3PM1A

Structure of qacr e90q bound to ethidium
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
185
structure length
185
Chain Sequence
LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title A single acidic residue can guide binding site selection but does not govern QacR cationic-drug affinity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 74
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3pm1A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pm1A02
1ZQ3P 3O8HA 2UXUA 5HBUA 2DN0A 3BG5A 2WUIA 4GFLA 5D18A 3JRFA 5CXIA 3VW1A 5C3EJ 4A3BJ 1QVTA 1AKHA 2DMQA 4FE7A 3RKQA 1EF4A 1GV2A 3GTJJ 4A3DJ 3VOKA 2L0KA 3HKZN 3S1QJ 2WB1N 5IOYA 2V57A 4W1UA 2M0CA 2DA3A 3ZOBA 3ZQFA 3TW6A 5F27A 3OSFA 1TWGJ 3HIMA 5DTDA 2O7OA 2EZKA 1XC5A 2OPTA 1IDZA 2YVHA 4GCLA 1NK3P 3IV5A 1ETXA 5FLVA 4JKZA 5IYCJ 4HNVA 2HI3A 1Z0XA 1WPKA 2Y9YA 2CU7A 3FKIJ 1MH4A 2R5YB 1YRNA 2EZLA 2XPUA 2NVXJ 2XGDA 4MFEA 4V2FA 3MKLA 1JJ6C 1APLC 1JT6A 2DA1A 1T33A 1HOMA 2LD5A 4C3IJ 3PO3J 1MSFC 3CQZJ 3NPIA 2R7ZJ 2ME6A 3EGQA 2GFNA 3HGYA 3PPBA 1U9NA 5D1RA 4A3MJ 3G56A 5F0CA 4BBRJ 1XS9A 3BJBA 5CXGA 2YVEA 3Q0VA 3BHQA 3I4NJ 2XSDC 3GTQJ 3NAUA 4XK4A 1YRNB 5FKKA 5EFYA 3CDLA 5FGLA 2UXPA 3B81A 2LFBA 3Q3SA 1K61A 2LKXA 1XG1A 2XB5A 3HOZJ 3ANPA 2JJ7A 2NS7A 5FLMJ 1GV5A 3FRQA 3JRDA 2CQXA 1UHSA 1UMQA 4PXIA 4IHWA 1RETA 1RKTA 2DA6A 2ZB9A 4RDUA 1PUFB 3BNIA 5FKLA 4XIDA 1B72A 3JSJA 3HDDA 2EZIA 1IV6A 2JA6J 3CCYA 1ETQA 1MBHA 4UUSA 3CMYA 4M3BA 3GEUA 4G12A 4M3DA 1ZR4A 1NK2P 1MBFA 2YU9J 1MBKA 2XPVA 1E3OC 3A03A 3SJMA 3BG9A 5F04A 3W6VA 3E7LA 3QPLA 3NNRA 3HGGA 9ANTA 1JUSA 4X6AJ 1VFCA 4XRSG 1QPIA 2O7TA 2TCTA 1RPWA 5FJ8J 1TC3C 1B72B 2X9DA 3HE0A 2M9HA 2DMNA 4IHYA 1JTXA 2M34A 2ID3A 4MIMA 2VKEA 4UUSB 3LSPA 1ITYA 3VVXA 1VNDA 2L7MP 4FISA 1X2MA 5J1YA 2K9NA 3ON4A 2H8RA 2X48A 2RAEA 2VUMJ 2ME0A 3FIWA 1HDDC 2JWTA 4I76A 2AHQA 5FMPA 4DZPA 2PZ9A 3M4OJ 3VP5A 2XPWA 5EYRA 4XRMA 3M3YJ 2LTPA 2W48A 3IH4A 4XICA 1U8BA 3S1NJ 4UDSA 3ZQLA 3QBMA 1MBJA 1TWAJ 2H1KA 1TWHJ 2QIBA 2E19A 3V6GA 3QPSA 3FISA 4QTRA 3CRJA 1Q1VA 2L7ZA 1LE8A 3I4MJ 2R5ZA 2G7SA 3A02A 5F0FA 3VW2A 4AC6A 3LOCA 4X1EA 2NX4A 2ZCXA 3GZIA 3S17J 4DZJA 1JJ8C 1JUPA 1IJWC 1IUFA 1RR7A 2XB0X 3PO2J 1GUUA 2PBXA 2FQ4A 2W53A 1NTCA 3S2HJ 4MFDA 3COLA 1UG2A 3KKCA 2Y9ZA 1X58A 4L5EA 3D1NI 1H88C 3GTLJ 3O8GA 4DYCA 1DU0A 1OJLA 5BNGA 5FKOA 2Y30A 4A3EJ 4ACIA 1TWCJ 1RKWA 1R9TJ 2LLKA 3B6CA 2ID6A 2R5YA 3GTOJ 4ME9A 3GTGJ 1U78A 3BR2A 3T6NA 2MW8A 3TP0A 1K83J 2DMPA 1JGGA 2GUHA 2UXHA 2O8KA 2HDDA 3LJLA 1I3QJ 5IP6A 4A3KJ 3ZQHA 5K58A 3G1MA 5HODA 1FTZA 3BCGA 5FKMA 2KDZA 4FCYA 5HAWA 1VF9A 3GTMJ 5C4XJ 2QWTA 2UXIA 4B3AA 1CQTA 2ZOYA 3G1LA 5EGOA 4QSHA 4CYCB 4DW6A 4CGRA 3LHQA 1BW6A 1JUMA 3K2AA 2E1OA 4JX5A 2G7LA 1DU6A 4AC0A 4GCTA 3MVPA 3C07A 4JL3A 5JLWA 3P9TA 4FE4A 2IBDA 2MSYA 2ZCNA 5J3LA 3HEFA 1PUFA 2NS8A 5E3MA 2GENA 2GM4A 1OCPA 2CRGA 1B8IA 3WHCA 3CJDA 1ETVA 2XRLA 3BRUA 3GBGA 1HLVA 5EGOB 3JRAA 3GTPJ 3BR0A 3TP3A 4A3JJ 2DA2A 2EQRA 4MLOA 5E3LA 2N8GA 4BKXA 4ICHA 2HOTA 3HOUJ 3BQZA 4GFKA 3LSJA 3BTLA 5C44J 1FTTA 1FIAA 2HYJA 2ELKA 2DG7A 1JKQC 1U9OA 2TRTA 1S7EA 3K7AJ 1W0UA 5DS9A 1HDPA 1FEXA 2OI8A 3PASA 1B8IB 3OOUA 5EZGA 1Z77A 3VIBA 4AUXA 5E3OA 2JMWA 1JT0A 1P7JA 1BJZA 5EEAA 4D7MA 2NVYJ 1LFUP 5F08A 3ZQGA 3BQYA 1ZTRA 2K40A 3AQTA 2F07A 3S5RA 4S0HB 4FTHA 2DA4A 1Y1WJ 1AHDP 1WI3A 3VVZA 2VI6A 3HBLA 2REKA 2XGCA 3VW0A 2Q24A 3JRBA 2OERA 1GVDA 4C3JJ 5AQCA 1LFBA 3A01B 2Y2ZA 3OSGA 1JKPC 2JN6A 1MH3A 3S1MJ 3IUVA 4IHVA 4JNNA 2FX0A 3NI7A 5EG0B 2D6YA 1ETOA 3KKDA 2HOSA 2EZHA 5F0HA 4M3EA 2YS9A 3NARA 2COBA 4NELA 3JRHA 2DTZA 3FK7A 4M6VA 3HOXJ 1POGA 1ORKA 2QCOA 1F43A 1SGMA 1ZR2A 2HYTA 5FHPA 2KT0A 1QRYA 2ECCA 3QQAA 5GPCA 1GDTA 2YUSA 2WAQN 4NDLA 3Q0WA 4BY1J 4A69C 4A3GJ 2JA8J 3HOYJ 1T56A 3WHBA 2DA5A 1WCMJ 2LP0A 2GBYA 5M5XJ 2P81A 1ZKGA 2X6OA 1GT0C 1HCRA 2EH3A 2DJNA 2CQQA 4HKUA 2WV1A 4BXXJ 2RHAA 1W0TA 5C4JJ 2NP5A 2E2IJ 4JYKA 4D5FA 3S14J 3S15J 3RZDJ 3L1PA 2PMZN 2NP3A 1JKOC 1ZK8A 1WH5A 5IP7J 3S2DJ 3O60A 1AU7A 2EBIA 2UXOA 1BA5A 3V78A 3Q0UA 3PM1A 3B6AA 4BY7J 3JREA 4MXMA 2GLOA 3IH2A 1A5JA 4YZEA 2XGEA 5M5WJ 1I50J 5D19A 1OFCX 1Y1VJ 3JR9A 1FJLA 3BR5A 3HM5A 2OF7A 3BR3A 4A3IJ 3G7RA 4NN1A 3HB9A 4D5CA 4CYCA 2R0QC 3KZ9A 1D5YA 3OIOA 3LSGA 3ZQIA 1G2HA 2B63J 5FKNA 2XDNA 2G3BA 4M3GA 3JRCA 1WH7A 4JX6A 2NOGA 2HQ5A 4BBSJ 5IP9J 2CUFA 4V2GA 2QF7A 4MO7A 2NVQJ 2JA5J 2IAIA 1IRZA 1JKRC 1MBGA 2DMUA 2IU5A 1QVUA 3SFIA 4A3FJ 3BR6A 2LK2A 3BT9A 4IEJA 3JRIA 5K7HA 2R92J 2G7GA 3HTHA 2JA7J 2AO9A 2M8GX 1X2NA 3GTKJ 3H0GJ 4Y52J 3MNLA 5JLXA 3F0CA 3TW7A 4GFBA 2DG8A 3QKXA 3ANGA 2I10A 1AKHB 4UUTA 4MK6A 2HXIA 3LNQA 3HOWJ 1ETYA 3UKGA 2JK3A 1ZGWA 2MG4A 3BG3A 4J19A 2L7FP 3RH2A 2L9RA 3MN2A 3C2BA 1JTYA 5K7FA 3KNWA 3RZOJ 3VVYA 3FK6A 2QTQA 3CWRA 1MBEA 3DEWA 1IGNA 3BR1A 3HOVJ 5GP9A 2M2EA 2QOPA 3TEDA 4LOCA 5IYDJ 3LSRA 1O4XA 1WGXA 1P7IA 1UI6A 5GPAA 3A01A 3BTJA 5HSZA 3HTIA 3LWJA 4QIWN 1TWFJ 2LVSA 5EG0A 2LY9A 1BL0A 4JP0A 3VOXA 4L62A 3DPJA 3ZQCA 4DYQA 5C4YA 2FD5A 1HF0A 2MGQA 3NRGA 3S16J 4A3LJ 5K7ZA 3G1OA 3E7QA 4C3HJ 2K9SA 4Y7NJ 3IH3A 5IYBJ 1F36A 3RQIA 4DYRA 1H89C 1SANA 2ZCMA 3F1BA 3HTJA 1IDYA 4I6ZA 2CJJA 2VPRA 3AQSA 4AYBN 5IOZA 2K9QA 4IHXA 5H9TA 4KWAA 1VI0A 2CUEA 3H3VK 3BTIA 3HTAA 5EZHA 2R93J 2WGBA 2FJ1A 3RD3A 2DMTA 4A3CJ 1ETKA 2LR8A 1OCTC 4RBOA 4A93J 4AF5A 5EF6A 2ECBA 2HOAA 5J1UA 5M5YJ 2E2JJ 1BW5A 2HKUA 4C2MJ 1I6HJ 1MSEC 1UI5A 1IG7A 5IPAA 2O9LA 4EEFG 1A6IA 2E2HJ 5DAJA 4JX4A 5F1JA 4B4CA 4W97A 4M3FA 2QKOA 4XRSA 1FIPA 2RASA 1IC8A 3ON2A 2VKVA 5J1RA 5M3FJ 2ZOZA 1ETWA 1ENHA 5E3NA 5EDNA 1H8AC 4GCKA 3SDGA 2DA7A 1RESA 3BTCA 4ABZA 3JRGA 3VUQA 5CW8A 2Y0SN 5M3MJ 3S1RJ 4D7NA 1MNMC 2HXOA 2D5VA 1SFOJ 2IEKA 3NXCA 2FBQA 3DCFA 2Y31A 3VPRA 4B1RA 1LE8B 2R5ZB 3EUPA 2NVTJ 2G0EA
chains in the Genus database with same CATH superfamily
3GUDA 2KLOA 1ZQ3P 3O8HA 5K5OA 2VJJA 4LK1F 3BG5A 4GFLA 1IRXA 3JRFA 3KPHA 5CXIA 2CFOA 5J47A 1YW7A 2MLKA 1QVTA 3AKZA 1AKHA 4A3BJ 4OIPF 3AFHA 2VBWA 4H4KC 3GFLA 3QODA 2LYCA 3ZN1A 1FBSA 3A0BC 4W1UA 2D1HA 3C2GA 4LITA 1A35A 2STTA 4X0GA 3OSFA 3BG7A 4H0EA 4GCLA 1IDZA 1GVJA 2W00A 2YVHA 4BS9A 2FA5A 2IVMA 5CYVA 1ETXA 3ECOA 2Y0SA 4JKZA 1XGNA 1RRJA 4HG2A 1MKMA 2CU7A 3FXUA 1MH4A 2EZLA 4XSZF 1XMXA 4V2FA 3L2VA 2L01A 2EWNA 4C30A 4BU2A 2P6TA 3I55I 3T8TA 3PO3J 2R7ZJ 3PPBA 2DU9A 5D1RA 1U9NA 4KJZA 2DODA 2VJIA 4BXUA 5FRNA 5F0CA 2V9VA 3BHQA 4ANJA 4I7HA 3BDDA 3I4NJ 1YJWI 1YRNB 5FKKA 5EFYA 2A6EF 3CDLA 1O3TA 3IAM2 2LFBA 1E3PA 3NRVA 1KYWA 4DIQA 3HOZJ 4CDGA 1YX5A 1ON1A 5HDKA 3ANPA 2NS7A 2QYOA 3IC7A 2XASA 2CQXA 1D1BA 2FOWA 1RKTA 4IHWA 2DA6A 4O5VA 2UZKA 2VBXA 1PUFB 3BNIA 4XIDA 1RNLA 2ZCWA 3HDDA 1LB2A 2JA6J 3E6BA 1T0FC 3CMYA 3GEUA 1Z9CA 2HEOA 2KQRA 4YG2F 4M6XA 2KJCA 3A03A 4HAMA 3U9GA 3SEZA 2DT7B 2QVOA 3HGGA 9ANTA 3QRFF 1VFCA 3F6OA 4KITB 5FJ8J 3K4BA 1B72B 3HE0A 1MGTA 2L4AA 4PJLA 2DMNA 1W7PA 4RAGA 3CCVI 2F5CA 3LSPA 2FNPA 1ITYA 4BACA 2I5UA 4FISA 1X2MA 2EV6A 2KP6A 4L9VA 2H8RA 3OOPA 4KT5C 2ME0A 3BC8A 4BEHB 1T8IA 2ZBKA 4ZJZA 3KLNA 3IHUA 2PZ9A 5EYRA 4UDSA 2L54A 1ZRFA 1MBJA 5E1WA 2H1KA 4I98B 4KYWA 3LSKA 1TT5B 4E7IA 2QIBA 2E19A 3A0HC 1D3YA 1I39A 3FISA 4QTRA 4BJ6C 3KP7A 2J5PA 2EPFA 2RNGA 2R5ZA 1LE8A 3M1EA 2G7SA 4N9IA 2BW3B 3VW2A 3LOCA 2CUZA 4E6KG 2KL4A 2X6XA 2CSOA 4DZJA 1FYKA 1MNEA 1IJWC 3CLOA 1RR7A 2XB0X 1DPRA 1EH6A 3CESA 4RGXA 4MFDA 1UG2A 2OD5A 4U7DA 3EQLF 1P9QC 4B8XA 1XPXA 1D1CA 1H88C 4M9SA 3TO7A 4MTDA 2YSRA 2P0WA 4P9FA 4DYCA 1XMKA 2X0LA 5FKOA 2Y30A 3KETA 4XKWA 4ZZDA 1R9TJ 2LLKA 2E5ZA 2EFOA 3MQ0A 2WY8Q 4A5NA 3GTGJ 4LMYA 1BI0A 3DKXA 5AIQA 3H9GA 2H8WA 3KFWX 3ZMTA 5FROA 5D5UB 1JGGA 4CHUA 5J8FA 4YIIA 3DEUA 1YO5C 3SDBA 3LJLA 4EJVA 3G1MA 1YJNI 4XMYA 2KDZA 5HAWA 1VQ7I 5C4XJ 2W1OA 1TZLA 2G7UA 1ZGJA 2CW0F 2ZOYA 1I1SA 4ZDLA 3K1PA 3K6GA 2BGCA 1LEAA 5FB2A 3LHQA 4Y13A 3VOEA 2P7VB 4MHGA 1DU6A 4AC0A 4GCTA 2D1VA 2OA4A 2O3FA 2M45A 1ZG5A 1PUFA 1QZEA 3FBNB 2GENA 1OCPA 2XRLA 1L0OC 1FX7A 3WGHA 3BR0A 2TDXA 4XLAA 2Z16A 1HKTA 1TNSA 4XORA 1B4AA 2MYSA 3E5QA 3SZTA 3BQZA 2IT0A 3KIOA 5C44J 4HRIA 1W7PD 4NHJA 2FSWA 1BR2A 5E8GA 1KA8A 2KIMA 2KZVA 3I53A 5DS9A 2W57A 3PASA 4AWXB 4KIGA 4AUXA 2Q0OA 2Z1DA 1BBYA 5LRRA 4HZFA 1IN6A 3ZMUA 4MGRA 2NVYJ 3BPXA 5F08A 1XMAA 2JTVA 1FC3A 5DEQA 4S0HB 1OCOH 1Y1WJ 2ZO4A 4IKFA 5L3EA 5H6RA 2VC1A 1MDMB 4MQVA 1J0RA 4UXNA 2REKA 3VW0A 3LA3A 2HQRA 5D8KB 3GEZA 1HXDA 1UG0A 2JZYA 4L9NA 5F1RA 1SD4A 2ETHA 3W2AA 4KN7X 4AIKA 3AL0B 2HDCA 2A2FX 1USTA 5A2QK 4IO9F 4MNUA 2BW3A 2PG4A 5F0HA 2YS9A 4CCOA 1B6AA 2COBA 2FBIA 4L9JA 4OINF 4NELA 3ABKH 1F9NA 3PNVA 4Z6YA 3HOXJ 2HYTA 1K4SA 2KT0A 2PX9A 5DCMA 5JI6A 2OCEA 2V1XA 5DV5A 3HHHA 3I59B 2CGPA 4M71A 3NEUA 3QPTA 2DOFA 2DA5A 2E34A 2QQBA 5CVIA 3WHBA 4B44A 2H27A 2IXSA 4EQQA 5M5XJ 1R7JA 2KDOA 3QYEA 4BJ5C 1HKSA 1XN7A 2VQHA 2EA4A 4I0AA 3Q9SA 2DK5A 4TV7A 2F4IA 2QQAA 2WAEA 1FYMA 1T39A 3S14J 2ZC2A 1QNTA 5EEGA 4IJAA 4CCNA 2PMZN 1LPQA 5DD8A 3DBHB 3P9CA 1EH7A 1ZGAA 3A4CA 3WG9A 3PIOF 2DAOA 4P96A 1AU7A 2XF6A 1KU9A 3B6AA 2ZFWA 2KZGA 4MXMA 1TBXA 2LBFA 4YZEA 4HX7A 2WAQA 3CUQB 3DKYA 4DGWB 1OFCX 2UXXA 5JFRA 3JR9A 1FJLA 2GXBA 2HQAA 3PNTA 3UR3C 3P7NA 3HOTA 3CCSI 2E36A 3HB9A 4D5CA 2FBHA 3KZ9A 3OYEA 2RKHA 3LSGA 2IA0A 3G73A 2ZSIB 3F8FA 3CO6C 3I56I 1VQ9I 3LSIA 4BQAA 3H92A 2WA0A 3JRCA 2NOGA 4PSWA 5DCFA 3HSRA 3S32A 1X1PA 2VQGA 2L7KA 3J7ZI 2XKPA 1D1AA 5D4RA 4EATA 1O3QA 3MCZA 4OAZA 1IN8A 3BT9A 3JRIA 5K7HA 3V42A 3OIQA 2LDUA 5LRSA 2NXNB 3HTHA 1OQYA 1TQMA 3GTKJ 1LDKB 3CCUI 3RQ4A 1BR4A 3F0CA 3TW7A 4YELA 2QKMB 2R7SA 2DG8A 2BOLA 4ENNA 4YIRX 2ZMEA 1R00A 4UUTA 3OR1C 3CMEI 2JA2A 1SAXA 1N78A 3OIPA 5KHDA 3LNQA 3KLOA 1ETYA 2K27A 3ZQ7A 2NS0A 3MWMA 4EJUA 3MKWB 5ICCA 4XOTA 1STZA 5K7FA 4NBQA 3LAPA 2ELJA 4L0YB 3RZOJ 1D0XA 2V26A 3CWRA 1IN4A 4Y15A 2M2EA 5CPRB 3HIFA 1C0WA 1WGXA 3H36A 4UVAA 2X85A 5GPAA 3BTJA 1YYVA 3QOEA 2WWYA 3AG2H 4YFXF 3H3ZA 3MD2A 1BL0A 5LEJA 3ZQCA 3EETA 1Z7UA 3FHZA 1MMSA 4UV9A 2YX4A 4HSTA 2MLGA 3K9TA 1BOBA 1BR1A 3WU2C 4ZYEA 3I59A 1O57A 3E7QA 5E1ZB 4C3HJ 3QYBA 3TMOA 3V8JA 2BY1A 3GZ6A 3HRTA 2JVGA 3RSNA 5IYBJ 3LAJA 3L2CA 4GDFA 1F36A 3RQIA 5BMZA 2Y0MA 3HG9A 3PFYA 3HTJA 3FMQA 1YG2A 3D5RC 1IZ1A 4D0PA 5BQTA 3BG6A 4CUGA 1H9TA 3BZCA 4FQGA 1NHAA 1BN5A 1R4MB 3CTAA 4U9LA 1VI0A 1VQ4I 3HTAA 5EZHA 1KONA 2LMDA 3T5XA 2DMTA 4A3CJ 4HPQA 1D8JA 2M4KA 3M9AA 4LFUA 4A93J 2L9NA 2VT3A 4AIHA 5JR3A 3I54A 2Z9OA 3DU6A 4C2MJ 1UI5A 1Q1HA 1IG7A 5FFXA 3CUQA 4I02A 3L9FA 5FD5A 1MW7A 2O9LA 4BXFA 4EEFG 4ZC3A 4BQQA 3K4MA 3MAJA 2YR2A 4C9YA 1OCZH 4W97A 1RR8C 1UELB 2QKOA 1YE9A 4XRSA 2KIUA 2JSPA 1LVAA 1ZREA 3ZMDA 1W36D 1MJBA 1MNDA 5JVTA 2FQ3A 2IGNA 3WTSC 4PFPA 3T0YA 3G2BA 4BQNA 2NVUB 3HXLA 2DA7A 2RDPA 2RN7A 1I1GA 2COMA 5CW8A 5EJCA 5M3MJ 4GO1A 3FBIB 1SFOJ 2VASA 2ZKZA 3DCFA 4CZZA 2CV1A 4Y17A 1X19A 2Y31A 3T8RA 4ASNA 2YPRA 4CSWA 2EFPA 3EUPA 4RGUA 4LB5A 1BIAA 2WUIA 1J2XA 2GA2A 3SHFA 4ZH4F 2M4GA 4PSXA 3MZHA 5L3DA 2P5LC 2DFHA 5E1XA 2DMQA 3IL2A 1GV2A 2EFNA 1ZH5A 1RIOH 3VOKA 2IGKA 3HKZN 3S1QJ 2Q2EA 2WB1N 2V57A 4OIRF 2MD0A 3PUBA 3KP3A 3ZOBA 3ZQFA 2LC2A 3QOPA 4Q4ZF 2BHYA 4BHBA 2O7OA 1WFXA 2EZKA 1Z67A 4ENJA 1R1UA 1NK3P 2E7XA 1UB9A 1WI9A 2M7BA 4E4HA 3HRUA 2PBIA 3J7YJ 1WPKA 3FKIJ 2R5YB 3TDUC 4XKVA 4DOZA 2XPUA 3B02A 2XGDA 1FY7A 3FHNA 4GYGA 1JJ6C 2P7CB 1Y6IA 3IRRA 2XAJA 1X3WB 3EGQA 5B1AH 3HGYA 4G7ZF 4U88A 3G56A 4I99C 4BBRJ 3GZ5A 3BJBA 3J80Z 2XAHA 2PLYA 4UNOA 5ICFA 2XSDC 2K3FA 3NAUA 4XK4A 5FGLA 2HZDA 2HR3A 5L3FA 5LHGA 2VE9A 4YFNF 1X1CA 2HVQA 2E5NA 3KP5A 3DFGA 1K61A 2LKXA 5BS6A 4R79A 3C3WA 2HKOA 2MFZA 3OMYA 5FLMJ 4E7LA 1HW2A 1GV5A 3FRQA 3JRDA 1UHSA 1UMQA 2X6YA 4PXIA 1RETA 3GW2A 2PMUA 4LLNA 2ZB9A 4RDUA 2XF7A 3ZPLA 3P5JA 4RA2A 1EA3A 3JSJA 1G8XA 1Z05A 4KIBA 2O6GE 3CF2A 4UUSA 2WBMA 3M7GA 3CP8A 3OYAA 3ML6A 5IT3A 3E3VA 1WJBA 1MBKA 4UB6C 5D5VB 3SJMA 3JTHA 3AG3H 1YIJI 4GXOA 4X6AJ 1X1AA 3KP6A 4N4NB 2XC7A 4HW0A 2L5QA 2KRCA 3TDZC 1JTXA 4MIMA 2M3AA 2MBFA 3HZJA 3OYJA 1VNDA 3U2RA 5J1YA 2K7LA 2K9NA 4OOIA 2H09A 3I71A 2G9WA 4OMYA 3WU0A 1HDDC 2JWTA 2KRHA 3K4CA 4IZZA 2LREA 3WTVC 2F4OB 2AHQA 1Y56A 5FMPA 4DZPA 3M4OJ 3VDXA 5D5XB 4XRMA 4ZTFA 3ABTA 2XAUA 2W48A 3IH4A 3QBMA 3KCCA 2BV6A 3ZR8X 1IRGA 1Q1VA 1XX5A 4B48A 2HZTA 3W2VA 3PIPF 1UHMA 1R5GA 3ABLH 3A02A 3IWFA 2IS6A 3H35A 5TJJA 1YW9A 3G6EI 2XSJC 3REOA 4RB3C 2NX4A 2AQEA 1R71A 2ZCXA 4EM2A 3GZIA 1PYVA 4LK0F 1KQ9A 1TNTA 4DBQA 2PBXA 4BQOA 2W53A 4YFKF 3COLA 3LFUA 5HNFA 2Y9ZA 1X58A 4L5EA 1N77A 4PUSA 5KNLA 2OU2A 1IF1A 2L3DA 4BUPA 4RGSA 1Z3YA 4Y33A 3KYCB 3W6KB 5DYMA 1OJLA 4UUVA 5HS8A 3QAHA 3TQNA 1TL8A 4ACIA 2F5EA 3FXMA 4V19K 1KQ0A 4R8HA 3EUAA 2WC2A 3K1MA 2R5YA 3GTOJ 1D5VA 1U78A 2VPLA 5J8CA 4B3XA 3T6NA 2HQNA 2ZXWH 3S3OA 2MW8A 3TP0A 4F3QA 4L5JA 4RAFA 3N05A 2EV5A 3CC7I 2IP2A 2GUHA 3E6MA 4RB1A 4CGZA 3RKXA 2VXZA 1BOAA 1K4TA 5K58A 5AIPA 1A36A 3ABUA 1FTZA 5FKMA 3BCGA 4E7KA 4XLHA 3CC2I 2QWTA 1AWCA 2PFBA 1CQTA 4G94A 5FFZA 2OUMA 1OYIA 3G1LA 5D6EA 4CYCB 1YQAA 3PQKA 3W3CA 5GTIC 1JUMA 3K2AA 2W85A 3PFIA 4XLFA 4JX5A 3C7JA 2AXLA 3OYLA 1VQ6I 2F5DA 4Q5SF 3C07A 2QUFA 2CW7A 1T6SA 5J3LA 2LG4A 3MZ8A 5E3MA 2F6CA 2VE8A 2XUBA 1ETVA 1T2KA 1PVEA 1UFMA 4RLQA 3JRAA 2PFVA 3TP3A 2DA2A 2QBYA 2N8GA 1X3UA 2OAZA 1ZAOA 2LY1A 4GFKA 3EYYA 3LMMA 1TTYA 1FTTA 1JGSA 3M8EA 1ON2A 1TW2A 3GVAA 3E5XA 1VQOI 2K85A 3K7AJ 4HX8A 1P4WA 1W0UA 2IJLA 2OI8A 4PK4A 3CC4I 3VIBA 4OU0A 1UJ8A 2JMWA 2KFDA 4EJOA 1JT0A 1BIBA 2A5WA 5LHIA 4D7MA 1LFUP 2PJPA 4RB0A 3DXJF 4B09A 2FNAA 2VJ4A 1MMGA 1S3JA 4G6TB 2R3SA 2F07A 1FP2A 3S5RA 4FTHA 4UHTA 5TISC 3RIRA 1MJ9A 1WI3A 1SMTA 4P1WA 2M0MA 1BJAA 1WVRA 3HBLA 4CA0A 2K02A 2VL8A 4WX9A 4DNCA 3B73A 3JRBA 4KT6A 3COAC 1GVDA 4C3JJ 3ZP5A 1FMWA 3DWLE 2VBZA 1AOYA 2VN2A 2Y2ZA 3IUVA 2JN6A 3LSTA 2Y69H 2WY7Q 5K5RA 4OIQF 3NI7A 4Z2YA 2D6YA 4I0BA 1ETOA 1VQ8I 2BXZA 2EJRA 2KKOA 2EZHA 3EUHA 2HOSA 3NARA 1K79A 1USSA 3FK7A 2QCOA 1WJCA 4NC6A 3ERMA 4RB2C 1GDTA 4KDPA 3GZNB 4LG3A 5IY5H 1DPUA 4A3GJ 1YIOA 5ICGA 5TGTA 4A5MA 1T56A 3GO5A 1DP7P 4HBLA 4PGHA 1EV7A 5BPDA 2R7FA 3FXJA 2X6OA 3J7AY 1GT0C 4XOPA 1HCRA 4WIBA 1OISA 1S7AA 4QWQA 3BP8A 2KISA 2ZJ2A 5DCMB 4HKUA 3CJRB 1T98A 3JW4A 1HC8A 2RHAA 5J4YA 3GLXA 2HVRA 5C4JJ 2PI0A 4AM3A 2NP5A 2GIZA 4D5FA 3RZDJ 3L1PA 3I5UA 1ZG1A 3F8MA 3KP2A 2XDVA 5J40A 2NP3A 1JKOC 5ILUA 1E2XA 1ZK8A 5H20A 1FPQA 3S2DJ 2MH9A 1OYYA 4UVBA 1BA5A 3Q0UA 4A0YA 3VSKA 1GLNA 2I8DA 3IH2A 3KX2A 1OR7A 5D19A 1Y1VJ 5J6XA 2JVHA 3BR5A 2JSCA 2OF7A 3BR3A 3J80K 4A3IJ 4CYCA 4Y3OA 4QPQA 2R0QC 1D5YA 3OIOA 1G2HA 1ZYRF 4IQJA 2B63J 1M1EB 2XDNA 2G3BA 4U7BA 3PJRA 5L3CA 4JX6A 3RI4A 4GYIA 5IP9J 1WWXA 5K5QA 2QF7A 1LKXA 4MO7A 4IRGA 2DTRA 2CQNA 2HPIA 2LBFB 2JA5J 1JKRC 1FLIA 1KYZA 1MBGA 3CJNA 2DFEA 5FLXZ 2IU5A 2CWEA 1QVUA 3KZIC 2LK2A 2PMZA 2R92J 5E17F 4LGWA 5HLGA 2M8GX 3H9JA 3MMYB 1X2NA 1HW1A 2DW4A 2OZUA 4B43A 4Y52J 3MNLA 2V4JC 3HYIA 4KICA 4ZYDA 3QKXA 2M87A 2GOMA 2O61A 3AL0C 2I10A 1IO2A 2JPCA 2K9LA 3R0AA 3PQJA 4HEA2 3VEPA 3HUGA 3DKWA 3I9V2 1DUXC 3FWEA 4WXDA 2Q1ZB 4E7ZA 1N75A 3UKGA 2B1EA 1VQLI 1RUOA 3AAFA 2MG4A 3BG3A 4J19A 3U21A 2L7FP 2L9RA 3WTTC 3VB2A 3C2BA 3KP4A 2AQFA 3OYGA 3F9KA 5FRMA 3VVYA 2EIMH 2V1DA 2ZMEB 3F8BA 2QKLB 5FGMA 3TEDA 5IYDJ 3LSRA 2RQQA 1R49A 1MMDA 2DOEA 3F72A 2E7WA 1G3YA 1E3HA 1TWFJ 4XRFA 2LVSA 5ILVA 2LY9A 2M8EA 2XVCA 1FOKA 2R7VA 2KRFA 3K10A 3QYFA 3CDIA 4DYQA 2CW8A 2F2EA 3N4MA 3HRSA 1YTYA 2RC4A 2Y48A 1OPCA 4CCMA 3GCMA 4M72A 3RYRA 2ZFUA 4A3LJ 5K7ZA 3IP4B 2QEXI 4HA8A 4DYRA 4U0VA 3FXKA 2CQKA 2VOOA 1QHGA 4LLLA 1X4OA 2HPMA 4IF4A 4I6ZA 3EPZA 3CUQC 2CJJA 4EV0A 2GXAA 2V6CA 4Y4RA 3TL4X 4KA4A 1RUNA 3KYLA 2J5OA 1B59A 2RV8A 1U6GA 4GGGA 1XCBA 3R4KA 4KWAA 3L2RA 3RD3A 4BE2A 1SD6A 2BYVE 1ETKA 2LR8A 2QWWA 5LGTA 3L2WA 1XSDA 4AF5A 4O3MA 2L2OA 2ECBA 3BROA 5LGNA 1T0FA 2E2JJ 2HKUA 4MEYF 1P2FA 1MSEC 3PL8A 1YS6A 1FBQA 3KYDB 2AS5F 3TOAA 1NH3A 3VWBA 2CS3A 5DUKA 5B3SH 1LVKA 1K6YA 5LBQA 2FF4A 3ERED 3WTZA 1WJAA 2AXTC 5DAJA 2H6CA 5F1JA 4A12A 2LRDA 4RMNA 1UCRA 4M3FA 2CG4A 2HTJA 2STWA 2LF8A 2X51A 1DGWY 2A05A 2ZOZA 5M3FJ 1CF7A 5EDNA 1EKEA 3TO9A 2FU4A 2QM3A 4ABZA 3JRGA 3OYDA 5H2FC 4XLPF 4XNFA 1F1ZA 5LEKA 1MNMC 4II3A 1DP3A 2IEKA 1U8RA 2DLLA 3CJTB 2B0LA 1S8NA 1Y0NA 5DD4A 3O3KA 4CH7A 2B9SA 4M9XA 2CV0A 3HSEA 2UXUA 1R58A 1V55H 2ZXIA 2DN0A 5D18A 3GX4X 3LSHA 2W82A 3OS0A 4FE7A 4LJZF 1MIJA 4IRVA 3GTJJ 4A3DJ 2L0KA 1R4NB 3ZMVA 2LSOA 2DT6A 1R5HA 2M0CA 3TW6A 2RGVA 3K4NA 1K6OA 1TWGJ 3HIMA 1HQCA 2V1NA 2L02A 2OPTA 4BE1A 1OKRA 1P4AA 1GXQA 1IN7A 5FLVA 1BI3A 4HNVA 1S9HA 2HI3A 2Y9YA 2FMLA 3V7RA 2Q2EB 3W6JB 2O5RA 4XN0A 1APLC 3MKLA 1JT6A 1SD7A 2DA1A 1T33A 3VFZA 4C3IJ 1MSFC 1SFKA 2A6TA 2ME6A 3H1CA 4A3MJ 2HTSA 2NYXA 5CXGA 2YVEA 1P92A 1LFPA 4YEJA 3Q0VA 3I64A 3CZ6A 2DOAA 2NNNA 3DV8A 5IT9Z 3HKZA 1VQMI 2WB1A 2UXPA 3B81A 1B1BA 2E1MC 3Q3SA 1XG1A 2MD5A 2XB5A 3CDHA 1V5GA 3V4GA 3SFZA 1V5FA 1N25A 3DPUA 2E60A 3H5RA 2EK5A 1CGPA 1T95A 5FKLA 1WKMA 3QU3A 3ZXSA 1IV6A 3CCYA 4DVYP 2BEOA 1OYWA 1LQ1A 1KGSA 4OWRB 4GRIA 1SC7A 1MMAA 3WU1B 2OJED 3DQVC 1WRJA 4ZYAA 3L2UA 1NK2P 1J75A 3F8CA 1TP4A 3CMAI 3SEQA 2YU9J 1GHCA 4XBFA 2XPVA 1G3SA 5F04A 3C1DA 3QPLA 4WCGA 3O2PE 3NNRA 2DBBA 4HSRA 1XD7A 2VKDA 4XRSG 1PP8F 2O7TA 2LF7A 2TCTA 1RPWA 4BGDA 5D4SA 2F5FA 3CUOA 4UV8A 2M34A 2ID3A 2HNHA 4UUSB 2A6HF 3K0LA 2KMUA 4M9ZA 1NG7A 3E6DA 2VONA 3CJQB 4ZYGA 1G3WA 2X48A 1I3AA 3FIWA 2ELHA 2E1MB 4I76A 3WGGA 4BYYA 3DEEA 2FEZA 1YITI 1LEBA 3VP5A 3TO6A 3M3YJ 3EDPA 1U2WA 2LTPA 3S1NJ 3BCAA 1U8BA 5CVUA 1W1WE 3IAS2 2DPDA 3BPVA 3OL3A 1S6LA 4NQWA 4BHCA 2BY0A 3V6GA 3QPSA 5FLXK 3HPHA 5JVGF 2LKSA 2R7DA 3M8FA 3J7AO 2W25A 3V8KA 2NAZA 4AC6A 4MTEA 1TW3A 1JHHA 3R6SA 3DTEA 3GMEA 4HQMA 2A3SA 2JRTA 3RPQA 3S17J 4HF0A 1JUPA 1E0EA 3GYHX 1R22A 4EJTA 3N97A 3DBLB 1FYLA 3VODA 1NTCA 2CUJA 3H5AA 5KVRA 2QSHX 2ISZA 1H0MA 1B9NA 1BI1A 4I09A 1Y8QB 2A5YB 3D1NI 1QZYA 1PUEE 3I0TA 3NS4A 3GTLJ 3O8GA 3T1BA 1ACIA 2GIVA 1DU0A 5BNGA 4A3EJ 3E0JB 4FX0A 1RKWA 3O6BB 5HS7A 2ZXHA 2R7OA 2OV7A 3B6CA 4KUMA 2VJ5A 1T38A 5GAEJ 1U5TA 1Z6RA 2HWVA 3BR2A 1S5LC 4U87A 2DMPA 2O8KA 3ZQQA 3LA7A 3FZVA 5CQEA 2HDDA 1TT0A 2XAQA 1MD0A 3HJEA 3ZQHA 2VOPA 3K70D 4A0ZA 5DM7F 4FCYA 2V9PA 5LGUA 2UXIA 4OD5A 2DCEA 2UXNA 1O3SA 3WGIA 5HDGA 3RDIA 3QWLA 5EGOA 4DW6A 3CO7C 2IS4A 3DU5A 3DPLC 1G59A 4IHTA 2E1OA 4G6DA 2IPQX 3BLYA 2G7LA 3GLLA 4NC8A 1MZBA 4JL3A 2V79A 3Q9VA 3I58A 4ON0A 1ZARA 2GXGA 3CCRI 1DDNA 2CV2A 1X1DA 3HEFA 4N0BA 6PAXA 2NS8A 1SMYF 5ILSA 3RKYA 3CJDA 3K4KA 1B8IA 3WHCA 1U0JA 2BY3A 3E1SA 1KU2A 4A3JJ 4J00A 1Z21A 2EQRA 3FDYA 5E3LA 4ICHA 4BKXA 5L3BA 2HOTA 4CO8A 3VYRB 3HOUJ 2RVCA 1QPMA 3FF5A 2WTEA 1FIAA 1W5CC 1JKQC 4OIOF 2DG7A 3FM5A 1U9OA 1S7EA 2IA2A 2F5VA 4F55A 1HDPA 3QP6A 1FEXA 3R60A 3GFJA 2QA4I 3OOUA 2ESHA 4HNTA 2V7FA 3K2ZA 4L5IA 2BVLA 1HKQA 3BJOA 3BOQA 2EFWA 1YS7A 1P7JA 1S72I 3G3ZA 1BJZA 2QBYB 3EUHC 2X1DA 3CCJI 3BQYA 1ZTRA 2W84A 2K40A 3AQTA 2QZ8A 1Y39A 4EMSA 3HOSA 3JSOA 3WTYC 3VVZA 4BDZA 2VI6A 1B9MA 5E79C 1K78B 3ROUA 5J4VA 3L09A 2Q24A 2LY2A 5H6QA 1IAWA 5AQCA 1LFBA 3A01B 1JKPC 3S1MJ 4JNNA 1MH3A 2L9SA 4JBAA 2P8TA 4IHVA 3OWTA 2FX0A 5EG0B 2JPBA 2H1LA 3GF2A 1W5SA 4M3EA 2MABA 2VC0A 1R1VA 3JRHA 1POGA 5FHPA 2OBPA 2ECCA 3QQAA 5GPCA 2YUSA 3FM3A 3Q0WA 4BY1J 1A04A 1ZHFA 1ZG3A 3ZCOA 3VTIA 3WE3A 1SFXA 2BBYA 2IA1A 5LLQA 2JA8J 3W2WA 1R5ID 4NC7A 4F92B 4UVCA 2LP0A 3PSFA 2GBYA 2MC3A 3FXOA 1ZKGA 2JQ7A 1I27A 1P6RA 3QPHA 4EVIA 4P5OA 1G6NA 2A69F 3G4SI 3K8PC 1XCVA 2WV1A 4WF2A 5GADJ 4RS8A 2RREA 4JYKA 4IRIA 5CKTA 2JUGA 4LIVA 2VQCA 3ZRGA 2IS1A 1WH5A 5CLSA 3ZMSA 4F93B 2M1BA 3O60A 2HFHA 1JI8A 2EBIA 3V78A 4XR6A 2B7EA 1FSEA 4BY7J 3J81Z 2ZJRF 3F8NA 1W5TA 1DQUA 3DF8A 4L9TA 2XGEA 2ZJPF 5D5WB 4IPAA 5M5WJ 4C2MA 1EJ9A 2HU9A 2ZJQF 3HM5A 1V5EA 4E7SA 3MKYB 1FOYA 2VB6A 1YHQI 3FXRA 1KZHA 2EB7A 1ZRDA 2WV0A 5FKNA 2OTJI 2CO5A 2HKXA 5LFAA 2PMHA 1WH7A 1Z91A 3H0DA 2CUFA 2HS5A 3AG4H 5E18F 2VIXA 4ZTJA 1OLTA 1WHUA 4R1HA 2EV0A 3WG7H 4XQFA 4U0WA 2HDWA 3BR6A 1WJDA 3H9QA 4N9HA 1OMIA 4IEJA 1IXRC 1PJRA 2F4MB 2G7GA 3FXLA 1JXSA 2HYGD 4CCJA 3IUOA 4E70A 2JT1A 3KEYA 3C2HA 2GAUA 4ZDOA 1SVOA 2VBYA 4GFBA 3FKJA 1SVLA 2OQRA 2IRFG 2VLAA 4EGZA 2DQLA 1RZ4A 4WXHA 2A61A 1O7LA 2HXIA 1XGSA 1YLFA 4PDKA 2X1CA 1XTAA 1Z3XA 2JK3A 2R7QA 2ACJA 4G9YA 1ZN2A 1FMVA 4O6JA 3BJ6A 3MN2A 1YX3A 3MKZA 3BZKA 4RM2A 1FNNA 3SZPA 1K78A 3FK6A 1REPC 1MBEA 3DEWA 1IGNA 2XGXA 3BR1A 1MJAA 2R4GA 5GP9A 3HUGB 3ULQB 3FMRA 4Q48A 2C6YA 1P7IA 1ULYA 3A01A 4KMUX 1X4PA 1T08B 1NG6A 2FBKA 5EG0A 5D8LB 3U1DA 4L62A 3H3UA 5CVRA 5F6FA 3DPJA 3DLLF 2DYRH 2BY2A 5BOXA 2MGQA 3OYBA 4RM3A 4U0YA 4WK8F 4LD5A 3WODF 1LDJA 2VODA 3G1OA 3JSPA 2BE5F 2XAFA 4AIJA 2K9SA 3OS1A 1JHFA 3OYCA 5HOOA 1VQ5I 4Y7NJ 4HF2A 3IH3A 1QGPA 4AIDA 4CCKA 4AD9A 1LUJB 1H89C 1SANA 4XLEA 2ZCMA 1OCCH 1FOXA 2BXYA 4MEXF 2DI3A 1IDYA 3F21A 2QENA 2VPRA 3H5NA 2FJI1 3OYIA 1QBJA 2E1NA 4AYBN 2F48A 3Q5FA 5IOZA 2K9QA 4BNCA 2DK8A 5JHUA 3BTIA 2R93J 3WE2A 4A6DA 1R6RA 2EILH 3QU6A 2WGBA 2FJ1A 3MZYA 2DPUA 2XRNA 4CYDA 2JUCA 4PGGA 3UNGC 5K1YA 1R1TA 2K3PA 2HOAA 2L9VA 1XDSA 4A0XA 4JOMA 4CCLA 2P5VA 3CD6I 4HV6A 4XKBA 1XSXA 1IN5A 2XHKA 3ELKA 4PFOA 1F4KA 1PDNC 4XLNF 2V6EA 3LL7A 3OYFA 4JX4A 5KCMA 4XONA 2DJIA 2IW5A 3K1NA 2XF5A 4II2A 4C2TA 1FIPA 1WSUA 4IVNA 2GLOA 3HHGA 1IC8A 3ON2A 1W36C 1IXCA 2VKVA 2MC4A 5J1RA 2HGCA 1ETWA 1ENHA 5E3NA 2VT2A 1H8AC 4GCKA 4F52A 3GFIA 3BTCA 3VUQA 2Y0SN 4D7NA 2HXOA 2FRHA 4BH9A 3NXCA 3M1CA 3VPRA 1XDUA 2KIQA 3BZ6A 2H6BA 2K86A 2NVTJ 2Q8KA 1I6XA 3DTIA 4LG0B 2X4HA 5HBUA 2ZMEC 1CF7B 1G4DA 2G7HA 1ZRCA 3VW1A 3KEQA 5C3EJ 2CQ7A 1UHWA 1IXSB 4F91B 4UY8I 3RKQA 3S3MA 1EF4A 3D0SA 2OQGA 2O8XA 5IOYA 2NRAC 2DA3A 4N4OB 1Y0UA 4BL0B 1IUYA 1SVMA 5F27A 1K7AA 5DTDA 1XC5A 3DTKA 3RTRA 2RNJA 1V54H 3IV5A 2QQ8A 3BCBA 3K70C 2CFXA 2Z2SB 4IL6C 5HLIA 4BAYA 5IYCJ 3ONQA 3IRQA 1Z0XA 2W24A 3OS2A 5DM6F 1YRNA 4NUBA 2NVXJ 4IOCF 4MFEA 3S8PA 4ZYHA 3CCLI 4L0ZB 4PCQA 3ZGKA 3BWGA 2K4BA 1HOMA 2LD5A 4F7ZA 5LHHA 3CQZJ 3NPIA 1ONVA 3MEXA 2GFNA 3K4LA 4KISA 5HS9A 2DDBA 3RKWA 4PJMA 5TRDA 1XS9A 1FSHA 4WWCA 4KN4X 1HSJA 4ENMA 2FXAA 3GTQJ 4G7OF 2GOXB 2O0YA 3L2QA 4BJTA 5KAIC 3PNYA 3G71I 3F22A 3DPTA 2JJ7A 3E5UA 2K5CA 2YX7A 4C2UA 3JTGA 4OAYA 2A68F 5CVJA 3GWZA 4U9NA 1B72A 3ECHA 2EZIA 1ETQA 1MBHA 2OZ6A 2GA1A 4RAZA 2DDAA 4CICA 3DBRB 4M3BA 4ESBA 4G12A 1TQIA 4M3DA 3TOBA 3V8LA 2P6SA 1ZR4A 2LKPA 2KIFA 1MBFA 4PJ0C 2DQRA 1A31A 4EM0B 5DDGA 1E3OC 3BG9A 4BEHA 3W6VA 3E7LA 1V4RA 5GAGJ 1JUSA 1Z1DA 1QPIA 1TC3C 2X9DA 2M9HA 4FX4A 4KNYA 1TLHB 4AU7A 4IHYA 2VKEA 3J81K 2XIGA 3KEOA 3VVXA 2EIKH 2L7MP 4YIFA 1L3LA 3ON4A 5FD6A 3M8JA 3A1YA 5EEHA 2RAEA 2VUMJ 1O3RA 3SQNA 2DFIA 1QHHD 2Z5UA 4QLCU 1X3ZB 5KAFC 3D5LA 5HVQC 2XPWA 3F6VA 4BE0A 3BJAA 3L00A 4XICA 2NNYA 3ZQLA 1TWAJ 1TWHJ 2R7WA 5E20A 1I5ZA 4P9UA 4B47A 1ZLKA 4AVPA 2R7RA 3CRJA 2L7ZA 4HDUA 4HDVA 3U1KA 1R23A 3I4MJ 3LSMA 5F0FA 4X1EA 4LG0A 4XN3A 4Q47A 1JJ8C 4P55A 1IUFA 2XROA 1GXPA 1U5TC 3PO2J 1GUUA 4NQWB 1HA8A 2FQ4A 3S2HJ 1KU3A 4MQ9F 3KKCA 2X1EA 3OYKA 2CYYA 2ZSHB 2X6WA 3E97A 5B66C 2D2WA 3KE2A 1FP1D 3ZN0A 2CH0A 1VQNI 4JQFA 3C18A 4PJJA 1XSVA 1BC7C 1UAAA 5FO5A 1TWCJ 5AONA 1ZELA 3VSLA 1F5TA 3F3XA 4J01A 3JAMZ 2ID6A 4ESJA 4ME9A 4FETA 2UV1A 2CMPA 3V7SA 2IGMA 1DGRM 3E6CC 2EIJH 3ASNH 1SFUA 2PJRB 1K83J 1LNWA 2UXHA 4RAYA 1XGMA 4LB6B 1I3QJ 5IP6A 4A3KJ 5HODA 2R7TA 4ITVA 4XSXF 4KMFA 1OCRH 1VF9A 5HLHA 2XKOA 3GTMJ 1EH8A 4B3AA 3HC7A 2D45A 4L18B 2DYSH 5CQGA 2M7AA 2PEXA 4D9JA 4QSHA 4CGRA 5JHFA 1U5TB 1BW6A 2GQQA 4I01A 2FE3A 2HYFA 4XL9A 5F64A 2QLZA 4BDYA 1Z6TA 4M74A 3MVPA 5HDNA 5JLWA 1SEUA 1TQPA 1ZLJA 4FE4A 2IBDA 2MSYA 4DQ2A 3D5SC 2ZCNA 3P9TA 4NNJA 1D0YA 1HW5A 1BC8C 2PQ8A 1YFHA 2JRMA 2GM4A 2CRGA 2E1CA 5B1BH 1H9GA 3GBGA 4I2OA 1HLVA 3TBIA 5EGOB 3BRUA 3R61A 3GTPJ 3WTWC 4MLOA 5E8IA 3NQOA 3CF5F 2KJBA 4A6EA 3R0JA 3HTSB 2VXDA 3LSJA 3BTLA 3S93A 2IS2A 4M6YA 3L7WA 3X2QH 2HYJA 2H94A 1FOWA 2ELKA 4S04A 4E7JA 3RPUA 2TRTA 1MDMA 2KHMA 3SXYA 2Z99A 2V1UA 1B8IB 1J9IA 5EZGA 1Z77A 1J59A 5E3OA 2DXIA 3VYSB 3K4JA 3PSIA 3JCUC 5EEAA 3CP2A 4D1QA 1YJ9I 1WZ2A 2W4SA 4CXFA 2ISYA 3EYIA 3ZQGA 3MFKA 3RCOA 3S3NA 1WJ5A 1YOVB 3OV8A 5GTHC 2DA4A 1FBUA 3FMSA 1AHDP 4ZZLA 2QGUA 2OC6A 3FXQA 2XGCA 4IOAF 2ZNYA 1KQ8A 1HSTA 1HBXG 2GWRA 2A07F 2OERA 3NWSA 3LWFA 4HNUA 2DFFA 2Y75A 3OYMA 3OSGA 2ESNA 1D8KA 4EGYA 3KKDA 4PZJA 3HSFA 5BPIA 2E35A 5KK1A 4KIFA 2DTZA 4M6VA 1F43A 3PUFA 1ORKA 1SGMA 1VQPI 3WTXC 1ZR2A 5CJ9A 4BHPA 3BY6A 1QRYA 2P5KA 2WAQN 2K4JA 4NDLA 1Z7LA 1SAUA 4A69C 2VQLA 4E7HA 2GZWA 1FWZA 5ICEA 2HOEA 4DBRA 4OD4A 3IWZA 1W4MA 2WADA 3HOYJ 1WCMJ 5CVVA 1JE8A 3LQQA 3GFMA 3DP7A 3I4PA 2XV4S 2P81A 4K2EA 3CCMI 1QA6A 3I3LA 2ICWG 2BHZA 1ODDA 2HVSA 4WXCA 1J7KA 4ENKA 2EH3A 2DJNA 2YU3A 2CQQA 2DO7A 4RGRA 5ERIA 2W7NA 2YVXA 3CCQI 4BXXJ 1W0TA 2E2IJ 3S15J 1S7OA 4FHTA 5B5EC 3TGNA 1AA7A 4IQ4A 4GCVA 3SZGA 2PJRA 4IHSA 3LQRA 2MH2A 5IP7J 2UXOA 3V7CA 5GAHJ 3HL2A 3PM1A 5D6FA 3JREA 1QZZA 1A5JA 3SYTA 1I50J 4UB8C 2B3WA 3SWHA 2XAGA 3G7RA 4NN1A 2QQ9A 3ZQIA 4HF1A 5HNHA 4QPOA 3OL4A 4M3GA 3CLQA 2ADUA 4ESFA 2HQ5A 4BBSJ 5DUIA 2EFQA 4V2GA 2Z3YA 3ISPA 1P4XA 2NVQJ 4PJNA 1IRZA 2IAIA 3WTUC 4XM3A 5LD2C 1PP7U 4FASD 2DMUA 4G6QA 4HOBA 3LFKA 3HRMA 3SFIA 3VYUB 4A3FJ 1SFEA 4EM1A 1WQ2A 4CZCA 1LJ9A 3ASOH 3RPUD 1YW8A 2ZNZA 2JA7J 2AO9A 2NOJB 1XGOA 3OR2C 2K9MA 2FOKA 3H0GJ 2L4MA 5JLXA 4G7HF 2WAFA 4G8XA 1D0ZA 1IW7F 3GXOA 3S2WA 1BI2A 1X1BA 3DLAA 1VQKI 1ERDA 3HTUA 4HX4A 3ANGA 3RYPA 2V9KA 1AKHB 4IXAA 2M5WA 4MK6A 2KPMA 2BVMA 2LNBA 3HOWJ 2P4WA 4S05A 2LH9A 1ZGWA 1FT9A 1LDDA 2O03A 4YRVA 3RH2A 1J5YA 2R7UA 2EA2A 4M73A 1JTYA 3KNWA 3TKYA 2QTQA 2ZY9A 1QO0D 3KZZA 2M30A 3HOVJ 1IRFA 3OY9A 2QOPA 1SD5A 4LOCA 1O4XA 4IX7A 3NWTA 4AVZA 3RJPA 1A6QA 1UI6A 3AG1H 2UWMA 5HSZA 3HTIA 2VKHA 3IKTA 3LWJA 2OTLI 4QIWN 4A2UA 4RLFA 4JP0A 3VOXA 3IKVA 3K69A 3CMMA 2LOOA 5C4YA 3FX3A 1QQIA 2FD5A 3HPGA 1O7FA 1HF0A 1MMNA 3NRGA 3S16J 2DT5A 2QSFX 1U3EM 3QP5A 2OCCH 4IRHA 1UZCA 4LLGF 2MA3A 4XKCA 1KU7A 3EUKL 5HLTA 4LIUA 3F1BA 5ED4A 3ESWB 3OYHA 4ETSA 3AQSA 3KZYA 4HV5A 4EJWA 2BZTA 2QSGX 4IHXA 5H9TA 1WJEA 1VTNC 2CUEA 3H3VK 1BM9A 1IV8A 3CCEI 4DJAA 1OCTC 2UUZA 4RBOA 3JAMK 1G3TA 5EF6A 1J09A 2FMYA 5J1UA 5M5YJ 1BW5A 1OR7C 2Z33A 1I6HJ 3ABMH 3P9IA 3A2KA 1RC9A 2FUG2 5IPAA 4OMZA 1W7PB 1A6IA 1WJFA 3P9KA 2E2HJ 1RI7A 4B4CA 2E71A 1FZPB 4HLXA 2RASA 1V3FA 1XB4A 4HLYA 4FT8A 4JK1X 4HQEA 2IGOA 3OYNA 1Y8RB 2RQPA 3F23A 2PN6A 2R7XA 3M07A 4AYBA 4KFCA 3SDGA 4HYEA 1RESA 1VZ0A 4NB5A 3ZMZA 5A2QZ 3S1RJ 1R36A 2D5VA 1E17A 4XLCA 5L3GA 2FBQA 1QU3A 2EINH 3VYTB 2ZXJA 5IT9K 1S29A 4B1RA 1YI2I 2R5ZB 1LE8B 3LA2A 4ZDPA 2G0EA
chains in the Genus database with same CATH topology
1ZQ3P 3O8HA 2UXUA 5HBUA 2DN0A 3BG5A 2WUIA 4GFLA 5D18A 3JRFA 5CXIA 3VW1A 5C3EJ 4A3BJ 1QVTA 1AKHA 2DMQA 4FE7A 3RKQA 1EF4A 1GV2A 3GTJJ 4A3DJ 3VOKA 2L0KA 3HKZN 3S1QJ 2WB1N 5IOYA 2V57A 4W1UA 2M0CA 2DA3A 3ZOBA 3ZQFA 3TW6A 5F27A 3OSFA 1TWGJ 3HIMA 5DTDA 2O7OA 2EZKA 1XC5A 2OPTA 1IDZA 2YVHA 4GCLA 1NK3P 3IV5A 1ETXA 5FLVA 4JKZA 5IYCJ 4HNVA 2HI3A 1Z0XA 1WPKA 2Y9YA 2CU7A 3FKIJ 1MH4A 2R5YB 1YRNA 2EZLA 2XPUA 2NVXJ 2XGDA 4MFEA 4V2FA 3MKLA 1JJ6C 1APLC 1JT6A 2DA1A 1T33A 1HOMA 2LD5A 4C3IJ 3PO3J 1MSFC 3CQZJ 3NPIA 2R7ZJ 2ME6A 3EGQA 2GFNA 3HGYA 3PPBA 1U9NA 5D1RA 4A3MJ 3G56A 5F0CA 4BBRJ 1XS9A 3BJBA 5CXGA 2YVEA 3Q0VA 3BHQA 3I4NJ 2XSDC 3GTQJ 3NAUA 4XK4A 1YRNB 5FKKA 5EFYA 3CDLA 5FGLA 2UXPA 3B81A 2LFBA 3Q3SA 1K61A 2LKXA 1XG1A 2XB5A 3HOZJ 3ANPA 2JJ7A 2NS7A 5FLMJ 1GV5A 3FRQA 3JRDA 2CQXA 1UHSA 1UMQA 4PXIA 4IHWA 1RETA 1RKTA 2DA6A 2ZB9A 4RDUA 1PUFB 3BNIA 5FKLA 4XIDA 1B72A 3JSJA 3HDDA 2EZIA 1IV6A 2JA6J 3CCYA 1ETQA 1MBHA 4UUSA 3CMYA 4M3BA 3GEUA 4G12A 4M3DA 1ZR4A 1NK2P 1MBFA 2YU9J 1MBKA 2XPVA 1E3OC 3A03A 3SJMA 3BG9A 5F04A 3W6VA 3E7LA 3QPLA 3NNRA 3HGGA 9ANTA 1JUSA 4X6AJ 1VFCA 4XRSG 1QPIA 2O7TA 2TCTA 1RPWA 5FJ8J 1TC3C 1B72B 2X9DA 3HE0A 2M9HA 2DMNA 4IHYA 1JTXA 2M34A 2ID3A 4MIMA 2VKEA 4UUSB 3LSPA 1ITYA 3VVXA 1VNDA 2L7MP 4FISA 1X2MA 5J1YA 2K9NA 3ON4A 2H8RA 2X48A 2RAEA 2VUMJ 2ME0A 3FIWA 1HDDC 2JWTA 4I76A 2AHQA 5FMPA 4DZPA 2PZ9A 3M4OJ 3VP5A 2XPWA 5EYRA 4XRMA 3M3YJ 2LTPA 2W48A 3IH4A 4XICA 1U8BA 3S1NJ 4UDSA 3ZQLA 3QBMA 1MBJA 1TWAJ 2H1KA 1TWHJ 2QIBA 2E19A 3V6GA 3QPSA 3FISA 4QTRA 3CRJA 1Q1VA 2L7ZA 1LE8A 3I4MJ 2R5ZA 2G7SA 3A02A 5F0FA 3VW2A 4AC6A 3LOCA 4X1EA 2NX4A 2ZCXA 3GZIA 3S17J 4DZJA 1JJ8C 1JUPA 1IJWC 1IUFA 1RR7A 2XB0X 3PO2J 1GUUA 2PBXA 2FQ4A 2W53A 1NTCA 3S2HJ 4MFDA 3COLA 1UG2A 3KKCA 2Y9ZA 1X58A 4L5EA 3D1NI 1H88C 3GTLJ 3O8GA 4DYCA 1DU0A 1OJLA 5BNGA 5FKOA 2Y30A 4A3EJ 4ACIA 1TWCJ 1RKWA 1R9TJ 2LLKA 3B6CA 2ID6A 2R5YA 3GTOJ 4ME9A 3GTGJ 1U78A 3BR2A 3T6NA 2MW8A 3TP0A 1K83J 2DMPA 1JGGA 2GUHA 2UXHA 2O8KA 2HDDA 3LJLA 1I3QJ 5IP6A 4A3KJ 3ZQHA 5K58A 3G1MA 5HODA 1FTZA 3BCGA 5FKMA 2KDZA 4FCYA 5HAWA 1VF9A 3GTMJ 5C4XJ 2QWTA 2UXIA 4B3AA 1CQTA 2ZOYA 3G1LA 5EGOA 4QSHA 4CYCB 4DW6A 4CGRA 3LHQA 1BW6A 1JUMA 3K2AA 2E1OA 4JX5A 2G7LA 1DU6A 4AC0A 4GCTA 3MVPA 3C07A 4JL3A 5JLWA 3P9TA 4FE4A 2IBDA 2MSYA 2ZCNA 5J3LA 3HEFA 1PUFA 2NS8A 5E3MA 2GENA 2GM4A 1OCPA 2CRGA 1B8IA 3WHCA 3CJDA 1ETVA 2XRLA 3BRUA 3GBGA 1HLVA 5EGOB 3JRAA 3GTPJ 3BR0A 3TP3A 4A3JJ 2DA2A 2EQRA 4MLOA 5E3LA 2N8GA 4BKXA 4ICHA 2HOTA 3HOUJ 3BQZA 4GFKA 3LSJA 3BTLA 5C44J 1FTTA 1FIAA 2HYJA 2ELKA 2DG7A 1JKQC 1U9OA 2TRTA 1S7EA 3K7AJ 1W0UA 5DS9A 1HDPA 1FEXA 2OI8A 3PASA 1B8IB 3OOUA 5EZGA 1Z77A 3VIBA 4AUXA 5E3OA 2JMWA 1JT0A 1P7JA 1BJZA 5EEAA 4D7MA 2NVYJ 1LFUP 5F08A 3ZQGA 3BQYA 1ZTRA 2K40A 3AQTA 2F07A 3S5RA 4S0HB 4FTHA 2DA4A 1Y1WJ 1AHDP 1WI3A 3VVZA 2VI6A 3HBLA 2REKA 2XGCA 3VW0A 2Q24A 3JRBA 2OERA 1GVDA 4C3JJ 5AQCA 1LFBA 3A01B 2Y2ZA 3OSGA 1JKPC 2JN6A 1MH3A 3S1MJ 3IUVA 4IHVA 4JNNA 2FX0A 3NI7A 5EG0B 2D6YA 1ETOA 3KKDA 2HOSA 2EZHA 5F0HA 4M3EA 2YS9A 3NARA 2COBA 4NELA 3JRHA 2DTZA 3FK7A 4M6VA 3HOXJ 1POGA 1ORKA 2QCOA 1F43A 1SGMA 1ZR2A 2HYTA 5FHPA 2KT0A 1QRYA 2ECCA 3QQAA 5GPCA 1GDTA 2YUSA 2WAQN 4NDLA 3Q0WA 4BY1J 4A69C 4A3GJ 2JA8J 3HOYJ 1T56A 3WHBA 2DA5A 1WCMJ 2LP0A 2GBYA 5M5XJ 2P81A 1ZKGA 2X6OA 1GT0C 1HCRA 2EH3A 2DJNA 2CQQA 4HKUA 2WV1A 4BXXJ 2RHAA 1W0TA 5C4JJ 2NP5A 2E2IJ 4JYKA 4D5FA 3S14J 3S15J 3RZDJ 3L1PA 2PMZN 2NP3A 1JKOC 1ZK8A 1WH5A 5IP7J 3S2DJ 3O60A 1AU7A 2EBIA 2UXOA 1BA5A 3V78A 3Q0UA 3PM1A 3B6AA 4BY7J 3JREA 4MXMA 2GLOA 3IH2A 1A5JA 4YZEA 2XGEA 5M5WJ 1I50J 5D19A 1OFCX 1Y1VJ 3JR9A 1FJLA 3BR5A 3HM5A 2OF7A 3BR3A 4A3IJ 3G7RA 4NN1A 3HB9A 4D5CA 4CYCA 2R0QC 3KZ9A 1D5YA 3OIOA 3LSGA 3ZQIA 1G2HA 2B63J 5FKNA 2XDNA 2G3BA 4M3GA 3JRCA 1WH7A 4JX6A 2NOGA 2HQ5A 4BBSJ 5IP9J 2CUFA 4V2GA 2QF7A 4MO7A 2NVQJ 2JA5J 2IAIA 1IRZA 1JKRC 1MBGA 2DMUA 2IU5A 1QVUA 3SFIA 4A3FJ 3BR6A 2LK2A 3BT9A 4IEJA 3JRIA 5K7HA 2R92J 2G7GA 3HTHA 2JA7J 2AO9A 2M8GX 1X2NA 3GTKJ 3H0GJ 4Y52J 3MNLA 5JLXA 3F0CA 3TW7A 4GFBA 2DG8A 3QKXA 3ANGA 2I10A 1AKHB 4UUTA 4MK6A 2HXIA 3LNQA 3HOWJ 1ETYA 3UKGA 2JK3A 1ZGWA 2MG4A 3BG3A 4J19A 2L7FP 3RH2A 2L9RA 3MN2A 3C2BA 1JTYA 5K7FA 3KNWA 3RZOJ 3VVYA 3FK6A 2QTQA 3CWRA 1MBEA 3DEWA 1IGNA 3BR1A 3HOVJ 5GP9A 2M2EA 2QOPA 3TEDA 4LOCA 5IYDJ 3LSRA 1O4XA 1WGXA 1P7IA 1UI6A 5GPAA 3A01A 3BTJA 5HSZA 3HTIA 3LWJA 4QIWN 1TWFJ 2LVSA 5EG0A 2LY9A 1BL0A 4JP0A 3VOXA 4L62A 3DPJA 3ZQCA 4DYQA 5C4YA 2FD5A 1HF0A 2MGQA 3NRGA 3S16J 4A3LJ 5K7ZA 3G1OA 3E7QA 4C3HJ 2K9SA 4Y7NJ 3IH3A 5IYBJ 1F36A 3RQIA 4DYRA 1H89C 1SANA 2ZCMA 3F1BA 3HTJA 1IDYA 4I6ZA 2CJJA 2VPRA 3AQSA 4AYBN 5IOZA 2K9QA 4IHXA 5H9TA 4KWAA 1VI0A 2CUEA 3H3VK 3BTIA 3HTAA 5EZHA 2R93J 2WGBA 2FJ1A 3RD3A 2DMTA 4A3CJ 1ETKA 2LR8A 1OCTC 4RBOA 4A93J 4AF5A 5EF6A 2ECBA 2HOAA 5J1UA 5M5YJ 2E2JJ 1BW5A 2HKUA 4C2MJ 1I6HJ 1MSEC 1UI5A 1IG7A 5IPAA 2O9LA 4EEFG 1A6IA 2E2HJ 5DAJA 4JX4A 5F1JA 4B4CA 4W97A 4M3FA 2QKOA 4XRSA 1FIPA 2RASA 1IC8A 3ON2A 2VKVA 5J1RA 5M3FJ 2ZOZA 1ETWA 1ENHA 5E3NA 5EDNA 1H8AC 4GCKA 3SDGA 2DA7A 1RESA 3BTCA 4ABZA 3JRGA 3VUQA 5CW8A 2Y0SN 5M3MJ 3S1RJ 4D7NA 1MNMC 2HXOA 2D5VA 1SFOJ 2IEKA 3NXCA 2FBQA 3DCFA 2Y31A 3VPRA 4B1RA 1LE8B 2R5ZB 3EUPA 2NVTJ 2G0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ3 P;  3O8H A;  2UXU A;  5HBU A;  2DN0 A;  3BG5 A;  2WUI A;  4GFL A;  5D18 A;  3JRF A;  5CXI A;  3VW1 A;  5C3E J;  4A3B J;  1QVT A;  1AKH A;  2DMQ A;  4FE7 A;  3RKQ A;  1EF4 A;  1GV2 A;  3GTJ J;  4A3D J;  3VOK A;  2L0K A;  3HKZ N;  3S1Q J;  2WB1 N;  5IOY A;  2V57 A;  4W1U A;  2M0C A;  2DA3 A;  3ZOB A;  3ZQF A;  3TW6 A;  5F27 A;  3OSF A;  1TWG J;  3HIM A;  5DTD A;  2O7O A;  2EZK A;  1XC5 A;  2OPT A;  1IDZ A;  2YVH A;  4GCL A;  1NK3 P;  3IV5 A;  1ETX A;  5FLV A;  4JKZ A;  5IYC J;  4HNV A;  2HI3 A;  1Z0X A;  1WPK A;  2Y9Y A;  2CU7 A;  3FKI J;  1MH4 A;  2R5Y B;  1YRN A;  2EZL A;  2XPU A;  2NVX J;  2XGD A;  4MFE A;  4V2F A;  3MKL A;  1JJ6 C;  1APL C;  1JT6 A;  2DA1 A;  1T33 A;  1HOM A;  2LD5 A;  4C3I J;  3PO3 J;  1MSF C;  3CQZ J;  3NPI A;  2R7Z J;  2ME6 A;  3EGQ A;  2GFN A;  3HGY A;  3PPB A;  1U9N A;  5D1R A;  4A3M J;  3G56 A;  5F0C A;  4BBR J;  1XS9 A;  3BJB A;  5CXG A;  2YVE A;  3Q0V A;  3BHQ A;  3I4N J;  2XSD C;  3GTQ J;  3NAU A;  4XK4 A;  1YRN B;  5FKK A;  5EFY A;  3CDL A;  5FGL A;  2UXP A;  3B81 A;  2LFB A;  3Q3S A;  1K61 A;  2LKX A;  1XG1 A;  2XB5 A;  3HOZ J;  3ANP A;  2JJ7 A;  2NS7 A;  5FLM J;  1GV5 A;  3FRQ A;  3JRD A;  2CQX A;  1UHS A;  1UMQ A;  4PXI A;  4IHW A;  1RET A;  1RKT A;  2DA6 A;  2ZB9 A;  4RDU A;  1PUF B;  3BNI A;  5FKL A;  4XID A;  1B72 A;  3JSJ A;  3HDD A;  2EZI A;  1IV6 A;  2JA6 J;  3CCY A;  1ETQ A;  1MBH A;  4UUS A;  3CMY A;  4M3B A;  3GEU A;  4G12 A;  4M3D A;  1ZR4 A;  1NK2 P;  1MBF A;  2YU9 J;  1MBK A;  2XPV A;  1E3O C;  3A03 A;  3SJM A;  3BG9 A;  5F04 A;  3W6V A;  3E7L A;  3QPL A;  3NNR A;  3HGG A;  9ANT A;  1JUS A;  4X6A J;  1VFC A;  4XRS G;  1QPI A;  2O7T A;  2TCT A;  1RPW A;  5FJ8 J;  1TC3 C;  1B72 B;  2X9D A;  3HE0 A;  2M9H A;  2DMN A;  4IHY A;  1JTX A;  2M34 A;  2ID3 A;  4MIM A;  2VKE A;  4UUS B;  3LSP A;  1ITY A;  3VVX A;  1VND A;  2L7M P;  4FIS A;  1X2M A;  5J1Y A;  2K9N A;  3ON4 A;  2H8R A;  2X48 A;  2RAE A;  2VUM J;  2ME0 A;  3FIW A;  1HDD C;  2JWT A;  4I76 A;  2AHQ A;  5FMP A;  4DZP A;  2PZ9 A;  3M4O J;  3VP5 A;  2XPW A;  5EYR A;  4XRM A;  3M3Y J;  2LTP A;  2W48 A;  3IH4 A;  4XIC A;  1U8B A;  3S1N J;  4UDS A;  3ZQL A;  3QBM A;  1MBJ A;  1TWA J;  2H1K A;  1TWH J;  2QIB A;  2E19 A;  3V6G A;  3QPS A;  3FIS A;  4QTR A;  3CRJ A;  1Q1V A;  2L7Z A;  1LE8 A;  3I4M J;  2R5Z A;  2G7S A;  3A02 A;  5F0F A;  3VW2 A;  4AC6 A;  3LOC A;  4X1E A;  2NX4 A;  2ZCX A;  3GZI A;  3S17 J;  4DZJ A;  1JJ8 C;  1JUP A;  1IJW C;  1IUF A;  1RR7 A;  2XB0 X;  3PO2 J;  1GUU A;  2PBX A;  2FQ4 A;  2W53 A;  1NTC A;  3S2H J;  4MFD A;  3COL A;  1UG2 A;  3KKC A;  2Y9Z A;  1X58 A;  4L5E A;  3D1N I;  1H88 C;  3GTL J;  3O8G A;  4DYC A;  1DU0 A;  1OJL A;  5BNG A;  5FKO A;  2Y30 A;  4A3E J;  4ACI A;  1TWC J;  1RKW A;  1R9T J;  2LLK A;  3B6C A;  2ID6 A;  2R5Y A;  3GTO J;  4ME9 A;  3GTG J;  1U78 A;  3BR2 A;  3T6N A;  2MW8 A;  3TP0 A;  1K83 J;  2DMP A;  1JGG A;  2GUH A;  2UXH A;  2O8K A;  2HDD A;  3LJL A;  1I3Q J;  5IP6 A;  4A3K J;  3ZQH A;  5K58 A;  3G1M A;  5HOD A;  1FTZ A;  3BCG A;  5FKM A;  2KDZ A;  4FCY A;  5HAW A;  1VF9 A;  3GTM J;  5C4X J;  2QWT A;  2UXI A;  4B3A A;  1CQT A;  2ZOY A;  3G1L A;  5EGO A;  4QSH A;  4CYC B;  4DW6 A;  4CGR A;  3LHQ A;  1BW6 A;  1JUM A;  3K2A A;  2E1O A;  4JX5 A;  2G7L A;  1DU6 A;  4AC0 A;  4GCT A;  3MVP A;  3C07 A;  4JL3 A;  5JLW A;  3P9T A;  4FE4 A;  2IBD A;  2MSY A;  2ZCN A;  5J3L A;  3HEF A;  1PUF A;  2NS8 A;  5E3M A;  2GEN A;  2GM4 A;  1OCP A;  2CRG A;  1B8I A;  3WHC A;  3CJD A;  1ETV A;  2XRL A;  3BRU A;  3GBG A;  1HLV A;  5EGO B;  3JRA A;  3GTP J;  3BR0 A;  3TP3 A;  4A3J J;  2DA2 A;  2EQR A;  4MLO A;  5E3L A;  2N8G A;  4BKX A;  4ICH A;  2HOT A;  3HOU J;  3BQZ A;  4GFK A;  3LSJ A;  3BTL A;  5C44 J;  1FTT A;  1FIA A;  2HYJ A;  2ELK A;  2DG7 A;  1JKQ C;  1U9O A;  2TRT A;  1S7E A;  3K7A J;  1W0U A;  5DS9 A;  1HDP A;  1FEX A;  2OI8 A;  3PAS A;  1B8I B;  3OOU A;  5EZG A;  1Z77 A;  3VIB A;  4AUX A;  5E3O A;  2JMW A;  1JT0 A;  1P7J A;  1BJZ A;  5EEA A;  4D7M A;  2NVY J;  1LFU P;  5F08 A;  3ZQG A;  3BQY A;  1ZTR A;  2K40 A;  3AQT A;  2F07 A;  3S5R A;  4S0H B;  4FTH A;  2DA4 A;  1Y1W J;  1AHD P;  1WI3 A;  3VVZ A;  2VI6 A;  3HBL A;  2REK A;  2XGC A;  3VW0 A;  2Q24 A;  3JRB A;  2OER A;  1GVD A;  4C3J J;  5AQC A;  1LFB A;  3A01 B;  2Y2Z A;  3OSG A;  1JKP C;  2JN6 A;  1MH3 A;  3S1M J;  3IUV A;  4IHV A;  4JNN A;  2FX0 A;  3NI7 A;  5EG0 B;  2D6Y A;  1ETO A;  3KKD A;  2HOS A;  2EZH A;  5F0H A;  4M3E A;  2YS9 A;  3NAR A;  2COB A;  4NEL A;  3JRH A;  2DTZ A;  3FK7 A;  4M6V A;  3HOX J;  1POG A;  1ORK A;  2QCO A;  1F43 A;  1SGM A;  1ZR2 A;  2HYT A;  5FHP A;  2KT0 A;  1QRY A;  2ECC A;  3QQA A;  5GPC A;  1GDT A;  2YUS A;  2WAQ N;  4NDL A;  3Q0W A;  4BY1 J;  4A69 C;  4A3G J;  2JA8 J;  3HOY J;  1T56 A;  3WHB A;  2DA5 A;  1WCM J;  2LP0 A;  2GBY A;  5M5X J;  2P81 A;  1ZKG A;  2X6O A;  1GT0 C;  1HCR A;  2EH3 A;  2DJN A;  2CQQ A;  4HKU A;  2WV1 A;  4BXX J;  2RHA A;  1W0T A;  5C4J J;  2NP5 A;  2E2I J;  4JYK A;  4D5F A;  3S14 J;  3S15 J;  3RZD J;  3L1P A;  2PMZ N;  2NP3 A;  1JKO C;  1ZK8 A;  1WH5 A;  5IP7 J;  3S2D J;  3O60 A;  1AU7 A;  2EBI A;  2UXO A;  1BA5 A;  3V78 A;  3Q0U A;  3PM1 A;  3B6A A;  4BY7 J;  3JRE A;  4MXM A;  2GLO A;  3IH2 A;  1A5J A;  4YZE A;  2XGE A;  5M5W J;  1I50 J;  5D19 A;  1OFC X;  1Y1V J;  3JR9 A;  1FJL A;  3BR5 A;  3HM5 A;  2OF7 A;  3BR3 A;  4A3I J;  3G7R A;  4NN1 A;  3HB9 A;  4D5C A;  4CYC A;  2R0Q C;  3KZ9 A;  1D5Y A;  3OIO A;  3LSG A;  3ZQI A;  1G2H A;  2B63 J;  5FKN A;  2XDN A;  2G3B A;  4M3G A;  3JRC A;  1WH7 A;  4JX6 A;  2NOG A;  2HQ5 A;  4BBS J;  5IP9 J;  2CUF A;  4V2G A;  2QF7 A;  4MO7 A;  2NVQ J;  2JA5 J;  2IAI A;  1IRZ A;  1JKR C;  1MBG A;  2DMU A;  2IU5 A;  1QVU A;  3SFI A;  4A3F J;  3BR6 A;  2LK2 A;  3BT9 A;  4IEJ A;  3JRI A;  5K7H A;  2R92 J;  2G7G A;  3HTH A;  2JA7 J;  2AO9 A;  2M8G X;  1X2N A;  3GTK J;  3H0G J;  4Y52 J;  3MNL A;  5JLX A;  3F0C A;  3TW7 A;  4GFB A;  2DG8 A;  3QKX A;  3ANG A;  2I10 A;  1AKH B;  4UUT A;  4MK6 A;  2HXI A;  3LNQ A;  3HOW J;  1ETY A;  3UKG A;  2JK3 A;  1ZGW A;  2MG4 A;  3BG3 A;  4J19 A;  2L7F P;  3RH2 A;  2L9R A;  3MN2 A;  3C2B A;  1JTY A;  5K7F A;  3KNW A;  3RZO J;  3VVY A;  3FK6 A;  2QTQ A;  3CWR A;  1MBE A;  3DEW A;  1IGN A;  3BR1 A;  3HOV J;  5GP9 A;  2M2E A;  2QOP A;  3TED A;  4LOC A;  5IYD J;  3LSR A;  1O4X A;  1WGX A;  1P7I A;  1UI6 A;  5GPA A;  3A01 A;  3BTJ A;  5HSZ A;  3HTI A;  3LWJ A;  4QIW N;  1TWF J;  2LVS A;  5EG0 A;  2LY9 A;  1BL0 A;  4JP0 A;  3VOX A;  4L62 A;  3DPJ A;  3ZQC A;  4DYQ A;  5C4Y A;  2FD5 A;  1HF0 A;  2MGQ A;  3NRG A;  3S16 J;  4A3L J;  5K7Z A;  3G1O A;  3E7Q A;  4C3H J;  2K9S A;  4Y7N J;  3IH3 A;  5IYB J;  1F36 A;  3RQI A;  4DYR A;  1H89 C;  1SAN A;  2ZCM A;  3F1B A;  3HTJ A;  1IDY A;  4I6Z A;  2CJJ A;  2VPR A;  3AQS A;  4AYB N;  5IOZ A;  2K9Q A;  4IHX A;  5H9T A;  4KWA A;  1VI0 A;  2CUE A;  3H3V K;  3BTI A;  3HTA A;  5EZH A;  2R93 J;  2WGB A;  2FJ1 A;  3RD3 A;  2DMT A;  4A3C J;  1ETK A;  2LR8 A;  1OCT C;  4RBO A;  4A93 J;  4AF5 A;  5EF6 A;  2ECB A;  2HOA A;  5J1U A;  5M5Y J;  2E2J J;  1BW5 A;  2HKU A;  4C2M J;  1I6H J;  1MSE C;  1UI5 A;  1IG7 A;  5IPA A;  2O9L A;  4EEF G;  1A6I A;  2E2H J;  5DAJ A;  4JX4 A;  5F1J A;  4B4C A;  4W97 A;  4M3F A;  2QKO A;  4XRS A;  1FIP A;  2RAS A;  1IC8 A;  3ON2 A;  2VKV A;  5J1R A;  5M3F J;  2ZOZ A;  1ETW A;  1ENH A;  5E3N A;  5EDN A;  1H8A C;  4GCK A;  3SDG A;  2DA7 A;  1RES A;  3BTC A;  4ABZ A;  3JRG A;  3VUQ A;  5CW8 A;  2Y0S N;  5M3M J;  3S1R J;  4D7N A;  1MNM C;  2HXO A;  2D5V A;  1SFO J;  2IEK A;  3NXC A;  2FBQ A;  3DCF A;  2Y31 A;  3VPR A;  4B1R A;  1LE8 B;  2R5Z B;  3EUP A;  2NVT J;  2G0E A; 
#chains in the Genus database with same CATH topology
 3GUD A;  2KLO A;  1ZQ3 P;  3O8H A;  5K5O A;  2VJJ A;  4LK1 F;  3BG5 A;  4GFL A;  1IRX A;  3JRF A;  3KPH A;  5CXI A;  2CFO A;  5J47 A;  1YW7 A;  2MLK A;  1QVT A;  3AKZ A;  1AKH A;  4A3B J;  4OIP F;  3AFH A;  2VBW A;  4H4K C;  3GFL A;  3QOD A;  2LYC A;  3ZN1 A;  1FBS A;  3A0B C;  4W1U A;  2D1H A;  3C2G A;  4LIT A;  1A35 A;  2STT A;  4X0G A;  3OSF A;  3BG7 A;  4H0E A;  4GCL A;  1IDZ A;  1GVJ A;  2W00 A;  2YVH A;  4BS9 A;  2FA5 A;  2IVM A;  5CYV A;  1ETX A;  3ECO A;  2Y0S A;  4JKZ A;  1XGN A;  1RRJ A;  4HG2 A;  1MKM A;  2CU7 A;  3FXU A;  1MH4 A;  2EZL A;  4XSZ F;  1XMX A;  4V2F A;  3L2V A;  2L01 A;  2EWN A;  4C30 A;  4BU2 A;  2P6T A;  3I55 I;  3T8T A;  3PO3 J;  2R7Z J;  3PPB A;  2DU9 A;  5D1R A;  1U9N A;  4KJZ A;  2DOD A;  2VJI A;  4BXU A;  5FRN A;  5F0C A;  2V9V A;  3BHQ A;  4ANJ A;  4I7H A;  3BDD A;  3I4N J;  1YJW I;  1YRN B;  5FKK A;  5EFY A;  2A6E F;  3CDL A;  1O3T A;  3IAM 2;  2LFB A;  1E3P A;  3NRV A;  1KYW A;  4DIQ A;  3HOZ J;  4CDG A;  1YX5 A;  1ON1 A;  5HDK A;  3ANP A;  2NS7 A;  2QYO A;  3IC7 A;  2XAS A;  2CQX A;  1D1B A;  2FOW A;  1RKT A;  4IHW A;  2DA6 A;  4O5V A;  2UZK A;  2VBX A;  1PUF B;  3BNI A;  4XID A;  1RNL A;  2ZCW A;  3HDD A;  1LB2 A;  2JA6 J;  3E6B A;  1T0F C;  3CMY A;  3GEU A;  1Z9C A;  2HEO A;  2KQR A;  4YG2 F;  4M6X A;  2KJC A;  3A03 A;  4HAM A;  3U9G A;  3SEZ A;  2DT7 B;  2QVO A;  3HGG A;  9ANT A;  3QRF F;  1VFC A;  3F6O A;  4KIT B;  5FJ8 J;  3K4B A;  1B72 B;  3HE0 A;  1MGT A;  2L4A A;  4PJL A;  2DMN A;  1W7P A;  4RAG A;  3CCV I;  2F5C A;  3LSP A;  2FNP A;  1ITY A;  4BAC A;  2I5U A;  4FIS A;  1X2M A;  2EV6 A;  2KP6 A;  4L9V A;  2H8R A;  3OOP A;  4KT5 C;  2ME0 A;  3BC8 A;  4BEH B;  1T8I A;  2ZBK A;  4ZJZ A;  3KLN A;  3IHU A;  2PZ9 A;  5EYR A;  4UDS A;  2L54 A;  1ZRF A;  1MBJ A;  5E1W A;  2H1K A;  4I98 B;  4KYW A;  3LSK A;  1TT5 B;  4E7I A;  2QIB A;  2E19 A;  3A0H C;  1D3Y A;  1I39 A;  3FIS A;  4QTR A;  4BJ6 C;  3KP7 A;  2J5P A;  2EPF A;  2RNG A;  2R5Z A;  1LE8 A;  3M1E A;  2G7S A;  4N9I A;  2BW3 B;  3VW2 A;  3LOC A;  2CUZ A;  4E6K G;  2KL4 A;  2X6X A;  2CSO A;  4DZJ A;  1FYK A;  1MNE A;  1IJW C;  3CLO A;  1RR7 A;  2XB0 X;  1DPR A;  1EH6 A;  3CES A;  4RGX A;  4MFD A;  1UG2 A;  2OD5 A;  4U7D A;  3EQL F;  1P9Q C;  4B8X A;  1XPX A;  1D1C A;  1H88 C;  4M9S A;  3TO7 A;  4MTD A;  2YSR A;  2P0W A;  4P9F A;  4DYC A;  1XMK A;  2X0L A;  5FKO A;  2Y30 A;  3KET A;  4XKW A;  4ZZD A;  1R9T J;  2LLK A;  2E5Z A;  2EFO A;  3MQ0 A;  2WY8 Q;  4A5N A;  3GTG J;  4LMY A;  1BI0 A;  3DKX A;  5AIQ A;  3H9G A;  2H8W A;  3KFW X;  3ZMT A;  5FRO A;  5D5U B;  1JGG A;  4CHU A;  5J8F A;  4YII A;  3DEU A;  1YO5 C;  3SDB A;  3LJL A;  4EJV A;  3G1M A;  1YJN I;  4XMY A;  2KDZ A;  5HAW A;  1VQ7 I;  5C4X J;  2W1O A;  1TZL A;  2G7U A;  1ZGJ A;  2CW0 F;  2ZOY A;  1I1S A;  4ZDL A;  3K1P A;  3K6G A;  2BGC A;  1LEA A;  5FB2 A;  3LHQ A;  4Y13 A;  3VOE A;  2P7V B;  4MHG A;  1DU6 A;  4AC0 A;  4GCT A;  2D1V A;  2OA4 A;  2O3F A;  2M45 A;  1ZG5 A;  1PUF A;  1QZE A;  3FBN B;  2GEN A;  1OCP A;  2XRL A;  1L0O C;  1FX7 A;  3WGH A;  3BR0 A;  2TDX A;  4XLA A;  2Z16 A;  1HKT A;  1TNS A;  4XOR A;  1B4A A;  2MYS A;  3E5Q A;  3SZT A;  3BQZ A;  2IT0 A;  3KIO A;  5C44 J;  4HRI A;  1W7P D;  4NHJ A;  2FSW A;  1BR2 A;  5E8G A;  1KA8 A;  2KIM A;  2KZV A;  3I53 A;  5DS9 A;  2W57 A;  3PAS A;  4AWX B;  4KIG A;  4AUX A;  2Q0O A;  2Z1D A;  1BBY A;  5LRR A;  4HZF A;  1IN6 A;  3ZMU A;  4MGR A;  2NVY J;  3BPX A;  5F08 A;  1XMA A;  2JTV A;  1FC3 A;  5DEQ A;  4S0H B;  1OCO H;  1Y1W J;  2ZO4 A;  4IKF A;  5L3E A;  5H6R A;  2VC1 A;  1MDM B;  4MQV A;  1J0R A;  4UXN A;  2REK A;  3VW0 A;  3LA3 A;  2HQR A;  5D8K B;  3GEZ A;  1HXD A;  1UG0 A;  2JZY A;  4L9N A;  5F1R A;  1SD4 A;  2ETH A;  3W2A A;  4KN7 X;  4AIK A;  3AL0 B;  2HDC A;  2A2F X;  1UST A;  5A2Q K;  4IO9 F;  4MNU A;  2BW3 A;  2PG4 A;  5F0H A;  2YS9 A;  4CCO A;  1B6A A;  2COB A;  2FBI A;  4L9J A;  4OIN F;  4NEL A;  3ABK H;  1F9N A;  3PNV A;  4Z6Y A;  3HOX J;  2HYT A;  1K4S A;  2KT0 A;  2PX9 A;  5DCM A;  5JI6 A;  2OCE A;  2V1X A;  5DV5 A;  3HHH A;  3I59 B;  2CGP A;  4M71 A;  3NEU A;  3QPT A;  2DOF A;  2DA5 A;  2E34 A;  2QQB A;  5CVI A;  3WHB A;  4B44 A;  2H27 A;  2IXS A;  4EQQ A;  5M5X J;  1R7J A;  2KDO A;  3QYE A;  4BJ5 C;  1HKS A;  1XN7 A;  2VQH A;  2EA4 A;  4I0A A;  3Q9S A;  2DK5 A;  4TV7 A;  2F4I A;  2QQA A;  2WAE A;  1FYM A;  1T39 A;  3S14 J;  2ZC2 A;  1QNT A;  5EEG A;  4IJA A;  4CCN A;  2PMZ N;  1LPQ A;  5DD8 A;  3DBH B;  3P9C A;  1EH7 A;  1ZGA A;  3A4C A;  3WG9 A;  3PIO F;  2DAO A;  4P96 A;  1AU7 A;  2XF6 A;  1KU9 A;  3B6A A;  2ZFW A;  2KZG A;  4MXM A;  1TBX A;  2LBF A;  4YZE A;  4HX7 A;  2WAQ A;  3CUQ B;  3DKY A;  4DGW B;  1OFC X;  2UXX A;  5JFR A;  3JR9 A;  1FJL A;  2GXB A;  2HQA A;  3PNT A;  3UR3 C;  3P7N A;  3HOT A;  3CCS I;  2E36 A;  3HB9 A;  4D5C A;  2FBH A;  3KZ9 A;  3OYE A;  2RKH A;  3LSG A;  2IA0 A;  3G73 A;  2ZSI B;  3F8F A;  3CO6 C;  3I56 I;  1VQ9 I;  3LSI A;  4BQA A;  3H92 A;  2WA0 A;  3JRC A;  2NOG A;  4PSW A;  5DCF A;  3HSR A;  3S32 A;  1X1P A;  2VQG A;  2L7K A;  3J7Z I;  2XKP A;  1D1A A;  5D4R A;  4EAT A;  1O3Q A;  3MCZ A;  4OAZ A;  1IN8 A;  3BT9 A;  3JRI A;  5K7H A;  3V42 A;  3OIQ A;  2LDU A;  5LRS A;  2NXN B;  3HTH A;  1OQY A;  1TQM A;  3GTK J;  1LDK B;  3CCU I;  3RQ4 A;  1BR4 A;  3F0C A;  3TW7 A;  4YEL A;  2QKM B;  2R7S A;  2DG8 A;  2BOL A;  4ENN A;  4YIR X;  2ZME A;  1R00 A;  4UUT A;  3OR1 C;  3CME I;  2JA2 A;  1SAX A;  1N78 A;  3OIP A;  5KHD A;  3LNQ A;  3KLO A;  1ETY A;  2K27 A;  3ZQ7 A;  2NS0 A;  3MWM A;  4EJU A;  3MKW B;  5ICC A;  4XOT A;  1STZ A;  5K7F A;  4NBQ A;  3LAP A;  2ELJ A;  4L0Y B;  3RZO J;  1D0X A;  2V26 A;  3CWR A;  1IN4 A;  4Y15 A;  2M2E A;  5CPR B;  3HIF A;  1C0W A;  1WGX A;  3H36 A;  4UVA A;  2X85 A;  5GPA A;  3BTJ A;  1YYV A;  3QOE A;  2WWY A;  3AG2 H;  4YFX F;  3H3Z A;  3MD2 A;  1BL0 A;  5LEJ A;  3ZQC A;  3EET A;  1Z7U A;  3FHZ A;  1MMS A;  4UV9 A;  2YX4 A;  4HST A;  2MLG A;  3K9T A;  1BOB A;  1BR1 A;  3WU2 C;  4ZYE A;  3I59 A;  1O57 A;  3E7Q A;  5E1Z B;  4C3H J;  3QYB A;  3TMO A;  3V8J A;  2BY1 A;  3GZ6 A;  3HRT A;  2JVG A;  3RSN A;  5IYB J;  3LAJ A;  3L2C A;  4GDF A;  1F36 A;  3RQI A;  5BMZ A;  2Y0M A;  3HG9 A;  3PFY A;  3HTJ A;  3FMQ A;  1YG2 A;  3D5R C;  1IZ1 A;  4D0P A;  5BQT A;  3BG6 A;  4CUG A;  1H9T A;  3BZC A;  4FQG A;  1NHA A;  1BN5 A;  1R4M B;  3CTA A;  4U9L A;  1VI0 A;  1VQ4 I;  3HTA A;  5EZH A;  1KON A;  2LMD A;  3T5X A;  2DMT A;  4A3C J;  4HPQ A;  1D8J A;  2M4K A;  3M9A A;  4LFU A;  4A93 J;  2L9N A;  2VT3 A;  4AIH A;  5JR3 A;  3I54 A;  2Z9O A;  3DU6 A;  4C2M J;  1UI5 A;  1Q1H A;  1IG7 A;  5FFX A;  3CUQ A;  4I02 A;  3L9F A;  5FD5 A;  1MW7 A;  2O9L A;  4BXF A;  4EEF G;  4ZC3 A;  4BQQ A;  3K4M A;  3MAJ A;  2YR2 A;  4C9Y A;  1OCZ H;  4W97 A;  1RR8 C;  1UEL B;  2QKO A;  1YE9 A;  4XRS A;  2KIU A;  2JSP A;  1LVA A;  1ZRE A;  3ZMD A;  1W36 D;  1MJB A;  1MND A;  5JVT A;  2FQ3 A;  2IGN A;  3WTS C;  4PFP A;  3T0Y A;  3G2B A;  4BQN A;  2NVU B;  3HXL A;  2DA7 A;  2RDP A;  2RN7 A;  1I1G A;  2COM A;  5CW8 A;  5EJC A;  5M3M J;  4GO1 A;  3FBI B;  1SFO J;  2VAS A;  2ZKZ A;  3DCF A;  4CZZ A;  2CV1 A;  4Y17 A;  1X19 A;  2Y31 A;  3T8R A;  4ASN A;  2YPR A;  4CSW A;  2EFP A;  3EUP A;  4RGU A;  4LB5 A;  1BIA A;  2WUI A;  1J2X A;  2GA2 A;  3SHF A;  4ZH4 F;  2M4G A;  4PSX A;  3MZH A;  5L3D A;  2P5L C;  2DFH A;  5E1X A;  2DMQ A;  3IL2 A;  1GV2 A;  2EFN A;  1ZH5 A;  1RIO H;  3VOK A;  2IGK A;  3HKZ N;  3S1Q J;  2Q2E A;  2WB1 N;  2V57 A;  4OIR F;  2MD0 A;  3PUB A;  3KP3 A;  3ZOB A;  3ZQF A;  2LC2 A;  3QOP A;  4Q4Z F;  2BHY A;  4BHB A;  2O7O A;  1WFX A;  2EZK A;  1Z67 A;  4ENJ A;  1R1U A;  1NK3 P;  2E7X A;  1UB9 A;  1WI9 A;  2M7B A;  4E4H A;  3HRU A;  2PBI A;  3J7Y J;  1WPK A;  3FKI J;  2R5Y B;  3TDU C;  4XKV A;  4DOZ A;  2XPU A;  3B02 A;  2XGD A;  1FY7 A;  3FHN A;  4GYG A;  1JJ6 C;  2P7C B;  1Y6I A;  3IRR A;  2XAJ A;  1X3W B;  3EGQ A;  5B1A H;  3HGY A;  4G7Z F;  4U88 A;  3G56 A;  4I99 C;  4BBR J;  3GZ5 A;  3BJB A;  3J80 Z;  2XAH A;  2PLY A;  4UNO A;  5ICF A;  2XSD C;  2K3F A;  3NAU A;  4XK4 A;  5FGL A;  2HZD A;  2HR3 A;  5L3F A;  5LHG A;  2VE9 A;  4YFN F;  1X1C A;  2HVQ A;  2E5N A;  3KP5 A;  3DFG A;  1K61 A;  2LKX A;  5BS6 A;  4R79 A;  3C3W A;  2HKO A;  2MFZ A;  3OMY A;  5FLM J;  4E7L A;  1HW2 A;  1GV5 A;  3FRQ A;  3JRD A;  1UHS A;  1UMQ A;  2X6Y A;  4PXI A;  1RET A;  3GW2 A;  2PMU A;  4LLN A;  2ZB9 A;  4RDU A;  2XF7 A;  3ZPL A;  3P5J A;  4RA2 A;  1EA3 A;  3JSJ A;  1G8X A;  1Z05 A;  4KIB A;  2O6G E;  3CF2 A;  4UUS A;  2WBM A;  3M7G A;  3CP8 A;  3OYA A;  3ML6 A;  5IT3 A;  3E3V A;  1WJB A;  1MBK A;  4UB6 C;  5D5V B;  3SJM A;  3JTH A;  3AG3 H;  1YIJ I;  4GXO A;  4X6A J;  1X1A A;  3KP6 A;  4N4N B;  2XC7 A;  4HW0 A;  2L5Q A;  2KRC A;  3TDZ C;  1JTX A;  4MIM A;  2M3A A;  2MBF A;  3HZJ A;  3OYJ A;  1VND A;  3U2R A;  5J1Y A;  2K7L A;  2K9N A;  4OOI A;  2H09 A;  3I71 A;  2G9W A;  4OMY A;  3WU0 A;  1HDD C;  2JWT A;  2KRH A;  3K4C A;  4IZZ A;  2LRE A;  3WTV C;  2F4O B;  2AHQ A;  1Y56 A;  5FMP A;  4DZP A;  3M4O J;  3VDX A;  5D5X B;  4XRM A;  4ZTF A;  3ABT A;  2XAU A;  2W48 A;  3IH4 A;  3QBM A;  3KCC A;  2BV6 A;  3ZR8 X;  1IRG A;  1Q1V A;  1XX5 A;  4B48 A;  2HZT A;  3W2V A;  3PIP F;  1UHM A;  1R5G A;  3ABL H;  3A02 A;  3IWF A;  2IS6 A;  3H35 A;  5TJJ A;  1YW9 A;  3G6E I;  2XSJ C;  3REO A;  4RB3 C;  2NX4 A;  2AQE A;  1R71 A;  2ZCX A;  4EM2 A;  3GZI A;  1PYV A;  4LK0 F;  1KQ9 A;  1TNT A;  4DBQ A;  2PBX A;  4BQO A;  2W53 A;  4YFK F;  3COL A;  3LFU A;  5HNF A;  2Y9Z A;  1X58 A;  4L5E A;  1N77 A;  4PUS A;  5KNL A;  2OU2 A;  1IF1 A;  2L3D A;  4BUP A;  4RGS A;  1Z3Y A;  4Y33 A;  3KYC B;  3W6K B;  5DYM A;  1OJL A;  4UUV A;  5HS8 A;  3QAH A;  3TQN A;  1TL8 A;  4ACI A;  2F5E A;  3FXM A;  4V19 K;  1KQ0 A;  4R8H A;  3EUA A;  2WC2 A;  3K1M A;  2R5Y A;  3GTO J;  1D5V A;  1U78 A;  2VPL A;  5J8C A;  4B3X A;  3T6N A;  2HQN A;  2ZXW H;  3S3O A;  2MW8 A;  3TP0 A;  4F3Q A;  4L5J A;  4RAF A;  3N05 A;  2EV5 A;  3CC7 I;  2IP2 A;  2GUH A;  3E6M A;  4RB1 A;  4CGZ A;  3RKX A;  2VXZ A;  1BOA A;  1K4T A;  5K58 A;  5AIP A;  1A36 A;  3ABU A;  1FTZ A;  5FKM A;  3BCG A;  4E7K A;  4XLH A;  3CC2 I;  2QWT A;  1AWC A;  2PFB A;  1CQT A;  4G94 A;  5FFZ A;  2OUM A;  1OYI A;  3G1L A;  5D6E A;  4CYC B;  1YQA A;  3PQK A;  3W3C A;  5GTI C;  1JUM A;  3K2A A;  2W85 A;  3PFI A;  4XLF A;  4JX5 A;  3C7J A;  2AXL A;  3OYL A;  1VQ6 I;  2F5D A;  4Q5S F;  3C07 A;  2QUF A;  2CW7 A;  1T6S A;  5J3L A;  2LG4 A;  3MZ8 A;  5E3M A;  2F6C A;  2VE8 A;  2XUB A;  1ETV A;  1T2K A;  1PVE A;  1UFM A;  4RLQ A;  3JRA A;  2PFV A;  3TP3 A;  2DA2 A;  2QBY A;  2N8G A;  1X3U A;  2OAZ A;  1ZAO A;  2LY1 A;  4GFK A;  3EYY A;  3LMM A;  1TTY A;  1FTT A;  1JGS A;  3M8E A;  1ON2 A;  1TW2 A;  3GVA A;  3E5X A;  1VQO I;  2K85 A;  3K7A J;  4HX8 A;  1P4W A;  1W0U A;  2IJL A;  2OI8 A;  4PK4 A;  3CC4 I;  3VIB A;  4OU0 A;  1UJ8 A;  2JMW A;  2KFD A;  4EJO A;  1JT0 A;  1BIB A;  2A5W A;  5LHI A;  4D7M A;  1LFU P;  2PJP A;  4RB0 A;  3DXJ F;  4B09 A;  2FNA A;  2VJ4 A;  1MMG A;  1S3J A;  4G6T B;  2R3S A;  2F07 A;  1FP2 A;  3S5R A;  4FTH A;  4UHT A;  5TIS C;  3RIR A;  1MJ9 A;  1WI3 A;  1SMT A;  4P1W A;  2M0M A;  1BJA A;  1WVR A;  3HBL A;  4CA0 A;  2K02 A;  2VL8 A;  4WX9 A;  4DNC A;  3B73 A;  3JRB A;  4KT6 A;  3COA C;  1GVD A;  4C3J J;  3ZP5 A;  1FMW A;  3DWL E;  2VBZ A;  1AOY A;  2VN2 A;  2Y2Z A;  3IUV A;  2JN6 A;  3LST A;  2Y69 H;  2WY7 Q;  5K5R A;  4OIQ F;  3NI7 A;  4Z2Y A;  2D6Y A;  4I0B A;  1ETO A;  1VQ8 I;  2BXZ A;  2EJR A;  2KKO A;  2EZH A;  3EUH A;  2HOS A;  3NAR A;  1K79 A;  1USS A;  3FK7 A;  2QCO A;  1WJC A;  4NC6 A;  3ERM A;  4RB2 C;  1GDT A;  4KDP A;  3GZN B;  4LG3 A;  5IY5 H;  1DPU A;  4A3G J;  1YIO A;  5ICG A;  5TGT A;  4A5M A;  1T56 A;  3GO5 A;  1DP7 P;  4HBL A;  4PGH A;  1EV7 A;  5BPD A;  2R7F A;  3FXJ A;  2X6O A;  3J7A Y;  1GT0 C;  4XOP A;  1HCR A;  4WIB A;  1OIS A;  1S7A A;  4QWQ A;  3BP8 A;  2KIS A;  2ZJ2 A;  5DCM B;  4HKU A;  3CJR B;  1T98 A;  3JW4 A;  1HC8 A;  2RHA A;  5J4Y A;  3GLX A;  2HVR A;  5C4J J;  2PI0 A;  4AM3 A;  2NP5 A;  2GIZ A;  4D5F A;  3RZD J;  3L1P A;  3I5U A;  1ZG1 A;  3F8M A;  3KP2 A;  2XDV A;  5J40 A;  2NP3 A;  1JKO C;  5ILU A;  1E2X A;  1ZK8 A;  5H20 A;  1FPQ A;  3S2D J;  2MH9 A;  1OYY A;  4UVB A;  1BA5 A;  3Q0U A;  4A0Y A;  3VSK A;  1GLN A;  2I8D A;  3IH2 A;  3KX2 A;  1OR7 A;  5D19 A;  1Y1V J;  5J6X A;  2JVH A;  3BR5 A;  2JSC A;  2OF7 A;  3BR3 A;  3J80 K;  4A3I J;  4CYC A;  4Y3O A;  4QPQ A;  2R0Q C;  1D5Y A;  3OIO A;  1G2H A;  1ZYR F;  4IQJ A;  2B63 J;  1M1E B;  2XDN A;  2G3B A;  4U7B A;  3PJR A;  5L3C A;  4JX6 A;  3RI4 A;  4GYI A;  5IP9 J;  1WWX A;  5K5Q A;  2QF7 A;  1LKX A;  4MO7 A;  4IRG A;  2DTR A;  2CQN A;  2HPI A;  2LBF B;  2JA5 J;  1JKR C;  1FLI A;  1KYZ A;  1MBG A;  3CJN A;  2DFE A;  5FLX Z;  2IU5 A;  2CWE A;  1QVU A;  3KZI C;  2LK2 A;  2PMZ A;  2R92 J;  5E17 F;  4LGW A;  5HLG A;  2M8G X;  3H9J A;  3MMY B;  1X2N A;  1HW1 A;  2DW4 A;  2OZU A;  4B43 A;  4Y52 J;  3MNL A;  2V4J C;  3HYI A;  4KIC A;  4ZYD A;  3QKX A;  2M87 A;  2GOM A;  2O61 A;  3AL0 C;  2I10 A;  1IO2 A;  2JPC A;  2K9L A;  3R0A A;  3PQJ A;  4HEA 2;  3VEP A;  3HUG A;  3DKW A;  3I9V 2;  1DUX C;  3FWE A;  4WXD A;  2Q1Z B;  4E7Z A;  1N75 A;  3UKG A;  2B1E A;  1VQL I;  1RUO A;  3AAF A;  2MG4 A;  3BG3 A;  4J19 A;  3U21 A;  2L7F P;  2L9R A;  3WTT C;  3VB2 A;  3C2B A;  3KP4 A;  2AQF A;  3OYG A;  3F9K A;  5FRM A;  3VVY A;  2EIM H;  2V1D A;  2ZME B;  3F8B A;  2QKL B;  5FGM A;  3TED A;  5IYD J;  3LSR A;  2RQQ A;  1R49 A;  1MMD A;  2DOE A;  3F72 A;  2E7W A;  1G3Y A;  1E3H A;  1TWF J;  4XRF A;  2LVS A;  5ILV A;  2LY9 A;  2M8E A;  2XVC A;  1FOK A;  2R7V A;  2KRF A;  3K10 A;  3QYF A;  3CDI A;  4DYQ A;  2CW8 A;  2F2E A;  3N4M A;  3HRS A;  1YTY A;  2RC4 A;  2Y48 A;  1OPC A;  4CCM A;  3GCM A;  4M72 A;  3RYR A;  2ZFU A;  4A3L J;  5K7Z A;  3IP4 B;  2QEX I;  4HA8 A;  4DYR A;  4U0V A;  3FXK A;  2CQK A;  2VOO A;  1QHG A;  4LLL A;  1X4O A;  2HPM A;  4IF4 A;  4I6Z A;  3EPZ A;  3CUQ C;  2CJJ A;  4EV0 A;  2GXA A;  2V6C A;  4Y4R A;  3TL4 X;  4KA4 A;  1RUN A;  3KYL A;  2J5O A;  1B59 A;  2RV8 A;  1U6G A;  4GGG A;  1XCB A;  3R4K A;  4KWA A;  3L2R A;  3RD3 A;  4BE2 A;  1SD6 A;  2BYV E;  1ETK A;  2LR8 A;  2QWW A;  5LGT A;  3L2W A;  1XSD A;  4AF5 A;  4O3M A;  2L2O A;  2ECB A;  3BRO A;  5LGN A;  1T0F A;  2E2J J;  2HKU A;  4MEY F;  1P2F A;  1MSE C;  3PL8 A;  1YS6 A;  1FBQ A;  3KYD B;  2AS5 F;  3TOA A;  1NH3 A;  3VWB A;  2CS3 A;  5DUK A;  5B3S H;  1LVK A;  1K6Y A;  5LBQ A;  2FF4 A;  3ERE D;  3WTZ A;  1WJA A;  2AXT C;  5DAJ A;  2H6C A;  5F1J A;  4A12 A;  2LRD A;  4RMN A;  1UCR A;  4M3F A;  2CG4 A;  2HTJ A;  2STW A;  2LF8 A;  2X51 A;  1DGW Y;  2A05 A;  2ZOZ A;  5M3F J;  1CF7 A;  5EDN A;  1EKE A;  3TO9 A;  2FU4 A;  2QM3 A;  4ABZ A;  3JRG A;  3OYD A;  5H2F C;  4XLP F;  4XNF A;  1F1Z A;  5LEK A;  1MNM C;  4II3 A;  1DP3 A;  2IEK A;  1U8R A;  2DLL A;  3CJT B;  2B0L A;  1S8N A;  1Y0N A;  5DD4 A;  3O3K A;  4CH7 A;  2B9S A;  4M9X A;  2CV0 A;  3HSE A;  2UXU A;  1R58 A;  1V55 H;  2ZXI A;  2DN0 A;  5D18 A;  3GX4 X;  3LSH A;  2W82 A;  3OS0 A;  4FE7 A;  4LJZ F;  1MIJ A;  4IRV A;  3GTJ J;  4A3D J;  2L0K A;  1R4N B;  3ZMV A;  2LSO A;  2DT6 A;  1R5H A;  2M0C A;  3TW6 A;  2RGV A;  3K4N A;  1K6O A;  1TWG J;  3HIM A;  1HQC A;  2V1N A;  2L02 A;  2OPT A;  4BE1 A;  1OKR A;  1P4A A;  1GXQ A;  1IN7 A;  5FLV A;  1BI3 A;  4HNV A;  1S9H A;  2HI3 A;  2Y9Y A;  2FML A;  3V7R A;  2Q2E B;  3W6J B;  2O5R A;  4XN0 A;  1APL C;  3MKL A;  1JT6 A;  1SD7 A;  2DA1 A;  1T33 A;  3VFZ A;  4C3I J;  1MSF C;  1SFK A;  2A6T A;  2ME6 A;  3H1C A;  4A3M J;  2HTS A;  2NYX A;  5CXG A;  2YVE A;  1P92 A;  1LFP A;  4YEJ A;  3Q0V A;  3I64 A;  3CZ6 A;  2DOA A;  2NNN A;  3DV8 A;  5IT9 Z;  3HKZ A;  1VQM I;  2WB1 A;  2UXP A;  3B81 A;  1B1B A;  2E1M C;  3Q3S A;  1XG1 A;  2MD5 A;  2XB5 A;  3CDH A;  1V5G A;  3V4G A;  3SFZ A;  1V5F A;  1N25 A;  3DPU A;  2E60 A;  3H5R A;  2EK5 A;  1CGP A;  1T95 A;  5FKL A;  1WKM A;  3QU3 A;  3ZXS A;  1IV6 A;  3CCY A;  4DVY P;  2BEO A;  1OYW A;  1LQ1 A;  1KGS A;  4OWR B;  4GRI A;  1SC7 A;  1MMA A;  3WU1 B;  2OJE D;  3DQV C;  1WRJ A;  4ZYA A;  3L2U A;  1NK2 P;  1J75 A;  3F8C A;  1TP4 A;  3CMA I;  3SEQ A;  2YU9 J;  1GHC A;  4XBF A;  2XPV A;  1G3S A;  5F04 A;  3C1D A;  3QPL A;  4WCG A;  3O2P E;  3NNR A;  2DBB A;  4HSR A;  1XD7 A;  2VKD A;  4XRS G;  1PP8 F;  2O7T A;  2LF7 A;  2TCT A;  1RPW A;  4BGD A;  5D4S A;  2F5F A;  3CUO A;  4UV8 A;  2M34 A;  2ID3 A;  2HNH A;  4UUS B;  2A6H F;  3K0L A;  2KMU A;  4M9Z A;  1NG7 A;  3E6D A;  2VON A;  3CJQ B;  4ZYG A;  1G3W A;  2X48 A;  1I3A A;  3FIW A;  2ELH A;  2E1M B;  4I76 A;  3WGG A;  4BYY A;  3DEE A;  2FEZ A;  1YIT I;  1LEB A;  3VP5 A;  3TO6 A;  3M3Y J;  3EDP A;  1U2W A;  2LTP A;  3S1N J;  3BCA A;  1U8B A;  5CVU A;  1W1W E;  3IAS 2;  2DPD A;  3BPV A;  3OL3 A;  1S6L A;  4NQW A;  4BHC A;  2BY0 A;  3V6G A;  3QPS A;  5FLX K;  3HPH A;  5JVG F;  2LKS A;  2R7D A;  3M8F A;  3J7A O;  2W25 A;  3V8K A;  2NAZ A;  4AC6 A;  4MTE A;  1TW3 A;  1JHH A;  3R6S A;  3DTE A;  3GME A;  4HQM A;  2A3S A;  2JRT A;  3RPQ A;  3S17 J;  4HF0 A;  1JUP A;  1E0E A;  3GYH X;  1R22 A;  4EJT A;  3N97 A;  3DBL B;  1FYL A;  3VOD A;  1NTC A;  2CUJ A;  3H5A A;  5KVR A;  2QSH X;  2ISZ A;  1H0M A;  1B9N A;  1BI1 A;  4I09 A;  1Y8Q B;  2A5Y B;  3D1N I;  1QZY A;  1PUE E;  3I0T A;  3NS4 A;  3GTL J;  3O8G A;  3T1B A;  1ACI A;  2GIV A;  1DU0 A;  5BNG A;  4A3E J;  3E0J B;  4FX0 A;  1RKW A;  3O6B B;  5HS7 A;  2ZXH A;  2R7O A;  2OV7 A;  3B6C A;  4KUM A;  2VJ5 A;  1T38 A;  5GAE J;  1U5T A;  1Z6R A;  2HWV A;  3BR2 A;  1S5L C;  4U87 A;  2DMP A;  2O8K A;  3ZQQ A;  3LA7 A;  3FZV A;  5CQE A;  2HDD A;  1TT0 A;  2XAQ A;  1MD0 A;  3HJE A;  3ZQH A;  2VOP A;  3K70 D;  4A0Z A;  5DM7 F;  4FCY A;  2V9P A;  5LGU A;  2UXI A;  4OD5 A;  2DCE A;  2UXN A;  1O3S A;  3WGI A;  5HDG A;  3RDI A;  3QWL A;  5EGO A;  4DW6 A;  3CO7 C;  2IS4 A;  3DU5 A;  3DPL C;  1G59 A;  4IHT A;  2E1O A;  4G6D A;  2IPQ X;  3BLY A;  2G7L A;  3GLL A;  4NC8 A;  1MZB A;  4JL3 A;  2V79 A;  3Q9V A;  3I58 A;  4ON0 A;  1ZAR A;  2GXG A;  3CCR I;  1DDN A;  2CV2 A;  1X1D A;  3HEF A;  4N0B A;  6PAX A;  2NS8 A;  1SMY F;  5ILS A;  3RKY A;  3CJD A;  3K4K A;  1B8I A;  3WHC A;  1U0J A;  2BY3 A;  3E1S A;  1KU2 A;  4A3J J;  4J00 A;  1Z21 A;  2EQR A;  3FDY A;  5E3L A;  4ICH A;  4BKX A;  5L3B A;  2HOT A;  4CO8 A;  3VYR B;  3HOU J;  2RVC A;  1QPM A;  3FF5 A;  2WTE A;  1FIA A;  1W5C C;  1JKQ C;  4OIO F;  2DG7 A;  3FM5 A;  1U9O A;  1S7E A;  2IA2 A;  2F5V A;  4F55 A;  1HDP A;  3QP6 A;  1FEX A;  3R60 A;  3GFJ A;  2QA4 I;  3OOU A;  2ESH A;  4HNT A;  2V7F A;  3K2Z A;  4L5I A;  2BVL A;  1HKQ A;  3BJO A;  3BOQ A;  2EFW A;  1YS7 A;  1P7J A;  1S72 I;  3G3Z A;  1BJZ A;  2QBY B;  3EUH C;  2X1D A;  3CCJ I;  3BQY A;  1ZTR A;  2W84 A;  2K40 A;  3AQT A;  2QZ8 A;  1Y39 A;  4EMS A;  3HOS A;  3JSO A;  3WTY C;  3VVZ A;  4BDZ A;  2VI6 A;  1B9M A;  5E79 C;  1K78 B;  3ROU A;  5J4V A;  3L09 A;  2Q24 A;  2LY2 A;  5H6Q A;  1IAW A;  5AQC A;  1LFB A;  3A01 B;  1JKP C;  3S1M J;  4JNN A;  1MH3 A;  2L9S A;  4JBA A;  2P8T A;  4IHV A;  3OWT A;  2FX0 A;  5EG0 B;  2JPB A;  2H1L A;  3GF2 A;  1W5S A;  4M3E A;  2MAB A;  2VC0 A;  1R1V A;  3JRH A;  1POG A;  5FHP A;  2OBP A;  2ECC A;  3QQA A;  5GPC A;  2YUS A;  3FM3 A;  3Q0W A;  4BY1 J;  1A04 A;  1ZHF A;  1ZG3 A;  3ZCO A;  3VTI A;  3WE3 A;  1SFX A;  2BBY A;  2IA1 A;  5LLQ A;  2JA8 J;  3W2W A;  1R5I D;  4NC7 A;  4F92 B;  4UVC A;  2LP0 A;  3PSF A;  2GBY A;  2MC3 A;  3FXO A;  1ZKG A;  2JQ7 A;  1I27 A;  1P6R A;  3QPH A;  4EVI A;  4P5O A;  1G6N A;  2A69 F;  3G4S I;  3K8P C;  1XCV A;  2WV1 A;  4WF2 A;  5GAD J;  4RS8 A;  2RRE A;  4JYK A;  4IRI A;  5CKT A;  2JUG A;  4LIV A;  2VQC A;  3ZRG A;  2IS1 A;  1WH5 A;  5CLS A;  3ZMS A;  4F93 B;  2M1B A;  3O60 A;  2HFH A;  1JI8 A;  2EBI A;  3V78 A;  4XR6 A;  2B7E A;  1FSE A;  4BY7 J;  3J81 Z;  2ZJR F;  3F8N A;  1W5T A;  1DQU A;  3DF8 A;  4L9T A;  2XGE A;  2ZJP F;  5D5W B;  4IPA A;  5M5W J;  4C2M A;  1EJ9 A;  2HU9 A;  2ZJQ F;  3HM5 A;  1V5E A;  4E7S A;  3MKY B;  1FOY A;  2VB6 A;  1YHQ I;  3FXR A;  1KZH A;  2EB7 A;  1ZRD A;  2WV0 A;  5FKN A;  2OTJ I;  2CO5 A;  2HKX A;  5LFA A;  2PMH A;  1WH7 A;  1Z91 A;  3H0D A;  2CUF A;  2HS5 A;  3AG4 H;  5E18 F;  2VIX A;  4ZTJ A;  1OLT A;  1WHU A;  4R1H A;  2EV0 A;  3WG7 H;  4XQF A;  4U0W A;  2HDW A;  3BR6 A;  1WJD A;  3H9Q A;  4N9H A;  1OMI A;  4IEJ A;  1IXR C;  1PJR A;  2F4M B;  2G7G A;  3FXL A;  1JXS A;  2HYG D;  4CCJ A;  3IUO A;  4E70 A;  2JT1 A;  3KEY A;  3C2H A;  2GAU A;  4ZDO A;  1SVO A;  2VBY A;  4GFB A;  3FKJ A;  1SVL A;  2OQR A;  2IRF G;  2VLA A;  4EGZ A;  2DQL A;  1RZ4 A;  4WXH A;  2A61 A;  1O7L A;  2HXI A;  1XGS A;  1YLF A;  4PDK A;  2X1C A;  1XTA A;  1Z3X A;  2JK3 A;  2R7Q A;  2ACJ A;  4G9Y A;  1ZN2 A;  1FMV A;  4O6J A;  3BJ6 A;  3MN2 A;  1YX3 A;  3MKZ A;  3BZK A;  4RM2 A;  1FNN A;  3SZP A;  1K78 A;  3FK6 A;  1REP C;  1MBE A;  3DEW A;  1IGN A;  2XGX A;  3BR1 A;  1MJA A;  2R4G A;  5GP9 A;  3HUG B;  3ULQ B;  3FMR A;  4Q48 A;  2C6Y A;  1P7I A;  1ULY A;  3A01 A;  4KMU X;  1X4P A;  1T08 B;  1NG6 A;  2FBK A;  5EG0 A;  5D8L B;  3U1D A;  4L62 A;  3H3U A;  5CVR A;  5F6F A;  3DPJ A;  3DLL F;  2DYR H;  2BY2 A;  5BOX A;  2MGQ A;  3OYB A;  4RM3 A;  4U0Y A;  4WK8 F;  4LD5 A;  3WOD F;  1LDJ A;  2VOD A;  3G1O A;  3JSP A;  2BE5 F;  2XAF A;  4AIJ A;  2K9S A;  3OS1 A;  1JHF A;  3OYC A;  5HOO A;  1VQ5 I;  4Y7N J;  4HF2 A;  3IH3 A;  1QGP A;  4AID A;  4CCK A;  4AD9 A;  1LUJ B;  1H89 C;  1SAN A;  4XLE A;  2ZCM A;  1OCC H;  1FOX A;  2BXY A;  4MEX F;  2DI3 A;  1IDY A;  3F21 A;  2QEN A;  2VPR A;  3H5N A;  2FJI 1;  3OYI A;  1QBJ A;  2E1N A;  4AYB N;  2F48 A;  3Q5F A;  5IOZ A;  2K9Q A;  4BNC A;  2DK8 A;  5JHU A;  3BTI A;  2R93 J;  3WE2 A;  4A6D A;  1R6R A;  2EIL H;  3QU6 A;  2WGB A;  2FJ1 A;  3MZY A;  2DPU A;  2XRN A;  4CYD A;  2JUC A;  4PGG A;  3UNG C;  5K1Y A;  1R1T A;  2K3P A;  2HOA A;  2L9V A;  1XDS A;  4A0X A;  4JOM A;  4CCL A;  2P5V A;  3CD6 I;  4HV6 A;  4XKB A;  1XSX A;  1IN5 A;  2XHK A;  3ELK A;  4PFO A;  1F4K A;  1PDN C;  4XLN F;  2V6E A;  3LL7 A;  3OYF A;  4JX4 A;  5KCM A;  4XON A;  2DJI A;  2IW5 A;  3K1N A;  2XF5 A;  4II2 A;  4C2T A;  1FIP A;  1WSU A;  4IVN A;  2GLO A;  3HHG A;  1IC8 A;  3ON2 A;  1W36 C;  1IXC A;  2VKV A;  2MC4 A;  5J1R A;  2HGC A;  1ETW A;  1ENH A;  5E3N A;  2VT2 A;  1H8A C;  4GCK A;  4F52 A;  3GFI A;  3BTC A;  3VUQ A;  2Y0S N;  4D7N A;  2HXO A;  2FRH A;  4BH9 A;  3NXC A;  3M1C A;  3VPR A;  1XDU A;  2KIQ A;  3BZ6 A;  2H6B A;  2K86 A;  2NVT J;  2Q8K A;  1I6X A;  3DTI A;  4LG0 B;  2X4H A;  5HBU A;  2ZME C;  1CF7 B;  1G4D A;  2G7H A;  1ZRC A;  3VW1 A;  3KEQ A;  5C3E J;  2CQ7 A;  1UHW A;  1IXS B;  4F91 B;  4UY8 I;  3RKQ A;  3S3M A;  1EF4 A;  3D0S A;  2OQG A;  2O8X A;  5IOY A;  2NRA C;  2DA3 A;  4N4O B;  1Y0U A;  4BL0 B;  1IUY A;  1SVM A;  5F27 A;  1K7A A;  5DTD A;  1XC5 A;  3DTK A;  3RTR A;  2RNJ A;  1V54 H;  3IV5 A;  2QQ8 A;  3BCB A;  3K70 C;  2CFX A;  2Z2S B;  4IL6 C;  5HLI A;  4BAY A;  5IYC J;  3ONQ A;  3IRQ A;  1Z0X A;  2W24 A;  3OS2 A;  5DM6 F;  1YRN A;  4NUB A;  2NVX J;  4IOC F;  4MFE A;  3S8P A;  4ZYH A;  3CCL I;  4L0Z B;  4PCQ A;  3ZGK A;  3BWG A;  2K4B A;  1HOM A;  2LD5 A;  4F7Z A;  5LHH A;  3CQZ J;  3NPI A;  1ONV A;  3MEX A;  2GFN A;  3K4L A;  4KIS A;  5HS9 A;  2DDB A;  3RKW A;  4PJM A;  5TRD A;  1XS9 A;  1FSH A;  4WWC A;  4KN4 X;  1HSJ A;  4ENM A;  2FXA A;  3GTQ J;  4G7O F;  2GOX B;  2O0Y A;  3L2Q A;  4BJT A;  5KAI C;  3PNY A;  3G71 I;  3F22 A;  3DPT A;  2JJ7 A;  3E5U A;  2K5C A;  2YX7 A;  4C2U A;  3JTG A;  4OAY A;  2A68 F;  5CVJ A;  3GWZ A;  4U9N A;  1B72 A;  3ECH A;  2EZI A;  1ETQ A;  1MBH A;  2OZ6 A;  2GA1 A;  4RAZ A;  2DDA A;  4CIC A;  3DBR B;  4M3B A;  4ESB A;  4G12 A;  1TQI A;  4M3D A;  3TOB A;  3V8L A;  2P6S A;  1ZR4 A;  2LKP A;  2KIF A;  1MBF A;  4PJ0 C;  2DQR A;  1A31 A;  4EM0 B;  5DDG A;  1E3O C;  3BG9 A;  4BEH A;  3W6V A;  3E7L A;  1V4R A;  5GAG J;  1JUS A;  1Z1D A;  1QPI A;  1TC3 C;  2X9D A;  2M9H A;  4FX4 A;  4KNY A;  1TLH B;  4AU7 A;  4IHY A;  2VKE A;  3J81 K;  2XIG A;  3KEO A;  3VVX A;  2EIK H;  2L7M P;  4YIF A;  1L3L A;  3ON4 A;  5FD6 A;  3M8J A;  3A1Y A;  5EEH A;  2RAE A;  2VUM J;  1O3R A;  3SQN A;  2DFI A;  1QHH D;  2Z5U A;  4QLC U;  1X3Z B;  5KAF C;  3D5L A;  5HVQ C;  2XPW A;  3F6V A;  4BE0 A;  3BJA A;  3L00 A;  4XIC A;  2NNY A;  3ZQL A;  1TWA J;  1TWH J;  2R7W A;  5E20 A;  1I5Z A;  4P9U A;  4B47 A;  1ZLK A;  4AVP A;  2R7R A;  3CRJ A;  2L7Z A;  4HDU A;  4HDV A;  3U1K A;  1R23 A;  3I4M J;  3LSM A;  5F0F A;  4X1E A;  4LG0 A;  4XN3 A;  4Q47 A;  1JJ8 C;  4P55 A;  1IUF A;  2XRO A;  1GXP A;  1U5T C;  3PO2 J;  1GUU A;  4NQW B;  1HA8 A;  2FQ4 A;  3S2H J;  1KU3 A;  4MQ9 F;  3KKC A;  2X1E A;  3OYK A;  2CYY A;  2ZSH B;  2X6W A;  3E97 A;  5B66 C;  2D2W A;  3KE2 A;  1FP1 D;  3ZN0 A;  2CH0 A;  1VQN I;  4JQF A;  3C18 A;  4PJJ A;  1XSV A;  1BC7 C;  1UAA A;  5FO5 A;  1TWC J;  5AON A;  1ZEL A;  3VSL A;  1F5T A;  3F3X A;  4J01 A;  3JAM Z;  2ID6 A;  4ESJ A;  4ME9 A;  4FET A;  2UV1 A;  2CMP A;  3V7S A;  2IGM A;  1DGR M;  3E6C C;  2EIJ H;  3ASN H;  1SFU A;  2PJR B;  1K83 J;  1LNW A;  2UXH A;  4RAY A;  1XGM A;  4LB6 B;  1I3Q J;  5IP6 A;  4A3K J;  5HOD A;  2R7T A;  4ITV A;  4XSX F;  4KMF A;  1OCR H;  1VF9 A;  5HLH A;  2XKO A;  3GTM J;  1EH8 A;  4B3A A;  3HC7 A;  2D45 A;  4L18 B;  2DYS H;  5CQG A;  2M7A A;  2PEX A;  4D9J A;  4QSH A;  4CGR A;  5JHF A;  1U5T B;  1BW6 A;  2GQQ A;  4I01 A;  2FE3 A;  2HYF A;  4XL9 A;  5F64 A;  2QLZ A;  4BDY A;  1Z6T A;  4M74 A;  3MVP A;  5HDN A;  5JLW A;  1SEU A;  1TQP A;  1ZLJ A;  4FE4 A;  2IBD A;  2MSY A;  4DQ2 A;  3D5S C;  2ZCN A;  3P9T A;  4NNJ A;  1D0Y A;  1HW5 A;  1BC8 C;  2PQ8 A;  1YFH A;  2JRM A;  2GM4 A;  2CRG A;  2E1C A;  5B1B H;  1H9G A;  3GBG A;  4I2O A;  1HLV A;  3TBI A;  5EGO B;  3BRU A;  3R61 A;  3GTP J;  3WTW C;  4MLO A;  5E8I A;  3NQO A;  3CF5 F;  2KJB A;  4A6E A;  3R0J A;  3HTS B;  2VXD A;  3LSJ A;  3BTL A;  3S93 A;  2IS2 A;  4M6Y A;  3L7W A;  3X2Q H;  2HYJ A;  2H94 A;  1FOW A;  2ELK A;  4S04 A;  4E7J A;  3RPU A;  2TRT A;  1MDM A;  2KHM A;  3SXY A;  2Z99 A;  2V1U A;  1B8I B;  1J9I A;  5EZG A;  1Z77 A;  1J59 A;  5E3O A;  2DXI A;  3VYS B;  3K4J A;  3PSI A;  3JCU C;  5EEA A;  3CP2 A;  4D1Q A;  1YJ9 I;  1WZ2 A;  2W4S A;  4CXF A;  2ISY A;  3EYI A;  3ZQG A;  3MFK A;  3RCO A;  3S3N A;  1WJ5 A;  1YOV B;  3OV8 A;  5GTH C;  2DA4 A;  1FBU A;  3FMS A;  1AHD P;  4ZZL A;  2QGU A;  2OC6 A;  3FXQ A;  2XGC A;  4IOA F;  2ZNY A;  1KQ8 A;  1HST A;  1HBX G;  2GWR A;  2A07 F;  2OER A;  3NWS A;  3LWF A;  4HNU A;  2DFF A;  2Y75 A;  3OYM A;  3OSG A;  2ESN A;  1D8K A;  4EGY A;  3KKD A;  4PZJ A;  3HSF A;  5BPI A;  2E35 A;  5KK1 A;  4KIF A;  2DTZ A;  4M6V A;  1F43 A;  3PUF A;  1ORK A;  1SGM A;  1VQP I;  3WTX C;  1ZR2 A;  5CJ9 A;  4BHP A;  3BY6 A;  1QRY A;  2P5K A;  2WAQ N;  2K4J A;  4NDL A;  1Z7L A;  1SAU A;  4A69 C;  2VQL A;  4E7H A;  2GZW A;  1FWZ A;  5ICE A;  2HOE A;  4DBR A;  4OD4 A;  3IWZ A;  1W4M A;  2WAD A;  3HOY J;  1WCM J;  5CVV A;  1JE8 A;  3LQQ A;  3GFM A;  3DP7 A;  3I4P A;  2XV4 S;  2P81 A;  4K2E A;  3CCM I;  1QA6 A;  3I3L A;  2ICW G;  2BHZ A;  1ODD A;  2HVS A;  4WXC A;  1J7K A;  4ENK A;  2EH3 A;  2DJN A;  2YU3 A;  2CQQ A;  2DO7 A;  4RGR A;  5ERI A;  2W7N A;  2YVX A;  3CCQ I;  4BXX J;  1W0T A;  2E2I J;  3S15 J;  1S7O A;  4FHT A;  5B5E C;  3TGN A;  1AA7 A;  4IQ4 A;  4GCV A;  3SZG A;  2PJR A;  4IHS A;  3LQR A;  2MH2 A;  5IP7 J;  2UXO A;  3V7C A;  5GAH J;  3HL2 A;  3PM1 A;  5D6F A;  3JRE A;  1QZZ A;  1A5J A;  3SYT A;  1I50 J;  4UB8 C;  2B3W A;  3SWH A;  2XAG A;  3G7R A;  4NN1 A;  2QQ9 A;  3ZQI A;  4HF1 A;  5HNH A;  4QPO A;  3OL4 A;  4M3G A;  3CLQ A;  2ADU A;  4ESF A;  2HQ5 A;  4BBS J;  5DUI A;  2EFQ A;  4V2G A;  2Z3Y A;  3ISP A;  1P4X A;  2NVQ J;  4PJN A;  1IRZ A;  2IAI A;  3WTU C;  4XM3 A;  5LD2 C;  1PP7 U;  4FAS D;  2DMU A;  4G6Q A;  4HOB A;  3LFK A;  3HRM A;  3SFI A;  3VYU B;  4A3F J;  1SFE A;  4EM1 A;  1WQ2 A;  4CZC A;  1LJ9 A;  3ASO H;  3RPU D;  1YW8 A;  2ZNZ A;  2JA7 J;  2AO9 A;  2NOJ B;  1XGO A;  3OR2 C;  2K9M A;  2FOK A;  3H0G J;  2L4M A;  5JLX A;  4G7H F;  2WAF A;  4G8X A;  1D0Z A;  1IW7 F;  3GXO A;  3S2W A;  1BI2 A;  1X1B A;  3DLA A;  1VQK I;  1ERD A;  3HTU A;  4HX4 A;  3ANG A;  3RYP A;  2V9K A;  1AKH B;  4IXA A;  2M5W A;  4MK6 A;  2KPM A;  2BVM A;  2LNB A;  3HOW J;  2P4W A;  4S05 A;  2LH9 A;  1ZGW A;  1FT9 A;  1LDD A;  2O03 A;  4YRV A;  3RH2 A;  1J5Y A;  2R7U A;  2EA2 A;  4M73 A;  1JTY A;  3KNW A;  3TKY A;  2QTQ A;  2ZY9 A;  1QO0 D;  3KZZ A;  2M30 A;  3HOV J;  1IRF A;  3OY9 A;  2QOP A;  1SD5 A;  4LOC A;  1O4X A;  4IX7 A;  3NWT A;  4AVZ A;  3RJP A;  1A6Q A;  1UI6 A;  3AG1 H;  2UWM A;  5HSZ A;  3HTI A;  2VKH A;  3IKT A;  3LWJ A;  2OTL I;  4QIW N;  4A2U A;  4RLF A;  4JP0 A;  3VOX A;  3IKV A;  3K69 A;  3CMM A;  2LOO A;  5C4Y A;  3FX3 A;  1QQI A;  2FD5 A;  3HPG A;  1O7F A;  1HF0 A;  1MMN A;  3NRG A;  3S16 J;  2DT5 A;  2QSF X;  1U3E M;  3QP5 A;  2OCC H;  4IRH A;  1UZC A;  4LLG F;  2MA3 A;  4XKC A;  1KU7 A;  3EUK L;  5HLT A;  4LIU A;  3F1B A;  5ED4 A;  3ESW B;  3OYH A;  4ETS A;  3AQS A;  3KZY A;  4HV5 A;  4EJW A;  2BZT A;  2QSG X;  4IHX A;  5H9T A;  1WJE A;  1VTN C;  2CUE A;  3H3V K;  1BM9 A;  1IV8 A;  3CCE I;  4DJA A;  1OCT C;  2UUZ A;  4RBO A;  3JAM K;  1G3T A;  5EF6 A;  1J09 A;  2FMY A;  5J1U A;  5M5Y J;  1BW5 A;  1OR7 C;  2Z33 A;  1I6H J;  3ABM H;  3P9I A;  3A2K A;  1RC9 A;  2FUG 2;  5IPA A;  4OMZ A;  1W7P B;  1A6I A;  1WJF A;  3P9K A;  2E2H J;  1RI7 A;  4B4C A;  2E71 A;  1FZP B;  4HLX A;  2RAS A;  1V3F A;  1XB4 A;  4HLY A;  4FT8 A;  4JK1 X;  4HQE A;  2IGO A;  3OYN A;  1Y8R B;  2RQP A;  3F23 A;  2PN6 A;  2R7X A;  3M07 A;  4AYB A;  4KFC A;  3SDG A;  4HYE A;  1RES A;  1VZ0 A;  4NB5 A;  3ZMZ A;  5A2Q Z;  3S1R J;  1R36 A;  2D5V A;  1E17 A;  4XLC A;  5L3G A;  2FBQ A;  1QU3 A;  2EIN H;  3VYT B;  2ZXJ A;  5IT9 K;  1S29 A;  4B1R A;  1YI2 I;  2R5Z B;  1LE8 B;  3LA2 A;  4ZDP A;  2G0E A; 
#chains in the Genus database with same CATH homology
 1ZQ3 P;  3O8H A;  2UXU A;  5HBU A;  2DN0 A;  3BG5 A;  2WUI A;  4GFL A;  5D18 A;  3JRF A;  5CXI A;  3VW1 A;  5C3E J;  4A3B J;  1QVT A;  1AKH A;  2DMQ A;  4FE7 A;  3RKQ A;  1EF4 A;  1GV2 A;  3GTJ J;  4A3D J;  3VOK A;  2L0K A;  3HKZ N;  3S1Q J;  2WB1 N;  5IOY A;  2V57 A;  4W1U A;  2M0C A;  2DA3 A;  3ZOB A;  3ZQF A;  3TW6 A;  5F27 A;  3OSF A;  1TWG J;  3HIM A;  5DTD A;  2O7O A;  2EZK A;  1XC5 A;  2OPT A;  1IDZ A;  2YVH A;  4GCL A;  1NK3 P;  3IV5 A;  1ETX A;  5FLV A;  4JKZ A;  5IYC J;  4HNV A;  2HI3 A;  1Z0X A;  1WPK A;  2Y9Y A;  2CU7 A;  3FKI J;  1MH4 A;  2R5Y B;  1YRN A;  2EZL A;  2XPU A;  2NVX J;  2XGD A;  4MFE A;  4V2F A;  3MKL A;  1JJ6 C;  1APL C;  1JT6 A;  2DA1 A;  1T33 A;  1HOM A;  2LD5 A;  4C3I J;  3PO3 J;  1MSF C;  3CQZ J;  3NPI A;  2R7Z J;  2ME6 A;  3EGQ A;  2GFN A;  3HGY A;  3PPB A;  1U9N A;  5D1R A;  4A3M J;  3G56 A;  5F0C A;  4BBR J;  1XS9 A;  3BJB A;  5CXG A;  2YVE A;  3Q0V A;  3BHQ A;  3I4N J;  2XSD C;  3GTQ J;  3NAU A;  4XK4 A;  1YRN B;  5FKK A;  5EFY A;  3CDL A;  5FGL A;  2UXP A;  3B81 A;  2LFB A;  3Q3S A;  1K61 A;  2LKX A;  1XG1 A;  2XB5 A;  3HOZ J;  3ANP A;  2JJ7 A;  2NS7 A;  5FLM J;  1GV5 A;  3FRQ A;  3JRD A;  2CQX A;  1UHS A;  1UMQ A;  4PXI A;  4IHW A;  1RET A;  1RKT A;  2DA6 A;  2ZB9 A;  4RDU A;  1PUF B;  3BNI A;  5FKL A;  4XID A;  1B72 A;  3JSJ A;  3HDD A;  2EZI A;  1IV6 A;  2JA6 J;  3CCY A;  1ETQ A;  1MBH A;  4UUS A;  3CMY A;  4M3B A;  3GEU A;  4G12 A;  4M3D A;  1ZR4 A;  1NK2 P;  1MBF A;  2YU9 J;  1MBK A;  2XPV A;  1E3O C;  3A03 A;  3SJM A;  3BG9 A;  5F04 A;  3W6V A;  3E7L A;  3QPL A;  3NNR A;  3HGG A;  9ANT A;  1JUS A;  4X6A J;  1VFC A;  4XRS G;  1QPI A;  2O7T A;  2TCT A;  1RPW A;  5FJ8 J;  1TC3 C;  1B72 B;  2X9D A;  3HE0 A;  2M9H A;  2DMN A;  4IHY A;  1JTX A;  2M34 A;  2ID3 A;  4MIM A;  2VKE A;  4UUS B;  3LSP A;  1ITY A;  3VVX A;  1VND A;  2L7M P;  4FIS A;  1X2M A;  5J1Y A;  2K9N A;  3ON4 A;  2H8R A;  2X48 A;  2RAE A;  2VUM J;  2ME0 A;  3FIW A;  1HDD C;  2JWT A;  4I76 A;  2AHQ A;  5FMP A;  4DZP A;  2PZ9 A;  3M4O J;  3VP5 A;  2XPW A;  5EYR A;  4XRM A;  3M3Y J;  2LTP A;  2W48 A;  3IH4 A;  4XIC A;  1U8B A;  3S1N J;  4UDS A;  3ZQL A;  3QBM A;  1MBJ A;  1TWA J;  2H1K A;  1TWH J;  2QIB A;  2E19 A;  3V6G A;  3QPS A;  3FIS A;  4QTR A;  3CRJ A;  1Q1V A;  2L7Z A;  1LE8 A;  3I4M J;  2R5Z A;  2G7S A;  3A02 A;  5F0F A;  3VW2 A;  4AC6 A;  3LOC A;  4X1E A;  2NX4 A;  2ZCX A;  3GZI A;  3S17 J;  4DZJ A;  1JJ8 C;  1JUP A;  1IJW C;  1IUF A;  1RR7 A;  2XB0 X;  3PO2 J;  1GUU A;  2PBX A;  2FQ4 A;  2W53 A;  1NTC A;  3S2H J;  4MFD A;  3COL A;  1UG2 A;  3KKC A;  2Y9Z A;  1X58 A;  4L5E A;  3D1N I;  1H88 C;  3GTL J;  3O8G A;  4DYC A;  1DU0 A;  1OJL A;  5BNG A;  5FKO A;  2Y30 A;  4A3E J;  4ACI A;  1TWC J;  1RKW A;  1R9T J;  2LLK A;  3B6C A;  2ID6 A;  2R5Y A;  3GTO J;  4ME9 A;  3GTG J;  1U78 A;  3BR2 A;  3T6N A;  2MW8 A;  3TP0 A;  1K83 J;  2DMP A;  1JGG A;  2GUH A;  2UXH A;  2O8K A;  2HDD A;  3LJL A;  1I3Q J;  5IP6 A;  4A3K J;  3ZQH A;  5K58 A;  3G1M A;  5HOD A;  1FTZ A;  3BCG A;  5FKM A;  2KDZ A;  4FCY A;  5HAW A;  1VF9 A;  3GTM J;  5C4X J;  2QWT A;  2UXI A;  4B3A A;  1CQT A;  2ZOY A;  3G1L A;  5EGO A;  4QSH A;  4CYC B;  4DW6 A;  4CGR A;  3LHQ A;  1BW6 A;  1JUM A;  3K2A A;  2E1O A;  4JX5 A;  2G7L A;  1DU6 A;  4AC0 A;  4GCT A;  3MVP A;  3C07 A;  4JL3 A;  5JLW A;  3P9T A;  4FE4 A;  2IBD A;  2MSY A;  2ZCN A;  5J3L A;  3HEF A;  1PUF A;  2NS8 A;  5E3M A;  2GEN A;  2GM4 A;  1OCP A;  2CRG A;  1B8I A;  3WHC A;  3CJD A;  1ETV A;  2XRL A;  3BRU A;  3GBG A;  1HLV A;  5EGO B;  3JRA A;  3GTP J;  3BR0 A;  3TP3 A;  4A3J J;  2DA2 A;  2EQR A;  4MLO A;  5E3L A;  2N8G A;  4BKX A;  4ICH A;  2HOT A;  3HOU J;  3BQZ A;  4GFK A;  3LSJ A;  3BTL A;  5C44 J;  1FTT A;  1FIA A;  2HYJ A;  2ELK A;  2DG7 A;  1JKQ C;  1U9O A;  2TRT A;  1S7E A;  3K7A J;  1W0U A;  5DS9 A;  1HDP A;  1FEX A;  2OI8 A;  3PAS A;  1B8I B;  3OOU A;  5EZG A;  1Z77 A;  3VIB A;  4AUX A;  5E3O A;  2JMW A;  1JT0 A;  1P7J A;  1BJZ A;  5EEA A;  4D7M A;  2NVY J;  1LFU P;  5F08 A;  3ZQG A;  3BQY A;  1ZTR A;  2K40 A;  3AQT A;  2F07 A;  3S5R A;  4S0H B;  4FTH A;  2DA4 A;  1Y1W J;  1AHD P;  1WI3 A;  3VVZ A;  2VI6 A;  3HBL A;  2REK A;  2XGC A;  3VW0 A;  2Q24 A;  3JRB A;  2OER A;  1GVD A;  4C3J J;  5AQC A;  1LFB A;  3A01 B;  2Y2Z A;  3OSG A;  1JKP C;  2JN6 A;  1MH3 A;  3S1M J;  3IUV A;  4IHV A;  4JNN A;  2FX0 A;  3NI7 A;  5EG0 B;  2D6Y A;  1ETO A;  3KKD A;  2HOS A;  2EZH A;  5F0H A;  4M3E A;  2YS9 A;  3NAR A;  2COB A;  4NEL A;  3JRH A;  2DTZ A;  3FK7 A;  4M6V A;  3HOX J;  1POG A;  1ORK A;  2QCO A;  1F43 A;  1SGM A;  1ZR2 A;  2HYT A;  5FHP A;  2KT0 A;  1QRY A;  2ECC A;  3QQA A;  5GPC A;  1GDT A;  2YUS A;  2WAQ N;  4NDL A;  3Q0W A;  4BY1 J;  4A69 C;  4A3G J;  2JA8 J;  3HOY J;  1T56 A;  3WHB A;  2DA5 A;  1WCM J;  2LP0 A;  2GBY A;  5M5X J;  2P81 A;  1ZKG A;  2X6O A;  1GT0 C;  1HCR A;  2EH3 A;  2DJN A;  2CQQ A;  4HKU A;  2WV1 A;  4BXX J;  2RHA A;  1W0T A;  5C4J J;  2NP5 A;  2E2I J;  4JYK A;  4D5F A;  3S14 J;  3S15 J;  3RZD J;  3L1P A;  2PMZ N;  2NP3 A;  1JKO C;  1ZK8 A;  1WH5 A;  5IP7 J;  3S2D J;  3O60 A;  1AU7 A;  2EBI A;  2UXO A;  1BA5 A;  3V78 A;  3Q0U A;  3PM1 A;  3B6A A;  4BY7 J;  3JRE A;  4MXM A;  2GLO A;  3IH2 A;  1A5J A;  4YZE A;  2XGE A;  5M5W J;  1I50 J;  5D19 A;  1OFC X;  1Y1V J;  3JR9 A;  1FJL A;  3BR5 A;  3HM5 A;  2OF7 A;  3BR3 A;  4A3I J;  3G7R A;  4NN1 A;  3HB9 A;  4D5C A;  4CYC A;  2R0Q C;  3KZ9 A;  1D5Y A;  3OIO A;  3LSG A;  3ZQI A;  1G2H A;  2B63 J;  5FKN A;  2XDN A;  2G3B A;  4M3G A;  3JRC A;  1WH7 A;  4JX6 A;  2NOG A;  2HQ5 A;  4BBS J;  5IP9 J;  2CUF A;  4V2G A;  2QF7 A;  4MO7 A;  2NVQ J;  2JA5 J;  2IAI A;  1IRZ A;  1JKR C;  1MBG A;  2DMU A;  2IU5 A;  1QVU A;  3SFI A;  4A3F J;  3BR6 A;  2LK2 A;  3BT9 A;  4IEJ A;  3JRI A;  5K7H A;  2R92 J;  2G7G A;  3HTH A;  2JA7 J;  2AO9 A;  2M8G X;  1X2N A;  3GTK J;  3H0G J;  4Y52 J;  3MNL A;  5JLX A;  3F0C A;  3TW7 A;  4GFB A;  2DG8 A;  3QKX A;  3ANG A;  2I10 A;  1AKH B;  4UUT A;  4MK6 A;  2HXI A;  3LNQ A;  3HOW J;  1ETY A;  3UKG A;  2JK3 A;  1ZGW A;  2MG4 A;  3BG3 A;  4J19 A;  2L7F P;  3RH2 A;  2L9R A;  3MN2 A;  3C2B A;  1JTY A;  5K7F A;  3KNW A;  3RZO J;  3VVY A;  3FK6 A;  2QTQ A;  3CWR A;  1MBE A;  3DEW A;  1IGN A;  3BR1 A;  3HOV J;  5GP9 A;  2M2E A;  2QOP A;  3TED A;  4LOC A;  5IYD J;  3LSR A;  1O4X A;  1WGX A;  1P7I A;  1UI6 A;  5GPA A;  3A01 A;  3BTJ A;  5HSZ A;  3HTI A;  3LWJ A;  4QIW N;  1TWF J;  2LVS A;  5EG0 A;  2LY9 A;  1BL0 A;  4JP0 A;  3VOX A;  4L62 A;  3DPJ A;  3ZQC A;  4DYQ A;  5C4Y A;  2FD5 A;  1HF0 A;  2MGQ A;  3NRG A;  3S16 J;  4A3L J;  5K7Z A;  3G1O A;  3E7Q A;  4C3H J;  2K9S A;  4Y7N J;  3IH3 A;  5IYB J;  1F36 A;  3RQI A;  4DYR A;  1H89 C;  1SAN A;  2ZCM A;  3F1B A;  3HTJ A;  1IDY A;  4I6Z A;  2CJJ A;  2VPR A;  3AQS A;  4AYB N;  5IOZ A;  2K9Q A;  4IHX A;  5H9T A;  4KWA A;  1VI0 A;  2CUE A;  3H3V K;  3BTI A;  3HTA A;  5EZH A;  2R93 J;  2WGB A;  2FJ1 A;  3RD3 A;  2DMT A;  4A3C J;  1ETK A;  2LR8 A;  1OCT C;  4RBO A;  4A93 J;  4AF5 A;  5EF6 A;  2ECB A;  2HOA A;  5J1U A;  5M5Y J;  2E2J J;  1BW5 A;  2HKU A;  4C2M J;  1I6H J;  1MSE C;  1UI5 A;  1IG7 A;  5IPA A;  2O9L A;  4EEF G;  1A6I A;  2E2H J;  5DAJ A;  4JX4 A;  5F1J A;  4B4C A;  4W97 A;  4M3F A;  2QKO A;  4XRS A;  1FIP A;  2RAS A;  1IC8 A;  3ON2 A;  2VKV A;  5J1R A;  5M3F J;  2ZOZ A;  1ETW A;  1ENH A;  5E3N A;  5EDN A;  1H8A C;  4GCK A;  3SDG A;  2DA7 A;  1RES A;  3BTC A;  4ABZ A;  3JRG A;  3VUQ A;  5CW8 A;  2Y0S N;  5M3M J;  3S1R J;  4D7N A;  1MNM C;  2HXO A;  2D5V A;  1SFO J;  2IEK A;  3NXC A;  2FBQ A;  3DCF A;  2Y31 A;  3VPR A;  4B1R A;  1LE8 B;  2R5Z B;  3EUP A;  2NVT J;  2G0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...