 3GTLJ 5F04A 4B1RA 2Y30A 3CRJA 1Z77A 2EZLA 2G0EA 3JRFA 1WCMJ 3B6CA 1B8IB 3HIMA 1X2NA 5F08A 5HODA 1JUSA 3HBLA 1AKHB 2MGQA 3HGGA 5E3MA 3SFIA 1OCTC 1BA5A 2XPUA 2NX4A 2NVXJ 3S1RJ 1AU7A 5EYRA 3ZQHA 1F43A 1B72A 2HYJA 3VW0A 4D5FA 3C07A 1JKPC 4C3JJ 3SDGA 5FJ8J 2M2EA 3GEUA 1I6HJ 4FISA 2R0QC 3GTPJ 4IHYA 3Q3SA 2HXOA 4DYCA 3CJDA 5K7ZA 3HTAA 4M3BA 2E1OA 2HKUA 3RD3A 2NP3A 5IP6A 3LNQA 5FKLA 2GFNA 3HTHA 1BW5A 1HOMA 3BRUA 1NK3P 3V6GA 2IU5A 2JMWA 3QPSA 4JX5A 4X1EA 3JRCA 3VOXA 2H8RA 1VFCA 2RHAA 1JT0A 4XRMA 4IHXA 1RESA 3AQSA 3NPIA 2PBXA 4KWAA 1Q1VA 2UXUA 2Y9YA 1ETVA 3CQZJ 1T33A 3JRIA 2REKA 2M0CA 4C2MJ 4XRSA 2Y31A 3K2AA 2WAQN 5GP9A 2EBIA 4CYCA 3Q0UA 1ZKGA 4JX4A 2IEKA 5DAJA 3JRBA 3GZIA 1IDYA 3W6VA 1GV5A 2KDZA 2PZ9A 3S2HJ 4L5EA 1JKOC 1ZTRA 2B63J 3JRGA 1TWHJ 3QBMA 4ACIA 5JLXA 3BR0A 1MSEC 3QPLA 1SGMA 1ENHA 4I76A 3E7QA 4YZEA 3GTGJ 3HB9A 1IUFA 5EZHA 4MXMA 3S16J 2Q24A 5GPCA 5CXGA 1RETA 1SFOJ 1JGGA 5IYDJ 1ORKA 1E3OC 2CRGA 4DYQA 2JA8J 1QPIA 3KKDA 3H0GJ 2XB5A 4MFEA 1LFBA 3A02A 3QKXA 3PO3J 3C2BA 2Y2ZA 1BJZA 5EG0A 3BQYA 2OPTA 1LE8A 2ZOYA 2COBA 5IP9J 3WHCA 2OF7A 2L0KA 1FEXA 2M9HA 3BJBA 1X2MA 2N8GA 4PXIA 2LY9A 5M5XJ 2OERA 3FISA 3LSGA 1LFUP 1XC5A 3SJMA 1UHSA 3CCYA 3O8HA 2RASA 4CGRA 4QSHA 4C3HJ 2R5YA 2G3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOC A;  5FKM A;  4FTH A;  1MBG A;  1MBE A;  3HGY A;  1U78 A;  2KT0 A;  1WH5 A;  2O7O A;  5HBU A;  3TW6 A;  2XGD A;  5EEA A;  2K9Q A;  1X58 A;  4A3L J;  3VVX A;  1BL0 A;  3DPJ A;  3TW7 A;  2XB0 X;  4B4C A;  4JP0 A;  1Z0X A;  3S15 J;  3WHB A;  5C44 J;  4V2G A;  2LFB A;  1GDT A;  3I4N J;  2YVH A;  1ETO A;  2WB1 N;  2XPW A;  1R9T J;  3MVP A;  1ZR2 A;  3HTJ A;  1PUF A;  2MSY A;  3H3V K;  3LSP A;  5AQC A;  2E19 A;  3VW2 A;  4JX6 A;  3BQZ A;  1MBJ A;  3ZQF A;  4A3F J;  3PO2 J;  3RZD J;  3IV5 A;  4A3C J;  5K58 A;  4BY7 J;  1APL C;  4GCK A;  3JRH A;  1I3Q J;  2HOS A;  2GBY A;  3ZQI A;  3LSR A;  2DA2 A;  2DMP A;  5FLV A;  4NEL A;  1UG2 A;  4W1U A;  2CUF A;  2ECC A;  2CQX A;  2ZB9 A;  3I4M J;  3ANP A;  3P9T A;  5FMP A;  2ZCM A;  1VI0 A;  4HKU A;  2XRL A;  2PMZ N;  3TP0 A;  4QTR A;  1ETK A;  5IOZ A;  2QWT A;  2YVE A;  4A3J J;  2X48 A;  3ON2 A;  4XRS G;  3O60 A;  3HOU J;  3S1N J;  2GUH A;  4D7N A;  4XID A;  5GPA A;  4A3M J;  2D6Y A;  3VUQ A;  5C4J J;  1JTY A;  2K9S A;  2L7F P;  1UI6 A;  3IH3 A;  1ZK8 A;  2H1K A;  4M3F A;  1A6I A;  5EFY A;  5HAW A;  2E2J J;  1TWF J;  3COL A;  3HOY J;  3LHQ A;  3BR1 A;  3VOK A;  1K83 J;  4IHV A;  2JWT A;  2EZK A;  2XSD C;  2AO9 A;  3JR9 A;  2XGE A;  3B6A A;  2NP5 A;  2K40 A;  1JKR C;  5F1J A;  4GFL A;  3BR5 A;  2D5V A;  1TWC J;  4CYC B;  2F07 A;  2FD5 A;  1RKW A;  3BNI A;  3BT9 A;  5DTD A;  2LLK A;  4GCL A;  2DTZ A;  1WH7 A;  4L62 A;  1AKH A;  4BY1 J;  1QVT A;  3HKZ N;  1QVU A;  1WPK A;  1W0T A;  4A93 J;  2JA5 J;  2ZOZ A;  1DU0 A;  1RPW A;  4IEJ A;  1SAN A;  3VVZ A;  2FQ4 A;  2HQ5 A;  1ZR4 A;  2DMT A;  4UUT A;  1VND A;  1IRZ A;  2ECB A;  1D5Y A;  3G1M A;  3A03 A;  2LVS A;  3GTM J;  2G7L A;  2CQQ A;  2W48 A;  4QIW N;  1IDZ A;  2L9R A;  4FE7 A;  3BG3 A;  4Y52 J;  2QF7 A;  3FK6 A;  1Y1V J;  4C3I J;  4MFD A;  3GTK J;  4ME9 A;  2ME0 A;  1VF9 A;  3IUV A;  5FLM J;  1JJ8 C;  4LOC A;  1I50 J;  4JYK A;  3S14 J;  3GTO J;  5HSZ A;  5EG0 B;  3S2D J;  3NRG A;  4DYR A;  4IHW A;  2DJN A;  1CQT A;  3HOZ J;  2EH3 A;  3HOW J;  1TWA J;  1DU6 A;  4BKX A;  2VKE A;  4XK4 A;  3G7R A;  3O8G A;  4NDL A;  3S1M J;  2EZH A;  3JRE A;  3ZOB A;  3TED A;  4BBS J;  1ETQ A;  3V78 A;  2IBD A;  4A69 C;  4J19 A;  3EUP A;  2NVQ J;  5JLW A;  2DG8 A;  1ETY A;  3MN2 A;  2ZCX A;  3HOX J;  3ZQL A;  3KZ9 A;  2LKX A;  3JRA A;  5H9T A;  2QCO A;  1F36 A;  4A3D J;  1A5J A;  2QTQ A;  2XDN A;  3EGQ A;  3HEF A;  4FE4 A;  1HF0 A;  4W97 A;  4M6V A;  2NVY J;  3DCF A;  2XGC A;  2RAE A;  3S1Q J;  1K61 A;  4A3B J;  1HDP A;  3BTL A;  3BTC A;  5EF6 A;  2K9N A;  1GUU A;  2FX0 A;  1PUF B;  4RDU A;  4D7M A;  5FKO A;  4ABZ A;  5FGL A;  5J1R A;  4DZJ A;  1JUP A;  2P81 A;  2I10 A;  1UMQ A;  1YRN A;  4AF5 A;  4JNN A;  2UXI A;  2DA4 A;  1T56 A;  2ME6 A;  5F0C A;  3ZQG A;  3CMY A;  5EGO A;  2YU9 J;  5C3E J;  1B72 B;  3KKC A;  2R5Z A;  1JT6 A;  1WGX A;  3F0C A;  4AYB N;  2XPV A;  1O4X A;  2WGB A;  3VW1 A;  4G12 A;  1JJ6 C;  5E3N A;  3QQA A;  4V2F A;  2VUM J;  1QRY A;  2YUS A;  5E3L A;  3VIB A;  3S17 J;  2X6O A;  4BBR J;  1NTC A;  3BG9 A;  5FKK A;  1BW6 A;  3HE0 A;  5BNG A;  4AC0 A;  2L7Z A;  1W0U A;  5C4Y A;  1GV2 A;  5F27 A;  2HOT A;  2WUI A;  4ICH A;  3OIO A;  1OFC X;  4B3A A;  2Y0S N;  2R7Z J;  5DS9 A;  1FJL A;  2R92 J;  2ID3 A;  2JA6 J;  5IPA A;  2MW8 A;  3NAU A;  3VPR A;  2DMQ A;  1P7J A;  3BR3 A;  4UUS A;  4EEF G;  1IG7 A;  4JL3 A;  3F1B A;  2VKV A;  1RKT A;  2ID6 A;  3NAR A;  4MO7 A;  3A01 A;  2DN0 A;  3BR6 A;  9ANT A;  3G1O A;  1FTZ A;  5M5Y J;  1OJL A;  1MH4 A;  1B8I A;  1EF4 A;  3RKQ A;  1IGN A;  2O8K A;  2L7M P;  2LD5 A;  1JTX A;  5J3L A;  2UXH A;  3RH2 A;  2QKO A;  3L1P A;  2WV1 A;  1GVD A;  2LTP A;  2DA6 A;  3ZQC A;  2ELK A;  4RBO A;  2HI3 A;  2LP0 A;  1WI3 A;  4DZP A;  5E3O A;  3T6N A;  1MH3 A;  3JRD A;  1FIA A;  1NK2 P;  2JN6 A;  2M34 A;  2GLO A;  3OOU A;  1ZQ3 P;  3BR2 A;  3B81 A;  5K7H A;  3HM5 A;  1U9O A;  5J1Y A;  2LK2 A;  4GCT A;  2DA1 A;  2NOG A;  2DMN A;  5J1U A;  4GFK A;  2CU7 A;  3TP3 A;  5EZG A;  3RZO J;  4DW6 A;  2W53 A;  3NI7 A;  4M3E A;  5M3M J;  3PAS A;  3GTJ J;  2NS8 A;  1ZGW A;  2FJ1 A;  2DG7 A;  3BHQ A;  3CWR A;  5FHP A;  1LE8 B;  2VPR A;  4A3E J;  1XS9 A;  2GM4 A;  1U8B A;  3BG5 A;  4XIC A;  1ITY A;  2HYT A;  2UXP A;  1IJW C;  3AQT A;  4GFB A;  3HDD A;  1HCR A;  1ETX A;  3BTJ A;  2EZI A;  3CDL A;  2CUE A;  4HNV A;  3BTI A;  5C4X J;  3FRQ A;  1FIP A;  2TRT A;  2EQR A;  2M8G X;  4M3G A;  2ZCN A;  4JKZ A;  1RR7 A;  5IYC J;  4S0H B;  3JSJ A;  4M3D A;  4Y7N J;  2R5Y B;  3NNR A;  3K7A J;  5D19 A;  3IH4 A;  2R93 J;  3FIW A;  2UXO A;  1MBF A;  3IH2 A;  1G2H A;  3G1L A;  3OSF A;  2G7S A;  5CW8 A;  3G56 A;  3ON4 A;  1TWG J;  2LR8 A;  2GEN A;  3HTI A;  1HDD C;  5FKN A;  4FCY A;  1IC8 A;  2DA3 A;  3LSJ A;  1H89 C;  1H88 C;  2O7T A;  1YRN B;  3HOV J;  5IYB J;  2E2I J;  2FBQ A;  2QIB A;  1UI5 A;  2QOP A;  3NXC A;  3M3Y J;  3UKG A;  1OCP A;  4I6Z A;  5M5W J;  4A3I J;  1TC3 C;  2JA7 J;  1HLV A;  3PPB A;  2O9L A;  2G7G A;  1AHD P;  4UDS A;  2E2H J;  3BCG A;  5EGO B;  3Q0V A;  2Y9Z A;  2NS7 A;  3FK7 A;  1MBK A;  2VI6 A;  1MBH A;  2R5Z B;  2YS9 A;  4X6A J;  2JJ7 A;  5F0F A;  1GT0 C;  3GBG A;  2X9D A;  4MLO A;  3VVY A;  3LWJ A;  4NN1 A;  3OSG A;  4D5C A;  4BXX J;  1P7I A;  5K7F A;  1H8A C;  3M4O J;  5D1R A;  1S7E A;  3LJL A;  3ANG A;  1POG A;  2DA7 A;  3DEW A;  2HXI A;  3PM1 A;  5EDN A;  2TCT A;  3MNL A;  5D18 A;  3VP5 A;  1XG1 A;  3Q0W A;  1FTT A;  1ETW A;  3E7L A;  4A3K J;  1JKQ C;  1MNM C;  4AC6 A;  3MKL A;  3S5R A;  2DMU A;  3D1N I;  3KNW A;  5IP7 J;  1MSF C;  3FKI J;  3RQI A;  1U9N A;  2IAI A;  5IOY A;  2OI8 A;  2CJJ A;  2HDD A;  4UUS B;  5CXI A;  1JUM A;  1Y1W J;  2V57 A;  3GTQ J;  4MIM A;  4A3G J;  4MK6 A;  2JK3 A;  1IV6 A;  2NVT J;  4AUX A;  2MG4 A;  2DA5 A;  5F0H A;  3A01 B;  2HOA A;  5M3F J;  2AHQ A;  3GTL J;  5F04 A;  4B1R A;  2Y30 A;  3CRJ A;  1Z77 A;  2EZL A;  2G0E A;  3JRF A;  1WCM J;  3B6C A;  1B8I B;  3HIM A;  1X2N A;  5F08 A;  5HOD A;  1JUS A;  3HBL A;  1AKH B;  2MGQ A;  3HGG A;  5E3M A;  3SFI A;  1OCT C;  1BA5 A;  2XPU A;  2NX4 A;  2NVX J;  3S1R J;  1AU7 A;  5EYR A;  3ZQH A;  1F43 A;  1B72 A;  2HYJ A;  3VW0 A;  4D5F A;  3C07 A;  1JKP C;  4C3J J;  3SDG A;  5FJ8 J;  2M2E A;  3GEU A;  1I6H J;  4FIS A;  2R0Q C;  3GTP J;  4IHY A;  3Q3S A;  2HXO A;  4DYC A;  3CJD A;  5K7Z A;  3HTA A;  4M3B A;  2E1O A;  2HKU A;  3RD3 A;  2NP3 A;  5IP6 A;  3LNQ A;  5FKL A;  2GFN A;  3HTH A;  1BW5 A;  1HOM A;  3BRU A;  1NK3 P;  3V6G A;  2IU5 A;  2JMW A;  3QPS A;  4JX5 A;  4X1E A;  3JRC A;  3VOX A;  2H8R A;  1VFC A;  2RHA A;  1JT0 A;  4XRM A;  4IHX A;  1RES A;  3AQS A;  3NPI A;  2PBX A;  4KWA A;  1Q1V A;  2UXU A;  2Y9Y A;  1ETV A;  3CQZ J;  1T33 A;  3JRI A;  2REK A;  2M0C A;  4C2M J;  4XRS A;  2Y31 A;  3K2A A;  2WAQ N;  5GP9 A;  2EBI A;  4CYC A;  3Q0U A;  1ZKG A;  4JX4 A;  2IEK A;  5DAJ A;  3JRB A;  3GZI A;  1IDY A;  3W6V A;  1GV5 A;  2KDZ A;  2PZ9 A;  3S2H J;  4L5E A;  1JKO C;  1ZTR A;  2B63 J;  3JRG A;  1TWH J;  3QBM A;  4ACI A;  5JLX A;  3BR0 A;  1MSE C;  3QPL A;  1SGM A;  1ENH A;  4I76 A;  3E7Q A;  4YZE A;  3GTG J;  3HB9 A;  1IUF A;  5EZH A;  4MXM A;  3S16 J;  2Q24 A;  5GPC A;  5CXG A;  1RET A;  1SFO J;  1JGG A;  5IYD J;  1ORK A;  1E3O C;  2CRG A;  4DYQ A;  2JA8 J;  1QPI A;  3KKD A;  3H0G J;  2XB5 A;  4MFE A;  1LFB A;  3A02 A;  3QKX A;  3PO3 J;  3C2B A;  2Y2Z A;  1BJZ A;  5EG0 A;  3BQY A;  2OPT A;  1LE8 A;  2ZOY A;  2COB A;  5IP9 J;  3WHC A;  2OF7 A;  2L0K A;  1FEX A;  2M9H A;  3BJB A;  1X2M A;  2N8G A;  4PXI A;  2LY9 A;  5M5X J;  2OER A;  3FIS A;  3LSG A;  1LFU P;  1XC5 A;  3SJM A;  1UHS A;  3CCY A;  3O8H A;  2RAS A;  4CGR A;  4QSH A;  4C3H J;  2R5Y A;  2G3B A; 
#chains in the Genus database with same CATH topology
 3LOC A;  1KON A;  4II2 A;  3CMA I;  4E4H A;  3S3O A;  2ZFW A;  5ICE A;  1TLH B;  3V42 A;  3K2Z A;  5D5V B;  3HGY A;  2M4G A;  3BZ6 A;  2HEO A;  2KT0 A;  3WE2 A;  3QYF A;  5D5X B;  4OOI A;  1QZY A;  2LSO A;  5CVV A;  3R0A A;  1X58 A;  1BL0 A;  2QWW A;  4X0G A;  3S15 J;  3D5S C;  1IXC A;  2ELJ A;  4BU2 A;  3DBL B;  4YRV A;  2F5F A;  1XDS A;  4EV0 A;  4HF1 A;  2YVH A;  1WQ2 A;  3OL3 A;  1R9T J;  2XAS A;  5KHD A;  1P4A A;  1YYV A;  2JZY A;  4TV7 A;  3E1S A;  2E19 A;  4JX6 A;  3U21 A;  2UXX A;  5DM7 F;  4A3F J;  1E17 A;  2DK5 A;  1UZC A;  1APL C;  1X3Z B;  3GW2 A;  3LSR A;  3O3K A;  1TQP A;  4W1U A;  1S29 A;  2ECC A;  2CQX A;  2ZB9 A;  2CW0 F;  3P9T A;  1I1G A;  5FO5 A;  1J75 A;  3IHU A;  2E5Z A;  3QYE A;  2DU9 A;  2V7F A;  2XRL A;  3TP0 A;  4QTR A;  2YVE A;  5IOZ A;  2QWT A;  1W5S A;  3I59 B;  4A3J J;  2V6C A;  2DPD A;  2DXI A;  2GUH A;  2QQ9 A;  4XID A;  3QU6 A;  4A3M J;  2OZ6 A;  1JTY A;  3IH3 A;  4M9Z A;  1WHU A;  1ZK8 A;  2HZT A;  4M3F A;  3ZMT A;  2O61 A;  2ZCW A;  3HOY J;  2IT0 A;  2HKX A;  1K83 J;  4IHV A;  2EZK A;  5D8L B;  4OMY A;  2MC4 A;  2LKS A;  4BYY A;  2K40 A;  4L0Y B;  4U0V A;  2R7U A;  1TWC J;  3NRV A;  1BN5 A;  1OR7 C;  1RKW A;  4MQV A;  5DTD A;  4N9I A;  3Q5F A;  5LGU A;  1SD7 A;  3L2C A;  1WFX A;  3FMS A;  4XQF A;  1QVT A;  2VC1 A;  2FNA A;  1WPK A;  5E1X A;  3NWT A;  2ISZ A;  5L3C A;  4KYW A;  5GAG J;  2V26 A;  3VVZ A;  1VQO I;  1LQ1 A;  4A0Z A;  2FQ4 A;  1IRZ A;  3HPH A;  2CH0 A;  3R4K A;  4OAY A;  4CXF A;  1J2X A;  4QWQ A;  2EA2 A;  2P7C B;  1FZP B;  1FMV A;  2CQQ A;  2DI3 A;  3GWZ A;  4R1H A;  4C2M A;  1SVM A;  3FXQ A;  1M1E B;  3QAH A;  3IRQ A;  2BBY A;  2W00 A;  4Y52 J;  4MFD A;  2QQA A;  3X2Q H;  2XC7 A;  2F4O B;  2AXL A;  2W24 A;  3A1Y A;  3S14 J;  1TT0 A;  3GTO J;  2P5K A;  3NRG A;  4DYR A;  5CVJ A;  2P7V B;  3VB2 A;  2DJN A;  1QHG A;  4XMY A;  1CQT A;  3HOZ J;  3K8P C;  3LMM A;  4HBL A;  1BBY A;  1TWA J;  3DXJ F;  1DU6 A;  1EA3 A;  5BPD A;  1QA6 A;  1BC7 C;  3O8G A;  4NDL A;  3RKY A;  4A12 A;  1E0E A;  1R00 A;  3E6D A;  2KQR A;  2JVH A;  2HPI A;  1P92 A;  3E0J B;  3FXM A;  1VQ5 I;  4A69 C;  3CP2 A;  3C7J A;  3HOX J;  3ZQL A;  4P55 A;  4L18 B;  2G7U A;  2EB7 A;  1MMG A;  2QCO A;  2O8X A;  4LLN A;  4A3D J;  2XDN A;  1LDJ A;  2MD0 A;  4BJ5 C;  2K4B A;  3JSP A;  2UZK A;  3VEP A;  4W97 A;  5E1Z B;  2RAE A;  4WF2 A;  3CCU I;  5F6F A;  1K78 B;  3OR2 C;  3CUQ B;  3BZK A;  2WC2 A;  4Q47 A;  1YE9 A;  3WTV C;  3DEE A;  3PUB A;  4PZJ A;  5L3D A;  3CMM A;  4E7S A;  2A5W A;  3E5U A;  2NAZ A;  4XOT A;  5K1Y A;  4RDU A;  1OYI A;  3GF2 A;  3J7A O;  3C2H A;  5FKO A;  5FGL A;  4DZJ A;  3S3M A;  2P81 A;  3RJP A;  5E8I A;  1YRN A;  1ERD A;  1KQ0 A;  4DVY P;  5A2Q Z;  1UEL B;  3EYI A;  3HXL A;  2EV5 A;  2QM3 A;  1WWX A;  4JNN A;  2HU9 A;  1YW7 A;  4EJU A;  3FDY A;  3OMY A;  3KP3 A;  4XSX F;  1T0F A;  4UVA A;  4Y4R A;  4BS9 A;  1MZB A;  4UY8 I;  4P5O A;  4G12 A;  3ULQ B;  4V2F A;  2CFO A;  2CSO A;  3TOB A;  1X1B A;  4JQF A;  2FOK A;  3VIB A;  3CUQ C;  2X6O A;  4LLG F;  4BBR J;  2HOE A;  3TDU C;  4C9Y A;  2VC0 A;  2LBF B;  5FKK A;  2HKO A;  1FOW A;  4XKB A;  1QZZ A;  2WUI A;  1FMW A;  4KIG A;  2QSH X;  1OLT A;  4B3A A;  5DS9 A;  5JI6 A;  3K69 A;  3P9C A;  4RLF A;  4BE2 A;  4OD5 A;  4OD4 A;  2DMQ A;  3DTI A;  3F8C A;  4L9N A;  3SHF A;  4JL3 A;  3HG9 A;  2B1E A;  3F1B A;  3GLL A;  2W84 A;  3A01 A;  2B9S A;  4L0Z B;  2MYS A;  4I02 A;  3BG7 A;  4OIP F;  4IVN A;  3M8E A;  5M5Y J;  4RAZ A;  3BCB A;  1OJL A;  1QU3 A;  1OYY A;  2WV0 A;  3RKQ A;  2E7X A;  1JXS A;  2R7Q A;  2X6X A;  1WVR A;  3PUF A;  3VDX A;  3L1P A;  2WV1 A;  2V4J C;  3K6G A;  2AS5 F;  5GTI C;  2B0L A;  5DCM A;  4RBO A;  1SD4 A;  2GZW A;  2BOL A;  3HZJ A;  4DZP A;  1MH3 A;  3JRD A;  1FLI A;  2H1L A;  3IKV A;  2JN6 A;  2M34 A;  2VIX A;  3KYL A;  3K4L A;  1OCZ H;  2PQ8 A;  3DLA A;  3B81 A;  3B73 A;  4OWR B;  5K7H A;  2CS3 A;  4ENN A;  2ESH A;  2LK2 A;  2CMP A;  3HHG A;  1SAX A;  2NOG A;  2COM A;  5J1U A;  5B1A H;  4FX0 A;  2L9V A;  3TP3 A;  3NI7 A;  2ZNZ A;  3HUG A;  2F5D A;  3WTZ A;  3GTJ J;  2CW7 A;  1O57 A;  2KJB A;  1FOK A;  1I6X A;  5DV5 A;  5FHP A;  2VPR A;  3BG5 A;  4B48 A;  4G9Y A;  3I58 A;  4M9X A;  3EUK L;  3BRO A;  2LY2 A;  3BTJ A;  3FMR A;  4WWC A;  1A04 A;  3EUH A;  1FIP A;  4XKV A;  2M8G X;  4L9J A;  4S0H B;  2V9P A;  3JSJ A;  4DNC A;  5D19 A;  3K1M A;  2NVU B;  4AU7 A;  3N05 A;  3IH4 A;  3J7Y J;  4KNY A;  1MBF A;  1G2H A;  1TL8 A;  5H20 A;  3LQQ A;  1XB4 A;  2LR8 A;  1I5Z A;  2GEN A;  2ZXI A;  3AG4 H;  1WJD A;  4M74 A;  1R5G A;  5DYM A;  2LY1 A;  4II3 A;  1IC8 A;  3V7C A;  2DA3 A;  1H88 C;  4F55 A;  3PQJ A;  1SFU A;  2FBQ A;  2E2I J;  4MGR A;  2X0L A;  2QIB A;  4MTD A;  2LNB A;  1RRJ A;  3M3Y J;  3UKG A;  2K3F A;  2EIL H;  3V8L A;  2GXA A;  1ZRC A;  1BOB A;  2QKL B;  2XHK A;  5LGT A;  4KN4 X;  3OYN A;  4YFK F;  5E79 C;  1RR8 C;  4S04 A;  3KP5 A;  5FLX Z;  2R5Z B;  1MBH A;  3KEY A;  3PNV A;  5ED4 A;  2JJ7 A;  2M4K A;  4E6K G;  4BJ6 C;  3CDI A;  4NN1 A;  1IXS B;  1SAU A;  4D5C A;  2VON A;  5CLS A;  1E2X A;  3SZG A;  1H8A C;  4BXX J;  3M4O J;  2QSG X;  2DO7 A;  3LJL A;  5D1R A;  3S8P A;  2VT3 A;  5HDK A;  5D18 A;  2TCT A;  3HHH A;  1USS A;  3AL0 B;  1XG1 A;  3WGI A;  4HV5 A;  3S5R A;  2EV0 A;  1KQ8 A;  1GHC A;  1H0M A;  3RQI A;  1MSF C;  2KRC A;  2CJJ A;  4AD9 A;  1JUM A;  2OC6 A;  4MIM A;  4A3G J;  2XRO A;  2MG4 A;  2DA5 A;  4PJL A;  5F0H A;  2HOA A;  5M3F J;  3I5U A;  3PNT A;  2V6E A;  2R7T A;  2AHQ A;  1HST A;  4A2U A;  1Z77 A;  3CRJ A;  5HLH A;  1WCM J;  4UB8 C;  3QYB A;  2BEO A;  2JTV A;  3CCE I;  1UFM A;  4J00 A;  3HBL A;  4XN3 A;  2XF5 A;  3LA7 A;  2NX4 A;  4I09 A;  1WZ2 A;  3I71 A;  2NVX J;  1B59 A;  3ZQH A;  5ICC A;  3K1N A;  5D8K B;  2FSW A;  1B72 A;  5GAE J;  2XV4 S;  1T38 A;  1TT5 B;  2F48 A;  5HS7 A;  3DTK A;  2E7W A;  3WTU C;  5TRD A;  2P6T A;  1UJ8 A;  1XSD A;  4WX9 A;  3IP4 B;  1ZRD A;  1GVJ A;  3GEU A;  3GTP J;  2O0Y A;  5CQG A;  1GLN A;  2I8D A;  4UV9 A;  3ZXS A;  1S9H A;  1D1C A;  4DYC A;  3CJD A;  1YX5 A;  2HVQ A;  3LNQ A;  2GFN A;  1BIA A;  4CCO A;  5BPI A;  4ZYE A;  2FNP A;  3PSF A;  4C2U A;  3QPS A;  4WXD A;  4N4O B;  2ZXW H;  3K4M A;  3OYM A;  1LEA A;  4P9F A;  5J40 A;  4BHP A;  5D4S A;  1XSX A;  2H8R A;  5CVR A;  1YJN I;  3H9J A;  1RES A;  2PBX A;  4YEJ A;  2ZFU A;  4KWA A;  1Q1V A;  3VYT B;  3ZMV A;  3CQZ J;  1ETV A;  2Y75 A;  1PYV A;  1T33 A;  4HF0 A;  3JRI A;  2M87 A;  3HRU A;  4C2M J;  5E17 F;  5ERI A;  3K2A A;  2WAQ N;  1CF7 A;  3TO9 A;  1FWZ A;  3HSE A;  3W2W A;  2DT6 A;  2RNJ A;  4NBQ A;  3KPH A;  1JKO C;  3E3V A;  1R49 A;  2Q0O A;  5DM6 F;  1Y56 A;  5GTH C;  3REO A;  4ACI A;  3A0B C;  3BR0 A;  1SMY F;  3CCR I;  4JK1 X;  3QPL A;  1SGM A;  1OCR H;  4I76 A;  4BEH A;  2ZME A;  3VWB A;  5CXG A;  1RET A;  2XAJ A;  2BGC A;  4RM3 A;  2HQR A;  1YIJ I;  4L9T A;  2JSP A;  2KIS A;  4I99 C;  2DT5 A;  4CA0 A;  3KKD A;  1SMT A;  3W3C A;  3SZT A;  3ZN1 A;  1IZ1 A;  2XB5 A;  4AYB A;  5CPR B;  4UUV A;  1BJZ A;  2OPT A;  3G4S I;  1LE8 A;  2HVR A;  4E7K A;  4IZZ A;  1FBU A;  2L0K A;  5AON A;  1MJB A;  2P0W A;  4NHJ A;  1TNT A;  2JSC A;  1ZLJ A;  2LRD A;  4B09 A;  2LY9 A;  5D4R A;  5EEH A;  3LSG A;  2M7B A;  1LFU P;  3SJM A;  2BXY A;  1L0O C;  2QQB A;  4QSH A;  4C3H J;  4CGR A;  2Y0S A;  3CC2 I;  1S7O A;  3BZC A;  3AG3 H;  4WXH A;  4FTH A;  5FD6 A;  5FRO A;  5JVT A;  4KFC A;  4CH7 A;  5HBU A;  3QP5 A;  2CUJ A;  3I55 I;  5EEA A;  2IGO A;  2K9Q A;  4A3L J;  3T8R A;  3DPJ A;  1KYZ A;  2OD5 A;  2XB0 X;  4ESB A;  4JP0 A;  4ZYG A;  2Q2E B;  2P5V A;  1GDT A;  1QO0 D;  2HFH A;  4NQW B;  4ON0 A;  3I4N J;  2JQ7 A;  1VQP I;  3GEZ A;  3L7W A;  2WB1 N;  2MD5 A;  3RIR A;  2Z99 A;  4GYI A;  1KGS A;  4A0X A;  1O3Q A;  1BIB A;  5CKT A;  1PUF A;  3H3V K;  3DKX A;  3S93 A;  3CC7 I;  3ECH A;  5LHG A;  5AQC A;  3BQZ A;  1MBJ A;  3ZQF A;  4RM2 A;  2FF4 A;  3PO2 J;  2RC4 A;  4R79 A;  5J8F A;  1T2K A;  4A3C J;  4G7O F;  2EFN A;  4BY7 J;  3JRH A;  4OIR F;  2HOS A;  3ZQI A;  4EM1 A;  1I39 A;  5FLV A;  4NEL A;  1TQM A;  1STZ A;  2CUF A;  3CDH A;  3I4M J;  2EFQ A;  5FMP A;  2ZCM A;  2MH2 A;  2QEX I;  1VI0 A;  1LUJ B;  2YR2 A;  4G7H F;  1ZRF A;  1ETK A;  2NYX A;  2GA2 A;  3IWF A;  3OWT A;  3O2P E;  2X48 A;  3O60 A;  5AIQ A;  3HOU J;  1EV7 A;  3ZMD A;  3T8T A;  3N4M A;  3CP8 A;  2FML A;  4G6D A;  2E1M C;  2CO5 A;  2L7F P;  1I27 A;  1YW8 A;  2H1K A;  3H0D A;  1VQ6 I;  5HAW A;  2E2J J;  3RQ4 A;  2WBM A;  3DU6 A;  4L5J A;  4QLC U;  2XSD C;  4IO9 F;  2EWN A;  2K4J A;  3H5R A;  2W7N A;  4BDZ A;  4NC6 A;  3HJE A;  4XLP F;  4GFL A;  3K10 A;  4BAY A;  2HTS A;  2JPC A;  2D5V A;  1FY7 A;  1N77 A;  2R7R A;  1OMI A;  3T5X A;  4CYC B;  2CV2 A;  4L62 A;  2LLK A;  2X1E A;  1MMD A;  4IXA A;  1AKH A;  1MDM A;  5LLQ A;  4BY1 J;  3C3W A;  1IN4 A;  2XSJ C;  3HKZ N;  4MEY F;  3FKJ A;  2MFZ A;  3FM3 A;  1QVU A;  3KE2 A;  2ZOZ A;  2H27 A;  3KP4 A;  2VL8 A;  3E6B A;  4IEJ A;  4Y33 A;  1D8K A;  3F9K A;  2BW3 A;  2DFF A;  4XLC A;  6PAX A;  4UUT A;  1VND A;  3G6E I;  4C30 A;  1XCB A;  2Q8K A;  2F4I A;  1DGW Y;  2LVS A;  3A03 A;  4LJZ F;  1SEU A;  1RUO A;  5KK1 A;  5KAI C;  1IDZ A;  1R6R A;  1YIO A;  4AIJ A;  5LHH A;  1LNW A;  2QF7 A;  1Y1V J;  4S05 A;  4DIQ A;  3LSK A;  1ON2 A;  3FXO A;  2A3S A;  4LOC A;  1F9N A;  2OAZ A;  1YJ9 I;  5EG0 B;  3TL4 X;  2FRH A;  3WTY C;  1D5V A;  4ITV A;  3LST A;  4IHW A;  4FT8 A;  4CHU A;  3KLO A;  3HOW J;  1QPM A;  2A68 F;  4WK8 F;  4BKX A;  4XK4 A;  1V5F A;  2VBZ A;  3DU5 A;  1IN5 A;  1X19 A;  2CG4 A;  3WGH A;  3JRE A;  3TED A;  1LVA A;  2DCE A;  1ETQ A;  3MQ0 A;  2JVG A;  2QA4 I;  1LVK A;  1W7P A;  5TGT A;  5BMZ A;  3I3L A;  4B8X A;  1W36 D;  1QBJ A;  2DG8 A;  3ABT A;  1ETY A;  5JR3 A;  2DK8 A;  4KIS A;  1F36 A;  3WTS C;  2QTQ A;  4MHG A;  2QVO A;  3WG9 A;  2O5R A;  3QOP A;  3KIO A;  3LWF A;  2NVY J;  1UAA A;  3S1Q J;  2KIF A;  3BTC A;  2UWM A;  3OIP A;  1G3T A;  2K9N A;  1GUU A;  2DOD A;  2ZJ2 A;  1C0W A;  2FX0 A;  1SD6 A;  2O3F A;  2V1X A;  3E97 A;  3I54 A;  4RA2 A;  4HG2 A;  4BL0 B;  4F52 A;  5J1R A;  1JUP A;  5KNL A;  2I10 A;  3TBI A;  5L3E A;  1KU2 A;  1NH3 A;  2FBK A;  4G8X A;  1XX5 A;  4LK1 F;  2VQC A;  2XAQ A;  4RAF A;  2ZY9 A;  1AA7 A;  3OYE A;  1UG0 A;  1D8J A;  3HC7 A;  4DOZ A;  1XSV A;  4ME9 A;  2IS2 A;  2DLL A;  1T08 B;  1U0J A;  3JAM Z;  2YU9 J;  5C3E J;  4IQ4 A;  1V55 H;  3CTA A;  4I7H A;  3F0C A;  1O4X A;  1KU9 A;  1XMA A;  3DLL F;  1Z9C A;  1QRY A;  2PX9 A;  3ABM H;  5E3L A;  3UNG C;  3A2K A;  1NTC A;  1Z91 A;  2X85 A;  2VJJ A;  5ILU A;  1PUE E;  3HE0 A;  4LD5 A;  5BNG A;  2BZT A;  3K4B A;  5FRM A;  2GXG A;  2ZJP F;  2VE8 A;  4HF2 A;  5C4Y A;  3OYL A;  2R7Z J;  2R92 J;  1QGP A;  2ID3 A;  3MZ8 A;  1S7A A;  2MW8 A;  5IPA A;  3ERE D;  3KCC A;  1VQM I;  3VPR A;  2DPU A;  2YU3 A;  2X4H A;  4M71 A;  3BR3 A;  3QP6 A;  4OMZ A;  4EEF G;  2FOW A;  1P4X A;  3QPH A;  2BY1 A;  2VKV A;  5IT9 K;  5DD8 A;  3WTW C;  3EUA A;  3ELK A;  2X6Y A;  4PJM A;  3R6S A;  3FM5 A;  3I64 A;  2X1D A;  1J5Y A;  4QPO A;  4CCJ A;  1N75 A;  4EJT A;  1B9M A;  2O8K A;  2QBY A;  1ONV A;  5K5O A;  2UXH A;  1OR7 A;  3M1C A;  1SD5 A;  2HTJ A;  3GYH X;  1R36 A;  3L09 A;  1GVD A;  5K5R A;  1VQL I;  2DA6 A;  4UV8 A;  4HDU A;  1A36 A;  1A6Q A;  4C2T A;  3DEU A;  4XLA A;  2CQN A;  2EFO A;  1RC9 A;  2OQR A;  3P7N A;  3HPG A;  1ZEL A;  3J81 Z;  4AM3 A;  5B66 C;  1TQI A;  1U9O A;  4PJ0 C;  2DAO A;  2DA1 A;  4ENJ A;  4Q5S F;  4G6Q A;  4LLL A;  4DW6 A;  4FET A;  4JBA A;  4M3E A;  5M3M J;  1X3U A;  3G2B A;  4ETS A;  1ZGW A;  3TQN A;  1TP4 A;  2KRH A;  3CWR A;  3RI4 A;  1U8B A;  3P9I A;  4IF4 A;  4XIC A;  5DDG A;  1IJW C;  1DPR A;  3AQT A;  1HCR A;  2KL4 A;  3CDL A;  2CUE A;  1S6L A;  3EYY A;  5C4X J;  3FRQ A;  3V7S A;  2X51 A;  2TRT A;  2QUF A;  2EQR A;  4IQJ A;  2BXZ A;  3VYR B;  2ZCN A;  1BI1 A;  2STT A;  4EJV A;  4Y7N J;  2R5Y B;  3OY9 A;  3NNR A;  2P6S A;  3MCZ A;  1Y0U A;  2V1U A;  3FIW A;  3IL2 A;  3IH2 A;  4KUM A;  4PJJ A;  3KYC B;  3H3U A;  5CVI A;  5F64 A;  3HSR A;  3G71 I;  4BQO A;  4XON A;  1XMX A;  3LSJ A;  4NB5 A;  1X1A A;  5E18 F;  1YRN B;  3HOV J;  4F92 B;  3M7G A;  4YFN F;  2FA5 A;  1I1S A;  1KA8 A;  1UI5 A;  3NXC A;  2M0M A;  2ESN A;  3EET A;  3F8B A;  2O9L A;  3GUD A;  5FB2 A;  3BCG A;  2VE9 A;  4G6T B;  2MLK A;  4RB0 A;  4X6A J;  2YS9 A;  1R23 A;  1Z6T A;  3GVA A;  2E36 A;  4MLO A;  3RYP A;  3VVY A;  3MMY B;  3SEQ A;  3MFK A;  2CGP A;  3PJR A;  1YOV B;  3ANG A;  2MBF A;  1LB2 A;  2DA7 A;  3DEW A;  3PM1 A;  3MNL A;  1XCV A;  4KMF A;  1R58 A;  1ETW A;  4A3K J;  2QZ8 A;  4UNO A;  2H8W A;  1T95 A;  3FMQ A;  1CGP A;  3DFG A;  2V9K A;  3QOD A;  2QYO A;  4EQQ A;  5J6X A;  3J80 K;  2K7L A;  4PFP A;  1K78 A;  3ROU A;  4HV6 A;  5HLI A;  4KIB A;  3KEO A;  1VTN C;  3GTQ J;  4MK6 A;  3DWL E;  2JK3 A;  4NC8 A;  2NVT J;  1T0F C;  2OCE A;  3A01 B;  2PFB A;  1Z3X A;  3GTL J;  1MJA A;  2Y30 A;  3CZ6 A;  3JRF A;  2EZL A;  4OIO F;  1G4D A;  5JHF A;  3LAJ A;  1BR2 A;  4IL6 C;  4JOM A;  2A6E F;  1ZN2 A;  1X2N A;  3HRM A;  4KN7 X;  2E60 A;  3RKW A;  5HOO A;  2LC2 A;  2CYY A;  3V8J A;  4Y3O A;  3RCO A;  4U9N A;  2BY3 A;  1XN7 A;  3HGG A;  1W36 C;  1BA5 A;  4G7Z F;  4IOC F;  3S1R J;  4QPQ A;  3EQL F;  3DBH B;  3FXK A;  3M8F A;  5DCM B;  4PSW A;  2D45 A;  1R4M B;  4CZZ A;  4BXF A;  1V5G A;  5LHI A;  3VW0 A;  2ZKZ A;  3SDG A;  1P2F A;  3I56 I;  5FJ8 J;  2DYR H;  2PN6 A;  2LBF A;  4GDF A;  2PI0 A;  2R0Q C;  4BQA A;  3Q3S A;  4M3B A;  2E1O A;  1RZ4 A;  2G7H A;  4HX4 A;  2A6T A;  4XNF A;  3W2A A;  1FYM A;  3HUG B;  4DBR A;  5HNH A;  1BW5 A;  3BRU A;  3W2V A;  3CO7 C;  1ULY A;  4KIF A;  2IS6 A;  2JPB A;  1P6R A;  3VOX A;  2GWR A;  2RHA A;  2CV1 A;  3SXY A;  1YJW I;  2OZU A;  4RB2 C;  1YHQ I;  2UXU A;  1YW9 A;  2XIG A;  1MW7 A;  2REK A;  1Y39 A;  3ZP5 A;  5DUK A;  1B1B A;  2Z16 A;  2M0C A;  1Z6R A;  2DYS H;  5HS8 A;  2MAB A;  2M3A A;  3C2G A;  2ZSH B;  2EBI A;  1H9T A;  4EMS A;  2IPQ X;  1ZKG A;  2BY2 A;  1IW7 F;  2IEK A;  2UUZ A;  3CCM I;  3JRB A;  2KLO A;  4HSR A;  1GV5 A;  2KDZ A;  2HWV A;  2A07 F;  5HLT A;  4L5E A;  3J7A Y;  2B63 J;  4WXC A;  3QBM A;  4HRI A;  2FE3 A;  1MSE C;  4RGS A;  3GTG J;  2Y48 A;  2XAF A;  4IJA A;  5EZH A;  5GPC A;  1Z67 A;  4U87 A;  1J7K A;  1JGG A;  1IF1 A;  4ZTF A;  4XN0 A;  4CYD A;  2XKO A;  2VBW A;  2CRG A;  2UXN A;  2NOJ B;  1QPI A;  3H0G J;  3V4G A;  1HXD A;  2H6B A;  3BLY A;  2XDV A;  1G3Y A;  2IA0 A;  4IOA F;  4GRI A;  3BQY A;  2ZOY A;  5IP9 J;  3HSF A;  3IAS 2;  2M1B A;  2M9H A;  2N8G A;  2NNN A;  1GXP A;  1WKM A;  5M5X J;  4O3M A;  4Q48 A;  2LMD A;  3IRR A;  3IWZ A;  2RAS A;  1KQ9 A;  2NNY A;  2YSR A;  2L5Q A;  2G3B A;  1MBE A;  3BJ6 A;  3ZQ7 A;  2VJ5 A;  2ZC2 A;  5LRR A;  1WH5 A;  5LEK A;  4PSX A;  2LYC A;  1EH7 A;  2HYF A;  1QZE A;  2AXT C;  1YIT I;  1ZLK A;  4GO1 A;  3Q9V A;  4B4C A;  4HNT A;  1HC8 A;  4XOR A;  4D1Q A;  3MVP A;  3KP7 A;  1FSH A;  5H2F C;  1XDU A;  3HTJ A;  3VW2 A;  4ZDO A;  3F3X A;  2XAH A;  2P4W A;  4ZDP A;  3IV5 A;  1A31 A;  5K58 A;  2STW A;  2KZG A;  3B02 A;  3DPL C;  1MMS A;  4LG0 B;  2O6G E;  2IVM A;  3H9Q A;  4RB1 A;  3AL0 C;  1FC3 A;  4GYG A;  5FGM A;  3ANP A;  2Z1D A;  2HVS A;  2D2W A;  3HOS A;  4HKU A;  2KRF A;  4HOB A;  2LOO A;  3VYU B;  3CJN A;  5CYV A;  1YQA A;  3ON2 A;  3COA C;  2A6H F;  3S1N J;  2XGX A;  3CCV I;  3TO6 A;  4HW0 A;  1DQU A;  3K4K A;  1TW3 A;  4AVZ A;  1O7F A;  3K70 D;  5GPA A;  3VUQ A;  1KU7 A;  3CES A;  3E5X A;  2KMU A;  3HYI A;  1A6I A;  4LFU A;  1R5I D;  1TWF J;  3LHQ A;  3D5R C;  3U1D A;  4B43 A;  2VQG A;  1YI2 I;  3NWS A;  2JWT A;  4BUP A;  1U5T B;  3WU1 B;  2AO9 A;  3JR9 A;  3SZP A;  4Z2Y A;  2NP5 A;  5F1J A;  4IRV A;  3BR5 A;  1VQK I;  5CVU A;  1Y8R B;  2E5N A;  3KLN A;  1K4S A;  2F07 A;  3L9F A;  2FD5 A;  4V19 K;  2M7A A;  3MD2 A;  3T1B A;  2DTZ A;  4A0Y A;  5LGN A;  2WTE A;  3PQK A;  1O7L A;  2JA5 J;  4A93 J;  1DU0 A;  3AG2 H;  3OYB A;  2HQ5 A;  3CF2 A;  1PDN C;  2ZXJ A;  3QRF F;  2ECB A;  3G1M A;  4BEH B;  2PJR A;  1OKR A;  1B9N A;  2ZME B;  1VQ4 I;  5AIP A;  3TKY A;  4E70 A;  1P9Q C;  2V1D A;  4FE7 A;  3IUO A;  3BPV A;  3LSH A;  3SFZ A;  3BG3 A;  3F21 A;  1U5T C;  2E71 A;  2L9N A;  3FK6 A;  3U1K A;  1ACI A;  4C3I J;  2H94 A;  1TZL A;  1VF9 A;  2W1O A;  1K4T A;  3WGG A;  4YIR X;  2BVL A;  2DQL A;  2ICW G;  4PJN A;  1I50 J;  4JYK A;  5HSZ A;  3F8N A;  3OIQ A;  3K4C A;  4MNU A;  1ZGJ A;  3AKZ A;  5F1R A;  4HNU A;  1PP7 U;  4EJO A;  2DBB A;  4NC7 A;  1ZG5 A;  4A5M A;  5EJC A;  2VKE A;  4I0B A;  5L3B A;  2K9L A;  3OYH A;  4L9V A;  3G7R A;  4RLQ A;  2RKH A;  3R60 A;  4IPA A;  3OS2 A;  3S1M J;  2EZH A;  2O03 A;  1R1U A;  3LFU A;  2VKH A;  4PFO A;  2ZNY A;  1YS6 A;  2F2E A;  2EIN H;  3FHZ A;  2RNG A;  2XAU A;  3KZ9 A;  1LKX A;  3FXR A;  3JRA A;  2LKX A;  5H9T A;  4CO8 A;  4LB6 B;  1A5J A;  1HA8 A;  4ESF A;  2OTL I;  3GLX A;  4FE4 A;  1HF0 A;  2OV7 A;  1J9I A;  4M6V A;  3PFI A;  2IGK A;  3DCF A;  4A3B J;  1MMA A;  1HDP A;  3BTL A;  1BI3 A;  1UHM A;  3PIO F;  3K9T A;  5EF6 A;  4LMY A;  1W5T A;  2L54 A;  1PUF B;  2YX7 A;  3TDZ C;  4E7H A;  4ABZ A;  3PSI A;  3KET A;  1UCR A;  2Z9O A;  4PK4 A;  4HPQ A;  4HQM A;  4XLH A;  4AF5 A;  4DQ2 A;  1BJA A;  2UXI A;  2ME6 A;  1IN6 A;  5F0C A;  1OCO H;  4D0P A;  2QGU A;  3FWE A;  3ZQG A;  5EGO A;  5ILS A;  2IS4 A;  1JHH A;  1JT6 A;  2WGB A;  2XPV A;  1YS7 A;  4E7L A;  3VW1 A;  2FBH A;  3QQA A;  2PMU A;  3I9V 2;  2CW8 A;  3MZY A;  2BE5 F;  2YUS A;  5TJJ A;  2EIJ H;  5ICG A;  3CLQ A;  2GOX B;  2EIK H;  3BG9 A;  2FJI 1;  3ZRG A;  3CO6 C;  1NG7 A;  2L7Z A;  3ERM A;  1GV2 A;  5F27 A;  2HOT A;  4LK0 F;  3OIO A;  3LL7 A;  3L2R A;  3J81 K;  4FX4 A;  2J5P A;  3E6M A;  2ACJ A;  2JA6 J;  2DQR A;  2BV6 A;  1YO5 C;  4RAG A;  1HSJ A;  2Q2E A;  3L2V A;  4A5N A;  3FZV A;  4NQW A;  3K1P A;  4UUS A;  1R22 A;  5IT3 A;  1IG7 A;  2LG4 A;  2GXB A;  5HDG A;  2WAQ A;  2RGV A;  2CUZ A;  2GA1 A;  2A5Y B;  3NAR A;  1JHF A;  2ID6 A;  2XF7 A;  3M07 A;  3H36 A;  4MO7 A;  1MDM B;  3BJO A;  4MTE A;  1GXQ A;  2IGM A;  3G1O A;  4GCV A;  2WAD A;  5L3G A;  1EH8 A;  4IKF A;  1FTZ A;  2CFX A;  1FNN A;  2BW3 B;  5K5Q A;  1B8I A;  2E1N A;  1EF4 A;  1KZH A;  1IGN A;  5DCF A;  1TNS A;  1U2W A;  3HL2 A;  2NS0 A;  5ICF A;  1IRX A;  1JTX A;  4PCQ A;  5J3L A;  3FBN B;  2QKO A;  1SFE A;  3ZMU A;  3OYD A;  3GZ6 A;  4UB6 C;  5LFA A;  3ZR8 X;  2ELK A;  1O3T A;  2IJL A;  2IP2 A;  4U88 A;  2E35 A;  2LP0 A;  1WI3 A;  2VXZ A;  3FX3 A;  2ZSI B;  3OL4 A;  2LH9 A;  1FIA A;  3D5L A;  5E3O A;  4MEX F;  1IUY A;  4HX7 A;  1XPX A;  3KYD B;  2MC3 A;  2P5L C;  3OOU A;  3BR2 A;  1R4N B;  3K0L A;  1MD0 A;  5J1Y A;  5DD4 A;  1ZYR F;  1P4W A;  4DGW B;  2DMN A;  2HQA A;  2QKM B;  2XKP A;  5EZG A;  3RZO J;  1VQ8 I;  3F8M A;  5D5W B;  4IHS A;  4GXO A;  2D1H A;  3MWM A;  3OYG A;  1ZGA A;  5B1B H;  2Y0M A;  1V54 H;  2BHZ A;  1RIO H;  3IAM 2;  5HLG A;  2FJ1 A;  2DG7 A;  2YX4 A;  3BHQ A;  1DUX C;  4A3E J;  2EA4 A;  1FX7 A;  4EM2 A;  3ZN0 A;  1YLF A;  3OS0 A;  2KP6 A;  1ITY A;  2HYT A;  2UXP A;  3F8F A;  2RN7 A;  3HRT A;  5J4V A;  1ETX A;  4Y13 A;  3PIP F;  2EZI A;  3L2U A;  1HKQ A;  3BTI A;  5A2Q K;  1E3H A;  2EJR A;  3H9G A;  4CSW A;  2JRT A;  2HPM A;  5IYC J;  4M3D A;  1ZAR A;  2X1C A;  1T98 A;  4DBQ A;  2H6C A;  4ZJZ A;  1MJ9 A;  2R93 J;  4AIK A;  4P9U A;  3VTI A;  3K70 C;  5JHU A;  3RPU A;  5CW8 A;  3QPT A;  3G56 A;  2CQ7 A;  3ON4 A;  1TWG J;  3ASO H;  3I53 A;  2WB1 A;  4ZYD A;  3HTI A;  3CJQ B;  4AID A;  2VPL A;  2FMY A;  4F3Q A;  5FKN A;  4FCY A;  3KX2 A;  2F5V A;  3G3Z A;  2O7T A;  3RDI A;  5IYB J;  4ZC3 A;  3HIF A;  2R7X A;  2K02 A;  5D6E A;  4I6Z A;  2BYV E;  2JA7 J;  2WAF A;  3PFY A;  3HRS A;  1BOA A;  2R7V A;  4F91 B;  4IX7 A;  4UDS A;  1O3R A;  4LIV A;  4CIC A;  2Y9Z A;  3R61 A;  4KDP A;  1MBK A;  2VI6 A;  2VQL A;  3DKW A;  3FK7 A;  3VOE A;  5F0F A;  3GBG A;  3CCS I;  3ABU A;  4ZYA A;  1FT9 A;  2WA0 A;  3PNY A;  3LWJ A;  2BHY A;  4ZDL A;  1P7I A;  1F1Z A;  2TDX A;  1S7E A;  4M73 A;  1BM9 A;  5EDN A;  4BAC A;  2HXI A;  4H4K C;  4K2E A;  5KAF C;  3OS1 A;  2XUB A;  3VP5 A;  3Q0W A;  3BWG A;  2DJI A;  1XMK A;  4AC6 A;  3RTR A;  3MKL A;  3L2Q A;  1WJE A;  2DMU A;  3D1N I;  4HDV A;  1Y6I A;  5BS6 A;  2NRA C;  1FOY A;  3KNW A;  1U3E M;  2DFE A;  1FPQ A;  4RMN A;  1W5C C;  2OI8 A;  2L02 A;  1Z05 A;  1HW2 A;  4A6E A;  5J4Y A;  2V57 A;  3MAJ A;  1YTY A;  4AUX A;  3FXJ A;  5H6Q A;  3I0T A;  4U0W A;  2C6Y A;  3K4N A;  2HGC A;  4BJT A;  4ZZD A;  2V9V A;  2KFD A;  3HKZ A;  3DKY A;  4B1R A;  4YEL A;  2R3S A;  4KT5 C;  4PGG A;  2DFI A;  3B6C A;  3HIM A;  1EH6 A;  4M6Y A;  2AQF A;  4BXU A;  5HOD A;  3CC4 I;  2DDA A;  4XL9 A;  2QBY B;  1V3F A;  3J7Z I;  2MGQ A;  2PEX A;  3SFI A;  3ISP A;  1OCT C;  1Y0N A;  4NNJ A;  2GQQ A;  3DF8 A;  3JSO A;  1F43 A;  1UB9 A;  2HYJ A;  1S72 I;  5HDN A;  5JVG F;  4XRF A;  3ASN H;  4D5F A;  1REP C;  3C07 A;  3DPU A;  2L4M A;  2M2E A;  1D3Y A;  2A69 F;  1I6H J;  2L4A A;  4FIS A;  1FBQ A;  1S8N A;  1K7A A;  3WU2 C;  4IHY A;  1DPU A;  2HXO A;  4CCL A;  2M30 A;  2FUG 2;  5J47 A;  1HW5 A;  1Z1D A;  5LD2 C;  2NP3 A;  5IP6 A;  2VN2 A;  5FKL A;  3N97 A;  3I59 A;  2R7W A;  1NK3 P;  2G9W A;  2IU5 A;  3P9K A;  2K3P A;  1O3S A;  4JX5 A;  4X1E A;  3JRC A;  1ZRE A;  2BY0 A;  3GXO A;  3GME A;  3H92 A;  4KMU X;  1VFC A;  4ASN A;  4XRM A;  3NPI A;  3KFW X;  2M8E A;  1RUN A;  2Y9Y A;  1D0Z A;  1LEB A;  4FHT A;  1WJF A;  2OTJ I;  1WRJ A;  4F7Z A;  2PFV A;  3Q0U A;  4JX4 A;  5DAJ A;  3ZQQ A;  3P5J A;  4IRH A;  1IDY A;  3G73 A;  5FLX K;  4UHT A;  2KHM A;  4LIT A;  1I3A A;  2PZ9 A;  1R5H A;  3S2H J;  1H9G A;  1SFK A;  1ZTR A;  4ZH4 F;  2VOD A;  3JRG A;  1TWH J;  1K6Y A;  1J0R A;  3WTX C;  4OAZ A;  2GOM A;  4Y17 A;  1G3W A;  3ZPL A;  1ENH A;  3JCU C;  3E7Q A;  1WI9 A;  2ZJQ F;  1LDD A;  3RYR A;  3AG1 H;  2HYG D;  2XAG A;  5E1W A;  5IYD J;  1ORK A;  3OR1 C;  5JFR A;  2XF6 A;  1E3O C;  3SDB A;  3GFL A;  3U9G A;  3JTH A;  2JA8 J;  4B44 A;  3OYI A;  3QWL A;  3LFK A;  4MFE A;  1LFB A;  2PLY A;  3A02 A;  4GGG A;  3QKX A;  3SWH A;  1Z7L A;  1J09 A;  2KZV A;  2Y2Z A;  3C2B A;  4Z6Y A;  2CV0 A;  2COB A;  2HDC A;  3WHC A;  3QU3 A;  4CCN A;  4EGZ A;  1FOX A;  1FEX A;  2Z33 A;  3CJT B;  3BDD A;  3FXL A;  3BJB A;  4N9H A;  1S3J A;  2GAU A;  5J8C A;  3WTT C;  4PXI A;  1OYW A;  2OER A;  4OU0 A;  5EEG A;  3KZZ A;  3LSI A;  1XC5 A;  2OBP A;  4XSZ F;  1LPQ A;  2PMH A;  2R5Y A;  3A4C A;  2FBI A;  2VLA A;  4LGW A;  5FKM A;  1R71 A;  4YII A;  1B4A A;  1MBG A;  2LKP A;  3S32 A;  1G3S A;  3DTE A;  1U78 A;  4PUS A;  3M1E A;  2O7O A;  1IXR C;  5D5U B;  3TW6 A;  2W25 A;  1X1P A;  2DFH A;  2XGD A;  5D6F A;  4XLF A;  4PDK A;  1D0Y A;  3VVX A;  3TW7 A;  3NS4 A;  3CD6 I;  1Z0X A;  3WHB A;  5C44 J;  4V2G A;  2LFB A;  4AIH A;  3MEX A;  3CUQ A;  5B3S H;  4O6J A;  1ETO A;  2W85 A;  2XPW A;  2MH9 A;  3S2W A;  1ZR2 A;  3VFZ A;  3TMO A;  2MSY A;  2FQ3 A;  3LSP A;  1N78 A;  1FBS A;  3VOD A;  2VOO A;  3MKW B;  5HNF A;  2OA4 A;  5CJ9 A;  2E1C A;  1IRF A;  4XBF A;  1EJ9 A;  3RZD J;  1JGS A;  1FSE A;  2ZXH A;  4GCK A;  2W82 A;  1I3Q J;  1Y8Q B;  2DOA A;  3W6J B;  2GBY A;  4P96 A;  4B47 A;  2DA2 A;  2DMP A;  1UG2 A;  2IRF G;  3WG7 H;  1D1A A;  4E7I A;  3LA3 A;  3OYF A;  2Z5U A;  1OCC H;  2F4M B;  2PMZ N;  4BDY A;  4XM3 A;  4XLN F;  3ONQ A;  3Q9S A;  5DEQ A;  4XRS G;  2HQN A;  3DBR B;  3U2R A;  4D7N A;  2D6Y A;  3CJR B;  5C4J J;  1NHA A;  2K9S A;  4PGH A;  4R8H A;  1UI6 A;  2KIQ A;  5EFY A;  1MNE A;  3CLO A;  3COL A;  4BQQ A;  3BR1 A;  4HLX A;  4O5V A;  3VOK A;  2ZO4 A;  3OV8 A;  2XGE A;  2A2F X;  2R7D A;  3B6A A;  4NUB A;  3GX4 X;  1JKR C;  1FP1 D;  2K85 A;  1XGO A;  4UXN A;  3BNI A;  3BT9 A;  4BH9 A;  3F72 A;  1G6N A;  5E8G A;  1WH7 A;  4GCL A;  4M9S A;  2HDW A;  4EM0 B;  4CZC A;  1PJR A;  2DOF A;  4EGY A;  4EJW A;  1LJ9 A;  1W0T A;  2K86 A;  1RPW A;  4BHC A;  1SAN A;  2Z3Y A;  4RS8 A;  2B7E A;  5FRN A;  1VQ9 I;  3KEQ A;  4L5I A;  4U7D A;  1ZR4 A;  2DMT A;  2WY8 Q;  2UV1 A;  1D5Y A;  2PBI A;  5LRS A;  3GTM J;  2G7L A;  3RSN A;  4HLY A;  2W48 A;  4QIW N;  3DP7 A;  3KP6 A;  2L9R A;  4CCM A;  4CUG A;  2CWE A;  4BNC A;  1T39 A;  3GFI A;  1W4M A;  2MA3 A;  2VJ4 A;  3EDP A;  2CQK A;  3FHN A;  2ME0 A;  3KZY A;  4XR6 A;  3HTS B;  3GTK J;  2PJP A;  3IUV A;  5FLM J;  1JJ8 C;  1IAW A;  3CCQ I;  2WY7 Q;  1KYW A;  3S2D J;  1T6S A;  2M5W A;  3KP2 A;  3VSL A;  2YPR A;  2EH3 A;  3EUH C;  3RPQ A;  3ZMZ A;  4F93 B;  3E6C C;  4CDG A;  3HTU A;  3GZN B;  2IS1 A;  4BBS J;  3D0S A;  3ZOB A;  4EVI A;  4XKC A;  1NG6 A;  1MGT A;  2Z2S B;  4A6D A;  1K79 A;  3FF5 A;  3CUO A;  3V78 A;  3CF5 F;  2IBD A;  3C1D A;  4YIF A;  1A35 A;  4J19 A;  4OIN F;  1DDN A;  3EUP A;  2NVQ J;  5JLW A;  3ABK H;  2ZCX A;  3MN2 A;  3ZGK A;  3OYK A;  2OCC H;  2EPF A;  3WOD F;  1XD7 A;  2A61 A;  3EGQ A;  5FFX A;  1L3L A;  3HEF A;  2L2O A;  2IGN A;  3H3Z A;  3BJA A;  1JE8 A;  2XGC A;  4AWX B;  1K61 A;  2KKO A;  4KT6 A;  1ODD A;  2DDB A;  1MKM A;  2W4S A;  4CCK A;  4RGR A;  2ELH A;  1K6O A;  1ZAO A;  5BOX A;  1SVO A;  2A05 A;  3BC8 A;  4D7M A;  1Q1H A;  3NQO A;  4I98 B;  4RAY A;  2KIM A;  3S3N A;  1UMQ A;  1BR1 A;  5LEJ A;  1Z7U A;  2ADU A;  2PMZ A;  2DA4 A;  1T56 A;  1FYK A;  4XKW A;  1TBX A;  1LDK B;  1YFH A;  4N0B A;  3CMY A;  1WSU A;  3BOQ A;  1B72 B;  1QNT A;  2R5Z A;  3KKC A;  1WGX A;  2NXN B;  2IXS A;  3AFH A;  4AYB N;  1JJ6 C;  5E3N A;  4ZTJ A;  2VUM J;  2ZBK A;  1IV8 A;  3S17 J;  4H0E A;  1D1B A;  3OYA A;  1VQ7 I;  1BW6 A;  4AC0 A;  4KIT B;  1W0U A;  2VKD A;  3SYT A;  3LSM A;  4ICH A;  1OFC X;  3DPT A;  2Y0S N;  1Z3Y A;  2RVC A;  4LIU A;  1FJL A;  2EFW A;  1U8R A;  1UST A;  2M45 A;  3NAU A;  1SVL A;  3KZI C;  2E34 A;  1X4P A;  1P7J A;  1VZ0 A;  3L2W A;  2XRN A;  5GAD J;  1X1D A;  3VSK A;  4KJZ A;  4Q4Z F;  1RKT A;  2VB6 A;  2GIZ A;  2LDU A;  2DN0 A;  3BR6 A;  4DJA A;  9ANT A;  4HEA 2;  4IHT A;  3K4J A;  4B3X A;  1QQI A;  5H6R A;  1AOY A;  4UVB A;  5HS9 A;  2B3W A;  3GFJ A;  4WIB A;  2F5C A;  1MH4 A;  1W7P D;  2V79 A;  1BC8 C;  2DW4 A;  3H5N A;  1F5T A;  1CF7 B;  4HYE A;  2L7M P;  4BQN A;  2OJE D;  2LD5 A;  3MZH A;  1MND A;  4LG0 A;  1OPC A;  3RPU D;  3GCM A;  1IN7 A;  4ANJ A;  2PJR B;  3RH2 A;  3FBI B;  3J80 Z;  2LTP A;  5IT9 Z;  3ZQC A;  2KIU A;  1D0X A;  3SEZ A;  4RB3 C;  2K9M A;  1DGR M;  2HI3 A;  1BI2 A;  3T6N A;  3VYS B;  1NK2 P;  3GFM A;  2GLO A;  1B6A A;  3M9A A;  5HVQ C;  2OQG A;  3NEU A;  2QEN A;  1XGM A;  2DTR A;  2ZJR F;  1EKE A;  1ZQ3 P;  1DP3 A;  3HM5 A;  3OOP A;  2ISY A;  1X1C A;  4GCT A;  2QQ8 A;  4UVC A;  3M8J A;  3R0J A;  1MIJ A;  3BG6 A;  5E20 A;  1DP7 P;  4GFK A;  2CU7 A;  2JUC A;  2X6W A;  2W53 A;  3ESW B;  3ZCO A;  4I0A A;  4LG3 A;  1U5T A;  1UHW A;  2VBY A;  5KCM A;  3PAS A;  2NS8 A;  3BPX A;  1LE8 B;  4N4N B;  1XS9 A;  2HNH A;  2QLZ A;  4HQE A;  1PVE A;  2GM4 A;  4GFB A;  3HDD A;  1PP8 F;  2FXA A;  3F22 A;  4HNV A;  3FXU A;  1V4R A;  1RI7 A;  2R7O A;  2JUG A;  3ML6 A;  4M3G A;  1SC7 A;  1WJC A;  4JKZ A;  1RR7 A;  1W1W E;  3V8K A;  2RRE A;  3K7A J;  2K5C A;  1RNL A;  1WJB A;  2ZME C;  2KDO A;  3EPZ A;  2UXO A;  2EFP A;  3MKY B;  4E7J A;  4ZZL A;  3JW4 A;  3JAM K;  4I01 A;  1R1V A;  3G1L A;  3OSF A;  4IRG A;  2G7S A;  4G94 A;  1AWC A;  4U7B A;  3L00 A;  4ESJ A;  2DT7 B;  2IA1 A;  5ILV A;  1HDD C;  4BGD A;  4U9L A;  4ENK A;  2XVC A;  3IC7 A;  1H89 C;  4E7Z A;  1KU3 A;  4EAT A;  1WJA A;  3DV8 A;  3OYC A;  2QOP A;  2EIM H;  3BY6 A;  3T0Y A;  1OCP A;  3OYJ A;  2OUM A;  1VQN I;  5M5W J;  4A3I J;  4CGZ A;  1TC3 C;  1HLV A;  3PPB A;  1FYL A;  2G7G A;  1SFX A;  2HZD A;  1AHD P;  2E2H J;  5EGO B;  3Q0V A;  4XLE A;  3LQR A;  2NS7 A;  3V7R A;  1GT0 C;  1ON1 A;  2X9D A;  3F6V A;  3A0H C;  4P1W A;  3LAP A;  3OSG A;  5K7F A;  1T8I A;  1X3W B;  1POG A;  4I2O A;  2VBX A;  3PL8 A;  1FTT A;  2IA2 A;  2MLG A;  1ZHF A;  4ZYH A;  3E7L A;  4KIC A;  1JKQ C;  1MNM C;  2L01 A;  3TO7 A;  1XGS A;  5GAH J;  2R4G A;  2V1N A;  5IP7 J;  5CQE A;  3FKI J;  1U9N A;  2IAI A;  4HST A;  5IOY A;  1IO2 A;  1V5E A;  2IW5 A;  3WE3 A;  3IKT A;  3CCL I;  2RQP A;  2WWY A;  2HDD A;  4UUS B;  5CXI A;  1Y1W J;  4J01 A;  2D1V A;  3H1C A;  3MKZ A;  5TIS C;  3H35 A;  1IV6 A;  1IRG A;  1U6G A;  2E1M B;  3BCA A;  3WU0 A;  2KJC A;  1BI0 A;  3TOA A;  3H5A A;  2LRE A;  2RDP A;  3ZMS A;  5F04 A;  2G0E A;  1HW1 A;  2HR3 A;  2JT1 A;  1B8I B;  1S5L C;  2I5U A;  5F08 A;  3DQV C;  2AQE A;  1JUS A;  2FEZ A;  1AKH B;  3ECO A;  5E3M A;  1XTA A;  2XPU A;  1N25 A;  2FU4 A;  4YFX F;  4KA4 A;  3UR3 C;  1LFP A;  2KPM A;  4Y15 A;  5EYR A;  4RGU A;  1AU7 A;  3QOE A;  4AVP A;  2W57 A;  2RV8 A;  3RKX A;  4LB5 A;  1JKP C;  4C3J J;  3ABL H;  1OIS A;  3BP8 A;  4RGX A;  2JA2 A;  4FQG A;  5IY5 H;  1HQC A;  4BE0 A;  4BHB A;  3HTA A;  5K7Z A;  2HKU A;  2LF8 A;  4D9J A;  2ETH A;  3RD3 A;  1G59 A;  4HX8 A;  3O6B B;  3HTH A;  1E3P A;  1HOM A;  2EV6 A;  3V6G A;  2BVM A;  2JMW A;  1ZG1 A;  1TTY A;  1BR4 A;  1J59 A;  1Z21 A;  4HZF A;  4U0Y A;  3F23 A;  3CCJ I;  3CME I;  4OIQ F;  1IN8 A;  1MMN A;  1JT0 A;  4XOP A;  4IHX A;  3AQS A;  1ZG3 A;  3GO5 A;  1G8X A;  2HS5 A;  4IRI A;  4BE1 A;  1XGN A;  3LA2 A;  3AAF A;  2Y69 H;  2PG4 A;  4XRS A;  1JI8 A;  2Y31 A;  2RQQ A;  2J5O A;  5B5E C;  4CYC A;  5GP9 A;  1W7P B;  1YG2 A;  2YVX A;  2WAE A;  2GIV A;  5LBQ A;  3GZI A;  2DOE A;  3TGN A;  3W6V A;  3E5Q A;  2VXD A;  4M72 A;  1R1T A;  1WJ5 A;  1F4K A;  2LF7 A;  3F6O A;  2R7S A;  5DUI A;  4FAS D;  1OQY A;  5JLX A;  3GZ5 A;  4HAM A;  2EK5 A;  1ZH5 A;  1HBX G;  1R7J A;  2VAS A;  3JTG A;  4YZE A;  2VOP A;  2R7F A;  3HB9 A;  1IUF A;  2F6C A;  4MXM A;  3S16 J;  4YG2 F;  2Q24 A;  1SFO J;  5FFZ A;  1QHH D;  2OU2 A;  2F5E A;  2L3D A;  2K27 A;  1X4O A;  4DYQ A;  5KVR A;  2H09 A;  2L7K A;  2VJI A;  4ENM A;  4HA8 A;  3I4P A;  2VQH A;  2VT2 A;  3SQN A;  4WCG A;  5L3F A;  3PO3 J;  2L9S A;  5EG0 A;  1TW2 A;  2JRM A;  2P8T A;  3W6K B;  2OF7 A;  1FP2 A;  4MQ9 F;  4M6X A;  2Q1Z B;  1X2M A;  1HKT A;  5BQT A;  1HKS A;  3FIS A;  3HOT A;  3C18 A;  1UHS A;  3CCY A;  3O8H A;  1YX3 A;  5FD5 A;  2QSF X; 
#chains in the Genus database with same CATH homology
 3LOC A;  5FKM A;  4FTH A;  1MBG A;  1MBE A;  3HGY A;  1U78 A;  2KT0 A;  1WH5 A;  2O7O A;  5HBU A;  3TW6 A;  2XGD A;  5EEA A;  2K9Q A;  1X58 A;  4A3L J;  3VVX A;  1BL0 A;  3DPJ A;  3TW7 A;  2XB0 X;  4B4C A;  4JP0 A;  1Z0X A;  3S15 J;  3WHB A;  5C44 J;  4V2G A;  2LFB A;  1GDT A;  3I4N J;  2YVH A;  1ETO A;  2WB1 N;  2XPW A;  1R9T J;  3MVP A;  1ZR2 A;  3HTJ A;  1PUF A;  2MSY A;  3H3V K;  3LSP A;  5AQC A;  2E19 A;  3VW2 A;  4JX6 A;  3BQZ A;  1MBJ A;  3ZQF A;  4A3F J;  3PO2 J;  3RZD J;  3IV5 A;  4A3C J;  5K58 A;  4BY7 J;  1APL C;  4GCK A;  3JRH A;  1I3Q J;  2HOS A;  2GBY A;  3ZQI A;  3LSR A;  2DA2 A;  2DMP A;  5FLV A;  4NEL A;  1UG2 A;  4W1U A;  2CUF A;  2ECC A;  2CQX A;  2ZB9 A;  3I4M J;  3ANP A;  3P9T A;  5FMP A;  2ZCM A;  1VI0 A;  4HKU A;  2XRL A;  2PMZ N;  3TP0 A;  4QTR A;  1ETK A;  5IOZ A;  2QWT A;  2YVE A;  4A3J J;  2X48 A;  3ON2 A;  4XRS G;  3O60 A;  3HOU J;  3S1N J;  2GUH A;  4D7N A;  4XID A;  5GPA A;  4A3M J;  2D6Y A;  3VUQ A;  5C4J J;  1JTY A;  2K9S A;  2L7F P;  1UI6 A;  3IH3 A;  1ZK8 A;  2H1K A;  4M3F A;  1A6I A;  5EFY A;  5HAW A;  2E2J J;  1TWF J;  3COL A;  3HOY J;  3LHQ A;  3BR1 A;  3VOK A;  1K83 J;  4IHV A;  2JWT A;  2EZK A;  2XSD C;  2AO9 A;  3JR9 A;  2XGE A;  3B6A A;  2NP5 A;  2K40 A;  1JKR C;  5F1J A;  4GFL A;  3BR5 A;  2D5V A;  1TWC J;  4CYC B;  2F07 A;  2FD5 A;  1RKW A;  3BNI A;  3BT9 A;  5DTD A;  2LLK A;  4GCL A;  2DTZ A;  1WH7 A;  4L62 A;  1AKH A;  4BY1 J;  1QVT A;  3HKZ N;  1QVU A;  1WPK A;  1W0T A;  4A93 J;  2JA5 J;  2ZOZ A;  1DU0 A;  1RPW A;  4IEJ A;  1SAN A;  3VVZ A;  2FQ4 A;  2HQ5 A;  1ZR4 A;  2DMT A;  4UUT A;  1VND A;  1IRZ A;  2ECB A;  1D5Y A;  3G1M A;  3A03 A;  2LVS A;  3GTM J;  2G7L A;  2CQQ A;  2W48 A;  4QIW N;  1IDZ A;  2L9R A;  4FE7 A;  3BG3 A;  4Y52 J;  2QF7 A;  3FK6 A;  1Y1V J;  4C3I J;  4MFD A;  3GTK J;  4ME9 A;  2ME0 A;  1VF9 A;  3IUV A;  5FLM J;  1JJ8 C;  4LOC A;  1I50 J;  4JYK A;  3S14 J;  3GTO J;  5HSZ A;  5EG0 B;  3S2D J;  3NRG A;  4DYR A;  4IHW A;  2DJN A;  1CQT A;  3HOZ J;  2EH3 A;  3HOW J;  1TWA J;  1DU6 A;  4BKX A;  2VKE A;  4XK4 A;  3G7R A;  3O8G A;  4NDL A;  3S1M J;  2EZH A;  3JRE A;  3ZOB A;  3TED A;  4BBS J;  1ETQ A;  3V78 A;  2IBD A;  4A69 C;  4J19 A;  3EUP A;  2NVQ J;  5JLW A;  2DG8 A;  1ETY A;  3MN2 A;  2ZCX A;  3HOX J;  3ZQL A;  3KZ9 A;  2LKX A;  3JRA A;  5H9T A;  2QCO A;  1F36 A;  4A3D J;  1A5J A;  2QTQ A;  2XDN A;  3EGQ A;  3HEF A;  4FE4 A;  1HF0 A;  4W97 A;  4M6V A;  2NVY J;  3DCF A;  2XGC A;  2RAE A;  3S1Q J;  1K61 A;  4A3B J;  1HDP A;  3BTL A;  3BTC A;  5EF6 A;  2K9N A;  1GUU A;  2FX0 A;  1PUF B;  4RDU A;  4D7M A;  5FKO A;  4ABZ A;  5FGL A;  5J1R A;  4DZJ A;  1JUP A;  2P81 A;  2I10 A;  1UMQ A;  1YRN A;  4AF5 A;  4JNN A;  2UXI A;  2DA4 A;  1T56 A;  2ME6 A;  5F0C A;  3ZQG A;  3CMY A;  5EGO A;  2YU9 J;  5C3E J;  1B72 B;  3KKC A;  2R5Z A;  1JT6 A;  1WGX A;  3F0C A;  4AYB N;  2XPV A;  1O4X A;  2WGB A;  3VW1 A;  4G12 A;  1JJ6 C;  5E3N A;  3QQA A;  4V2F A;  2VUM J;  1QRY A;  2YUS A;  5E3L A;  3VIB A;  3S17 J;  2X6O A;  4BBR J;  1NTC A;  3BG9 A;  5FKK A;  1BW6 A;  3HE0 A;  5BNG A;  4AC0 A;  2L7Z A;  1W0U A;  5C4Y A;  1GV2 A;  5F27 A;  2HOT A;  2WUI A;  4ICH A;  3OIO A;  1OFC X;  4B3A A;  2Y0S N;  2R7Z J;  5DS9 A;  1FJL A;  2R92 J;  2ID3 A;  2JA6 J;  5IPA A;  2MW8 A;  3NAU A;  3VPR A;  2DMQ A;  1P7J A;  3BR3 A;  4UUS A;  4EEF G;  1IG7 A;  4JL3 A;  3F1B A;  2VKV A;  1RKT A;  2ID6 A;  3NAR A;  4MO7 A;  3A01 A;  2DN0 A;  3BR6 A;  9ANT A;  3G1O A;  1FTZ A;  5M5Y J;  1OJL A;  1MH4 A;  1B8I A;  1EF4 A;  3RKQ A;  1IGN A;  2O8K A;  2L7M P;  2LD5 A;  1JTX A;  5J3L A;  2UXH A;  3RH2 A;  2QKO A;  3L1P A;  2WV1 A;  1GVD A;  2LTP A;  2DA6 A;  3ZQC A;  2ELK A;  4RBO A;  2HI3 A;  2LP0 A;  1WI3 A;  4DZP A;  5E3O A;  3T6N A;  1MH3 A;  3JRD A;  1FIA A;  1NK2 P;  2JN6 A;  2M34 A;  2GLO A;  3OOU A;  1ZQ3 P;  3BR2 A;  3B81 A;  5K7H A;  3HM5 A;  1U9O A;  5J1Y A;  2LK2 A;  4GCT A;  2DA1 A;  2NOG A;  2DMN A;  5J1U A;  4GFK A;  2CU7 A;  3TP3 A;  5EZG A;  3RZO J;  4DW6 A;  2W53 A;  3NI7 A;  4M3E A;  5M3M J;  3PAS A;  3GTJ J;  2NS8 A;  1ZGW A;  2FJ1 A;  2DG7 A;  3BHQ A;  3CWR A;  5FHP A;  1LE8 B;  2VPR A;  4A3E J;  1XS9 A;  2GM4 A;  1U8B A;  3BG5 A;  4XIC A;  1ITY A;  2HYT A;  2UXP A;  1IJW C;  3AQT A;  4GFB A;  3HDD A;  1HCR A;  1ETX A;  3BTJ A;  2EZI A;  3CDL A;  2CUE A;  4HNV A;  3BTI A;  5C4X J;  3FRQ A;  1FIP A;  2TRT A;  2EQR A;  2M8G X;  4M3G A;  2ZCN A;  4JKZ A;  1RR7 A;  5IYC J;  4S0H B;  3JSJ A;  4M3D A;  4Y7N J;  2R5Y B;  3NNR A;  3K7A J;  5D19 A;  3IH4 A;  2R93 J;  3FIW A;  2UXO A;  1MBF A;  3IH2 A;  1G2H A;  3G1L A;  3OSF A;  2G7S A;  5CW8 A;  3G56 A;  3ON4 A;  1TWG J;  2LR8 A;  2GEN A;  3HTI A;  1HDD C;  5FKN A;  4FCY A;  1IC8 A;  2DA3 A;  3LSJ A;  1H89 C;  1H88 C;  2O7T A;  1YRN B;  3HOV J;  5IYB J;  2E2I J;  2FBQ A;  2QIB A;  1UI5 A;  2QOP A;  3NXC A;  3M3Y J;  3UKG A;  1OCP A;  4I6Z A;  5M5W J;  4A3I J;  1TC3 C;  2JA7 J;  1HLV A;  3PPB A;  2O9L A;  2G7G A;  1AHD P;  4UDS A;  2E2H J;  3BCG A;  5EGO B;  3Q0V A;  2Y9Z A;  2NS7 A;  3FK7 A;  1MBK A;  2VI6 A;  1MBH A;  2R5Z B;  2YS9 A;  4X6A J;  2JJ7 A;  5F0F A;  1GT0 C;  3GBG A;  2X9D A;  4MLO A;  3VVY A;  3LWJ A;  4NN1 A;  3OSG A;  4D5C A;  4BXX J;  1P7I A;  5K7F A;  1H8A C;  3M4O J;  5D1R A;  1S7E A;  3LJL A;  3ANG A;  1POG A;  2DA7 A;  3DEW A;  2HXI A;  3PM1 A;  5EDN A;  2TCT A;  3MNL A;  5D18 A;  3VP5 A;  1XG1 A;  3Q0W A;  1FTT A;  1ETW A;  3E7L A;  4A3K J;  1JKQ C;  1MNM C;  4AC6 A;  3MKL A;  3S5R A;  2DMU A;  3D1N I;  3KNW A;  5IP7 J;  1MSF C;  3FKI J;  3RQI A;  1U9N A;  2IAI A;  5IOY A;  2OI8 A;  2CJJ A;  2HDD A;  4UUS B;  5CXI A;  1JUM A;  1Y1W J;  2V57 A;  3GTQ J;  4MIM A;  4A3G J;  4MK6 A;  2JK3 A;  1IV6 A;  2NVT J;  4AUX A;  2MG4 A;  2DA5 A;  5F0H A;  3A01 B;  2HOA A;  5M3F J;  2AHQ A;  3GTL J;  5F04 A;  4B1R A;  2Y30 A;  3CRJ A;  1Z77 A;  2EZL A;  2G0E A;  3JRF A;  1WCM J;  3B6C A;  1B8I B;  3HIM A;  1X2N A;  5F08 A;  5HOD A;  1JUS A;  3HBL A;  1AKH B;  2MGQ A;  3HGG A;  5E3M A;  3SFI A;  1OCT C;  1BA5 A;  2XPU A;  2NX4 A;  2NVX J;  3S1R J;  1AU7 A;  5EYR A;  3ZQH A;  1F43 A;  1B72 A;  2HYJ A;  3VW0 A;  4D5F A;  3C07 A;  1JKP C;  4C3J J;  3SDG A;  5FJ8 J;  2M2E A;  3GEU A;  1I6H J;  4FIS A;  2R0Q C;  3GTP J;  4IHY A;  3Q3S A;  2HXO A;  4DYC A;  3CJD A;  5K7Z A;  3HTA A;  4M3B A;  2E1O A;  2HKU A;  3RD3 A;  2NP3 A;  5IP6 A;  3LNQ A;  5FKL A;  2GFN A;  3HTH A;  1BW5 A;  1HOM A;  3BRU A;  1NK3 P;  3V6G A;  2IU5 A;  2JMW A;  3QPS A;  4JX5 A;  4X1E A;  3JRC A;  3VOX A;  2H8R A;  1VFC A;  2RHA A;  1JT0 A;  4XRM A;  4IHX A;  1RES A;  3AQS A;  3NPI A;  2PBX A;  4KWA A;  1Q1V A;  2UXU A;  2Y9Y A;  1ETV A;  3CQZ J;  1T33 A;  3JRI A;  2REK A;  2M0C A;  4C2M J;  4XRS A;  2Y31 A;  3K2A A;  2WAQ N;  5GP9 A;  2EBI A;  4CYC A;  3Q0U A;  1ZKG A;  4JX4 A;  2IEK A;  5DAJ A;  3JRB A;  3GZI A;  1IDY A;  3W6V A;  1GV5 A;  2KDZ A;  2PZ9 A;  3S2H J;  4L5E A;  1JKO C;  1ZTR A;  2B63 J;  3JRG A;  1TWH J;  3QBM A;  4ACI A;  5JLX A;  3BR0 A;  1MSE C;  3QPL A;  1SGM A;  1ENH A;  4I76 A;  3E7Q A;  4YZE A;  3GTG J;  3HB9 A;  1IUF A;  5EZH A;  4MXM A;  3S16 J;  2Q24 A;  5GPC A;  5CXG A;  1RET A;  1SFO J;  1JGG A;  5IYD J;  1ORK A;  1E3O C;  2CRG A;  4DYQ A;  2JA8 J;  1QPI A;  3KKD A;  3H0G J;  2XB5 A;  4MFE A;  1LFB A;  3A02 A;  3QKX A;  3PO3 J;  3C2B A;  2Y2Z A;  1BJZ A;  5EG0 A;  3BQY A;  2OPT A;  1LE8 A;  2ZOY A;  2COB A;  5IP9 J;  3WHC A;  2OF7 A;  2L0K A;  1FEX A;  2M9H A;  3BJB A;  1X2M A;  2N8G A;  4PXI A;  2LY9 A;  5M5X J;  2OER A;  3FIS A;  3LSG A;  1LFU P;  1XC5 A;  3SJM A;  1UHS A;  3CCY A;  3O8H A;  2RAS A;  4CGR A;  4QSH A;  4C3H J;  2R5Y A;  2G3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...