3PM1A

Structure of qacr e90q bound to ethidium
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
185
structure length
185
Chain Sequence
LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title A single acidic residue can guide binding site selection but does not govern QacR cationic-drug affinity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 74
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3pm1A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pm1A02
3S15J 3VIBA 3S2DJ 2YUSA 5FKNA 5HAWA 2HYJA 3JREA 4A3JJ 3NPIA 2XGDA 5IP6A 4BY7J 3VVZA 1UHSA 2COBA 5C4XJ 2XPVA 5FGLA 4IEJA 5EYRA 3GTMJ 1E3OC 2OERA 1LFUP 3LWJA 4MO7A 3C2BA 3GTQJ 3BRUA 4FE4A 3BJBA 4BY1J 4L5EA 1NK3P 4B3AA 9ANTA 3ZQGA 3G1MA 3S1QJ 1ZGWA 1ZK8A 2DA2A 4ICHA 1S7EA 4BBRJ 1B8IA 2EZKA 4X6AJ 4NDLA 2NVXJ 2O9LA 1MBEA 3CMYA 1B72B 3MKLA 4C2MJ 3ZOBA 1TC3C 1HOMA 3IV5A 2RASA 5EZHA 3I4MJ 2G7GA 1Z0XA 1EF4A 1WGXA 3B6AA 3FRQA 5F1JA 1Q1VA 2Y31A 2FBQA 2M2EA 3PO2J 3JRAA 2HOSA 1G2HA 3Q0WA 3OSFA 1I3QJ 3HOUJ 3BQYA 4HNVA 3B81A 4DW6A 3CRJA 3BHQA 4JX5A 5JLWA 4GCLA 5E3MA 3NNRA 1VI0A 3KNWA 2ZB9A 3BQZA 2JK3A 2P81A 2KDZA 1CQTA 1YRNB 1MBKA 2FJ1A 4A3KJ 3MNLA 5C4JJ 2O8KA 5H9TA 4MFDA 5K7ZA 3TP0A 3RD3A 2TRTA 1AKHB 4W97A 5GPCA 2VI6A 3ZQLA 3BG9A 2ZOZA 4JX4A 1F43A 1JUSA 2WGBA 3IH4A 4Y52J 3UKGA 4AF5A 1SGMA 4LOCA 4A3BJ 5F04A 2MG4A 4M3EA 5EDNA 3S1MJ 1ETOA 2IAIA 3ON4A 1O4XA 1MBGA 3QKXA 1XC5A 4UUSA 2JA6J 1IC8A 2HKUA 5EFYA 4FCYA 2R93J 3LSRA 3AQTA 3S1NJ 4M6VA 2GUHA 2E1OA 5JLXA 3LHQA 4B1RA 5IPAA 3HTHA 2DMPA 2MW8A 3BR3A 2UXOA 2ZCMA 1F36A 2DMQA 3K2AA 2QCOA 4DZPA 2X6OA 2XRLA 5IYBJ 3ANPA 1GV2A 2LR8A 3IH2A 5EF6A 4I6ZA 5D1RA 1YRNA 3JRHA 3FKIJ 4PXIA 2UXUA 2ZCNA 1GV5A 2W48A 1BL0A 2R92J 2RHAA 5E3NA 1GVDA 4GFBA 1IV6A 4V2FA 2JA7J 2TCTA 3QPSA 1WH5A 3BR5A 3HTJA 4FE7A 4MK6A 1FEXA 1I50J 3JRDA 2FQ4A 2L9RA 1ZKGA 3AQSA 4QSHA 2M8GX 2GM4A 2F07A 2XPWA 4D7MA 3S2HJ 3PO3J 1VFCA 1OFCX 3VPRA 1MBFA 1MBHA 1TWHJ 1H89C 1HF0A 1IGNA 2XGCA 5C3EJ 4M3FA 3BG3A 2REKA 3CQZJ 4XIDA 2LK2A 1MNMC 1FIPA 4XK4A 2G7LA 1JGGA 4YZEA 3VP5A 1GUUA 2YS9A 2XDNA 2ECBA 3DEWA 3GTOJ 2NOGA 2XGEA 1B8IB 3V78A 2EZHA 2PMZN 4A93J 3BR0A 1ETYA 2E19A 2QIBA 1LE8B 2EH3A 2VPRA 2D5VA 5FKLA 1TWGJ 2R0QC 1ETKA 1W0TA 4ABZA 3ZQHA 1ZR4A 3HOYJ 3RZOJ 1WH7A 1UI6A 2IBDA 2KT0A 3GTKJ 2PZ9A 4HKUA 1W0UA 4A3FJ 2B63J 3M4OJ 2WB1N 5J3LA 4A3MJ 2GFNA 2DJNA 2E2HJ 3F1BA 2LTPA 1A5JA 1JJ6C 3IH3A 1WPKA 4D7NA 2XB0X 2RAEA 5E3LA 3WHBA 5CW8A 2ID6A 5D18A 3PM1A 1JKQC 3Q0UA 4FTHA 4D5FA 2LVSA 2DG7A 2Y9YA 1JTYA 2NP5A 4XICA 2DA6A 3COLA 4DYCA 3TW6A 2CQXA 2VKVA 3NAUA 5EEAA 4IHWA 4EEFG 3JSJA 5DS9A 2AHQA 5DAJA 3ZQCA 5F27A 5D19A 3HGYA 2XSDC 3CDLA 1LE8A 1FTTA 5FJ8J 4UUSB 3TW7A 2V57A 5C44J 4B4CA 4M3GA 4DZJA 4QIWN 4S0HB 1JUMA 1RESA 2DA3A 2DA7A 1X58A 1IDZA 2LP0A 3GTGJ 3RQIA 5F0FA 2UXIA 1UG2A 1ENHA 1OCPA 1WI3A 1XG1A 4D5CA 3FK6A 2EBIA 2CUEA 1JT6A 2LD5A 3F0CA 2GENA 4A3GJ 2R7ZJ 3O8HA 1JKRC 5M3MJ 2HXIA 4ME9A 3OIOA 3BTJA 3HBLA 5IP7J 2ID3A 2JN6A 2K40A 1JUPA 3SFIA 1RKWA 1HDDC 3G7RA 3SDGA 2XB5A 4RBOA 4C3IJ 1QVUA 4JKZA 3Q3SA 3BT9A 1APLC 3V6GA 2CRGA 1WCMJ 1U8BA 3NARA 5GP9A 3D1NI 3HKZN 3H3VK 2LKXA 4AYBN 3Q0VA 4MXMA 3GTJJ 2NX4A 1JTXA 2JMWA 5CXIA 3O60A 2Y30A 4UDSA 3QQAA 2QTQA 1HDPA 3G1LA 2Y0SN 1U9NA 5FKMA 4NELA 2R5YB 2ZCXA 2VKEA 3RZDJ 5GPAA 2QKOA 1RR7A 5EGOA 3HE0A 1DU6A 4GCKA 2NS8A 4A3DJ 2IU5A 2OPTA 2ZOYA 2ME6A 3BG5A 4A3CJ 2G3BA 3NXCA 4A3IJ 1JJ8C 3ANGA 4IHVA 2HOAA 4AUXA 1ETXA 1OJLA 4JL3A 2ME0A 2L7FP 3JRCA 3VW1A 1ETVA 1ITYA 4JYKA 3IUVA 2HDDA 5IP9J 5HODA 3FIWA 1P7JA 2DN0A 3GTLJ 4BBSJ 3B6CA 2K9QA 5IOYA 1QPIA 3ON2A 3BR1A 3HIMA 3MN2A 5BNGA 5E3OA 2NVYJ 1GDTA 2H8RA 1X2NA 4I76A 3GEUA 2JJ7A 1ZQ3P 1HLVA 3VOXA 3S17J 4IHYA 4ACIA 4KWAA 5FHPA 1Y1VJ 5HSZA 1T33A 3BTIA 1POGA 3HTAA 2GBYA 4MLOA 4XRMA 5F0HA 2E2IJ 1AU7A 2R5YA 2OI8A 3BNIA 5CXGA 5AQCA 1OCTC 3I4NJ 3HDDA 3BR6A 2DMNA 1K83J 1MSEC 3CCYA 2E2JJ 4NN1A 2HQ5A 2WV1A 3VUQA 1IUFA 4C3HJ 1ZR2A 3KZ9A 1MH3A 3L1PA 1RKTA 4V2GA 3RH2A 3S5RA 3OOUA 3BR2A 4UUTA 2NVTJ 1XS9A 2MGQA 3VVXA 2L0KA 2ELKA 2EZIA 2HI3A 2HYTA 5FKOA 3JRGA 3JR9A 5EZGA 2DA5A 2HOTA 1IDYA 4L62A 4A3EJ 5DTDA 3PPBA 3JRIA 2MSYA 2PBXA 1FJLA 1MH4A 2L7ZA 1UI5A 2QWTA 3DPJA 1H8AC 2WUIA 4FISA 4M3BA 2EZLA 1NTCA 1A6IA 1T56A 2DTZA 2K9NA 5M5WJ 3HTIA 2NS7A 3HB9A 4XRSG 4RDUA 5J1UA 5FKKA 3TP3A 3SJMA 1MBJA 1TWFJ 3HM5A 4JP0A 5F0CA 4C3JJ 2NVQJ 3FISA 5HBUA 2YVHA 3ZQFA 1BW5A 4GCTA 3HOXJ 3QPLA 5IYCJ 2G0EA 1P7IA 2R5ZA 4CYCA 4QTRA 1AHDP 2O7TA 1R9TJ 2H1KA 2UXHA 3G1OA 2Q24A 3VW2A 3JRBA 3LJLA 4M3DA 1IRZA 2DMUA 4Y7NJ 4IHXA 2CJJA 5J1YA 5FMPA 1IJWC 3O8GA 2M9HA 5J1RA 3A02A 1Y1WJ 2G7SA 4X1EA 3S1RJ 5EGOB 4BXXJ 3S16J 2DA4A 4J19A 4AC0A 1GT0C 5F08A 3S14J 3LSJA 2HXOA 3LOCA 5EG0B 3GBGA 3E7QA 4AC6A 5K58A 2DG8A 2XPUA 1MSFC 5FLVA 2D6YA 3C07A 4GFLA 1FIAA 1U9OA 3P9TA 4MIMA 1DU0A 1ETWA 2L7MP 1JKPC 4A3LJ 3KKCA 2GLOA 2ECCA 3HGGA 3T6NA 4GFKA 3HOZJ 5M3FJ 1HCRA 1K61A 5IYDJ 1BA5A 2WAQN 1VF9A 2LFBA 3LSGA 2AO9A 3NRGA 3VW0A 3LSPA 3BCGA 3A01B 3EUPA 2Y9ZA 3NI7A 2IEKA 2QF7A 1SFOJ 3BTLA 2CQQA 2CUFA 4A69C 2NP3A 4CGRA 2O7OA 2EQRA 3H0GJ 3TEDA 2VUMJ 3JRFA 1B72A 3PASA 3FK7A 3OSGA 2UXPA 3MVPA 2M0CA 5EG0A 3RKQA 1JT0A 1QVTA 2JA8J 1FTZA 2JA5J 3VVYA 1NK2P 3QBMA 1ETQA 2FD5A 2YU9J 3EGQA 2LY9A 2M34A 5C4YA 4JX6A 4DYQA 3DCFA 1BJZA 1I6HJ 1X2MA 2I10A 2X9DA 4G12A 4W1UA 1SANA 2Y2ZA 4XRSA 4BKXA 2QOPA 1LFBA 2CU7A 2N8GA 3LNQA 2DMTA 1AKHA 3CWRA 3A01A 2FX0A 5FLMJ 2JWTA 1RPWA 3A03A 1PUFB 3KKDA 5K7FA 1H88C 3M3YJ 1IG7A 1Z77A 1D5YA 3G56A 1RETA 1QRYA 4MFEA 3VOKA 2R5ZB 1JKOC 4CYCB 5M5YJ 2OF7A 3BTCA 4DYRA 1ZTRA 4JNNA 3HEFA 2X48A 1UMQA 5M5XJ 3GTPJ 3E7LA 2W53A 1TWCJ 1TWAJ 3HOWJ 3HOVJ 3CJDA 2LLKA 2YVEA 2DA1A 3K7AJ 3ZQIA 1ORKA 2K9SA 1U78A 1BW6A 5K7HA 3GZIA 3W6VA 1PUFA 3WHCA 1VNDA 5IOZA
chains in the Genus database with same CATH superfamily
2BY1A 2E5NA 3S15J 1B59A 2P8TA 3VIBA 1NG7A 4RAGA 2HYJA 4M72A 2ZBKA 3K8PC 3TL4X 1U5TA 4BY7J 3OS0A 4O3MA 5FGLA 2Y69H 4F7ZA 1BOAA 2O3FA 1X1AA 3SZTA 4PZJA 2WWYA 3K1NA 4YEJA 1V5GA 4MO7A 3LWJA 2L4MA 3K10A 4FE4A 2GXGA 1TNSA 1A6QA 1NK3P 1FMWA 4BY1J 1ZGWA 1GHCA 3WGIA 4ICHA 1BI2A 1K79A 3MAJA 4RGSA 4L9NA 2D1HA 3P5JA 4M9XA 2EFPA 2E35A 3OOPA 5DD8A 4HLXA 1UG0A 2OCEA 3I4MJ 2K5CA 2WAEA 3E5UA 3RTRA 2PFVA 4DJAA 3ZMVA 5F1JA 3EETA 4NBQA 2BVLA 3PO2J 2GWRA 3K4LA 1SMYF 3HOUJ 3AAFA 3BQYA 3BPXA 4NC6A 3CRJA 3BHQA 4YIRX 4BU2A 3NNRA 4L5JA 1VI0A 3KNWA 2R7FA 3BQZA 3ZN0A 2JK3A 2KZVA 5CLSA 3QYFA 3R61A 3VODA 3T5XA 4ZZLA 3BCBA 2NNNA 5H9TA 2O8KA 3RD3A 2TRTA 4E7IA 2WTEA 3B73A 2VI6A 4W97A 4GDFA 2AQFA 2PEXA 1F43A 1J75A 4E7JA 3M8EA 3UKGA 3ZN1A 4Y52J 4A3BJ 1DPUA 2QGUA 1SGMA 2ELJA 2VJ5A 2BBYA 3VYSB 5LHGA 4JOMA 3G6EI 5LGTA 2BXYA 4UUSA 2JA6J 1IC8A 3V4GA 1WZ2A 3T8RA 1Z7LA 3VFZA 1OISA 3K4JA 4FCYA 2R93J 2VXDA 3WGHA 3S1NJ 1YO5C 5IPAA 2ZJRF 2COMA 1I27A 2XKPA 3RKXA 3BR3A 5CVVA 1RIOH 3FBNB 1F36A 3QYBA 3ZQQA 5L3EA 4AIDA 1I39A 2QCOA 2KJCA 1GV2A 2GQQA 2LR8A 3IH2A 4ZH4F 5EF6A 3OYMA 2RC4A 1EV7A 3ZQ7A 3HRMA 2RHAA 2MLKA 2STWA 1IV6A 1Y6IA 1XSVA 3H5AA 2VOOA 2DFFA 2TCTA 2JUGA 4UB6C 2HR3A 4RM3A 3MD2A 1GLNA 4MK6A 3BJAA 1FEXA 2L9RA 1ZKGA 2M4GA 3KLNA 5CKTA 3LQQA 2DI3A 1DUXC 2GM4A 2F07A 3B02A 4EJWA 4EJTA 2XPWA 3W2VA 3BG6A 3RKYA 1WJAA 3VPRA 1TWHJ 3QP5A 2F4OB 4H4KC 4LD5A 3BG3A 1FT9A 1FWZA 1YX5A 1FIPA 4E7KA 2VN2A 1QO0D 4YZEA 2YS9A 2E1NA 3IAS2 3ERMA 6PAXA 2EA4A 3V78A 2V6CA 2V4JC 4A93J 3GCMA 2E19A 3IL2A 1O3SA 3I56I 3PIPF 3CESA 2EH3A 2VPRA 4ASNA 4B44A 2D5VA 3T8TA 2VE8A 4ZJZA 1ETKA 1W0TA 3ZQHA 2CGPA 1VQ6I 4HAMA 4CYDA 1WH7A 4CO8A 3SEZA 2PZ9A 2DXIA 1ZG1A 1W0UA 2B63J 3FF5A 2WB1N 4I02A 5DCFA 3WG7H 3LA2A 2KDOA 3IH3A 3R0JA 3NQOA 3N4MA 5DCMA 4HDUA 4BEHA 5CW8A 2V26A 4YFNF 2KP6A 1OCRH 1O7LA 1W5CC 2DG7A 3D0SA 2Y9YA 2ZKZA 2FJI1 1XMXA 1F1ZA 2VKVA 3GF2A 1F5TA 3ZQCA 1K6OA 4F91B 1WHUA 2OV7A 3ELKA 2XSDC 5FJ8J 4DZJA 2X6XA 3J81K 1S3JA 3KIOA 4F93B 3L2CA 3PIOF 3DU6A 2DA3A 3IAM2 2DA7A 2Q2EB 2X85A 1J9IA 4WXDA 1IDZA 3ERED 1KU9A 4MGRA 2LP0A 5DYMA 1E0EA 3C1DA 3RQIA 4JBAA 4XR6A 1MMAA 2NVUB 2NRAC 4BHCA 3OYAA 3K69A 2GENA 2FBKA 5F6FA 1QU3A 2R7ZJ 1JKRC 5M3MJ 3BTJA 4HPQA 3SFIA 1SVLA 3IP4B 2ZC2A 1IXSB 4HQEA 4HLYA 2P7CB 3Q3SA 3BT9A 1APLC 3V6GA 1XDUA 2K3FA 2CRGA 4HX7A 5GP9A 4L0YB 2VOPA 1YYVA 3GMEA 4M71A 1S7AA 2H8WA 2G9WA 3E5XA 3Q0VA 1LPQA 1JTXA 3V7CA 4U9NA 2QM3A 2WY8Q 2CO5A 1Z67A 2M4KA 5E1XA 5ICFA 1HDPA 4C2UA 4BAYA 1UZCA 1V5EA 5FKMA 2XRNA 1U6GA 1IN7A 2D2WA 3M3YJ 5J40A 3O6BB 3IRRA 4U87A 2NS8A 2OPTA 2YVXA 3NXCA 2L9VA 3SDBA 1OJLA 3DPTA 2UXNA 2L7FP 1A04A 1ETVA 2E1MC 2IA0A 3IUVA 4U9LA 5IP9J 2XUBA 3BY6A 4IL6C 4IVNA 3SHFA 5KK1A 3L7WA 1FMVA 4KFCA 2K9QA 4DNCA 5FD6A 3HIMA 3MN2A 1BC8C 5BNGA 3AL0C 2IP2A 1Y0UA 5DV5A 3GEUA 1TBXA 2DPUA 4OIPF 5LRRA 1G3TA 1SFXA 1YIJI 2MLGA 2VPLA 3BZKA 4N9IA 2IS4A 1XCVA 5J6XA 3ZR8X 2Z3YA 5F0HA 2E2IJ 2F5DA 2QQ8A 1HSTA 1D0ZA 2P5LC 1L3LA 3JW4A 5D6EA 1MJAA 1IAWA 2QBYB 3I4NJ 2DMNA 4G7ZF 3WTSC 1K83J 3F8BA 1MSEC 2PJRA 1W1WE 3KFWX 4IF4A 4M74A 1J0RA 2HQ5A 3GEZA 2HVRA 1IUFA 1D5VA 1MH3A 3L1PA 1ZLKA 3OS1A 3NRVA 2BW3B 3OIPA 4E6KG 3TDZC 1H0MA 1XS9A 1JHHA 2MGQA 2L0KA 4Y13A 2ELKA 2HYTA 3N97A 2CUJA 3JRGA 3JR9A 2QSHX 1JGSA 2NYXA 4A3EJ 3PPBA 3ZMSA 2P5KA 3JRIA 2PBXA 3DPJA 1KQ8A 4G94A 3GLLA 1PYVA 4NQWA 2RV8A 1WI9A 2WUIA 4M3BA 5E8IA 4BACA 3CJTB 1XGMA 2K9NA 5M5WJ 4RM2A 4OOIA 4KUMA 1QQIA 5J1UA 2ISZA 2Z99A 3SJMA 3DBHB 4JP0A 3WTYC 3GLXA 4U0WA 1BR2A 3I55I 4RAFA 4GCTA 2L01A 4D9JA 1DQUA 3JCUC 4U7DA 3W2WA 5LGUA 1OLTA 3F72A 4EGYA 2B3WA 1FOWA 4CYCA 5HVQC 4QTRA 4OAYA 1SAXA 1VQPI 1VQ4I 3QPHA 2HS5A 3JRBA 3W6KB 4ENNA 4Y7NJ 4IHXA 3KP6A 3A02A 1T98A 5B1BH 2RQPA 2IRFG 3S1RJ 1P9QC 2LOOA 5LRSA 1LDJA 2XROA 2Z2SB 2DA4A 4ZYEA 3FWEA 2BZTA 3BOQA 2E1MB 2QVOA 2ZJQF 2IJLA 3LOCA 5K58A 2XPUA 4BL0B 2D6YA 3C07A 5TRDA 4ESJA 1U9OA 3FX3A 2ZY9A 4MIMA 5ICGA 3DEEA 3AL0B 1ETWA 1I1GA 2M87A 2L7MP 3MCZA 1GVJA 2LYCA 4A3LJ 4JQFA 2ECCA 1Q1HA 5M3FJ 4AIJA 1ZLJA 3REOA 5IYDJ 4IOAF 3EPZA 2R7XA 2WAQN 2Q0OA 2M1BA 2IPQX 3RKWA 1B4AA 2B1EA 2QLZA 1HW5A 2QF7A 5D8KB 5IY5H 5D5VB 1FYLA 3PJRA 2K85A 4BNCA 1WJBA 2JQ7A 3FK7A 2LY1A 4CCKA 3MVPA 2M0CA 4WK8F 2L54A 4IRIA 1QVTA 2PN6A 2C6YA 1Z6RA 4XLEA 1P4XA 5CQGA 5C4YA 4DIQA 4ZDOA 3CP8A 3DCFA 4RGXA 1BJZA 1Z6TA 1SFEA 2OTLI 1TW3A 2I10A 2K9MA 2X9DA 4OIQF 4W1UA 3PUFA 4KN7X 1HC8A 2QOPA 3H3ZA 1U2WA 1SVMA 1AKHA 2O61A 2FNAA 3H92A 4AWXB 2MABA 4PUSA 1RPWA 1PUFB 3KKDA 4AIHA 1ACIA 2AS5F 2OA4A 5TJJA 5CPRB 1H88C 4KIFA 3TKYA 2XC7A 4LGWA 3QU6A 3QP6A 1S9HA 4IRGA 1FY7A 2R5ZB 5M5YJ 1O7FA 1PJRA 2HYGD 3BZ6A 1MIJA 2HQRA 2OZ6A 4PSXA 3ABLH 3OMYA 2OAZA 3LFKA 5M5XJ 4WCGA 5H2FC 3GTPJ 3E7LA 5GTHC 4OIRF 2W53A 4P96A 2GIZA 1FPQA 2HOEA 1PDNC 1IRXA 3DU5A 2LLKA 2M30A 2DA1A 2W24A 1JI8A 4P1WA 3K7AJ 4UY8I 3BJOA 2XVCA 1ORKA 2LRDA 2EIMH 2K9SA 4LK0F 2A5WA 1W7PA 2VC1A 1U78A 3BLYA 4HV6A 5HNFA 3RI4A 1PUFA 3WHCA 3T0YA 5IOZA 2OERA 4L0ZB 1XTAA 5FKNA 2QZ8A 5F64A 4L9VA 1J2XA 5IP6A 3VVZA 3OWTA 2XPVA 5E20A 1T6SA 4IEJA 3GTMJ 2L5QA 3ONQA 1R00A 1E3OC 4MHGA 2XSJC 3QODA 3BRUA 4UVBA 4KIBA 4YG2F 3J7ZI 3BJBA 3FMSA 1Z7UA 4FX4A 2OUMA 4BUPA 2DA2A 4M6XA 5DUIA 3JSPA 1S7EA 3VYUB 3HHHA 1B8IA 1J7KA 1AOYA 4GO1A 4X6AJ 2NVXJ 1BI3A 4HF0A 2Y75A 3MKLA 3ZOBA 4IPAA 3UR3C 3TMOA 2R7WA 1WJEA 1TC3C 5EZHA 1IRFA 1GXQA 2G7GA 1Z0XA 1T8IA 1ERDA 3F8MA 3K4KA 3OYNA 2F5FA 4LLNA 2F4MB 3HYIA 3S3OA 2CG4A 2O0YA 1G2HA 1I3QJ 3GZNB 2FOKA 4HNVA 1UHWA 2V6EA 3B81A 1DPRA 2W82A 4DW6A 4JX5A 1ON2A 4GCLA 4Y3OA 4UVAA 4I7HA 2ZB9A 2FXAA 3I9V2 3CDHA 1YRNB 2P81A 3VSLA 3TQNA 4BS9A 2WV0A 3K1MA 4MFDA 1QHGA 2ZMEB 5K7ZA 5J8FA 5GPCA 3BG9A 4G7HF 4XMYA 1EH8A 2A05A 2WGBA 3BZCA 4XBFA 2MG4A 1ON1A 1O3RA 3LAPA 3R0AA 2IAIA 1LDKB 1MBGA 1HW2A 3H9JA 2HKUA 3WU0A 1RC9A 1Y0NA 2STTA 3M7GA 4E7SA 3ABMH 1LNWA 3KEQA 1X19A 1H9GA 2GUHA 1JE8A 5HLHA 2VQGA 2DMPA 2AXTC 2MW8A 2GAUA 1R5GA 2DMQA 2M8EA 3DLLF 4DBRA 4CH7A 4I6ZA 2CW7A 1RRJA 1MMDA 4OD4A 1YRNA 3JRHA 4R8HA 5TGTA 1X1BA 4YFKF 1BL0A 5D5XB 2XF5A 2R92J 2FUG2 2GIVA 3HUGB 3CTAA 2EPFA 3I53A 3DKYA 3DTKA 1S7OA 3TO9A 2FQ4A 1O3QA 3AQSA 3DTEA 1VQLI 1W5TA 4QSHA 2M8GX 3HG9A 3VEPA 1P4WA 4RS8A 3GO5A 1MBFA 2G7UA 2HTSA 2MC4A 5C3EJ 2REKA 4F3QA 2P6SA 1JGGA 3MEXA 2HVQA 3J7AO 3H1CA 3DEWA 2XGEA 4S04A 1WRJA 3BR0A 3QU3A 1IUYA 3FDYA 3OYJA 3GX4X 2PMHA 1SAUA 4LG0B 4IOCF 4XM3A 3EQLF 4K2EA 1BIBA 1TWGJ 4DBQA 4HNTA 2WC2A 2ZNZA 4ABZA 1ZR4A 1ODDA 2K27A 3LA7A 2LSOA 3RZOJ 1Z1DA 1FBQA 3OYDA 3E6DA 4XLNF 3RPUA 1UI6A 3SEQA 2V79A 1DDNA 2HKXA 1S29A 2KIMA 2FBIA 4RLQA 4ZDPA 2CW0F 2E2HJ 4R1HA 1BI1A 2X6WA 4TV7A 2EV5A 3FKJA 4CDGA 2V1NA 2J5OA 2ID6A 2VBXA 4U0YA 1DGRM 3IUOA 4N4NB 3E6MA 3D5SC 5L3FA 1MMGA 2BY0A 1IN5A 3G71I 4M6YA 1JTYA 3BWGA 4XICA 2DA6A 5IT3A 3V42A 2ZFUA 1U0JA 5EEAA 3RYPA 1I3AA 3PNYA 4EEFG 5ICCA 5EEHA 1ZH5A 3JSJA 5F27A 2ZSIB 1HXDA 1SMTA 2FBHA 3MQ0A 3FMQA 3BDDA 3HGYA 3OL3A 1OPCA 3M1CA 3P9IA 4LG0A 1R49A 4UUSB 1FTTA 3DEUA 5C44J 2Z5UA 3MZHA 4UB8C 1JUMA 1KQ0A 2JZYA 2BHYA 2MH9A 3CJNA 4KICA 3GTGJ 4OAZA 5F0FA 2CS3A 3EYYA 4XSZF 2WY7Q 1BC7C 1WI3A 1XG1A 1J5YA 2EBIA 2CUEA 4RAZA 2LD5A 1KU7A 2JTVA 3L09A 5B3SH 3O8HA 2NNYA 4I2OA 2HXIA 3OIOA 2PMZA 1B9NA 3CJRB 1YS6A 2ID3A 2R7OA 2JN6A 4XSXF 4LB6B 1RKWA 4HBLA 1T0FC 5HLGA 4RMNA 4RBOA 2VBZA 1QVUA 1ZG3A 2PQ8A 3GW2A 4MTDA 2BGCA 2H6BA 1FBSA 3CCQI 1WCMJ 1V54H 5JHUA 3CCEI 5KCMA 3H3VK 3LL7A 5K5QA 5FGMA 2PX9A 3UNGC 3CO6C 4IJAA 3GTJJ 1SD5A 2EINH 2A61A 4KMFA 4B8XA 2B0LA 2JRMA 2G7HA 4IKFA 4KNYA 4UDSA 3QQAA 3K4BA 1UELB 1U9NA 5EJCA 1XGOA 3OYEA 3H9GA 2VJJA 3RZDJ 5CVRA 5CVJA 1RR7A 5EGOA 2F5EA 3JAMK 4GCKA 1VQ9I 1YW8A 4BQNA 2EWNA 1V3FA 2LREA 2IU5A 3DP7A 3KP7A 4XN3A 2ME6A 2HEOA 2ZOYA 4ZZDA 2L7KA 4A3CJ 5CQEA 3KLOA 2IT0A 3ANGA 4RA2A 2FMLA 1QPMA 2NXNB 2UV1A 2ME0A 3V7SA 4Y33A 3JRCA 3F9KA 1E3PA 1ITYA 3VW1A 4JYKA 3CC4I 1D1AA 5B5EC 2FU4A 3FIWA 1P7JA 3GTLJ 1Z3XA 3DQVC 2TDXA 3B6CA 2IA2A 4UV8A 5IOYA 3ON2A 4A0ZA 1IZ1A 3S3NA 2DCEA 3ZPLA 2NVYJ 1D0YA 2Z1DA 2ZXHA 1F4KA 4ZC3A 2H8RA 4WIBA 5DCMB 4A0YA 4BEHB 3RQ4A 2I8DA 3S17J 1XGSA 4KWAA 2E7WA 3IWFA 2KLOA 4EVIA 4XKCA 2A68F 2QQ9A 1U8RA 3BJ6A 1SD4A 4RGUA 1PVEA 3BNIA 3HDDA 3BR6A 2ZO4A 4CCLA 2QSGX 2QQAA 3V8KA 1HKSA 1EKEA 4BXUA 3CCYA 3F8CA 2VKHA 3LFUA 2E2JJ 1IV8A 5L3BA 3ZXSA 4XKVA 4AYBA 3KZ9A 3IC7A 1K4TA 2O6GE 1RKTA 1WFXA 2B9SA 1RI7A 3WE3A 4BYYA 5J4VA 2IW5A 2Y0SA 3FM5A 5EZGA 4L62A 5E8GA 2MC3A 2L4AA 2ZSHB 5DTDA 2BY2A 1FOXA 1TT5B 2PMUA 4BHPA 1UI5A 3MKYB 2QWTA 2DFIA 1H8AC 5LGNA 2MBFA 3CUQC 2JRTA 2EZLA 3E5QA 1UCRA 3H3UA 5EEGA 3HTIA 2NS7A 2Y0MA 2X6YA 4JK1X 3CMMA 4P9FA 3TP3A 1CGPA 4HOBA 3S32A 3HM5A 2X1CA 2YVHA 3FISA 2EFWA 3KEYA 4ITVA 3FM3A 3ZQFA 4QWQA 4Y15A 5ICEA 2HZTA 1BW5A 1QZYA 3CCUI 4R79A 5LEKA 2ESNA 4UVCA 4RB3C 1Y8RB 3F21A 1FP2A 1X4OA 4GYGA 2Q8KA 3ECOA 2H1KA 3RYRA 3HL2A 2H27A 4M3DA 2WADA 3S2WA 1X4PA 5GAGJ 5DUKA 5J1RA 4ENJA 4G6DA 2G7SA 1UAAA 3E1SA 3F6OA 5JFRA 4BXXJ 1T0FA 4GGGA 4FASD 3CO7C 5ERIA 3LSJA 2HXOA 3E7QA 4E7LA 4HF2A 1D8KA 5FLVA 4B47A 4GFLA 4IRVA 1FIAA 1T08B 2WAFA 1WVRA 2L3DA 2VT2A 1MMSA 1FZPB 1J59A 4HSTA 1DU0A 2W00A 4IRHA 4L18B 1ONVA 2OZUA 4KT6A 2XGXA 4EM0B 2R7RA 4NC8A 5LLQA 1FOKA 1TT0A 4GFKA 2QA4I 4ESFA 1UHMA 5GADJ 4U88A 3DKXA 5GAHJ 4PDKA 1VF9A 3LSGA 4DQ2A 1SC7A 2VONA 2L02A 4B48A 1SFUA 4PGGA 3EUPA 2Y9ZA 3U9GA 1XGNA 1SFOJ 1HQCA 3BTLA 1OCCH 2CUFA 4FETA 1VQ8I 3QOPA 2PJRB 3M8JA 2VB6A 4XLHA 2NP3A 4CGRA 2VE9A 5AIPA 1B72A 3PASA 3FXLA 2UXPA 3ML6A 1XMKA 2QSFX 3M9AA 1JT0A 4FT8A 3I4PA 1FTZA 3EDPA 2CFOA 2JA5J 1IN4A 4KJZA 3CCLI 2CSOA 4NC7A 1BI0A 3JAMZ 4DYQA 5FRMA 1FC3A 2Z33A 2M5WA 4G12A 3K4MA 3FXOA 1WJDA 4BXFA 4NQWB 1UB9A 3HSFA 4BKXA 4XRSA 3DXJF 2CU7A 3BP8A 4FX0A 2Q1ZB 3LNQA 2DMTA 4G6QA 3CWRA 3OYIA 3K1PA 1E17A 5J4YA 1YHQI 2L2OA 2JWTA 3AFHA 1XB4A 3HRSA 4G8XA 1IXCA 2KZGA 4D0PA 3OL4A 2K4JA 3OV8A 4HV5A 1VQNI 4NB5A 5L3DA 5DDGA 4M9ZA 5HS8A 1D5YA 1IG7A 4OIOF 1RETA 1LKXA 5JI6A 2YR2A 3VOKA 3WTTC 2KQRA 4XL9A 1JKOC 2KRHA 4CYCB 1KONA 4PSWA 4EJUA 1HKQA 1KU3A 1O3TA 4KYWA 2QQBA 2YU3A 3TOBA 3HEFA 3AG4H 4CCOA 3FZVA 1Z91A 3WGGA 5BMZA 3KCCA 3I5UA 4MEXF 3HOWJ 3CUQA 3CJDA 4QPQA 4LG3A 3W3CA 3QRFF 3W2AA 3ZGKA 3QAHA 2LBFA 2MD0A 1ZHFA 4LLLA 3LSIA 3FMRA 3QWLA 2CV1A 1K6YA 2CQ7A 3GZ6A 2DT7B 1Y39A 2VODA 5K7HA 3V8JA 1U3EM 3GZIA 1H9TA 4NUBA 4ZTJA 4ZDLA 1TZLA 1R6RA 5FFZA 1R22A 2PG4A 4HEA2 3JREA 4A3JJ 2R7TA 2XGDA 5ED4A 5KNLA 2COBA 5H6QA 4KN4X 5C4XJ 4Y17A 3I59B 5EYRA 4BH9A 3EUAA 3V7RA 1DP7P 3E3VA 4ANJA 2FOWA 3DBRB 2XAUA 3Q9SA 3C2BA 3GTQJ 3IRQA 2RDPA 2QEXI 3KP5A 3F22A 2A2FX 2RREA 4L5EA 4B3AA 1EH7A 3HPGA 3ZQGA 3F6VA 1BJAA 4BBRJ 3E6CC 2EZKA 3DKWA 2YX4A 2PI0A 4NDLA 2VC0A 4A0XA 3J81Z 2RNGA 1MBEA 3CMYA 1R36A 2DO7A 1HOMA 4C2MJ 2IXSA 5DD4A 1K78B 4BQAA 1EF4A 3B6AA 2VXZA 4YELA 1W36C 3ZMZA 3OR2C 1Q1VA 2Y31A 3L2RA 2FBQA 1IN6A 5E1WA 4E4HA 4UHTA 3K70C 3OSFA 3VTIA 1Y8QB 5JLWA 5E3MA 4WF2A 2MYSA 3HZJA 2KDZA 2OC6A 3LSHA 3I59A 1CQTA 3NWTA 2F4IA 1MBKA 2BY3A 2RGVA 3A4CA 3MNLA 5C4JJ 2H1LA 1AKHB 2ZOZA 1XCBA 2RVCA 2EFQA 1JHFA 2DDBA 1HSJA 3HIFA 4AF5A 2LMDA 5AONA 5LHIA 1RNLA 1VQMI 4M3EA 2A6EF 5EDNA 1S5LC 3V8LA 3AKZA 3LAJA 2DT6A 3Q9VA 1ETOA 4S05A 4LIVA 1BOBA 1G3SA 1XC5A 1Z3YA 4HSRA 4CCMA 1UJ8A 5ILVA 1F9NA 1K78A 1LB2A 2ZJPF 3CCMI 1NG6A 1PP7U 4M6VA 1V4RA 2E1OA 5DEQA 4B1RA 4LK1F 1R1UA 3HTHA 1YS7A 1PUEE 2M7BA 2EJRA 2UXOA 3K2AA 1QA6A 2A6HF 2DOAA 2A6TA 4DZPA 2X6OA 3VYRB 2XRLA 5D1RA 1VZ0A 4PJJA 3J7AY 3GYHX 2EA2A 3MZYA 2UXUA 2E5ZA 3G3ZA 1GV5A 2W48A 4HX4A 5E3NA 1W7PB 4HDVA 4V2FA 4P55A 2JA7J 2XAQA 3QPSA 1N25A 2XV4S 4U0VA 1XMAA 3CMEI 1WH5A 1YI2I 4FE7A 3CLOA 3LSKA 1R71A 1GXPA 3I64A 2ACJA 3I58A 1ZREA 1PP8F 2KJBA 5D6FA 4D7MA 3P7NA 3VB2A 2KRCA 3WTZA 5H20A 5E1ZB 3QPTA 2P6TA 4YFXF 1HF0A 1IGNA 4M3FA 3VSKA 5KAFC 3CQZJ 1MNMC 2LK2A 3J7YJ 4XK4A 2EFNA 2G7LA 2ICWG 3MKZA 4UV9A 3HSRA 2XDNA 2ECBA 1B8IB 1DGWY 2PMZN 4E7ZA 1RUNA 3M8FA 1Z05A 5FKLA 2R0QC 1STZA 2PJPA 2HQAA 3CDIA 4G9YA 2HVSA 1DP3A 1L0OC 1E3HA 4E7HA 2IBDA 2KT0A 3DFGA 3GTKJ 1FSHA 3CCRI 4F52A 3OYHA 4A3FJ 3S3MA 4OINF 3M4OJ 3I71A 5J3LA 2OJED 5JR3A 4A3MJ 2OQRA 1Z21A 3TO6A 5FFXA 2LTPA 1A5JA 5GTIC 4O6JA 2RN7A 1WPKA 4D7NA 4V19K 2XB0X 2RAEA 5E3LA 1IXRC 3TO7A 3PM1A 2PLYA 3Q0UA 1KYWA 3FBIB 1D3YA 5BPIA 4GCVA 2LVSA 3CC7I 2E7XA 1NHAA 2CQXA 4C30A 5CVUA 5DS9A 4DOZA 2X4HA 1TP4A 3CDLA 1FBUA 1D1BA 3TW7A 2V57A 1I5ZA 1ZRCA 2LKPA 5FD5A 3CMAI 4CZCA 4MTEA 3IKVA 3U2RA 4GYIA 3CD6I 3R60A 3TGNA 3OIQA 1G59A 2EV6A 4D5CA 1FYKA 2MD5A 3FK6A 4XLPF 2FSWA 5E18F 4CGZA 2V9PA 1XPXA 3EUHA 4HA8A 2ETHA 4A3GJ 4ME9A 2X1EA 2HGCA 1KYZA 2IGNA 1P6RA 3SZGA 2K40A 1JUPA 2F48A 3PSIA 3G7RA 1KU2A 1OCZH 4ZYGA 1LQ1A 3U1KA 4C3IJ 3OS2A 1X3ZB 4PFOA 1I6XA 4E70A 4XOPA 1YJNI 2EFOA 4MEYF 1W7PD 4DGWB 3D1NI 1MGTA 3WODF 4DVYP 1USTA 1QBJA 4AYBN 2E60A 2KL4A 1G4DA 4MXMA 2NX4A 4L5IA 3C18A 2JMWA 3M07A 1K4SA 1G3WA 4FHTA 1ZELA 4HYEA 2O8XA 5BQTA 2QTQA 3ABTA 3NS4A 2Y0SN 5F1RA 4NELA 2YPRA 2R5YB 2CQNA 4IX7A 2VKEA 3CZ6A 3WU1B 4IQ4A 1XD7A 4PGHA 2EIKH 2ZXJA 3BG5A 1AWCA 1EA3A 2G3BA 4WX9A 4A3IJ 4AVPA 4WXHA 1JJ8C 1WQ2A 3DPLC 2HOAA 2X51A 1ETXA 1MDMA 2QUFA 4JL3A 1YQAA 4Z2YA 5HODA 2DFHA 2M0MA 4F92B 4BBSJ 1FSEA 3VOEA 1LEBA 2JSCA 2OBPA 3FXUA 2MA3A 1IF1A 4I76A 2JJ7A 3VOXA 1HLVA 2EV0A 2R7SA 3CCJI 5D5WB 4IHYA 4ACIA 4ZYDA 5FHPA 1Y1VJ 5HSZA 1FNNA 3LWFA 4MLOA 1AU7A 2K9LA 2R5YA 1ZARA 4NNJA 1ZG5A 2OI8A 5CXGA 3AG2H 5HS9A 4XKBA 3IHUA 4HZFA 3OY9A 4I98B 1LEAA 4RB1A 5BS6A 1LJ9A 2WV1A 1ZR2A 3KZIC 3L2WA 3RH2A 3OOUA 3W6JB 3BR2A 2W1OA 3ZMTA 3D5RC 2VKDA 2A69F 2LC2A 2EZIA 2NAZA 1OKRA 5FKOA 5HDKA 2HOTA 2DA5A 1IDYA 5H6RA 3E6BA 1YJ9I 2L7ZA 2KIQA 4GRIA 1R1VA 5JVTA 1BBYA 5HDGA 4XLCA 1WKMA 2GOMA 4L9JA 3CF5F 1NTCA 2LG4A 2XF6A 1R58A 4XLAA 5HLIA 4MQ9F 2VBYA 3HB9A 4XRSG 4RDUA 3WTWC 2MH2A 5FKKA 1TWFJ 2NVQJ 1R4NB 5F0CA 2RNJA 2K86A 4ON0A 4BJ6C 1N77A 2GXBA 5HBUA 3GWZA 1YIOA 3HOXJ 2EK5A 4MQVA 1D1CA 3QPLA 4N0BA 3VDXA 5LEJA 3FXJA 5D4RA 3K2ZA 2VQCA 2ESHA 1AHDP 1R9TJ 1T95A 1CF7A 4PJ0C 3RSNA 4BE0A 2Q24A 3TBIA 5D4SA 3H0DA 3LJLA 1IRZA 2L9NA 3COAC 2DMUA 4HW0A 5J1YA 2CW8A 4HG2A 2ZCWA 2M9HA 3E0JB 3O8GA 3R6SA 4BQOA 1IJWC 4X1EA 4HRIA 3CLQA 4XORA 5EGOB 3HTSB 1G6NA 4Q48A 1LDDA 5ILUA 2DBBA 4B43A 4AC0A 3MKWB 1XX5A 4HQMA 5F08A 3S14J 1X3WB 3GBGA 2KIFA 2IGKA 4LB5A 2VJ4A 5K1YA 2D45A 2OTJI 2WA0A 4KISA 2XKOA 1KQ9A 2DK8A 3MMYB 3BROA 2YSRA 4KA4A 2BVMA 2ZFWA 1RR8C 2CQKA 3PQJA 2GLOA 4N9HA 2EB7A 3HOZJ 2CWEA 2FEZA 3SFZA 3RPUD 1D0XA 1K61A 1X1PA 2KFDA 2VIXA 1HCRA 2AXLA 2Y48A 1YOVB 4J00A 3A0HC 3VW0A 4EATA 1KZHA 3A01B 1SVOA 3NI7A 2IEKA 2F5CA 4CSWA 2RQQA 2CFXA 3A2KA 3C7JA 3KPHA 3FXQA 1MKMA 4XRFA 4EQQA 1R5HA 3ABUA 2EQRA 3H0GJ 2VUMJ 2OU2A 1RUOA 3OSGA 2XHKA 4XNFA 1S72I 2GA2A 2GA1A 1REPC 4RB2C 3RKQA 2JA8J 1FYMA 3C2GA 3VVYA 2MFZA 1NK2P 3RIRA 1LVAA 5KAIC 3J80K 2FD5A 1NH3A 4UNOA 3EGQA 2ISYA 2M34A 4JX6A 2BHZA 4IZZA 2W85A 1A35A 4OWRB 1J09A 1YX3A 2JPCA 4OD5A 2W25A 2XASA 3K0LA 3OYKA 5LD2C 1SANA 2L9SA 5JVGF 1LFBA 1BIAA 1T2KA 3LSMA 5CVIA 3A01A 3HPHA 4C9YA 1MMNA 1X1CA 5FLMJ 3KYDB 4IHSA 4BJTA 1S8NA 4P5OA 4ZYAA 3MWMA 1IO2A 3ZMUA 3G56A 4XKWA 4EJOA 4MFEA 4D1QA 3ZMDA 1VTNC 2OF7A 3BTCA 1BN5A 2HPMA 4DYRA 1ZRFA 3C2HA 4EMSA 1TLHB 4XOTA 5B66C 1TNTA 3HC7A 1YITI 2X48A 2P7VB 5DM6F 1UMQA 2M7AA 3E97A 1XN7A 3DLAA 2DYRH 4BHBA 1WSUA 4IQJA 4I99C 2NS0A 3LQRA 2A3SA 2DAOA 3H5NA 4XQFA 2CUZA 2KRFA 1TWCJ 4XONA 1TWAJ 1LFPA 3HOVJ 3HRTA 2V7FA 1R5ID 3ISPA 3A0BC 4LMYA 1XSDA 3ZQIA 4ESBA 2Z9OA 4PFPA 2XAFA 5CJ9A 1X1DA 1VNDA 2EIJH 2DPDA 4UUVA 3CP2A 2UZKA 3S2DJ 2YUSA 5HAWA 2K3PA 4ZTFA 3OYLA 5JHFA 3NPIA 3P9CA 1TQMA 1UHSA 2DQRA 3HRUA 1LFUP 4H0EA 3QYEA 9ANTA 1HW1A 3G1MA 2IGMA 4G6TB 3S1QJ 2A5YB 1ZK8A 5AIQA 3ULQB 4IO9F 1QGPA 1HBXG 4YRVA 2XAJA 2B7EA 2O9LA 1B72B 3ZCOA 2RASA 4ZYHA 3IV5A 1QZEA 2P5VA 2LNBA 3DF8A 4EV0A 1TQIA 3KZZA 1WGXA 2XAGA 1EJ9A 3PUBA 4AU7A 1TL8A 3FRQA 2DYSH 3WTVC 2M2EA 3JRAA 2ZJ2A 2HOSA 3Q0WA 2FMYA 3FXMA 3EUKL 2W57A 3ABKH 3H5RA 4Z6YA 3HOSA 2IS6A 2H94A 3KE2A 4OMYA 2HTJA 3GUDA 2E36A 3JSOA 4EGZA 1BM9A 4CCNA 2BYVE 2FJ1A 4A3KJ 2J5PA 4U7BA 2M45A 3HTUA 3TP0A 3H36A 1A31A 3Q5FA 3ZQLA 1Y56A 3PNTA 4JX4A 1IRGA 3WE2A 1JUSA 1OYIA 3IH4A 1T39A 3ASNH 3L2QA 4LOCA 2FA5A 5F04A 2XDVA 1YJWI 3S1MJ 2BEOA 1LVKA 3EYIA 3ON4A 2CMPA 2HQNA 1O4XA 1BR1A 3SXYA 3QKXA 4X0GA 1FX7A 1S6LA 4A5MA 5EFYA 1USSA 3A1YA 1QHHD 2DFEA 2IVMA 3LSRA 3AQTA 1WJ5A 3QOEA 2HPIA 5JLXA 3LHQA 2O03A 2Q2EA 2HWVA 4CHUA 5TISC 2ZCMA 4PJLA 3CUQB 1G3YA 2JUCA 1T38A 5FLXK 5IYBJ 3ANPA 1G8XA 2JA2A 3FKIJ 2LBFB 4PXIA 2KHMA 2JSPA 5HDNA 2ZCNA 5ILSA 3J80Z 3AG1H 4II3A 1GVDA 1B1BA 4GFBA 2HFHA 3HOTA 4KIGA 1KGSA 3BR5A 4WXCA 3HTJA 4BE1A 1I50J 3JRDA 2OQGA 2IA1A 3TDUC 2BXZA 3HXLA 2DTRA 2HDCA 1ULYA 2DLLA 4PJMA 2HYFA 1R23A 1B9MA 2V1UA 3S2HJ 5KVRA 3PO3J 1VFCA 1OFCX 1H89C 1MBHA 4QLCU 2XGCA 2QKMB 3RDIA 1V55H 4XIDA 2HNHA 3VP5A 2Z16A 1GUUA 3GTOJ 2NOGA 2AQEA 1V5FA 2EZHA 4YIFA 3F23A 1MNDA 2ZNYA 3X2QH 1ETYA 2BE5F 2QIBA 4AD9A 1LE8B 2K4BA 2W4SA 4RAYA 3PSFA 1TTYA 1ZAOA 3WU2C 4ENMA 2UWMA 5E17F 1R1TA 3HOYJ 1K7AA 1JXSA 3DPUA 4KITB 4HKUA 3D5LA 4M9SA 3M1EA 4M73A 2GFNA 1XSXA 3ESWB 4L9TA 2DJNA 3RJPA 2LF7A 3F1BA 1ZGAA 5D5UB 5A2QK 1JJ6C 5HNHA 1SD6A 4GXOA 1TW2A 5LBQA 2HU9A 3LA3A 3SZPA 3WHBA 5HOOA 5D18A 5GAEJ 1JKQC 4FTHA 4I01A 1P2FA 1HKTA 1XDSA 3I3LA 2P4WA 4D5FA 3GFIA 2NP5A 4UXNA 2QBYA 1FLIA 3COLA 4DYCA 3CUOA 3TW6A 3NAUA 1TQPA 4IHWA 2GOXB 2AHQA 5IT9K 5DAJA 1WJCA 3DWLE 5CYVA 5D19A 4AM3A 1LE8A 4B09A 2JVGA 4Q5SF 4B4CA 4M3GA 4QIWN 3O3KA 3O2PE 4S0HB 2BW3A 2WBMA 1RESA 3CJQB 4RLFA 4LJZF 3VYTB 1X58A 4BDZA 2W84A 3IKTA 1ZGJA 4II2A 1UG2A 3T1BA 2UXIA 1ENHA 1OCPA 2F6CA 3LSTA 1WWXA 3U21A 4BE2A 3TOAA 1JT6A 3F0CA 5J8CA 1HA8A 2CH0A 2OCCH 4OU0A 2UXXA 5IP7J 3HBLA 1OQYA 1HDDC 3ZP5A 3EUHC 2XB5A 3SDGA 4AIKA 2CYYA 5HS7A 3ROUA 4AVZA 4A6EA 2DU9A 2O5RA 4JKZA 3OYFA 2GZWA 2GXAA 3GZ5A 4LLGF 3FXRA 2VBWA 2DOEA 1MD0A 1VQKI 3IWZA 3NARA 1U8BA 4CZZA 3HKZN 2LKXA 4Q47A 2XF7A 2CV2A 3P9KA 2WB1A 4A12A 1OCOH 3K4NA 3RPQA 3BG7A 3BC8A 3HHGA 3SYTA 3L2VA 4IHTA 1I1SA 3O60A 5CXIA 5LFAA 2Y30A 5B1AH 2FNPA 4EM1A 2I5UA 2ZXWH 3G1LA 5LHHA 1VQOI 4C2MA 4CA0A 3GVAA 4A2UA 2IS1A 2ZCXA 2DJIA 5GPAA 2QKOA 3HE0A 1P4AA 2JPBA 1DU6A 2ZXIA 4A3DJ 2KIUA 1WJFA 1O57A 4EM2A 1MJ9A 1YE9A 1IW7F 4B3XA 4IHVA 1E2XA 1OR7C 3KYLA 4AUXA 4C2TA 5FO5A 2HDDA 1SFKA 2QKLB 5D8LB 2DN0A 5FLXZ 5FRNA 2BV6A 2PFBA 3K4CA 5L3GA 2E34A 2VASA 1QPIA 1YG2A 3BR1A 2P0WA 1OYYA 5E3OA 3PFIA 1GDTA 4I0BA 4I09A 1X2NA 3VWBA 1P92A 1B6AA 4IXAA 5BOXA 4KT5C 2R7QA 1ZQ3P 2FE3A 4OMZA 2R3SA 1T33A 3BTIA 1POGA 3HTAA 2GBYA 3MZ8A 4XRMA 1FOYA 2FF4A 1MZBA 4HX8A 5AQCA 2LDUA 3G2BA 4A5NA 2R4GA 4RGRA 1OCTC 2ZMEC 3HJEA 3FXKA 3CC2I 2PBIA 4LIUA 2F5VA 4MNUA 4PJNA 3DTIA 4F55A 5J47A 4NN1A 3OR1C 2DOFA 3VUQA 2E71A 4C3HJ 2ELHA 4V2GA 2V1DA 3S5RA 1AA7A 3MFKA 3F8NA 4UUTA 2LKSA 2VQLA 2NVTJ 3VVXA 2D1VA 3BCAA 2NOJB 5KHDA 1C0WA 2HI3A 3KYCB 2JVHA 3NWSA 3OYGA 4BJ5C 2KISA 1W5SA 1BR4A 3KZYA 3AG3H 2MSYA 3H35A 4RB0A 1MH4A 1EH6A 2VQHA 3GFMA 4EJVA 1FJLA 3KP3A 3I0TA 2H6CA 2VLAA 3OYCA 1MNEA 3BPVA 4FISA 1YLFA 3F8FA 1A6IA 4BDYA 1T56A 2DTZA 3N05A 2QWWA 2M3AA 4YIIA 2VT3A 3HSEA 1YW7A 1ZN2A 3RCOA 2YX7A 1MBJA 2DDAA 4C3JJ 2IGOA 2CV0A 4XN0A 2VL8A 4CUGA 4CXFA 5A2QZ 4NHJA 5IYCJ 2FRHA 5DM7F 2G0EA 2LH9A 1D8JA 1P7IA 2R7VA 4ETSA 3I54A 2R5ZA 2R7UA 5E79C 2O7TA 1R7JA 3PL8A 3L00A 2UXHA 3G1OA 2V9KA 3VW2A 1U5TC 2W7NA 2V9VA 3JTGA 1MJBA 2E1CA 5FMPA 3WTXC 2CJJA 3CCSI 4KDPA 5IT9Z 1Y1WJ 3K9TA 2XAHA 2EILH 3S16J 1N75A 4P9UA 4BGDA 2R7DA 5HLTA 4J19A 3KP4A 3PQKA 2K7LA 3S93A 2A07F 1GT0C 1SD7A 3ECHA 3KEOA 3G73A 5EG0B 4AC6A 1IN8A 1MDMB 2DG8A 4BQQA 1A36A 2K02A 3PNVA 1MSFC 2KKOA 2HDWA 3F3XA 1KA8A 2DT5A 3P9TA 1YTYA 2DK5A 1QNTA 4PK4A 5L3CA 1YW9A 4J01A 3CCVI 1JKPC 3L9FA 4LITA 3KKCA 2DODA 2BOLA 2VJIA 3T6NA 3HGGA 2KMUA 1MW7A 4LFUA 3G4SI 3KP2A 1YFHA 3DV8A 3OYBA 1BA5A 2LFBA 4Y4RA 2AO9A 3NRGA 2UUZA 3LSPA 3NEUA 3BCGA 2RKHA 3KX2A 1X3UA 4QPOA 3FHZA 5FB2A 2CQQA 1UFMA 4KMUX 3L2UA 4A69C 3LMMA 1OR7A 3H9QA 2O7OA 3TEDA 3GXOA 3JRFA 3ZRGA 3ASOH 2DQLA 5EG0A 3JTHA 1OMIA 1SEUA 1VQ5I 2HZDA 1Z9CA 2FQ3A 1W36D 1VQ7I 3QBMA 1ZYRF 1ETQA 2YU9J 2LY9A 1ZRDA 2LY2A 3CF2A 3K70D 3C3WA 4XLFA 2F2EA 5K5OA 1I6HJ 1X2MA 4HNUA 3K6GA 1R4MB 3S8PA 2ADUA 2Y2ZA 4Q4ZF 2N8GA 3FHNA 2ZMEA 2X0LA 4N4OB 3WG9A 5FROA 1FP1D 2FX0A 3A03A 1OYWA 5K7FA 1Z77A 4CICA 1M1EB 1QZZA 4PCQA 2QYOA 2OD5A 1QRYA 3HKZA 2QENA 3WTUC 1U5TB 3GFLA 2LF8A 1LUJB 4ENKA 1ZTRA 3R4KA 3PFYA 1CF7B 4JNNA 4G7OF 4HF1A 4CCJA 2WAQA 2V1XA 2JT1A 1N78A 2DW4A 3SWHA 3SQNA 4O5VA 1W4MA 2HKOA 2X1DA 2YVEA 4A6DA 3DBLB 3KETA 5BPDA 1RZ4A 2KPMA 4WWCA 5K5RA 2H09A 3GFJA 3U1DA 4FQGA 1BW6A 2XIGA 3HUGA 2IS2A 3W6VA 4I0AA
chains in the Genus database with same CATH topology
3S15J 3VIBA 3S2DJ 2YUSA 5FKNA 5HAWA 2HYJA 3JREA 4A3JJ 3NPIA 2XGDA 5IP6A 4BY7J 3VVZA 1UHSA 2COBA 5C4XJ 2XPVA 5FGLA 4IEJA 5EYRA 3GTMJ 1E3OC 2OERA 1LFUP 3LWJA 4MO7A 3C2BA 3GTQJ 3BRUA 4FE4A 3BJBA 4BY1J 4L5EA 1NK3P 4B3AA 9ANTA 3ZQGA 3G1MA 3S1QJ 1ZGWA 1ZK8A 2DA2A 4ICHA 1S7EA 4BBRJ 1B8IA 2EZKA 4X6AJ 4NDLA 2NVXJ 2O9LA 1MBEA 3CMYA 1B72B 3MKLA 4C2MJ 3ZOBA 1TC3C 1HOMA 3IV5A 2RASA 5EZHA 3I4MJ 2G7GA 1Z0XA 1EF4A 1WGXA 3B6AA 3FRQA 5F1JA 1Q1VA 2Y31A 2FBQA 2M2EA 3PO2J 3JRAA 2HOSA 1G2HA 3Q0WA 3OSFA 1I3QJ 3HOUJ 3BQYA 4HNVA 3B81A 4DW6A 3CRJA 3BHQA 4JX5A 5JLWA 4GCLA 5E3MA 3NNRA 1VI0A 3KNWA 2ZB9A 3BQZA 2JK3A 2P81A 2KDZA 1CQTA 1YRNB 1MBKA 2FJ1A 4A3KJ 3MNLA 5C4JJ 2O8KA 5H9TA 4MFDA 5K7ZA 3TP0A 3RD3A 2TRTA 1AKHB 4W97A 5GPCA 2VI6A 3ZQLA 3BG9A 2ZOZA 4JX4A 1F43A 1JUSA 2WGBA 3IH4A 4Y52J 3UKGA 4AF5A 1SGMA 4LOCA 4A3BJ 5F04A 2MG4A 4M3EA 5EDNA 3S1MJ 1ETOA 2IAIA 3ON4A 1O4XA 1MBGA 3QKXA 1XC5A 4UUSA 2JA6J 1IC8A 2HKUA 5EFYA 4FCYA 2R93J 3LSRA 3AQTA 3S1NJ 4M6VA 2GUHA 2E1OA 5JLXA 3LHQA 4B1RA 5IPAA 3HTHA 2DMPA 2MW8A 3BR3A 2UXOA 2ZCMA 1F36A 2DMQA 3K2AA 2QCOA 4DZPA 2X6OA 2XRLA 5IYBJ 3ANPA 1GV2A 2LR8A 3IH2A 5EF6A 4I6ZA 5D1RA 1YRNA 3JRHA 3FKIJ 4PXIA 2UXUA 2ZCNA 1GV5A 2W48A 1BL0A 2R92J 2RHAA 5E3NA 1GVDA 4GFBA 1IV6A 4V2FA 2JA7J 2TCTA 3QPSA 1WH5A 3BR5A 3HTJA 4FE7A 4MK6A 1FEXA 1I50J 3JRDA 2FQ4A 2L9RA 1ZKGA 3AQSA 4QSHA 2M8GX 2GM4A 2F07A 2XPWA 4D7MA 3S2HJ 3PO3J 1VFCA 1OFCX 3VPRA 1MBFA 1MBHA 1TWHJ 1H89C 1HF0A 1IGNA 2XGCA 5C3EJ 4M3FA 3BG3A 2REKA 3CQZJ 4XIDA 2LK2A 1MNMC 1FIPA 4XK4A 2G7LA 1JGGA 4YZEA 3VP5A 1GUUA 2YS9A 2XDNA 2ECBA 3DEWA 3GTOJ 2NOGA 2XGEA 1B8IB 3V78A 2EZHA 2PMZN 4A93J 3BR0A 1ETYA 2E19A 2QIBA 1LE8B 2EH3A 2VPRA 2D5VA 5FKLA 1TWGJ 2R0QC 1ETKA 1W0TA 4ABZA 3ZQHA 1ZR4A 3HOYJ 3RZOJ 1WH7A 1UI6A 2IBDA 2KT0A 3GTKJ 2PZ9A 4HKUA 1W0UA 4A3FJ 2B63J 3M4OJ 2WB1N 5J3LA 4A3MJ 2GFNA 2DJNA 2E2HJ 3F1BA 2LTPA 1A5JA 1JJ6C 3IH3A 1WPKA 4D7NA 2XB0X 2RAEA 5E3LA 3WHBA 5CW8A 2ID6A 5D18A 3PM1A 1JKQC 3Q0UA 4FTHA 4D5FA 2LVSA 2DG7A 2Y9YA 1JTYA 2NP5A 4XICA 2DA6A 3COLA 4DYCA 3TW6A 2CQXA 2VKVA 3NAUA 5EEAA 4IHWA 4EEFG 3JSJA 5DS9A 2AHQA 5DAJA 3ZQCA 5F27A 5D19A 3HGYA 2XSDC 3CDLA 1LE8A 1FTTA 5FJ8J 4UUSB 3TW7A 2V57A 5C44J 4B4CA 4M3GA 4DZJA 4QIWN 4S0HB 1JUMA 1RESA 2DA3A 2DA7A 1X58A 1IDZA 2LP0A 3GTGJ 3RQIA 5F0FA 2UXIA 1UG2A 1ENHA 1OCPA 1WI3A 1XG1A 4D5CA 3FK6A 2EBIA 2CUEA 1JT6A 2LD5A 3F0CA 2GENA 4A3GJ 2R7ZJ 3O8HA 1JKRC 5M3MJ 2HXIA 4ME9A 3OIOA 3BTJA 3HBLA 5IP7J 2ID3A 2JN6A 2K40A 1JUPA 3SFIA 1RKWA 1HDDC 3G7RA 3SDGA 2XB5A 4RBOA 4C3IJ 1QVUA 4JKZA 3Q3SA 3BT9A 1APLC 3V6GA 2CRGA 1WCMJ 1U8BA 3NARA 5GP9A 3D1NI 3HKZN 3H3VK 2LKXA 4AYBN 3Q0VA 4MXMA 3GTJJ 2NX4A 1JTXA 2JMWA 5CXIA 3O60A 2Y30A 4UDSA 3QQAA 2QTQA 1HDPA 3G1LA 2Y0SN 1U9NA 5FKMA 4NELA 2R5YB 2ZCXA 2VKEA 3RZDJ 5GPAA 2QKOA 1RR7A 5EGOA 3HE0A 1DU6A 4GCKA 2NS8A 4A3DJ 2IU5A 2OPTA 2ZOYA 2ME6A 3BG5A 4A3CJ 2G3BA 3NXCA 4A3IJ 1JJ8C 3ANGA 4IHVA 2HOAA 4AUXA 1ETXA 1OJLA 4JL3A 2ME0A 2L7FP 3JRCA 3VW1A 1ETVA 1ITYA 4JYKA 3IUVA 2HDDA 5IP9J 5HODA 3FIWA 1P7JA 2DN0A 3GTLJ 4BBSJ 3B6CA 2K9QA 5IOYA 1QPIA 3ON2A 3BR1A 3HIMA 3MN2A 5BNGA 5E3OA 2NVYJ 1GDTA 2H8RA 1X2NA 4I76A 3GEUA 2JJ7A 1ZQ3P 1HLVA 3VOXA 3S17J 4IHYA 4ACIA 4KWAA 5FHPA 1Y1VJ 5HSZA 1T33A 3BTIA 1POGA 3HTAA 2GBYA 4MLOA 4XRMA 5F0HA 2E2IJ 1AU7A 2R5YA 2OI8A 3BNIA 5CXGA 5AQCA 1OCTC 3I4NJ 3HDDA 3BR6A 2DMNA 1K83J 1MSEC 3CCYA 2E2JJ 4NN1A 2HQ5A 2WV1A 3VUQA 1IUFA 4C3HJ 1ZR2A 3KZ9A 1MH3A 3L1PA 1RKTA 4V2GA 3RH2A 3S5RA 3OOUA 3BR2A 4UUTA 2NVTJ 1XS9A 2MGQA 3VVXA 2L0KA 2ELKA 2EZIA 2HI3A 2HYTA 5FKOA 3JRGA 3JR9A 5EZGA 2DA5A 2HOTA 1IDYA 4L62A 4A3EJ 5DTDA 3PPBA 3JRIA 2MSYA 2PBXA 1FJLA 1MH4A 2L7ZA 1UI5A 2QWTA 3DPJA 1H8AC 2WUIA 4FISA 4M3BA 2EZLA 1NTCA 1A6IA 1T56A 2DTZA 2K9NA 5M5WJ 3HTIA 2NS7A 3HB9A 4XRSG 4RDUA 5J1UA 5FKKA 3TP3A 3SJMA 1MBJA 1TWFJ 3HM5A 4JP0A 5F0CA 4C3JJ 2NVQJ 3FISA 5HBUA 2YVHA 3ZQFA 1BW5A 4GCTA 3HOXJ 3QPLA 5IYCJ 2G0EA 1P7IA 2R5ZA 4CYCA 4QTRA 1AHDP 2O7TA 1R9TJ 2H1KA 2UXHA 3G1OA 2Q24A 3VW2A 3JRBA 3LJLA 4M3DA 1IRZA 2DMUA 4Y7NJ 4IHXA 2CJJA 5J1YA 5FMPA 1IJWC 3O8GA 2M9HA 5J1RA 3A02A 1Y1WJ 2G7SA 4X1EA 3S1RJ 5EGOB 4BXXJ 3S16J 2DA4A 4J19A 4AC0A 1GT0C 5F08A 3S14J 3LSJA 2HXOA 3LOCA 5EG0B 3GBGA 3E7QA 4AC6A 5K58A 2DG8A 2XPUA 1MSFC 5FLVA 2D6YA 3C07A 4GFLA 1FIAA 1U9OA 3P9TA 4MIMA 1DU0A 1ETWA 2L7MP 1JKPC 4A3LJ 3KKCA 2GLOA 2ECCA 3HGGA 3T6NA 4GFKA 3HOZJ 5M3FJ 1HCRA 1K61A 5IYDJ 1BA5A 2WAQN 1VF9A 2LFBA 3LSGA 2AO9A 3NRGA 3VW0A 3LSPA 3BCGA 3A01B 3EUPA 2Y9ZA 3NI7A 2IEKA 2QF7A 1SFOJ 3BTLA 2CQQA 2CUFA 4A69C 2NP3A 4CGRA 2O7OA 2EQRA 3H0GJ 3TEDA 2VUMJ 3JRFA 1B72A 3PASA 3FK7A 3OSGA 2UXPA 3MVPA 2M0CA 5EG0A 3RKQA 1JT0A 1QVTA 2JA8J 1FTZA 2JA5J 3VVYA 1NK2P 3QBMA 1ETQA 2FD5A 2YU9J 3EGQA 2LY9A 2M34A 5C4YA 4JX6A 4DYQA 3DCFA 1BJZA 1I6HJ 1X2MA 2I10A 2X9DA 4G12A 4W1UA 1SANA 2Y2ZA 4XRSA 4BKXA 2QOPA 1LFBA 2CU7A 2N8GA 3LNQA 2DMTA 1AKHA 3CWRA 3A01A 2FX0A 5FLMJ 2JWTA 1RPWA 3A03A 1PUFB 3KKDA 5K7FA 1H88C 3M3YJ 1IG7A 1Z77A 1D5YA 3G56A 1RETA 1QRYA 4MFEA 3VOKA 2R5ZB 1JKOC 4CYCB 5M5YJ 2OF7A 3BTCA 4DYRA 1ZTRA 4JNNA 3HEFA 2X48A 1UMQA 5M5XJ 3GTPJ 3E7LA 2W53A 1TWCJ 1TWAJ 3HOWJ 3HOVJ 3CJDA 2LLKA 2YVEA 2DA1A 3K7AJ 3ZQIA 1ORKA 2K9SA 1U78A 1BW6A 5K7HA 3GZIA 3W6VA 1PUFA 3WHCA 1VNDA 5IOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S15 J;  3VIB A;  3S2D J;  2YUS A;  5FKN A;  5HAW A;  2HYJ A;  3JRE A;  4A3J J;  3NPI A;  2XGD A;  5IP6 A;  4BY7 J;  3VVZ A;  1UHS A;  2COB A;  5C4X J;  2XPV A;  5FGL A;  4IEJ A;  5EYR A;  3GTM J;  1E3O C;  2OER A;  1LFU P;  3LWJ A;  4MO7 A;  3C2B A;  3GTQ J;  3BRU A;  4FE4 A;  3BJB A;  4BY1 J;  4L5E A;  1NK3 P;  4B3A A;  9ANT A;  3ZQG A;  3G1M A;  3S1Q J;  1ZGW A;  1ZK8 A;  2DA2 A;  4ICH A;  1S7E A;  4BBR J;  1B8I A;  2EZK A;  4X6A J;  4NDL A;  2NVX J;  2O9L A;  1MBE A;  3CMY A;  1B72 B;  3MKL A;  4C2M J;  3ZOB A;  1TC3 C;  1HOM A;  3IV5 A;  2RAS A;  5EZH A;  3I4M J;  2G7G A;  1Z0X A;  1EF4 A;  1WGX A;  3B6A A;  3FRQ A;  5F1J A;  1Q1V A;  2Y31 A;  2FBQ A;  2M2E A;  3PO2 J;  3JRA A;  2HOS A;  1G2H A;  3Q0W A;  3OSF A;  1I3Q J;  3HOU J;  3BQY A;  4HNV A;  3B81 A;  4DW6 A;  3CRJ A;  3BHQ A;  4JX5 A;  5JLW A;  4GCL A;  5E3M A;  3NNR A;  1VI0 A;  3KNW A;  2ZB9 A;  3BQZ A;  2JK3 A;  2P81 A;  2KDZ A;  1CQT A;  1YRN B;  1MBK A;  2FJ1 A;  4A3K J;  3MNL A;  5C4J J;  2O8K A;  5H9T A;  4MFD A;  5K7Z A;  3TP0 A;  3RD3 A;  2TRT A;  1AKH B;  4W97 A;  5GPC A;  2VI6 A;  3ZQL A;  3BG9 A;  2ZOZ A;  4JX4 A;  1F43 A;  1JUS A;  2WGB A;  3IH4 A;  4Y52 J;  3UKG A;  4AF5 A;  1SGM A;  4LOC A;  4A3B J;  5F04 A;  2MG4 A;  4M3E A;  5EDN A;  3S1M J;  1ETO A;  2IAI A;  3ON4 A;  1O4X A;  1MBG A;  3QKX A;  1XC5 A;  4UUS A;  2JA6 J;  1IC8 A;  2HKU A;  5EFY A;  4FCY A;  2R93 J;  3LSR A;  3AQT A;  3S1N J;  4M6V A;  2GUH A;  2E1O A;  5JLX A;  3LHQ A;  4B1R A;  5IPA A;  3HTH A;  2DMP A;  2MW8 A;  3BR3 A;  2UXO A;  2ZCM A;  1F36 A;  2DMQ A;  3K2A A;  2QCO A;  4DZP A;  2X6O A;  2XRL A;  5IYB J;  3ANP A;  1GV2 A;  2LR8 A;  3IH2 A;  5EF6 A;  4I6Z A;  5D1R A;  1YRN A;  3JRH A;  3FKI J;  4PXI A;  2UXU A;  2ZCN A;  1GV5 A;  2W48 A;  1BL0 A;  2R92 J;  2RHA A;  5E3N A;  1GVD A;  4GFB A;  1IV6 A;  4V2F A;  2JA7 J;  2TCT A;  3QPS A;  1WH5 A;  3BR5 A;  3HTJ A;  4FE7 A;  4MK6 A;  1FEX A;  1I50 J;  3JRD A;  2FQ4 A;  2L9R A;  1ZKG A;  3AQS A;  4QSH A;  2M8G X;  2GM4 A;  2F07 A;  2XPW A;  4D7M A;  3S2H J;  3PO3 J;  1VFC A;  1OFC X;  3VPR A;  1MBF A;  1MBH A;  1TWH J;  1H89 C;  1HF0 A;  1IGN A;  2XGC A;  5C3E J;  4M3F A;  3BG3 A;  2REK A;  3CQZ J;  4XID A;  2LK2 A;  1MNM C;  1FIP A;  4XK4 A;  2G7L A;  1JGG A;  4YZE A;  3VP5 A;  1GUU A;  2YS9 A;  2XDN A;  2ECB A;  3DEW A;  3GTO J;  2NOG A;  2XGE A;  1B8I B;  3V78 A;  2EZH A;  2PMZ N;  4A93 J;  3BR0 A;  1ETY A;  2E19 A;  2QIB A;  1LE8 B;  2EH3 A;  2VPR A;  2D5V A;  5FKL A;  1TWG J;  2R0Q C;  1ETK A;  1W0T A;  4ABZ A;  3ZQH A;  1ZR4 A;  3HOY J;  3RZO J;  1WH7 A;  1UI6 A;  2IBD A;  2KT0 A;  3GTK J;  2PZ9 A;  4HKU A;  1W0U A;  4A3F J;  2B63 J;  3M4O J;  2WB1 N;  5J3L A;  4A3M J;  2GFN A;  2DJN A;  2E2H J;  3F1B A;  2LTP A;  1A5J A;  1JJ6 C;  3IH3 A;  1WPK A;  4D7N A;  2XB0 X;  2RAE A;  5E3L A;  3WHB A;  5CW8 A;  2ID6 A;  5D18 A;  3PM1 A;  1JKQ C;  3Q0U A;  4FTH A;  4D5F A;  2LVS A;  2DG7 A;  2Y9Y A;  1JTY A;  2NP5 A;  4XIC A;  2DA6 A;  3COL A;  4DYC A;  3TW6 A;  2CQX A;  2VKV A;  3NAU A;  5EEA A;  4IHW A;  4EEF G;  3JSJ A;  5DS9 A;  2AHQ A;  5DAJ A;  3ZQC A;  5F27 A;  5D19 A;  3HGY A;  2XSD C;  3CDL A;  1LE8 A;  1FTT A;  5FJ8 J;  4UUS B;  3TW7 A;  2V57 A;  5C44 J;  4B4C A;  4M3G A;  4DZJ A;  4QIW N;  4S0H B;  1JUM A;  1RES A;  2DA3 A;  2DA7 A;  1X58 A;  1IDZ A;  2LP0 A;  3GTG J;  3RQI A;  5F0F A;  2UXI A;  1UG2 A;  1ENH A;  1OCP A;  1WI3 A;  1XG1 A;  4D5C A;  3FK6 A;  2EBI A;  2CUE A;  1JT6 A;  2LD5 A;  3F0C A;  2GEN A;  4A3G J;  2R7Z J;  3O8H A;  1JKR C;  5M3M J;  2HXI A;  4ME9 A;  3OIO A;  3BTJ A;  3HBL A;  5IP7 J;  2ID3 A;  2JN6 A;  2K40 A;  1JUP A;  3SFI A;  1RKW A;  1HDD C;  3G7R A;  3SDG A;  2XB5 A;  4RBO A;  4C3I J;  1QVU A;  4JKZ A;  3Q3S A;  3BT9 A;  1APL C;  3V6G A;  2CRG A;  1WCM J;  1U8B A;  3NAR A;  5GP9 A;  3D1N I;  3HKZ N;  3H3V K;  2LKX A;  4AYB N;  3Q0V A;  4MXM A;  3GTJ J;  2NX4 A;  1JTX A;  2JMW A;  5CXI A;  3O60 A;  2Y30 A;  4UDS A;  3QQA A;  2QTQ A;  1HDP A;  3G1L A;  2Y0S N;  1U9N A;  5FKM A;  4NEL A;  2R5Y B;  2ZCX A;  2VKE A;  3RZD J;  5GPA A;  2QKO A;  1RR7 A;  5EGO A;  3HE0 A;  1DU6 A;  4GCK A;  2NS8 A;  4A3D J;  2IU5 A;  2OPT A;  2ZOY A;  2ME6 A;  3BG5 A;  4A3C J;  2G3B A;  3NXC A;  4A3I J;  1JJ8 C;  3ANG A;  4IHV A;  2HOA A;  4AUX A;  1ETX A;  1OJL A;  4JL3 A;  2ME0 A;  2L7F P;  3JRC A;  3VW1 A;  1ETV A;  1ITY A;  4JYK A;  3IUV A;  2HDD A;  5IP9 J;  5HOD A;  3FIW A;  1P7J A;  2DN0 A;  3GTL J;  4BBS J;  3B6C A;  2K9Q A;  5IOY A;  1QPI A;  3ON2 A;  3BR1 A;  3HIM A;  3MN2 A;  5BNG A;  5E3O A;  2NVY J;  1GDT A;  2H8R A;  1X2N A;  4I76 A;  3GEU A;  2JJ7 A;  1ZQ3 P;  1HLV A;  3VOX A;  3S17 J;  4IHY A;  4ACI A;  4KWA A;  5FHP A;  1Y1V J;  5HSZ A;  1T33 A;  3BTI A;  1POG A;  3HTA A;  2GBY A;  4MLO A;  4XRM A;  5F0H A;  2E2I J;  1AU7 A;  2R5Y A;  2OI8 A;  3BNI A;  5CXG A;  5AQC A;  1OCT C;  3I4N J;  3HDD A;  3BR6 A;  2DMN A;  1K83 J;  1MSE C;  3CCY A;  2E2J J;  4NN1 A;  2HQ5 A;  2WV1 A;  3VUQ A;  1IUF A;  4C3H J;  1ZR2 A;  3KZ9 A;  1MH3 A;  3L1P A;  1RKT A;  4V2G A;  3RH2 A;  3S5R A;  3OOU A;  3BR2 A;  4UUT A;  2NVT J;  1XS9 A;  2MGQ A;  3VVX A;  2L0K A;  2ELK A;  2EZI A;  2HI3 A;  2HYT A;  5FKO A;  3JRG A;  3JR9 A;  5EZG A;  2DA5 A;  2HOT A;  1IDY A;  4L62 A;  4A3E J;  5DTD A;  3PPB A;  3JRI A;  2MSY A;  2PBX A;  1FJL A;  1MH4 A;  2L7Z A;  1UI5 A;  2QWT A;  3DPJ A;  1H8A C;  2WUI A;  4FIS A;  4M3B A;  2EZL A;  1NTC A;  1A6I A;  1T56 A;  2DTZ A;  2K9N A;  5M5W J;  3HTI A;  2NS7 A;  3HB9 A;  4XRS G;  4RDU A;  5J1U A;  5FKK A;  3TP3 A;  3SJM A;  1MBJ A;  1TWF J;  3HM5 A;  4JP0 A;  5F0C A;  4C3J J;  2NVQ J;  3FIS A;  5HBU A;  2YVH A;  3ZQF A;  1BW5 A;  4GCT A;  3HOX J;  3QPL A;  5IYC J;  2G0E A;  1P7I A;  2R5Z A;  4CYC A;  4QTR A;  1AHD P;  2O7T A;  1R9T J;  2H1K A;  2UXH A;  3G1O A;  2Q24 A;  3VW2 A;  3JRB A;  3LJL A;  4M3D A;  1IRZ A;  2DMU A;  4Y7N J;  4IHX A;  2CJJ A;  5J1Y A;  5FMP A;  1IJW C;  3O8G A;  2M9H A;  5J1R A;  3A02 A;  1Y1W J;  2G7S A;  4X1E A;  3S1R J;  5EGO B;  4BXX J;  3S16 J;  2DA4 A;  4J19 A;  4AC0 A;  1GT0 C;  5F08 A;  3S14 J;  3LSJ A;  2HXO A;  3LOC A;  5EG0 B;  3GBG A;  3E7Q A;  4AC6 A;  5K58 A;  2DG8 A;  2XPU A;  1MSF C;  5FLV A;  2D6Y A;  3C07 A;  4GFL A;  1FIA A;  1U9O A;  3P9T A;  4MIM A;  1DU0 A;  1ETW A;  2L7M P;  1JKP C;  4A3L J;  3KKC A;  2GLO A;  2ECC A;  3HGG A;  3T6N A;  4GFK A;  3HOZ J;  5M3F J;  1HCR A;  1K61 A;  5IYD J;  1BA5 A;  2WAQ N;  1VF9 A;  2LFB A;  3LSG A;  2AO9 A;  3NRG A;  3VW0 A;  3LSP A;  3BCG A;  3A01 B;  3EUP A;  2Y9Z A;  3NI7 A;  2IEK A;  2QF7 A;  1SFO J;  3BTL A;  2CQQ A;  2CUF A;  4A69 C;  2NP3 A;  4CGR A;  2O7O A;  2EQR A;  3H0G J;  3TED A;  2VUM J;  3JRF A;  1B72 A;  3PAS A;  3FK7 A;  3OSG A;  2UXP A;  3MVP A;  2M0C A;  5EG0 A;  3RKQ A;  1JT0 A;  1QVT A;  2JA8 J;  1FTZ A;  2JA5 J;  3VVY A;  1NK2 P;  3QBM A;  1ETQ A;  2FD5 A;  2YU9 J;  3EGQ A;  2LY9 A;  2M34 A;  5C4Y A;  4JX6 A;  4DYQ A;  3DCF A;  1BJZ A;  1I6H J;  1X2M A;  2I10 A;  2X9D A;  4G12 A;  4W1U A;  1SAN A;  2Y2Z A;  4XRS A;  4BKX A;  2QOP A;  1LFB A;  2CU7 A;  2N8G A;  3LNQ A;  2DMT A;  1AKH A;  3CWR A;  3A01 A;  2FX0 A;  5FLM J;  2JWT A;  1RPW A;  3A03 A;  1PUF B;  3KKD A;  5K7F A;  1H88 C;  3M3Y J;  1IG7 A;  1Z77 A;  1D5Y A;  3G56 A;  1RET A;  1QRY A;  4MFE A;  3VOK A;  2R5Z B;  1JKO C;  4CYC B;  5M5Y J;  2OF7 A;  3BTC A;  4DYR A;  1ZTR A;  4JNN A;  3HEF A;  2X48 A;  1UMQ A;  5M5X J;  3GTP J;  3E7L A;  2W53 A;  1TWC J;  1TWA J;  3HOW J;  3HOV J;  3CJD A;  2LLK A;  2YVE A;  2DA1 A;  3K7A J;  3ZQI A;  1ORK A;  2K9S A;  1U78 A;  1BW6 A;  5K7H A;  3GZI A;  3W6V A;  1PUF A;  3WHC A;  1VND A;  5IOZ A; 
#chains in the Genus database with same CATH topology
 2BY1 A;  2E5N A;  3S15 J;  1B59 A;  2P8T A;  3VIB A;  1NG7 A;  4RAG A;  2HYJ A;  4M72 A;  2ZBK A;  3K8P C;  3TL4 X;  1U5T A;  4BY7 J;  3OS0 A;  4O3M A;  5FGL A;  2Y69 H;  4F7Z A;  1BOA A;  2O3F A;  1X1A A;  3SZT A;  4PZJ A;  2WWY A;  3K1N A;  4YEJ A;  1V5G A;  4MO7 A;  3LWJ A;  2L4M A;  3K10 A;  4FE4 A;  2GXG A;  1TNS A;  1A6Q A;  1NK3 P;  1FMW A;  4BY1 J;  1ZGW A;  1GHC A;  3WGI A;  4ICH A;  1BI2 A;  1K79 A;  3MAJ A;  4RGS A;  4L9N A;  2D1H A;  3P5J A;  4M9X A;  2EFP A;  2E35 A;  3OOP A;  5DD8 A;  4HLX A;  1UG0 A;  2OCE A;  3I4M J;  2K5C A;  2WAE A;  3E5U A;  3RTR A;  2PFV A;  4DJA A;  3ZMV A;  5F1J A;  3EET A;  4NBQ A;  2BVL A;  3PO2 J;  2GWR A;  3K4L A;  1SMY F;  3HOU J;  3AAF A;  3BQY A;  3BPX A;  4NC6 A;  3CRJ A;  3BHQ A;  4YIR X;  4BU2 A;  3NNR A;  4L5J A;  1VI0 A;  3KNW A;  2R7F A;  3BQZ A;  3ZN0 A;  2JK3 A;  2KZV A;  5CLS A;  3QYF A;  3R61 A;  3VOD A;  3T5X A;  4ZZL A;  3BCB A;  2NNN A;  5H9T A;  2O8K A;  3RD3 A;  2TRT A;  4E7I A;  2WTE A;  3B73 A;  2VI6 A;  4W97 A;  4GDF A;  2AQF A;  2PEX A;  1F43 A;  1J75 A;  4E7J A;  3M8E A;  3UKG A;  3ZN1 A;  4Y52 J;  4A3B J;  1DPU A;  2QGU A;  1SGM A;  2ELJ A;  2VJ5 A;  2BBY A;  3VYS B;  5LHG A;  4JOM A;  3G6E I;  5LGT A;  2BXY A;  4UUS A;  2JA6 J;  1IC8 A;  3V4G A;  1WZ2 A;  3T8R A;  1Z7L A;  3VFZ A;  1OIS A;  3K4J A;  4FCY A;  2R93 J;  2VXD A;  3WGH A;  3S1N J;  1YO5 C;  5IPA A;  2ZJR F;  2COM A;  1I27 A;  2XKP A;  3RKX A;  3BR3 A;  5CVV A;  1RIO H;  3FBN B;  1F36 A;  3QYB A;  3ZQQ A;  5L3E A;  4AID A;  1I39 A;  2QCO A;  2KJC A;  1GV2 A;  2GQQ A;  2LR8 A;  3IH2 A;  4ZH4 F;  5EF6 A;  3OYM A;  2RC4 A;  1EV7 A;  3ZQ7 A;  3HRM A;  2RHA A;  2MLK A;  2STW A;  1IV6 A;  1Y6I A;  1XSV A;  3H5A A;  2VOO A;  2DFF A;  2TCT A;  2JUG A;  4UB6 C;  2HR3 A;  4RM3 A;  3MD2 A;  1GLN A;  4MK6 A;  3BJA A;  1FEX A;  2L9R A;  1ZKG A;  2M4G A;  3KLN A;  5CKT A;  3LQQ A;  2DI3 A;  1DUX C;  2GM4 A;  2F07 A;  3B02 A;  4EJW A;  4EJT A;  2XPW A;  3W2V A;  3BG6 A;  3RKY A;  1WJA A;  3VPR A;  1TWH J;  3QP5 A;  2F4O B;  4H4K C;  4LD5 A;  3BG3 A;  1FT9 A;  1FWZ A;  1YX5 A;  1FIP A;  4E7K A;  2VN2 A;  1QO0 D;  4YZE A;  2YS9 A;  2E1N A;  3IAS 2;  3ERM A;  6PAX A;  2EA4 A;  3V78 A;  2V6C A;  2V4J C;  4A93 J;  3GCM A;  2E19 A;  3IL2 A;  1O3S A;  3I56 I;  3PIP F;  3CES A;  2EH3 A;  2VPR A;  4ASN A;  4B44 A;  2D5V A;  3T8T A;  2VE8 A;  4ZJZ A;  1ETK A;  1W0T A;  3ZQH A;  2CGP A;  1VQ6 I;  4HAM A;  4CYD A;  1WH7 A;  4CO8 A;  3SEZ A;  2PZ9 A;  2DXI A;  1ZG1 A;  1W0U A;  2B63 J;  3FF5 A;  2WB1 N;  4I02 A;  5DCF A;  3WG7 H;  3LA2 A;  2KDO A;  3IH3 A;  3R0J A;  3NQO A;  3N4M A;  5DCM A;  4HDU A;  4BEH A;  5CW8 A;  2V26 A;  4YFN F;  2KP6 A;  1OCR H;  1O7L A;  1W5C C;  2DG7 A;  3D0S A;  2Y9Y A;  2ZKZ A;  2FJI 1;  1XMX A;  1F1Z A;  2VKV A;  3GF2 A;  1F5T A;  3ZQC A;  1K6O A;  4F91 B;  1WHU A;  2OV7 A;  3ELK A;  2XSD C;  5FJ8 J;  4DZJ A;  2X6X A;  3J81 K;  1S3J A;  3KIO A;  4F93 B;  3L2C A;  3PIO F;  3DU6 A;  2DA3 A;  3IAM 2;  2DA7 A;  2Q2E B;  2X85 A;  1J9I A;  4WXD A;  1IDZ A;  3ERE D;  1KU9 A;  4MGR A;  2LP0 A;  5DYM A;  1E0E A;  3C1D A;  3RQI A;  4JBA A;  4XR6 A;  1MMA A;  2NVU B;  2NRA C;  4BHC A;  3OYA A;  3K69 A;  2GEN A;  2FBK A;  5F6F A;  1QU3 A;  2R7Z J;  1JKR C;  5M3M J;  3BTJ A;  4HPQ A;  3SFI A;  1SVL A;  3IP4 B;  2ZC2 A;  1IXS B;  4HQE A;  4HLY A;  2P7C B;  3Q3S A;  3BT9 A;  1APL C;  3V6G A;  1XDU A;  2K3F A;  2CRG A;  4HX7 A;  5GP9 A;  4L0Y B;  2VOP A;  1YYV A;  3GME A;  4M71 A;  1S7A A;  2H8W A;  2G9W A;  3E5X A;  3Q0V A;  1LPQ A;  1JTX A;  3V7C A;  4U9N A;  2QM3 A;  2WY8 Q;  2CO5 A;  1Z67 A;  2M4K A;  5E1X A;  5ICF A;  1HDP A;  4C2U A;  4BAY A;  1UZC A;  1V5E A;  5FKM A;  2XRN A;  1U6G A;  1IN7 A;  2D2W A;  3M3Y J;  5J40 A;  3O6B B;  3IRR A;  4U87 A;  2NS8 A;  2OPT A;  2YVX A;  3NXC A;  2L9V A;  3SDB A;  1OJL A;  3DPT A;  2UXN A;  2L7F P;  1A04 A;  1ETV A;  2E1M C;  2IA0 A;  3IUV A;  4U9L A;  5IP9 J;  2XUB A;  3BY6 A;  4IL6 C;  4IVN A;  3SHF A;  5KK1 A;  3L7W A;  1FMV A;  4KFC A;  2K9Q A;  4DNC A;  5FD6 A;  3HIM A;  3MN2 A;  1BC8 C;  5BNG A;  3AL0 C;  2IP2 A;  1Y0U A;  5DV5 A;  3GEU A;  1TBX A;  2DPU A;  4OIP F;  5LRR A;  1G3T A;  1SFX A;  1YIJ I;  2MLG A;  2VPL A;  3BZK A;  4N9I A;  2IS4 A;  1XCV A;  5J6X A;  3ZR8 X;  2Z3Y A;  5F0H A;  2E2I J;  2F5D A;  2QQ8 A;  1HST A;  1D0Z A;  2P5L C;  1L3L A;  3JW4 A;  5D6E A;  1MJA A;  1IAW A;  2QBY B;  3I4N J;  2DMN A;  4G7Z F;  3WTS C;  1K83 J;  3F8B A;  1MSE C;  2PJR A;  1W1W E;  3KFW X;  4IF4 A;  4M74 A;  1J0R A;  2HQ5 A;  3GEZ A;  2HVR A;  1IUF A;  1D5V A;  1MH3 A;  3L1P A;  1ZLK A;  3OS1 A;  3NRV A;  2BW3 B;  3OIP A;  4E6K G;  3TDZ C;  1H0M A;  1XS9 A;  1JHH A;  2MGQ A;  2L0K A;  4Y13 A;  2ELK A;  2HYT A;  3N97 A;  2CUJ A;  3JRG A;  3JR9 A;  2QSH X;  1JGS A;  2NYX A;  4A3E J;  3PPB A;  3ZMS A;  2P5K A;  3JRI A;  2PBX A;  3DPJ A;  1KQ8 A;  4G94 A;  3GLL A;  1PYV A;  4NQW A;  2RV8 A;  1WI9 A;  2WUI A;  4M3B A;  5E8I A;  4BAC A;  3CJT B;  1XGM A;  2K9N A;  5M5W J;  4RM2 A;  4OOI A;  4KUM A;  1QQI A;  5J1U A;  2ISZ A;  2Z99 A;  3SJM A;  3DBH B;  4JP0 A;  3WTY C;  3GLX A;  4U0W A;  1BR2 A;  3I55 I;  4RAF A;  4GCT A;  2L01 A;  4D9J A;  1DQU A;  3JCU C;  4U7D A;  3W2W A;  5LGU A;  1OLT A;  3F72 A;  4EGY A;  2B3W A;  1FOW A;  4CYC A;  5HVQ C;  4QTR A;  4OAY A;  1SAX A;  1VQP I;  1VQ4 I;  3QPH A;  2HS5 A;  3JRB A;  3W6K B;  4ENN A;  4Y7N J;  4IHX A;  3KP6 A;  3A02 A;  1T98 A;  5B1B H;  2RQP A;  2IRF G;  3S1R J;  1P9Q C;  2LOO A;  5LRS A;  1LDJ A;  2XRO A;  2Z2S B;  2DA4 A;  4ZYE A;  3FWE A;  2BZT A;  3BOQ A;  2E1M B;  2QVO A;  2ZJQ F;  2IJL A;  3LOC A;  5K58 A;  2XPU A;  4BL0 B;  2D6Y A;  3C07 A;  5TRD A;  4ESJ A;  1U9O A;  3FX3 A;  2ZY9 A;  4MIM A;  5ICG A;  3DEE A;  3AL0 B;  1ETW A;  1I1G A;  2M87 A;  2L7M P;  3MCZ A;  1GVJ A;  2LYC A;  4A3L J;  4JQF A;  2ECC A;  1Q1H A;  5M3F J;  4AIJ A;  1ZLJ A;  3REO A;  5IYD J;  4IOA F;  3EPZ A;  2R7X A;  2WAQ N;  2Q0O A;  2M1B A;  2IPQ X;  3RKW A;  1B4A A;  2B1E A;  2QLZ A;  1HW5 A;  2QF7 A;  5D8K B;  5IY5 H;  5D5V B;  1FYL A;  3PJR A;  2K85 A;  4BNC A;  1WJB A;  2JQ7 A;  3FK7 A;  2LY1 A;  4CCK A;  3MVP A;  2M0C A;  4WK8 F;  2L54 A;  4IRI A;  1QVT A;  2PN6 A;  2C6Y A;  1Z6R A;  4XLE A;  1P4X A;  5CQG A;  5C4Y A;  4DIQ A;  4ZDO A;  3CP8 A;  3DCF A;  4RGX A;  1BJZ A;  1Z6T A;  1SFE A;  2OTL I;  1TW3 A;  2I10 A;  2K9M A;  2X9D A;  4OIQ F;  4W1U A;  3PUF A;  4KN7 X;  1HC8 A;  2QOP A;  3H3Z A;  1U2W A;  1SVM A;  1AKH A;  2O61 A;  2FNA A;  3H92 A;  4AWX B;  2MAB A;  4PUS A;  1RPW A;  1PUF B;  3KKD A;  4AIH A;  1ACI A;  2AS5 F;  2OA4 A;  5TJJ A;  5CPR B;  1H88 C;  4KIF A;  3TKY A;  2XC7 A;  4LGW A;  3QU6 A;  3QP6 A;  1S9H A;  4IRG A;  1FY7 A;  2R5Z B;  5M5Y J;  1O7F A;  1PJR A;  2HYG D;  3BZ6 A;  1MIJ A;  2HQR A;  2OZ6 A;  4PSX A;  3ABL H;  3OMY A;  2OAZ A;  3LFK A;  5M5X J;  4WCG A;  5H2F C;  3GTP J;  3E7L A;  5GTH C;  4OIR F;  2W53 A;  4P96 A;  2GIZ A;  1FPQ A;  2HOE A;  1PDN C;  1IRX A;  3DU5 A;  2LLK A;  2M30 A;  2DA1 A;  2W24 A;  1JI8 A;  4P1W A;  3K7A J;  4UY8 I;  3BJO A;  2XVC A;  1ORK A;  2LRD A;  2EIM H;  2K9S A;  4LK0 F;  2A5W A;  1W7P A;  2VC1 A;  1U78 A;  3BLY A;  4HV6 A;  5HNF A;  3RI4 A;  1PUF A;  3WHC A;  3T0Y A;  5IOZ A;  2OER A;  4L0Z B;  1XTA A;  5FKN A;  2QZ8 A;  5F64 A;  4L9V A;  1J2X A;  5IP6 A;  3VVZ A;  3OWT A;  2XPV A;  5E20 A;  1T6S A;  4IEJ A;  3GTM J;  2L5Q A;  3ONQ A;  1R00 A;  1E3O C;  4MHG A;  2XSJ C;  3QOD A;  3BRU A;  4UVB A;  4KIB A;  4YG2 F;  3J7Z I;  3BJB A;  3FMS A;  1Z7U A;  4FX4 A;  2OUM A;  4BUP A;  2DA2 A;  4M6X A;  5DUI A;  3JSP A;  1S7E A;  3VYU B;  3HHH A;  1B8I A;  1J7K A;  1AOY A;  4GO1 A;  4X6A J;  2NVX J;  1BI3 A;  4HF0 A;  2Y75 A;  3MKL A;  3ZOB A;  4IPA A;  3UR3 C;  3TMO A;  2R7W A;  1WJE A;  1TC3 C;  5EZH A;  1IRF A;  1GXQ A;  2G7G A;  1Z0X A;  1T8I A;  1ERD A;  3F8M A;  3K4K A;  3OYN A;  2F5F A;  4LLN A;  2F4M B;  3HYI A;  3S3O A;  2CG4 A;  2O0Y A;  1G2H A;  1I3Q J;  3GZN B;  2FOK A;  4HNV A;  1UHW A;  2V6E A;  3B81 A;  1DPR A;  2W82 A;  4DW6 A;  4JX5 A;  1ON2 A;  4GCL A;  4Y3O A;  4UVA A;  4I7H A;  2ZB9 A;  2FXA A;  3I9V 2;  3CDH A;  1YRN B;  2P81 A;  3VSL A;  3TQN A;  4BS9 A;  2WV0 A;  3K1M A;  4MFD A;  1QHG A;  2ZME B;  5K7Z A;  5J8F A;  5GPC A;  3BG9 A;  4G7H F;  4XMY A;  1EH8 A;  2A05 A;  2WGB A;  3BZC A;  4XBF A;  2MG4 A;  1ON1 A;  1O3R A;  3LAP A;  3R0A A;  2IAI A;  1LDK B;  1MBG A;  1HW2 A;  3H9J A;  2HKU A;  3WU0 A;  1RC9 A;  1Y0N A;  2STT A;  3M7G A;  4E7S A;  3ABM H;  1LNW A;  3KEQ A;  1X19 A;  1H9G A;  2GUH A;  1JE8 A;  5HLH A;  2VQG A;  2DMP A;  2AXT C;  2MW8 A;  2GAU A;  1R5G A;  2DMQ A;  2M8E A;  3DLL F;  4DBR A;  4CH7 A;  4I6Z A;  2CW7 A;  1RRJ A;  1MMD A;  4OD4 A;  1YRN A;  3JRH A;  4R8H A;  5TGT A;  1X1B A;  4YFK F;  1BL0 A;  5D5X B;  2XF5 A;  2R92 J;  2FUG 2;  2GIV A;  3HUG B;  3CTA A;  2EPF A;  3I53 A;  3DKY A;  3DTK A;  1S7O A;  3TO9 A;  2FQ4 A;  1O3Q A;  3AQS A;  3DTE A;  1VQL I;  1W5T A;  4QSH A;  2M8G X;  3HG9 A;  3VEP A;  1P4W A;  4RS8 A;  3GO5 A;  1MBF A;  2G7U A;  2HTS A;  2MC4 A;  5C3E J;  2REK A;  4F3Q A;  2P6S A;  1JGG A;  3MEX A;  2HVQ A;  3J7A O;  3H1C A;  3DEW A;  2XGE A;  4S04 A;  1WRJ A;  3BR0 A;  3QU3 A;  1IUY A;  3FDY A;  3OYJ A;  3GX4 X;  2PMH A;  1SAU A;  4LG0 B;  4IOC F;  4XM3 A;  3EQL F;  4K2E A;  1BIB A;  1TWG J;  4DBQ A;  4HNT A;  2WC2 A;  2ZNZ A;  4ABZ A;  1ZR4 A;  1ODD A;  2K27 A;  3LA7 A;  2LSO A;  3RZO J;  1Z1D A;  1FBQ A;  3OYD A;  3E6D A;  4XLN F;  3RPU A;  1UI6 A;  3SEQ A;  2V79 A;  1DDN A;  2HKX A;  1S29 A;  2KIM A;  2FBI A;  4RLQ A;  4ZDP A;  2CW0 F;  2E2H J;  4R1H A;  1BI1 A;  2X6W A;  4TV7 A;  2EV5 A;  3FKJ A;  4CDG A;  2V1N A;  2J5O A;  2ID6 A;  2VBX A;  4U0Y A;  1DGR M;  3IUO A;  4N4N B;  3E6M A;  3D5S C;  5L3F A;  1MMG A;  2BY0 A;  1IN5 A;  3G71 I;  4M6Y A;  1JTY A;  3BWG A;  4XIC A;  2DA6 A;  5IT3 A;  3V42 A;  2ZFU A;  1U0J A;  5EEA A;  3RYP A;  1I3A A;  3PNY A;  4EEF G;  5ICC A;  5EEH A;  1ZH5 A;  3JSJ A;  5F27 A;  2ZSI B;  1HXD A;  1SMT A;  2FBH A;  3MQ0 A;  3FMQ A;  3BDD A;  3HGY A;  3OL3 A;  1OPC A;  3M1C A;  3P9I A;  4LG0 A;  1R49 A;  4UUS B;  1FTT A;  3DEU A;  5C44 J;  2Z5U A;  3MZH A;  4UB8 C;  1JUM A;  1KQ0 A;  2JZY A;  2BHY A;  2MH9 A;  3CJN A;  4KIC A;  3GTG J;  4OAZ A;  5F0F A;  2CS3 A;  3EYY A;  4XSZ F;  2WY7 Q;  1BC7 C;  1WI3 A;  1XG1 A;  1J5Y A;  2EBI A;  2CUE A;  4RAZ A;  2LD5 A;  1KU7 A;  2JTV A;  3L09 A;  5B3S H;  3O8H A;  2NNY A;  4I2O A;  2HXI A;  3OIO A;  2PMZ A;  1B9N A;  3CJR B;  1YS6 A;  2ID3 A;  2R7O A;  2JN6 A;  4XSX F;  4LB6 B;  1RKW A;  4HBL A;  1T0F C;  5HLG A;  4RMN A;  4RBO A;  2VBZ A;  1QVU A;  1ZG3 A;  2PQ8 A;  3GW2 A;  4MTD A;  2BGC A;  2H6B A;  1FBS A;  3CCQ I;  1WCM J;  1V54 H;  5JHU A;  3CCE I;  5KCM A;  3H3V K;  3LL7 A;  5K5Q A;  5FGM A;  2PX9 A;  3UNG C;  3CO6 C;  4IJA A;  3GTJ J;  1SD5 A;  2EIN H;  2A61 A;  4KMF A;  4B8X A;  2B0L A;  2JRM A;  2G7H A;  4IKF A;  4KNY A;  4UDS A;  3QQA A;  3K4B A;  1UEL B;  1U9N A;  5EJC A;  1XGO A;  3OYE A;  3H9G A;  2VJJ A;  3RZD J;  5CVR A;  5CVJ A;  1RR7 A;  5EGO A;  2F5E A;  3JAM K;  4GCK A;  1VQ9 I;  1YW8 A;  4BQN A;  2EWN A;  1V3F A;  2LRE A;  2IU5 A;  3DP7 A;  3KP7 A;  4XN3 A;  2ME6 A;  2HEO A;  2ZOY A;  4ZZD A;  2L7K A;  4A3C J;  5CQE A;  3KLO A;  2IT0 A;  3ANG A;  4RA2 A;  2FML A;  1QPM A;  2NXN B;  2UV1 A;  2ME0 A;  3V7S A;  4Y33 A;  3JRC A;  3F9K A;  1E3P A;  1ITY A;  3VW1 A;  4JYK A;  3CC4 I;  1D1A A;  5B5E C;  2FU4 A;  3FIW A;  1P7J A;  3GTL J;  1Z3X A;  3DQV C;  2TDX A;  3B6C A;  2IA2 A;  4UV8 A;  5IOY A;  3ON2 A;  4A0Z A;  1IZ1 A;  3S3N A;  2DCE A;  3ZPL A;  2NVY J;  1D0Y A;  2Z1D A;  2ZXH A;  1F4K A;  4ZC3 A;  2H8R A;  4WIB A;  5DCM B;  4A0Y A;  4BEH B;  3RQ4 A;  2I8D A;  3S17 J;  1XGS A;  4KWA A;  2E7W A;  3IWF A;  2KLO A;  4EVI A;  4XKC A;  2A68 F;  2QQ9 A;  1U8R A;  3BJ6 A;  1SD4 A;  4RGU A;  1PVE A;  3BNI A;  3HDD A;  3BR6 A;  2ZO4 A;  4CCL A;  2QSG X;  2QQA A;  3V8K A;  1HKS A;  1EKE A;  4BXU A;  3CCY A;  3F8C A;  2VKH A;  3LFU A;  2E2J J;  1IV8 A;  5L3B A;  3ZXS A;  4XKV A;  4AYB A;  3KZ9 A;  3IC7 A;  1K4T A;  2O6G E;  1RKT A;  1WFX A;  2B9S A;  1RI7 A;  3WE3 A;  4BYY A;  5J4V A;  2IW5 A;  2Y0S A;  3FM5 A;  5EZG A;  4L62 A;  5E8G A;  2MC3 A;  2L4A A;  2ZSH B;  5DTD A;  2BY2 A;  1FOX A;  1TT5 B;  2PMU A;  4BHP A;  1UI5 A;  3MKY B;  2QWT A;  2DFI A;  1H8A C;  5LGN A;  2MBF A;  3CUQ C;  2JRT A;  2EZL A;  3E5Q A;  1UCR A;  3H3U A;  5EEG A;  3HTI A;  2NS7 A;  2Y0M A;  2X6Y A;  4JK1 X;  3CMM A;  4P9F A;  3TP3 A;  1CGP A;  4HOB A;  3S32 A;  3HM5 A;  2X1C A;  2YVH A;  3FIS A;  2EFW A;  3KEY A;  4ITV A;  3FM3 A;  3ZQF A;  4QWQ A;  4Y15 A;  5ICE A;  2HZT A;  1BW5 A;  1QZY A;  3CCU I;  4R79 A;  5LEK A;  2ESN A;  4UVC A;  4RB3 C;  1Y8R B;  3F21 A;  1FP2 A;  1X4O A;  4GYG A;  2Q8K A;  3ECO A;  2H1K A;  3RYR A;  3HL2 A;  2H27 A;  4M3D A;  2WAD A;  3S2W A;  1X4P A;  5GAG J;  5DUK A;  5J1R A;  4ENJ A;  4G6D A;  2G7S A;  1UAA A;  3E1S A;  3F6O A;  5JFR A;  4BXX J;  1T0F A;  4GGG A;  4FAS D;  3CO7 C;  5ERI A;  3LSJ A;  2HXO A;  3E7Q A;  4E7L A;  4HF2 A;  1D8K A;  5FLV A;  4B47 A;  4GFL A;  4IRV A;  1FIA A;  1T08 B;  2WAF A;  1WVR A;  2L3D A;  2VT2 A;  1MMS A;  1FZP B;  1J59 A;  4HST A;  1DU0 A;  2W00 A;  4IRH A;  4L18 B;  1ONV A;  2OZU A;  4KT6 A;  2XGX A;  4EM0 B;  2R7R A;  4NC8 A;  5LLQ A;  1FOK A;  1TT0 A;  4GFK A;  2QA4 I;  4ESF A;  1UHM A;  5GAD J;  4U88 A;  3DKX A;  5GAH J;  4PDK A;  1VF9 A;  3LSG A;  4DQ2 A;  1SC7 A;  2VON A;  2L02 A;  4B48 A;  1SFU A;  4PGG A;  3EUP A;  2Y9Z A;  3U9G A;  1XGN A;  1SFO J;  1HQC A;  3BTL A;  1OCC H;  2CUF A;  4FET A;  1VQ8 I;  3QOP A;  2PJR B;  3M8J A;  2VB6 A;  4XLH A;  2NP3 A;  4CGR A;  2VE9 A;  5AIP A;  1B72 A;  3PAS A;  3FXL A;  2UXP A;  3ML6 A;  1XMK A;  2QSF X;  3M9A A;  1JT0 A;  4FT8 A;  3I4P A;  1FTZ A;  3EDP A;  2CFO A;  2JA5 J;  1IN4 A;  4KJZ A;  3CCL I;  2CSO A;  4NC7 A;  1BI0 A;  3JAM Z;  4DYQ A;  5FRM A;  1FC3 A;  2Z33 A;  2M5W A;  4G12 A;  3K4M A;  3FXO A;  1WJD A;  4BXF A;  4NQW B;  1UB9 A;  3HSF A;  4BKX A;  4XRS A;  3DXJ F;  2CU7 A;  3BP8 A;  4FX0 A;  2Q1Z B;  3LNQ A;  2DMT A;  4G6Q A;  3CWR A;  3OYI A;  3K1P A;  1E17 A;  5J4Y A;  1YHQ I;  2L2O A;  2JWT A;  3AFH A;  1XB4 A;  3HRS A;  4G8X A;  1IXC A;  2KZG A;  4D0P A;  3OL4 A;  2K4J A;  3OV8 A;  4HV5 A;  1VQN I;  4NB5 A;  5L3D A;  5DDG A;  4M9Z A;  5HS8 A;  1D5Y A;  1IG7 A;  4OIO F;  1RET A;  1LKX A;  5JI6 A;  2YR2 A;  3VOK A;  3WTT C;  2KQR A;  4XL9 A;  1JKO C;  2KRH A;  4CYC B;  1KON A;  4PSW A;  4EJU A;  1HKQ A;  1KU3 A;  1O3T A;  4KYW A;  2QQB A;  2YU3 A;  3TOB A;  3HEF A;  3AG4 H;  4CCO A;  3FZV A;  1Z91 A;  3WGG A;  5BMZ A;  3KCC A;  3I5U A;  4MEX F;  3HOW J;  3CUQ A;  3CJD A;  4QPQ A;  4LG3 A;  3W3C A;  3QRF F;  3W2A A;  3ZGK A;  3QAH A;  2LBF A;  2MD0 A;  1ZHF A;  4LLL A;  3LSI A;  3FMR A;  3QWL A;  2CV1 A;  1K6Y A;  2CQ7 A;  3GZ6 A;  2DT7 B;  1Y39 A;  2VOD A;  5K7H A;  3V8J A;  1U3E M;  3GZI A;  1H9T A;  4NUB A;  4ZTJ A;  4ZDL A;  1TZL A;  1R6R A;  5FFZ A;  1R22 A;  2PG4 A;  4HEA 2;  3JRE A;  4A3J J;  2R7T A;  2XGD A;  5ED4 A;  5KNL A;  2COB A;  5H6Q A;  4KN4 X;  5C4X J;  4Y17 A;  3I59 B;  5EYR A;  4BH9 A;  3EUA A;  3V7R A;  1DP7 P;  3E3V A;  4ANJ A;  2FOW A;  3DBR B;  2XAU A;  3Q9S A;  3C2B A;  3GTQ J;  3IRQ A;  2RDP A;  2QEX I;  3KP5 A;  3F22 A;  2A2F X;  2RRE A;  4L5E A;  4B3A A;  1EH7 A;  3HPG A;  3ZQG A;  3F6V A;  1BJA A;  4BBR J;  3E6C C;  2EZK A;  3DKW A;  2YX4 A;  2PI0 A;  4NDL A;  2VC0 A;  4A0X A;  3J81 Z;  2RNG A;  1MBE A;  3CMY A;  1R36 A;  2DO7 A;  1HOM A;  4C2M J;  2IXS A;  5DD4 A;  1K78 B;  4BQA A;  1EF4 A;  3B6A A;  2VXZ A;  4YEL A;  1W36 C;  3ZMZ A;  3OR2 C;  1Q1V A;  2Y31 A;  3L2R A;  2FBQ A;  1IN6 A;  5E1W A;  4E4H A;  4UHT A;  3K70 C;  3OSF A;  3VTI A;  1Y8Q B;  5JLW A;  5E3M A;  4WF2 A;  2MYS A;  3HZJ A;  2KDZ A;  2OC6 A;  3LSH A;  3I59 A;  1CQT A;  3NWT A;  2F4I A;  1MBK A;  2BY3 A;  2RGV A;  3A4C A;  3MNL A;  5C4J J;  2H1L A;  1AKH B;  2ZOZ A;  1XCB A;  2RVC A;  2EFQ A;  1JHF A;  2DDB A;  1HSJ A;  3HIF A;  4AF5 A;  2LMD A;  5AON A;  5LHI A;  1RNL A;  1VQM I;  4M3E A;  2A6E F;  5EDN A;  1S5L C;  3V8L A;  3AKZ A;  3LAJ A;  2DT6 A;  3Q9V A;  1ETO A;  4S05 A;  4LIV A;  1BOB A;  1G3S A;  1XC5 A;  1Z3Y A;  4HSR A;  4CCM A;  1UJ8 A;  5ILV A;  1F9N A;  1K78 A;  1LB2 A;  2ZJP F;  3CCM I;  1NG6 A;  1PP7 U;  4M6V A;  1V4R A;  2E1O A;  5DEQ A;  4B1R A;  4LK1 F;  1R1U A;  3HTH A;  1YS7 A;  1PUE E;  2M7B A;  2EJR A;  2UXO A;  3K2A A;  1QA6 A;  2A6H F;  2DOA A;  2A6T A;  4DZP A;  2X6O A;  3VYR B;  2XRL A;  5D1R A;  1VZ0 A;  4PJJ A;  3J7A Y;  3GYH X;  2EA2 A;  3MZY A;  2UXU A;  2E5Z A;  3G3Z A;  1GV5 A;  2W48 A;  4HX4 A;  5E3N A;  1W7P B;  4HDV A;  4V2F A;  4P55 A;  2JA7 J;  2XAQ A;  3QPS A;  1N25 A;  2XV4 S;  4U0V A;  1XMA A;  3CME I;  1WH5 A;  1YI2 I;  4FE7 A;  3CLO A;  3LSK A;  1R71 A;  1GXP A;  3I64 A;  2ACJ A;  3I58 A;  1ZRE A;  1PP8 F;  2KJB A;  5D6F A;  4D7M A;  3P7N A;  3VB2 A;  2KRC A;  3WTZ A;  5H20 A;  5E1Z B;  3QPT A;  2P6T A;  4YFX F;  1HF0 A;  1IGN A;  4M3F A;  3VSK A;  5KAF C;  3CQZ J;  1MNM C;  2LK2 A;  3J7Y J;  4XK4 A;  2EFN A;  2G7L A;  2ICW G;  3MKZ A;  4UV9 A;  3HSR A;  2XDN A;  2ECB A;  1B8I B;  1DGW Y;  2PMZ N;  4E7Z A;  1RUN A;  3M8F A;  1Z05 A;  5FKL A;  2R0Q C;  1STZ A;  2PJP A;  2HQA A;  3CDI A;  4G9Y A;  2HVS A;  1DP3 A;  1L0O C;  1E3H A;  4E7H A;  2IBD A;  2KT0 A;  3DFG A;  3GTK J;  1FSH A;  3CCR I;  4F52 A;  3OYH A;  4A3F J;  3S3M A;  4OIN F;  3M4O J;  3I71 A;  5J3L A;  2OJE D;  5JR3 A;  4A3M J;  2OQR A;  1Z21 A;  3TO6 A;  5FFX A;  2LTP A;  1A5J A;  5GTI C;  4O6J A;  2RN7 A;  1WPK A;  4D7N A;  4V19 K;  2XB0 X;  2RAE A;  5E3L A;  1IXR C;  3TO7 A;  3PM1 A;  2PLY A;  3Q0U A;  1KYW A;  3FBI B;  1D3Y A;  5BPI A;  4GCV A;  2LVS A;  3CC7 I;  2E7X A;  1NHA A;  2CQX A;  4C30 A;  5CVU A;  5DS9 A;  4DOZ A;  2X4H A;  1TP4 A;  3CDL A;  1FBU A;  1D1B A;  3TW7 A;  2V57 A;  1I5Z A;  1ZRC A;  2LKP A;  5FD5 A;  3CMA I;  4CZC A;  4MTE A;  3IKV A;  3U2R A;  4GYI A;  3CD6 I;  3R60 A;  3TGN A;  3OIQ A;  1G59 A;  2EV6 A;  4D5C A;  1FYK A;  2MD5 A;  3FK6 A;  4XLP F;  2FSW A;  5E18 F;  4CGZ A;  2V9P A;  1XPX A;  3EUH A;  4HA8 A;  2ETH A;  4A3G J;  4ME9 A;  2X1E A;  2HGC A;  1KYZ A;  2IGN A;  1P6R A;  3SZG A;  2K40 A;  1JUP A;  2F48 A;  3PSI A;  3G7R A;  1KU2 A;  1OCZ H;  4ZYG A;  1LQ1 A;  3U1K A;  4C3I J;  3OS2 A;  1X3Z B;  4PFO A;  1I6X A;  4E70 A;  4XOP A;  1YJN I;  2EFO A;  4MEY F;  1W7P D;  4DGW B;  3D1N I;  1MGT A;  3WOD F;  4DVY P;  1UST A;  1QBJ A;  4AYB N;  2E60 A;  2KL4 A;  1G4D A;  4MXM A;  2NX4 A;  4L5I A;  3C18 A;  2JMW A;  3M07 A;  1K4S A;  1G3W A;  4FHT A;  1ZEL A;  4HYE A;  2O8X A;  5BQT A;  2QTQ A;  3ABT A;  3NS4 A;  2Y0S N;  5F1R A;  4NEL A;  2YPR A;  2R5Y B;  2CQN A;  4IX7 A;  2VKE A;  3CZ6 A;  3WU1 B;  4IQ4 A;  1XD7 A;  4PGH A;  2EIK H;  2ZXJ A;  3BG5 A;  1AWC A;  1EA3 A;  2G3B A;  4WX9 A;  4A3I J;  4AVP A;  4WXH A;  1JJ8 C;  1WQ2 A;  3DPL C;  2HOA A;  2X51 A;  1ETX A;  1MDM A;  2QUF A;  4JL3 A;  1YQA A;  4Z2Y A;  5HOD A;  2DFH A;  2M0M A;  4F92 B;  4BBS J;  1FSE A;  3VOE A;  1LEB A;  2JSC A;  2OBP A;  3FXU A;  2MA3 A;  1IF1 A;  4I76 A;  2JJ7 A;  3VOX A;  1HLV A;  2EV0 A;  2R7S A;  3CCJ I;  5D5W B;  4IHY A;  4ACI A;  4ZYD A;  5FHP A;  1Y1V J;  5HSZ A;  1FNN A;  3LWF A;  4MLO A;  1AU7 A;  2K9L A;  2R5Y A;  1ZAR A;  4NNJ A;  1ZG5 A;  2OI8 A;  5CXG A;  3AG2 H;  5HS9 A;  4XKB A;  3IHU A;  4HZF A;  3OY9 A;  4I98 B;  1LEA A;  4RB1 A;  5BS6 A;  1LJ9 A;  2WV1 A;  1ZR2 A;  3KZI C;  3L2W A;  3RH2 A;  3OOU A;  3W6J B;  3BR2 A;  2W1O A;  3ZMT A;  3D5R C;  2VKD A;  2A69 F;  2LC2 A;  2EZI A;  2NAZ A;  1OKR A;  5FKO A;  5HDK A;  2HOT A;  2DA5 A;  1IDY A;  5H6R A;  3E6B A;  1YJ9 I;  2L7Z A;  2KIQ A;  4GRI A;  1R1V A;  5JVT A;  1BBY A;  5HDG A;  4XLC A;  1WKM A;  2GOM A;  4L9J A;  3CF5 F;  1NTC A;  2LG4 A;  2XF6 A;  1R58 A;  4XLA A;  5HLI A;  4MQ9 F;  2VBY A;  3HB9 A;  4XRS G;  4RDU A;  3WTW C;  2MH2 A;  5FKK A;  1TWF J;  2NVQ J;  1R4N B;  5F0C A;  2RNJ A;  2K86 A;  4ON0 A;  4BJ6 C;  1N77 A;  2GXB A;  5HBU A;  3GWZ A;  1YIO A;  3HOX J;  2EK5 A;  4MQV A;  1D1C A;  3QPL A;  4N0B A;  3VDX A;  5LEJ A;  3FXJ A;  5D4R A;  3K2Z A;  2VQC A;  2ESH A;  1AHD P;  1R9T J;  1T95 A;  1CF7 A;  4PJ0 C;  3RSN A;  4BE0 A;  2Q24 A;  3TBI A;  5D4S A;  3H0D A;  3LJL A;  1IRZ A;  2L9N A;  3COA C;  2DMU A;  4HW0 A;  5J1Y A;  2CW8 A;  4HG2 A;  2ZCW A;  2M9H A;  3E0J B;  3O8G A;  3R6S A;  4BQO A;  1IJW C;  4X1E A;  4HRI A;  3CLQ A;  4XOR A;  5EGO B;  3HTS B;  1G6N A;  4Q48 A;  1LDD A;  5ILU A;  2DBB A;  4B43 A;  4AC0 A;  3MKW B;  1XX5 A;  4HQM A;  5F08 A;  3S14 J;  1X3W B;  3GBG A;  2KIF A;  2IGK A;  4LB5 A;  2VJ4 A;  5K1Y A;  2D45 A;  2OTJ I;  2WA0 A;  4KIS A;  2XKO A;  1KQ9 A;  2DK8 A;  3MMY B;  3BRO A;  2YSR A;  4KA4 A;  2BVM A;  2ZFW A;  1RR8 C;  2CQK A;  3PQJ A;  2GLO A;  4N9H A;  2EB7 A;  3HOZ J;  2CWE A;  2FEZ A;  3SFZ A;  3RPU D;  1D0X A;  1K61 A;  1X1P A;  2KFD A;  2VIX A;  1HCR A;  2AXL A;  2Y48 A;  1YOV B;  4J00 A;  3A0H C;  3VW0 A;  4EAT A;  1KZH A;  3A01 B;  1SVO A;  3NI7 A;  2IEK A;  2F5C A;  4CSW A;  2RQQ A;  2CFX A;  3A2K A;  3C7J A;  3KPH A;  3FXQ A;  1MKM A;  4XRF A;  4EQQ A;  1R5H A;  3ABU A;  2EQR A;  3H0G J;  2VUM J;  2OU2 A;  1RUO A;  3OSG A;  2XHK A;  4XNF A;  1S72 I;  2GA2 A;  2GA1 A;  1REP C;  4RB2 C;  3RKQ A;  2JA8 J;  1FYM A;  3C2G A;  3VVY A;  2MFZ A;  1NK2 P;  3RIR A;  1LVA A;  5KAI C;  3J80 K;  2FD5 A;  1NH3 A;  4UNO A;  3EGQ A;  2ISY A;  2M34 A;  4JX6 A;  2BHZ A;  4IZZ A;  2W85 A;  1A35 A;  4OWR B;  1J09 A;  1YX3 A;  2JPC A;  4OD5 A;  2W25 A;  2XAS A;  3K0L A;  3OYK A;  5LD2 C;  1SAN A;  2L9S A;  5JVG F;  1LFB A;  1BIA A;  1T2K A;  3LSM A;  5CVI A;  3A01 A;  3HPH A;  4C9Y A;  1MMN A;  1X1C A;  5FLM J;  3KYD B;  4IHS A;  4BJT A;  1S8N A;  4P5O A;  4ZYA A;  3MWM A;  1IO2 A;  3ZMU A;  3G56 A;  4XKW A;  4EJO A;  4MFE A;  4D1Q A;  3ZMD A;  1VTN C;  2OF7 A;  3BTC A;  1BN5 A;  2HPM A;  4DYR A;  1ZRF A;  3C2H A;  4EMS A;  1TLH B;  4XOT A;  5B66 C;  1TNT A;  3HC7 A;  1YIT I;  2X48 A;  2P7V B;  5DM6 F;  1UMQ A;  2M7A A;  3E97 A;  1XN7 A;  3DLA A;  2DYR H;  4BHB A;  1WSU A;  4IQJ A;  4I99 C;  2NS0 A;  3LQR A;  2A3S A;  2DAO A;  3H5N A;  4XQF A;  2CUZ A;  2KRF A;  1TWC J;  4XON A;  1TWA J;  1LFP A;  3HOV J;  3HRT A;  2V7F A;  1R5I D;  3ISP A;  3A0B C;  4LMY A;  1XSD A;  3ZQI A;  4ESB A;  2Z9O A;  4PFP A;  2XAF A;  5CJ9 A;  1X1D A;  1VND A;  2EIJ H;  2DPD A;  4UUV A;  3CP2 A;  2UZK A;  3S2D J;  2YUS A;  5HAW A;  2K3P A;  4ZTF A;  3OYL A;  5JHF A;  3NPI A;  3P9C A;  1TQM A;  1UHS A;  2DQR A;  3HRU A;  1LFU P;  4H0E A;  3QYE A;  9ANT A;  1HW1 A;  3G1M A;  2IGM A;  4G6T B;  3S1Q J;  2A5Y B;  1ZK8 A;  5AIQ A;  3ULQ B;  4IO9 F;  1QGP A;  1HBX G;  4YRV A;  2XAJ A;  2B7E A;  2O9L A;  1B72 B;  3ZCO A;  2RAS A;  4ZYH A;  3IV5 A;  1QZE A;  2P5V A;  2LNB A;  3DF8 A;  4EV0 A;  1TQI A;  3KZZ A;  1WGX A;  2XAG A;  1EJ9 A;  3PUB A;  4AU7 A;  1TL8 A;  3FRQ A;  2DYS H;  3WTV C;  2M2E A;  3JRA A;  2ZJ2 A;  2HOS A;  3Q0W A;  2FMY A;  3FXM A;  3EUK L;  2W57 A;  3ABK H;  3H5R A;  4Z6Y A;  3HOS A;  2IS6 A;  2H94 A;  3KE2 A;  4OMY A;  2HTJ A;  3GUD A;  2E36 A;  3JSO A;  4EGZ A;  1BM9 A;  4CCN A;  2BYV E;  2FJ1 A;  4A3K J;  2J5P A;  4U7B A;  2M45 A;  3HTU A;  3TP0 A;  3H36 A;  1A31 A;  3Q5F A;  3ZQL A;  1Y56 A;  3PNT A;  4JX4 A;  1IRG A;  3WE2 A;  1JUS A;  1OYI A;  3IH4 A;  1T39 A;  3ASN H;  3L2Q A;  4LOC A;  2FA5 A;  5F04 A;  2XDV A;  1YJW I;  3S1M J;  2BEO A;  1LVK A;  3EYI A;  3ON4 A;  2CMP A;  2HQN A;  1O4X A;  1BR1 A;  3SXY A;  3QKX A;  4X0G A;  1FX7 A;  1S6L A;  4A5M A;  5EFY A;  1USS A;  3A1Y A;  1QHH D;  2DFE A;  2IVM A;  3LSR A;  3AQT A;  1WJ5 A;  3QOE A;  2HPI A;  5JLX A;  3LHQ A;  2O03 A;  2Q2E A;  2HWV A;  4CHU A;  5TIS C;  2ZCM A;  4PJL A;  3CUQ B;  1G3Y A;  2JUC A;  1T38 A;  5FLX K;  5IYB J;  3ANP A;  1G8X A;  2JA2 A;  3FKI J;  2LBF B;  4PXI A;  2KHM A;  2JSP A;  5HDN A;  2ZCN A;  5ILS A;  3J80 Z;  3AG1 H;  4II3 A;  1GVD A;  1B1B A;  4GFB A;  2HFH A;  3HOT A;  4KIG A;  1KGS A;  3BR5 A;  4WXC A;  3HTJ A;  4BE1 A;  1I50 J;  3JRD A;  2OQG A;  2IA1 A;  3TDU C;  2BXZ A;  3HXL A;  2DTR A;  2HDC A;  1ULY A;  2DLL A;  4PJM A;  2HYF A;  1R23 A;  1B9M A;  2V1U A;  3S2H J;  5KVR A;  3PO3 J;  1VFC A;  1OFC X;  1H89 C;  1MBH A;  4QLC U;  2XGC A;  2QKM B;  3RDI A;  1V55 H;  4XID A;  2HNH A;  3VP5 A;  2Z16 A;  1GUU A;  3GTO J;  2NOG A;  2AQE A;  1V5F A;  2EZH A;  4YIF A;  3F23 A;  1MND A;  2ZNY A;  3X2Q H;  1ETY A;  2BE5 F;  2QIB A;  4AD9 A;  1LE8 B;  2K4B A;  2W4S A;  4RAY A;  3PSF A;  1TTY A;  1ZAO A;  3WU2 C;  4ENM A;  2UWM A;  5E17 F;  1R1T A;  3HOY J;  1K7A A;  1JXS A;  3DPU A;  4KIT B;  4HKU A;  3D5L A;  4M9S A;  3M1E A;  4M73 A;  2GFN A;  1XSX A;  3ESW B;  4L9T A;  2DJN A;  3RJP A;  2LF7 A;  3F1B A;  1ZGA A;  5D5U B;  5A2Q K;  1JJ6 C;  5HNH A;  1SD6 A;  4GXO A;  1TW2 A;  5LBQ A;  2HU9 A;  3LA3 A;  3SZP A;  3WHB A;  5HOO A;  5D18 A;  5GAE J;  1JKQ C;  4FTH A;  4I01 A;  1P2F A;  1HKT A;  1XDS A;  3I3L A;  2P4W A;  4D5F A;  3GFI A;  2NP5 A;  4UXN A;  2QBY A;  1FLI A;  3COL A;  4DYC A;  3CUO A;  3TW6 A;  3NAU A;  1TQP A;  4IHW A;  2GOX B;  2AHQ A;  5IT9 K;  5DAJ A;  1WJC A;  3DWL E;  5CYV A;  5D19 A;  4AM3 A;  1LE8 A;  4B09 A;  2JVG A;  4Q5S F;  4B4C A;  4M3G A;  4QIW N;  3O3K A;  3O2P E;  4S0H B;  2BW3 A;  2WBM A;  1RES A;  3CJQ B;  4RLF A;  4LJZ F;  3VYT B;  1X58 A;  4BDZ A;  2W84 A;  3IKT A;  1ZGJ A;  4II2 A;  1UG2 A;  3T1B A;  2UXI A;  1ENH A;  1OCP A;  2F6C A;  3LST A;  1WWX A;  3U21 A;  4BE2 A;  3TOA A;  1JT6 A;  3F0C A;  5J8C A;  1HA8 A;  2CH0 A;  2OCC H;  4OU0 A;  2UXX A;  5IP7 J;  3HBL A;  1OQY A;  1HDD C;  3ZP5 A;  3EUH C;  2XB5 A;  3SDG A;  4AIK A;  2CYY A;  5HS7 A;  3ROU A;  4AVZ A;  4A6E A;  2DU9 A;  2O5R A;  4JKZ A;  3OYF A;  2GZW A;  2GXA A;  3GZ5 A;  4LLG F;  3FXR A;  2VBW A;  2DOE A;  1MD0 A;  1VQK I;  3IWZ A;  3NAR A;  1U8B A;  4CZZ A;  3HKZ N;  2LKX A;  4Q47 A;  2XF7 A;  2CV2 A;  3P9K A;  2WB1 A;  4A12 A;  1OCO H;  3K4N A;  3RPQ A;  3BG7 A;  3BC8 A;  3HHG A;  3SYT A;  3L2V A;  4IHT A;  1I1S A;  3O60 A;  5CXI A;  5LFA A;  2Y30 A;  5B1A H;  2FNP A;  4EM1 A;  2I5U A;  2ZXW H;  3G1L A;  5LHH A;  1VQO I;  4C2M A;  4CA0 A;  3GVA A;  4A2U A;  2IS1 A;  2ZCX A;  2DJI A;  5GPA A;  2QKO A;  3HE0 A;  1P4A A;  2JPB A;  1DU6 A;  2ZXI A;  4A3D J;  2KIU A;  1WJF A;  1O57 A;  4EM2 A;  1MJ9 A;  1YE9 A;  1IW7 F;  4B3X A;  4IHV A;  1E2X A;  1OR7 C;  3KYL A;  4AUX A;  4C2T A;  5FO5 A;  2HDD A;  1SFK A;  2QKL B;  5D8L B;  2DN0 A;  5FLX Z;  5FRN A;  2BV6 A;  2PFB A;  3K4C A;  5L3G A;  2E34 A;  2VAS A;  1QPI A;  1YG2 A;  3BR1 A;  2P0W A;  1OYY A;  5E3O A;  3PFI A;  1GDT A;  4I0B A;  4I09 A;  1X2N A;  3VWB A;  1P92 A;  1B6A A;  4IXA A;  5BOX A;  4KT5 C;  2R7Q A;  1ZQ3 P;  2FE3 A;  4OMZ A;  2R3S A;  1T33 A;  3BTI A;  1POG A;  3HTA A;  2GBY A;  3MZ8 A;  4XRM A;  1FOY A;  2FF4 A;  1MZB A;  4HX8 A;  5AQC A;  2LDU A;  3G2B A;  4A5N A;  2R4G A;  4RGR A;  1OCT C;  2ZME C;  3HJE A;  3FXK A;  3CC2 I;  2PBI A;  4LIU A;  2F5V A;  4MNU A;  4PJN A;  3DTI A;  4F55 A;  5J47 A;  4NN1 A;  3OR1 C;  2DOF A;  3VUQ A;  2E71 A;  4C3H J;  2ELH A;  4V2G A;  2V1D A;  3S5R A;  1AA7 A;  3MFK A;  3F8N A;  4UUT A;  2LKS A;  2VQL A;  2NVT J;  3VVX A;  2D1V A;  3BCA A;  2NOJ B;  5KHD A;  1C0W A;  2HI3 A;  3KYC B;  2JVH A;  3NWS A;  3OYG A;  4BJ5 C;  2KIS A;  1W5S A;  1BR4 A;  3KZY A;  3AG3 H;  2MSY A;  3H35 A;  4RB0 A;  1MH4 A;  1EH6 A;  2VQH A;  3GFM A;  4EJV A;  1FJL A;  3KP3 A;  3I0T A;  2H6C A;  2VLA A;  3OYC A;  1MNE A;  3BPV A;  4FIS A;  1YLF A;  3F8F A;  1A6I A;  4BDY A;  1T56 A;  2DTZ A;  3N05 A;  2QWW A;  2M3A A;  4YII A;  2VT3 A;  3HSE A;  1YW7 A;  1ZN2 A;  3RCO A;  2YX7 A;  1MBJ A;  2DDA A;  4C3J J;  2IGO A;  2CV0 A;  4XN0 A;  2VL8 A;  4CUG A;  4CXF A;  5A2Q Z;  4NHJ A;  5IYC J;  2FRH A;  5DM7 F;  2G0E A;  2LH9 A;  1D8J A;  1P7I A;  2R7V A;  4ETS A;  3I54 A;  2R5Z A;  2R7U A;  5E79 C;  2O7T A;  1R7J A;  3PL8 A;  3L00 A;  2UXH A;  3G1O A;  2V9K A;  3VW2 A;  1U5T C;  2W7N A;  2V9V A;  3JTG A;  1MJB A;  2E1C A;  5FMP A;  3WTX C;  2CJJ A;  3CCS I;  4KDP A;  5IT9 Z;  1Y1W J;  3K9T A;  2XAH A;  2EIL H;  3S16 J;  1N75 A;  4P9U A;  4BGD A;  2R7D A;  5HLT A;  4J19 A;  3KP4 A;  3PQK A;  2K7L A;  3S93 A;  2A07 F;  1GT0 C;  1SD7 A;  3ECH A;  3KEO A;  3G73 A;  5EG0 B;  4AC6 A;  1IN8 A;  1MDM B;  2DG8 A;  4BQQ A;  1A36 A;  2K02 A;  3PNV A;  1MSF C;  2KKO A;  2HDW A;  3F3X A;  1KA8 A;  2DT5 A;  3P9T A;  1YTY A;  2DK5 A;  1QNT A;  4PK4 A;  5L3C A;  1YW9 A;  4J01 A;  3CCV I;  1JKP C;  3L9F A;  4LIT A;  3KKC A;  2DOD A;  2BOL A;  2VJI A;  3T6N A;  3HGG A;  2KMU A;  1MW7 A;  4LFU A;  3G4S I;  3KP2 A;  1YFH A;  3DV8 A;  3OYB A;  1BA5 A;  2LFB A;  4Y4R A;  2AO9 A;  3NRG A;  2UUZ A;  3LSP A;  3NEU A;  3BCG A;  2RKH A;  3KX2 A;  1X3U A;  4QPO A;  3FHZ A;  5FB2 A;  2CQQ A;  1UFM A;  4KMU X;  3L2U A;  4A69 C;  3LMM A;  1OR7 A;  3H9Q A;  2O7O A;  3TED A;  3GXO A;  3JRF A;  3ZRG A;  3ASO H;  2DQL A;  5EG0 A;  3JTH A;  1OMI A;  1SEU A;  1VQ5 I;  2HZD A;  1Z9C A;  2FQ3 A;  1W36 D;  1VQ7 I;  3QBM A;  1ZYR F;  1ETQ A;  2YU9 J;  2LY9 A;  1ZRD A;  2LY2 A;  3CF2 A;  3K70 D;  3C3W A;  4XLF A;  2F2E A;  5K5O A;  1I6H J;  1X2M A;  4HNU A;  3K6G A;  1R4M B;  3S8P A;  2ADU A;  2Y2Z A;  4Q4Z F;  2N8G A;  3FHN A;  2ZME A;  2X0L A;  4N4O B;  3WG9 A;  5FRO A;  1FP1 D;  2FX0 A;  3A03 A;  1OYW A;  5K7F A;  1Z77 A;  4CIC A;  1M1E B;  1QZZ A;  4PCQ A;  2QYO A;  2OD5 A;  1QRY A;  3HKZ A;  2QEN A;  3WTU C;  1U5T B;  3GFL A;  2LF8 A;  1LUJ B;  4ENK A;  1ZTR A;  3R4K A;  3PFY A;  1CF7 B;  4JNN A;  4G7O F;  4HF1 A;  4CCJ A;  2WAQ A;  2V1X A;  2JT1 A;  1N78 A;  2DW4 A;  3SWH A;  3SQN A;  4O5V A;  1W4M A;  2HKO A;  2X1D A;  2YVE A;  4A6D A;  3DBL B;  3KET A;  5BPD A;  1RZ4 A;  2KPM A;  4WWC A;  5K5R A;  2H09 A;  3GFJ A;  3U1D A;  4FQG A;  1BW6 A;  2XIG A;  3HUG A;  2IS2 A;  3W6V A;  4I0A A; 
#chains in the Genus database with same CATH homology
 3S15 J;  3VIB A;  3S2D J;  2YUS A;  5FKN A;  5HAW A;  2HYJ A;  3JRE A;  4A3J J;  3NPI A;  2XGD A;  5IP6 A;  4BY7 J;  3VVZ A;  1UHS A;  2COB A;  5C4X J;  2XPV A;  5FGL A;  4IEJ A;  5EYR A;  3GTM J;  1E3O C;  2OER A;  1LFU P;  3LWJ A;  4MO7 A;  3C2B A;  3GTQ J;  3BRU A;  4FE4 A;  3BJB A;  4BY1 J;  4L5E A;  1NK3 P;  4B3A A;  9ANT A;  3ZQG A;  3G1M A;  3S1Q J;  1ZGW A;  1ZK8 A;  2DA2 A;  4ICH A;  1S7E A;  4BBR J;  1B8I A;  2EZK A;  4X6A J;  4NDL A;  2NVX J;  2O9L A;  1MBE A;  3CMY A;  1B72 B;  3MKL A;  4C2M J;  3ZOB A;  1TC3 C;  1HOM A;  3IV5 A;  2RAS A;  5EZH A;  3I4M J;  2G7G A;  1Z0X A;  1EF4 A;  1WGX A;  3B6A A;  3FRQ A;  5F1J A;  1Q1V A;  2Y31 A;  2FBQ A;  2M2E A;  3PO2 J;  3JRA A;  2HOS A;  1G2H A;  3Q0W A;  3OSF A;  1I3Q J;  3HOU J;  3BQY A;  4HNV A;  3B81 A;  4DW6 A;  3CRJ A;  3BHQ A;  4JX5 A;  5JLW A;  4GCL A;  5E3M A;  3NNR A;  1VI0 A;  3KNW A;  2ZB9 A;  3BQZ A;  2JK3 A;  2P81 A;  2KDZ A;  1CQT A;  1YRN B;  1MBK A;  2FJ1 A;  4A3K J;  3MNL A;  5C4J J;  2O8K A;  5H9T A;  4MFD A;  5K7Z A;  3TP0 A;  3RD3 A;  2TRT A;  1AKH B;  4W97 A;  5GPC A;  2VI6 A;  3ZQL A;  3BG9 A;  2ZOZ A;  4JX4 A;  1F43 A;  1JUS A;  2WGB A;  3IH4 A;  4Y52 J;  3UKG A;  4AF5 A;  1SGM A;  4LOC A;  4A3B J;  5F04 A;  2MG4 A;  4M3E A;  5EDN A;  3S1M J;  1ETO A;  2IAI A;  3ON4 A;  1O4X A;  1MBG A;  3QKX A;  1XC5 A;  4UUS A;  2JA6 J;  1IC8 A;  2HKU A;  5EFY A;  4FCY A;  2R93 J;  3LSR A;  3AQT A;  3S1N J;  4M6V A;  2GUH A;  2E1O A;  5JLX A;  3LHQ A;  4B1R A;  5IPA A;  3HTH A;  2DMP A;  2MW8 A;  3BR3 A;  2UXO A;  2ZCM A;  1F36 A;  2DMQ A;  3K2A A;  2QCO A;  4DZP A;  2X6O A;  2XRL A;  5IYB J;  3ANP A;  1GV2 A;  2LR8 A;  3IH2 A;  5EF6 A;  4I6Z A;  5D1R A;  1YRN A;  3JRH A;  3FKI J;  4PXI A;  2UXU A;  2ZCN A;  1GV5 A;  2W48 A;  1BL0 A;  2R92 J;  2RHA A;  5E3N A;  1GVD A;  4GFB A;  1IV6 A;  4V2F A;  2JA7 J;  2TCT A;  3QPS A;  1WH5 A;  3BR5 A;  3HTJ A;  4FE7 A;  4MK6 A;  1FEX A;  1I50 J;  3JRD A;  2FQ4 A;  2L9R A;  1ZKG A;  3AQS A;  4QSH A;  2M8G X;  2GM4 A;  2F07 A;  2XPW A;  4D7M A;  3S2H J;  3PO3 J;  1VFC A;  1OFC X;  3VPR A;  1MBF A;  1MBH A;  1TWH J;  1H89 C;  1HF0 A;  1IGN A;  2XGC A;  5C3E J;  4M3F A;  3BG3 A;  2REK A;  3CQZ J;  4XID A;  2LK2 A;  1MNM C;  1FIP A;  4XK4 A;  2G7L A;  1JGG A;  4YZE A;  3VP5 A;  1GUU A;  2YS9 A;  2XDN A;  2ECB A;  3DEW A;  3GTO J;  2NOG A;  2XGE A;  1B8I B;  3V78 A;  2EZH A;  2PMZ N;  4A93 J;  3BR0 A;  1ETY A;  2E19 A;  2QIB A;  1LE8 B;  2EH3 A;  2VPR A;  2D5V A;  5FKL A;  1TWG J;  2R0Q C;  1ETK A;  1W0T A;  4ABZ A;  3ZQH A;  1ZR4 A;  3HOY J;  3RZO J;  1WH7 A;  1UI6 A;  2IBD A;  2KT0 A;  3GTK J;  2PZ9 A;  4HKU A;  1W0U A;  4A3F J;  2B63 J;  3M4O J;  2WB1 N;  5J3L A;  4A3M J;  2GFN A;  2DJN A;  2E2H J;  3F1B A;  2LTP A;  1A5J A;  1JJ6 C;  3IH3 A;  1WPK A;  4D7N A;  2XB0 X;  2RAE A;  5E3L A;  3WHB A;  5CW8 A;  2ID6 A;  5D18 A;  3PM1 A;  1JKQ C;  3Q0U A;  4FTH A;  4D5F A;  2LVS A;  2DG7 A;  2Y9Y A;  1JTY A;  2NP5 A;  4XIC A;  2DA6 A;  3COL A;  4DYC A;  3TW6 A;  2CQX A;  2VKV A;  3NAU A;  5EEA A;  4IHW A;  4EEF G;  3JSJ A;  5DS9 A;  2AHQ A;  5DAJ A;  3ZQC A;  5F27 A;  5D19 A;  3HGY A;  2XSD C;  3CDL A;  1LE8 A;  1FTT A;  5FJ8 J;  4UUS B;  3TW7 A;  2V57 A;  5C44 J;  4B4C A;  4M3G A;  4DZJ A;  4QIW N;  4S0H B;  1JUM A;  1RES A;  2DA3 A;  2DA7 A;  1X58 A;  1IDZ A;  2LP0 A;  3GTG J;  3RQI A;  5F0F A;  2UXI A;  1UG2 A;  1ENH A;  1OCP A;  1WI3 A;  1XG1 A;  4D5C A;  3FK6 A;  2EBI A;  2CUE A;  1JT6 A;  2LD5 A;  3F0C A;  2GEN A;  4A3G J;  2R7Z J;  3O8H A;  1JKR C;  5M3M J;  2HXI A;  4ME9 A;  3OIO A;  3BTJ A;  3HBL A;  5IP7 J;  2ID3 A;  2JN6 A;  2K40 A;  1JUP A;  3SFI A;  1RKW A;  1HDD C;  3G7R A;  3SDG A;  2XB5 A;  4RBO A;  4C3I J;  1QVU A;  4JKZ A;  3Q3S A;  3BT9 A;  1APL C;  3V6G A;  2CRG A;  1WCM J;  1U8B A;  3NAR A;  5GP9 A;  3D1N I;  3HKZ N;  3H3V K;  2LKX A;  4AYB N;  3Q0V A;  4MXM A;  3GTJ J;  2NX4 A;  1JTX A;  2JMW A;  5CXI A;  3O60 A;  2Y30 A;  4UDS A;  3QQA A;  2QTQ A;  1HDP A;  3G1L A;  2Y0S N;  1U9N A;  5FKM A;  4NEL A;  2R5Y B;  2ZCX A;  2VKE A;  3RZD J;  5GPA A;  2QKO A;  1RR7 A;  5EGO A;  3HE0 A;  1DU6 A;  4GCK A;  2NS8 A;  4A3D J;  2IU5 A;  2OPT A;  2ZOY A;  2ME6 A;  3BG5 A;  4A3C J;  2G3B A;  3NXC A;  4A3I J;  1JJ8 C;  3ANG A;  4IHV A;  2HOA A;  4AUX A;  1ETX A;  1OJL A;  4JL3 A;  2ME0 A;  2L7F P;  3JRC A;  3VW1 A;  1ETV A;  1ITY A;  4JYK A;  3IUV A;  2HDD A;  5IP9 J;  5HOD A;  3FIW A;  1P7J A;  2DN0 A;  3GTL J;  4BBS J;  3B6C A;  2K9Q A;  5IOY A;  1QPI A;  3ON2 A;  3BR1 A;  3HIM A;  3MN2 A;  5BNG A;  5E3O A;  2NVY J;  1GDT A;  2H8R A;  1X2N A;  4I76 A;  3GEU A;  2JJ7 A;  1ZQ3 P;  1HLV A;  3VOX A;  3S17 J;  4IHY A;  4ACI A;  4KWA A;  5FHP A;  1Y1V J;  5HSZ A;  1T33 A;  3BTI A;  1POG A;  3HTA A;  2GBY A;  4MLO A;  4XRM A;  5F0H A;  2E2I J;  1AU7 A;  2R5Y A;  2OI8 A;  3BNI A;  5CXG A;  5AQC A;  1OCT C;  3I4N J;  3HDD A;  3BR6 A;  2DMN A;  1K83 J;  1MSE C;  3CCY A;  2E2J J;  4NN1 A;  2HQ5 A;  2WV1 A;  3VUQ A;  1IUF A;  4C3H J;  1ZR2 A;  3KZ9 A;  1MH3 A;  3L1P A;  1RKT A;  4V2G A;  3RH2 A;  3S5R A;  3OOU A;  3BR2 A;  4UUT A;  2NVT J;  1XS9 A;  2MGQ A;  3VVX A;  2L0K A;  2ELK A;  2EZI A;  2HI3 A;  2HYT A;  5FKO A;  3JRG A;  3JR9 A;  5EZG A;  2DA5 A;  2HOT A;  1IDY A;  4L62 A;  4A3E J;  5DTD A;  3PPB A;  3JRI A;  2MSY A;  2PBX A;  1FJL A;  1MH4 A;  2L7Z A;  1UI5 A;  2QWT A;  3DPJ A;  1H8A C;  2WUI A;  4FIS A;  4M3B A;  2EZL A;  1NTC A;  1A6I A;  1T56 A;  2DTZ A;  2K9N A;  5M5W J;  3HTI A;  2NS7 A;  3HB9 A;  4XRS G;  4RDU A;  5J1U A;  5FKK A;  3TP3 A;  3SJM A;  1MBJ A;  1TWF J;  3HM5 A;  4JP0 A;  5F0C A;  4C3J J;  2NVQ J;  3FIS A;  5HBU A;  2YVH A;  3ZQF A;  1BW5 A;  4GCT A;  3HOX J;  3QPL A;  5IYC J;  2G0E A;  1P7I A;  2R5Z A;  4CYC A;  4QTR A;  1AHD P;  2O7T A;  1R9T J;  2H1K A;  2UXH A;  3G1O A;  2Q24 A;  3VW2 A;  3JRB A;  3LJL A;  4M3D A;  1IRZ A;  2DMU A;  4Y7N J;  4IHX A;  2CJJ A;  5J1Y A;  5FMP A;  1IJW C;  3O8G A;  2M9H A;  5J1R A;  3A02 A;  1Y1W J;  2G7S A;  4X1E A;  3S1R J;  5EGO B;  4BXX J;  3S16 J;  2DA4 A;  4J19 A;  4AC0 A;  1GT0 C;  5F08 A;  3S14 J;  3LSJ A;  2HXO A;  3LOC A;  5EG0 B;  3GBG A;  3E7Q A;  4AC6 A;  5K58 A;  2DG8 A;  2XPU A;  1MSF C;  5FLV A;  2D6Y A;  3C07 A;  4GFL A;  1FIA A;  1U9O A;  3P9T A;  4MIM A;  1DU0 A;  1ETW A;  2L7M P;  1JKP C;  4A3L J;  3KKC A;  2GLO A;  2ECC A;  3HGG A;  3T6N A;  4GFK A;  3HOZ J;  5M3F J;  1HCR A;  1K61 A;  5IYD J;  1BA5 A;  2WAQ N;  1VF9 A;  2LFB A;  3LSG A;  2AO9 A;  3NRG A;  3VW0 A;  3LSP A;  3BCG A;  3A01 B;  3EUP A;  2Y9Z A;  3NI7 A;  2IEK A;  2QF7 A;  1SFO J;  3BTL A;  2CQQ A;  2CUF A;  4A69 C;  2NP3 A;  4CGR A;  2O7O A;  2EQR A;  3H0G J;  3TED A;  2VUM J;  3JRF A;  1B72 A;  3PAS A;  3FK7 A;  3OSG A;  2UXP A;  3MVP A;  2M0C A;  5EG0 A;  3RKQ A;  1JT0 A;  1QVT A;  2JA8 J;  1FTZ A;  2JA5 J;  3VVY A;  1NK2 P;  3QBM A;  1ETQ A;  2FD5 A;  2YU9 J;  3EGQ A;  2LY9 A;  2M34 A;  5C4Y A;  4JX6 A;  4DYQ A;  3DCF A;  1BJZ A;  1I6H J;  1X2M A;  2I10 A;  2X9D A;  4G12 A;  4W1U A;  1SAN A;  2Y2Z A;  4XRS A;  4BKX A;  2QOP A;  1LFB A;  2CU7 A;  2N8G A;  3LNQ A;  2DMT A;  1AKH A;  3CWR A;  3A01 A;  2FX0 A;  5FLM J;  2JWT A;  1RPW A;  3A03 A;  1PUF B;  3KKD A;  5K7F A;  1H88 C;  3M3Y J;  1IG7 A;  1Z77 A;  1D5Y A;  3G56 A;  1RET A;  1QRY A;  4MFE A;  3VOK A;  2R5Z B;  1JKO C;  4CYC B;  5M5Y J;  2OF7 A;  3BTC A;  4DYR A;  1ZTR A;  4JNN A;  3HEF A;  2X48 A;  1UMQ A;  5M5X J;  3GTP J;  3E7L A;  2W53 A;  1TWC J;  1TWA J;  3HOW J;  3HOV J;  3CJD A;  2LLK A;  2YVE A;  2DA1 A;  3K7A J;  3ZQI A;  1ORK A;  2K9S A;  1U78 A;  1BW6 A;  5K7H A;  3GZI A;  3W6V A;  1PUF A;  3WHC A;  1VND A;  5IOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...