2GUHA

Crystal structure of the putative tetr-family transcriptional regulator from rhodococcus sp. rha1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
b'RTAEQSRSLIVDAAGRAFATRPYREITLKDIAEDAGVSAPLIIKYFGSKEQLFDALVDFRAAAEIVFSGPLDGLGERMVSMFARPLEPYKPLSLNILFMSGPSEESSRKLRANYSAQMIDALAERLPGRDARLRAELVMSMLTGLAVMRRKMMQEHATGTPEEVVAHYAPLVQELLDGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
molecule tags Transcription
source organism Rhodococcus sp.
publication title Crystal Structure of the Putative TetR-family Transcriptional Regulator from Rhodococcus sp. RHA1
rcsb
total genus 60
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17920 TetR_C_16 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2guhA00
2FD5A 1JUPA 2RHAA 2TRTA 5F08A 4I76A 3BR3A 1T33A 4M3FA 5AQCA 5HBUA 2UXIA 1JT6A 3BTIA 1BJZA 4D7NA 1ZK8A 3JSJA 4X1EA 2DG8A 3KNWA 4GFKA 3RH2A 4KWAA 3EGQA 3IH4A 5C4YA 1QVUA 2ZOYA 5EZGA 4AC0A 2RASA 2NS8A 2UXPA 4GFLA 4M3BA 3CWRA 3DCFA 1A6IA 3GEUA 3IH2A 4JL3A 3BQYA 3NPIA 3C07A 4ACIA 3TP0A 4M3DA 2XGEA 2NX4A 3BTLA 4UDSA 5D19A 4MO7A 5CXGA 3FRQA 2HQ5A 3IUVA 4GCTA 4AC6A 2UXOA 2JJ7A 3COLA 2HXIA 3ZQGA 2QWTA 5J1YA 3Q3SA 2QKOA 4V2GA 3ZQLA 3VPRA 3KKDA 2OF7A 3BTCA 5FKLA 3QQAA 2FJ1A 1JUMA 2TCTA 2QIBA 1RKWA 5F27A 2Q24A 2ID6A 2XPVA 2GUHA 3NNRA 4JYKA 3WHCA 5F1JA 4I6ZA 2ZOZA 3F0CA 3BJBA 3QBMA 3V78A 1T56A 5K7HA 2O7TA 5FKKA 3VOKA 5IP6A 3S5RA 5FKNA 2GBYA 3AQSA 5F0FA 3G1MA 5J1UA 1U9OA 2XGCA 4W1UA 3BTJA 5EZHA 2ZB9A 3B6CA 5J1RA 3NI7A 5CW8A 3BCGA 5DAJA 3G56A 2NP5A 2VKVA 4JKZA 3ANGA 4CGRA 3NRGA 2QOPA 3PPBA 5CXIA 5GPAA 3DEWA 2G3BA 2Y31A 4DW6A 3E7QA 3HTAA 3BHQA 5D1RA 3LSPA 4XK4A 2O7OA 2NP3A 5FHPA 1VI0A 2IAIA 3HTHA 4W97A 4PXIA 4AF5A 3QPSA 3TP3A 3VVXA 3O8GA 1UI5A 2DG7A 3BQZA 3G1LA 3V6GA 2YVEA 5IOZA 2QTQA 5K7ZA 3GZIA 5IOYA 3ZQHA 2XPWA 2GENA 2UXUA 2F07A 2FBQA 4M3EA 3B6AA 4D5CA 1Z77A 3CRJA 2IBDA 5FKMA 2IEKA 3HTJA 5F0CA 3QPLA 4NN1A 3C2BA 3LOCA 2WGBA 3VP5A 3SFIA 4M3GA 2UXHA 3LHQA 3F1BA 4V2FA 2V57A 2Y30A 2FQ4A 2FX0A 3EUPA 4HKUA 3HGYA 3AQTA 2ID3A 4MK6A 3CDLA 2I10A 1JTXA 1ORKA 2DTZA 1Z0XA 2X6OA 5FGLA 3KKCA 3T6NA 3SDGA 1QPIA 2G0EA 2ZCMA 3O8HA 3G7RA 4AUXA 2JK3A 4GCLA 3BR0A 1RPWA 2WV1A 3ON2A 4B1RA 2ZCXA 1SGMA 3LJLA 5F0HA 2XGDA 3ANPA 3BR2A 3BR1A 2YVHA 3PM1A 1ZKGA 3FK7A 2X9DA 2PZ9A 4B3AA 2HYTA 3VVZA 5EFYA 2OERA 3BR5A 3Q0VA 1U9NA 3ON4A 2XRLA 1JTYA 1UI6A 2OI8A 4ABZA 2HYJA 2D6YA 3Q0UA 4YZEA 3QKXA 2IU5A 3CJDA 2HKUA 3BRUA 3HGGA 5GP9A 3VOXA 2G7LA 3VVYA 2XB5A 3VW1A 3BR6A 3FK6A 3VIBA 3VUQA 3CCYA 2WUIA 3PASA 4D7MA 3BNIA 5FKOA 3Q0WA 5K7FA 3VW0A 5FMPA 4L62A 3NXCA 3P9TA 3WHBA 2QCOA 3G1OA 3HIMA 1RKTA 3KZ9A 3HE0A 1JT0A 2ZCNA 5GPCA 4JNNA 5J3LA 2EH3A 4ICHA 3BT9A 4GCKA 2VKEA 2G7GA 5HSZA 3MNLA 5IPAA 2HXOA 2XDNA 2XPUA 1JUSA 2G7SA 2VPRA 3LWJA 3ZQFA 3RD3A 5EYRA 3IH3A 4D5FA 3O60A 2REKA 2GFNA 3LSJA 2W53A 5F04A 4ME9A 5HAWA 3MVPA 4G12A 2OPTA 2RAEA 2Y2ZA 2PBXA 2NS7A 3LSRA 3DPJA 3HTIA 5D18A 3VW2A 5H9TA 3ZQIA 3B81A 3FIWA 4NELA 1QVTA 5K58A 4MXMA
chains in the Genus database with same CATH superfamily
2FD5A 2R7WA 1JUPA 2RHAA 2R7VA 2R7OA 2TRTA 5F08A 4I76A 3BR3A 1T33A 4M3FA 2R7SA 5AQCA 5HBUA 2UXIA 1JT6A 2ZY9A 3BTIA 1BJZA 4D7NA 1ZK8A 3JSJA 4X1EA 2DG8A 3KNWA 4GFKA 3RH2A 4KWAA 3EGQA 3IH4A 5C4YA 1QVUA 2ZOYA 5EZGA 4AC0A 2RASA 2NS8A 2UXPA 4GFLA 4M3BA 3CWRA 3DCFA 3KYLA 3SWHA 1A6IA 3GEUA 3IH2A 4JL3A 3BQYA 3NPIA 3C07A 4ACIA 3TP0A 4M3DA 2XGEA 2NX4A 3BTLA 4UDSA 5D19A 4MO7A 5CXGA 4U9NA 3FRQA 2HQ5A 3IUVA 4GCTA 4AC6A 2UXOA 2JJ7A 3COLA 2PFVA 2HXIA 3ZQGA 2QWTA 5J1YA 3Q3SA 2QKOA 4V2GA 3ZQLA 3VPRA 3KKDA 2OF7A 3BTCA 5FKLA 3QQAA 2FJ1A 1JUMA 2TCTA 2QIBA 1RKWA 5F27A 2Q24A 2ID6A 2R7RA 2XPVA 2GUHA 3NNRA 4JYKA 3WHCA 5F1JA 2FJI1 4I6ZA 2R7UA 2ZOZA 3F0CA 3BJBA 3QBMA 3V78A 1T56A 5K7HA 2O7TA 5FKKA 3VOKA 5IP6A 3S5RA 5FKNA 2GBYA 3AQSA 5F0FA 5J1UA 3G1MA 1U9OA 4IRVA 2XGCA 4W1UA 3BTJA 5EZHA 2ZB9A 3B6CA 5J1RA 3NI7A 5CW8A 3BCGA 5DAJA 3G56A 3FHNA 2NP5A 2VKVA 4JKZA 3ANGA 4CGRA 4WIBA 3NRGA 2QOPA 3PPBA 5CXIA 5GPAA 3DEWA 2G3BA 2Y31A 4DW6A 3E7QA 3HTAA 3BHQA 5D1RA 3LSPA 4XK4A 2O7OA 4OD4A 2NP3A 5FHPA 1VI0A 2IAIA 3HTHA 4W97A 4PXIA 4AF5A 3QPSA 3TP3A 3VTIA 3VVXA 3O8GA 1UI5A 2DG7A 3BQZA 3V6GA 3G1LA 2YVEA 5IOZA 2QTQA 5K7ZA 3GZIA 5IOYA 3ZQHA 2XPWA 2GENA 2UXUA 2F07A 2FBQA 4OD5A 4M3EA 3B6AA 4D5CA 1Z77A 3CRJA 2IBDA 2R7TA 5FKMA 2IEKA 3HTJA 4DVYP 5F0CA 3QPLA 4NN1A 3C2BA 3LOCA 2WGBA 3VP5A 3SFIA 4M3GA 2UXHA 3LHQA 3F1BA 4V2FA 2V57A 2Y30A 2FQ4A 2FX0A 3EUPA 4HKUA 3HGYA 3AQTA 2ID3A 4MK6A 3CDLA 2I10A 2B3WA 1JTXA 1ORKA 2DTZA 1Z0XA 2X6OA 5FGLA 3KKCA 3T6NA 3SDGA 1QPIA 2G0EA 2ZCMA 3O8HA 3G7RA 4AUXA 2JK3A 4GCLA 3BR0A 1RPWA 2WV1A 3ON2A 4B1RA 2ZCXA 1SGMA 3LJLA 5F0HA 2XGDA 3ANPA 3BR2A 3BR1A 2YVHA 3PM1A 1ZKGA 3FK7A 2X9DA 2PZ9A 4B3AA 2HYTA 2B1EA 3VVZA 5EFYA 2OERA 3BR5A 3Q0VA 1U9NA 4U9LA 3ON4A 2XRLA 1JTYA 5CQGA 1UI6A 2OI8A 4ABZA 2HYJA 2D6YA 3Q0UA 4YZEA 3QKXA 2IU5A 3CJDA 2HKUA 3BRUA 3HGGA 5GP9A 3VOXA 2G7LA 3VVYA 2XB5A 4C2MA 3VW1A 3BR6A 3FK6A 3VIBA 3VUQA 3CCYA 2WUIA 3PASA 4D7MA 3BNIA 5FKOA 3Q0WA 5K7FA 3VW0A 5FMPA 4L62A 3NXCA 3P9TA 3WHBA 2QCOA 2R7QA 3G1OA 3HIMA 1RKTA 3KZ9A 3HE0A 1JT0A 2ZCNA 5GPCA 4JNNA 2A2FX 5J3LA 3NS4A 2EH3A 4ICHA 3BT9A 4GCKA 2VKEA 2G7GA 5HSZA 3MNLA 5IPAA 2HXOA 2XDNA 2XPUA 1JUSA 2G7SA 2VPRA 3LWJA 3ZQFA 3RD3A 5EYRA 3IH3A 4D5FA 3O60A 2REKA 2GFNA 3LSJA 2W53A 5F04A 4ME9A 5HAWA 3MVPA 4G12A 2OPTA 2RAEA 2Y2ZA 2PBXA 2NS7A 3LSRA 3DPJA 3HTIA 5D18A 3VW2A 5H9TA 3K8PC 3ZQIA 3B81A 3DU6A 3FIWA 2R7XA 4NELA 2YVXA 1QVTA 3DU5A 5K58A 4MXMA
chains in the Genus database with same CATH topology
2FD5A 1JUPA 2RHAA 2TRTA 5F08A 4I76A 3BR3A 1T33A 4M3FA 5AQCA 5HBUA 2UXIA 1JT6A 3BTIA 1BJZA 4D7NA 1ZK8A 3JSJA 4X1EA 2DG8A 3KNWA 4GFKA 3RH2A 4KWAA 3EGQA 3IH4A 5C4YA 1QVUA 2ZOYA 5EZGA 4AC0A 2RASA 2NS8A 2UXPA 4GFLA 4M3BA 3CWRA 3DCFA 1A6IA 3GEUA 3IH2A 4JL3A 3BQYA 3NPIA 3C07A 4ACIA 3TP0A 4M3DA 2XGEA 2NX4A 3BTLA 4UDSA 5D19A 4MO7A 5CXGA 3FRQA 2HQ5A 3IUVA 4GCTA 4AC6A 2UXOA 2JJ7A 3COLA 2HXIA 3ZQGA 2QWTA 5J1YA 3Q3SA 2QKOA 4V2GA 3ZQLA 3VPRA 3KKDA 2OF7A 3BTCA 5FKLA 3QQAA 2FJ1A 1JUMA 2TCTA 2QIBA 1RKWA 5F27A 2Q24A 2ID6A 2XPVA 2GUHA 3NNRA 4JYKA 3WHCA 5F1JA 4I6ZA 2ZOZA 3F0CA 3BJBA 3QBMA 3V78A 1T56A 5K7HA 2O7TA 5FKKA 3VOKA 5IP6A 3S5RA 5FKNA 2GBYA 3AQSA 5F0FA 3G1MA 5J1UA 1U9OA 2XGCA 4W1UA 3BTJA 5EZHA 2ZB9A 3B6CA 5J1RA 3NI7A 5CW8A 3BCGA 5DAJA 3G56A 2NP5A 2VKVA 4JKZA 3ANGA 4CGRA 3NRGA 2QOPA 3PPBA 5CXIA 5GPAA 3DEWA 2G3BA 2Y31A 4DW6A 3E7QA 3HTAA 3BHQA 5D1RA 3LSPA 4XK4A 2O7OA 2NP3A 5FHPA 1VI0A 2IAIA 3HTHA 4W97A 4PXIA 4AF5A 3QPSA 3TP3A 3VVXA 3O8GA 1UI5A 2DG7A 3BQZA 3G1LA 3V6GA 2YVEA 5IOZA 2QTQA 5K7ZA 3GZIA 5IOYA 3ZQHA 2XPWA 2GENA 2UXUA 2F07A 2FBQA 4M3EA 3B6AA 4D5CA 1Z77A 3CRJA 2IBDA 5FKMA 2IEKA 3HTJA 5F0CA 3QPLA 4NN1A 3C2BA 3LOCA 2WGBA 3VP5A 3SFIA 4M3GA 2UXHA 3LHQA 3F1BA 4V2FA 2V57A 2Y30A 2FQ4A 2FX0A 3EUPA 4HKUA 3HGYA 3AQTA 2ID3A 4MK6A 3CDLA 2I10A 1JTXA 1ORKA 2DTZA 1Z0XA 2X6OA 5FGLA 3KKCA 3T6NA 3SDGA 1QPIA 2G0EA 2ZCMA 3O8HA 3G7RA 4AUXA 2JK3A 4GCLA 3BR0A 1RPWA 2WV1A 3ON2A 4B1RA 2ZCXA 1SGMA 3LJLA 5F0HA 2XGDA 3ANPA 3BR2A 3BR1A 2YVHA 3PM1A 1ZKGA 3FK7A 2X9DA 2PZ9A 4B3AA 2HYTA 3VVZA 5EFYA 2OERA 3BR5A 3Q0VA 1U9NA 3ON4A 2XRLA 1JTYA 1UI6A 2OI8A 4ABZA 2HYJA 2D6YA 3Q0UA 4YZEA 3QKXA 2IU5A 3CJDA 2HKUA 3BRUA 3HGGA 5GP9A 3VOXA 2G7LA 3VVYA 2XB5A 3VW1A 3BR6A 3FK6A 3VIBA 3VUQA 3CCYA 2WUIA 3PASA 4D7MA 3BNIA 5FKOA 3Q0WA 5K7FA 3VW0A 5FMPA 4L62A 3NXCA 3P9TA 3WHBA 2QCOA 3G1OA 3HIMA 1RKTA 3KZ9A 3HE0A 1JT0A 2ZCNA 5GPCA 4JNNA 5J3LA 2EH3A 4ICHA 3BT9A 4GCKA 2VKEA 2G7GA 5HSZA 3MNLA 5IPAA 2HXOA 2XDNA 2XPUA 1JUSA 2G7SA 2VPRA 3LWJA 3ZQFA 3RD3A 5EYRA 3IH3A 4D5FA 3O60A 2REKA 2GFNA 3LSJA 2W53A 5F04A 4ME9A 5HAWA 3MVPA 4G12A 2OPTA 2RAEA 2Y2ZA 2PBXA 2NS7A 3LSRA 3DPJA 3HTIA 5D18A 3VW2A 5H9TA 3ZQIA 3B81A 3FIWA 4NELA 1QVTA 5K58A 4MXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD5 A;  1JUP A;  2RHA A;  2TRT A;  5F08 A;  4I76 A;  3BR3 A;  1T33 A;  4M3F A;  5AQC A;  5HBU A;  2UXI A;  1JT6 A;  3BTI A;  1BJZ A;  4D7N A;  1ZK8 A;  3JSJ A;  4X1E A;  2DG8 A;  3KNW A;  4GFK A;  3RH2 A;  4KWA A;  3EGQ A;  3IH4 A;  5C4Y A;  1QVU A;  2ZOY A;  5EZG A;  4AC0 A;  2RAS A;  2NS8 A;  2UXP A;  4GFL A;  4M3B A;  3CWR A;  3DCF A;  1A6I A;  3GEU A;  3IH2 A;  4JL3 A;  3BQY A;  3NPI A;  3C07 A;  4ACI A;  3TP0 A;  4M3D A;  2XGE A;  2NX4 A;  3BTL A;  4UDS A;  5D19 A;  4MO7 A;  5CXG A;  3FRQ A;  2HQ5 A;  3IUV A;  4GCT A;  4AC6 A;  2UXO A;  2JJ7 A;  3COL A;  2HXI A;  3ZQG A;  2QWT A;  5J1Y A;  3Q3S A;  2QKO A;  4V2G A;  3ZQL A;  3VPR A;  3KKD A;  2OF7 A;  3BTC A;  5FKL A;  3QQA A;  2FJ1 A;  1JUM A;  2TCT A;  2QIB A;  1RKW A;  5F27 A;  2Q24 A;  2ID6 A;  2XPV A;  2GUH A;  3NNR A;  4JYK A;  3WHC A;  5F1J A;  4I6Z A;  2ZOZ A;  3F0C A;  3BJB A;  3QBM A;  3V78 A;  1T56 A;  5K7H A;  2O7T A;  5FKK A;  3VOK A;  5IP6 A;  3S5R A;  5FKN A;  2GBY A;  3AQS A;  5F0F A;  3G1M A;  5J1U A;  1U9O A;  2XGC A;  4W1U A;  3BTJ A;  5EZH A;  2ZB9 A;  3B6C A;  5J1R A;  3NI7 A;  5CW8 A;  3BCG A;  5DAJ A;  3G56 A;  2NP5 A;  2VKV A;  4JKZ A;  3ANG A;  4CGR A;  3NRG A;  2QOP A;  3PPB A;  5CXI A;  5GPA A;  3DEW A;  2G3B A;  2Y31 A;  4DW6 A;  3E7Q A;  3HTA A;  3BHQ A;  5D1R A;  3LSP A;  4XK4 A;  2O7O A;  2NP3 A;  5FHP A;  1VI0 A;  2IAI A;  3HTH A;  4W97 A;  4PXI A;  4AF5 A;  3QPS A;  3TP3 A;  3VVX A;  3O8G A;  1UI5 A;  2DG7 A;  3BQZ A;  3G1L A;  3V6G A;  2YVE A;  5IOZ A;  2QTQ A;  5K7Z A;  3GZI A;  5IOY A;  3ZQH A;  2XPW A;  2GEN A;  2UXU A;  2F07 A;  2FBQ A;  4M3E A;  3B6A A;  4D5C A;  1Z77 A;  3CRJ A;  2IBD A;  5FKM A;  2IEK A;  3HTJ A;  5F0C A;  3QPL A;  4NN1 A;  3C2B A;  3LOC A;  2WGB A;  3VP5 A;  3SFI A;  4M3G A;  2UXH A;  3LHQ A;  3F1B A;  4V2F A;  2V57 A;  2Y30 A;  2FQ4 A;  2FX0 A;  3EUP A;  4HKU A;  3HGY A;  3AQT A;  2ID3 A;  4MK6 A;  3CDL A;  2I10 A;  1JTX A;  1ORK A;  2DTZ A;  1Z0X A;  2X6O A;  5FGL A;  3KKC A;  3T6N A;  3SDG A;  1QPI A;  2G0E A;  2ZCM A;  3O8H A;  3G7R A;  4AUX A;  2JK3 A;  4GCL A;  3BR0 A;  1RPW A;  2WV1 A;  3ON2 A;  4B1R A;  2ZCX A;  1SGM A;  3LJL A;  5F0H A;  2XGD A;  3ANP A;  3BR2 A;  3BR1 A;  2YVH A;  3PM1 A;  1ZKG A;  3FK7 A;  2X9D A;  2PZ9 A;  4B3A A;  2HYT A;  3VVZ A;  5EFY A;  2OER A;  3BR5 A;  3Q0V A;  1U9N A;  3ON4 A;  2XRL A;  1JTY A;  1UI6 A;  2OI8 A;  4ABZ A;  2HYJ A;  2D6Y A;  3Q0U A;  4YZE A;  3QKX A;  2IU5 A;  3CJD A;  2HKU A;  3BRU A;  3HGG A;  5GP9 A;  3VOX A;  2G7L A;  3VVY A;  2XB5 A;  3VW1 A;  3BR6 A;  3FK6 A;  3VIB A;  3VUQ A;  3CCY A;  2WUI A;  3PAS A;  4D7M A;  3BNI A;  5FKO A;  3Q0W A;  5K7F A;  3VW0 A;  5FMP A;  4L62 A;  3NXC A;  3P9T A;  3WHB A;  2QCO A;  3G1O A;  3HIM A;  1RKT A;  3KZ9 A;  3HE0 A;  1JT0 A;  2ZCN A;  5GPC A;  4JNN A;  5J3L A;  2EH3 A;  4ICH A;  3BT9 A;  4GCK A;  2VKE A;  2G7G A;  5HSZ A;  3MNL A;  5IPA A;  2HXO A;  2XDN A;  2XPU A;  1JUS A;  2G7S A;  2VPR A;  3LWJ A;  3ZQF A;  3RD3 A;  5EYR A;  3IH3 A;  4D5F A;  3O60 A;  2REK A;  2GFN A;  3LSJ A;  2W53 A;  5F04 A;  4ME9 A;  5HAW A;  3MVP A;  4G12 A;  2OPT A;  2RAE A;  2Y2Z A;  2PBX A;  2NS7 A;  3LSR A;  3DPJ A;  3HTI A;  5D18 A;  3VW2 A;  5H9T A;  3ZQI A;  3B81 A;  3FIW A;  4NEL A;  1QVT A;  5K58 A;  4MXM A; 
#chains in the Genus database with same CATH topology
 2FD5 A;  2R7W A;  1JUP A;  2RHA A;  2R7V A;  2R7O A;  2TRT A;  5F08 A;  4I76 A;  3BR3 A;  1T33 A;  4M3F A;  2R7S A;  5AQC A;  5HBU A;  2UXI A;  1JT6 A;  2ZY9 A;  3BTI A;  1BJZ A;  4D7N A;  1ZK8 A;  3JSJ A;  4X1E A;  2DG8 A;  3KNW A;  4GFK A;  3RH2 A;  4KWA A;  3EGQ A;  3IH4 A;  5C4Y A;  1QVU A;  2ZOY A;  5EZG A;  4AC0 A;  2RAS A;  2NS8 A;  2UXP A;  4GFL A;  4M3B A;  3CWR A;  3DCF A;  3KYL A;  3SWH A;  1A6I A;  3GEU A;  3IH2 A;  4JL3 A;  3BQY A;  3NPI A;  3C07 A;  4ACI A;  3TP0 A;  4M3D A;  2XGE A;  2NX4 A;  3BTL A;  4UDS A;  5D19 A;  4MO7 A;  5CXG A;  4U9N A;  3FRQ A;  2HQ5 A;  3IUV A;  4GCT A;  4AC6 A;  2UXO A;  2JJ7 A;  3COL A;  2PFV A;  2HXI A;  3ZQG A;  2QWT A;  5J1Y A;  3Q3S A;  2QKO A;  4V2G A;  3ZQL A;  3VPR A;  3KKD A;  2OF7 A;  3BTC A;  5FKL A;  3QQA A;  2FJ1 A;  1JUM A;  2TCT A;  2QIB A;  1RKW A;  5F27 A;  2Q24 A;  2ID6 A;  2R7R A;  2XPV A;  2GUH A;  3NNR A;  4JYK A;  3WHC A;  5F1J A;  2FJI 1;  4I6Z A;  2R7U A;  2ZOZ A;  3F0C A;  3BJB A;  3QBM A;  3V78 A;  1T56 A;  5K7H A;  2O7T A;  5FKK A;  3VOK A;  5IP6 A;  3S5R A;  5FKN A;  2GBY A;  3AQS A;  5F0F A;  5J1U A;  3G1M A;  1U9O A;  4IRV A;  2XGC A;  4W1U A;  3BTJ A;  5EZH A;  2ZB9 A;  3B6C A;  5J1R A;  3NI7 A;  5CW8 A;  3BCG A;  5DAJ A;  3G56 A;  3FHN A;  2NP5 A;  2VKV A;  4JKZ A;  3ANG A;  4CGR A;  4WIB A;  3NRG A;  2QOP A;  3PPB A;  5CXI A;  5GPA A;  3DEW A;  2G3B A;  2Y31 A;  4DW6 A;  3E7Q A;  3HTA A;  3BHQ A;  5D1R A;  3LSP A;  4XK4 A;  2O7O A;  4OD4 A;  2NP3 A;  5FHP A;  1VI0 A;  2IAI A;  3HTH A;  4W97 A;  4PXI A;  4AF5 A;  3QPS A;  3TP3 A;  3VTI A;  3VVX A;  3O8G A;  1UI5 A;  2DG7 A;  3BQZ A;  3V6G A;  3G1L A;  2YVE A;  5IOZ A;  2QTQ A;  5K7Z A;  3GZI A;  5IOY A;  3ZQH A;  2XPW A;  2GEN A;  2UXU A;  2F07 A;  2FBQ A;  4OD5 A;  4M3E A;  3B6A A;  4D5C A;  1Z77 A;  3CRJ A;  2IBD A;  2R7T A;  5FKM A;  2IEK A;  3HTJ A;  4DVY P;  5F0C A;  3QPL A;  4NN1 A;  3C2B A;  3LOC A;  2WGB A;  3VP5 A;  3SFI A;  4M3G A;  2UXH A;  3LHQ A;  3F1B A;  4V2F A;  2V57 A;  2Y30 A;  2FQ4 A;  2FX0 A;  3EUP A;  4HKU A;  3HGY A;  3AQT A;  2ID3 A;  4MK6 A;  3CDL A;  2I10 A;  2B3W A;  1JTX A;  1ORK A;  2DTZ A;  1Z0X A;  2X6O A;  5FGL A;  3KKC A;  3T6N A;  3SDG A;  1QPI A;  2G0E A;  2ZCM A;  3O8H A;  3G7R A;  4AUX A;  2JK3 A;  4GCL A;  3BR0 A;  1RPW A;  2WV1 A;  3ON2 A;  4B1R A;  2ZCX A;  1SGM A;  3LJL A;  5F0H A;  2XGD A;  3ANP A;  3BR2 A;  3BR1 A;  2YVH A;  3PM1 A;  1ZKG A;  3FK7 A;  2X9D A;  2PZ9 A;  4B3A A;  2HYT A;  2B1E A;  3VVZ A;  5EFY A;  2OER A;  3BR5 A;  3Q0V A;  1U9N A;  4U9L A;  3ON4 A;  2XRL A;  1JTY A;  5CQG A;  1UI6 A;  2OI8 A;  4ABZ A;  2HYJ A;  2D6Y A;  3Q0U A;  4YZE A;  3QKX A;  2IU5 A;  3CJD A;  2HKU A;  3BRU A;  3HGG A;  5GP9 A;  3VOX A;  2G7L A;  3VVY A;  2XB5 A;  4C2M A;  3VW1 A;  3BR6 A;  3FK6 A;  3VIB A;  3VUQ A;  3CCY A;  2WUI A;  3PAS A;  4D7M A;  3BNI A;  5FKO A;  3Q0W A;  5K7F A;  3VW0 A;  5FMP A;  4L62 A;  3NXC A;  3P9T A;  3WHB A;  2QCO A;  2R7Q A;  3G1O A;  3HIM A;  1RKT A;  3KZ9 A;  3HE0 A;  1JT0 A;  2ZCN A;  5GPC A;  4JNN A;  2A2F X;  5J3L A;  3NS4 A;  2EH3 A;  4ICH A;  3BT9 A;  4GCK A;  2VKE A;  2G7G A;  5HSZ A;  3MNL A;  5IPA A;  2HXO A;  2XDN A;  2XPU A;  1JUS A;  2G7S A;  2VPR A;  3LWJ A;  3ZQF A;  3RD3 A;  5EYR A;  3IH3 A;  4D5F A;  3O60 A;  2REK A;  2GFN A;  3LSJ A;  2W53 A;  5F04 A;  4ME9 A;  5HAW A;  3MVP A;  4G12 A;  2OPT A;  2RAE A;  2Y2Z A;  2PBX A;  2NS7 A;  3LSR A;  3DPJ A;  3HTI A;  5D18 A;  3VW2 A;  5H9T A;  3K8P C;  3ZQI A;  3B81 A;  3DU6 A;  3FIW A;  2R7X A;  4NEL A;  2YVX A;  1QVT A;  3DU5 A;  5K58 A;  4MXM A; 
#chains in the Genus database with same CATH homology
 2FD5 A;  1JUP A;  2RHA A;  2TRT A;  5F08 A;  4I76 A;  3BR3 A;  1T33 A;  4M3F A;  5AQC A;  5HBU A;  2UXI A;  1JT6 A;  3BTI A;  1BJZ A;  4D7N A;  1ZK8 A;  3JSJ A;  4X1E A;  2DG8 A;  3KNW A;  4GFK A;  3RH2 A;  4KWA A;  3EGQ A;  3IH4 A;  5C4Y A;  1QVU A;  2ZOY A;  5EZG A;  4AC0 A;  2RAS A;  2NS8 A;  2UXP A;  4GFL A;  4M3B A;  3CWR A;  3DCF A;  1A6I A;  3GEU A;  3IH2 A;  4JL3 A;  3BQY A;  3NPI A;  3C07 A;  4ACI A;  3TP0 A;  4M3D A;  2XGE A;  2NX4 A;  3BTL A;  4UDS A;  5D19 A;  4MO7 A;  5CXG A;  3FRQ A;  2HQ5 A;  3IUV A;  4GCT A;  4AC6 A;  2UXO A;  2JJ7 A;  3COL A;  2HXI A;  3ZQG A;  2QWT A;  5J1Y A;  3Q3S A;  2QKO A;  4V2G A;  3ZQL A;  3VPR A;  3KKD A;  2OF7 A;  3BTC A;  5FKL A;  3QQA A;  2FJ1 A;  1JUM A;  2TCT A;  2QIB A;  1RKW A;  5F27 A;  2Q24 A;  2ID6 A;  2XPV A;  2GUH A;  3NNR A;  4JYK A;  3WHC A;  5F1J A;  4I6Z A;  2ZOZ A;  3F0C A;  3BJB A;  3QBM A;  3V78 A;  1T56 A;  5K7H A;  2O7T A;  5FKK A;  3VOK A;  5IP6 A;  3S5R A;  5FKN A;  2GBY A;  3AQS A;  5F0F A;  3G1M A;  5J1U A;  1U9O A;  2XGC A;  4W1U A;  3BTJ A;  5EZH A;  2ZB9 A;  3B6C A;  5J1R A;  3NI7 A;  5CW8 A;  3BCG A;  5DAJ A;  3G56 A;  2NP5 A;  2VKV A;  4JKZ A;  3ANG A;  4CGR A;  3NRG A;  2QOP A;  3PPB A;  5CXI A;  5GPA A;  3DEW A;  2G3B A;  2Y31 A;  4DW6 A;  3E7Q A;  3HTA A;  3BHQ A;  5D1R A;  3LSP A;  4XK4 A;  2O7O A;  2NP3 A;  5FHP A;  1VI0 A;  2IAI A;  3HTH A;  4W97 A;  4PXI A;  4AF5 A;  3QPS A;  3TP3 A;  3VVX A;  3O8G A;  1UI5 A;  2DG7 A;  3BQZ A;  3G1L A;  3V6G A;  2YVE A;  5IOZ A;  2QTQ A;  5K7Z A;  3GZI A;  5IOY A;  3ZQH A;  2XPW A;  2GEN A;  2UXU A;  2F07 A;  2FBQ A;  4M3E A;  3B6A A;  4D5C A;  1Z77 A;  3CRJ A;  2IBD A;  5FKM A;  2IEK A;  3HTJ A;  5F0C A;  3QPL A;  4NN1 A;  3C2B A;  3LOC A;  2WGB A;  3VP5 A;  3SFI A;  4M3G A;  2UXH A;  3LHQ A;  3F1B A;  4V2F A;  2V57 A;  2Y30 A;  2FQ4 A;  2FX0 A;  3EUP A;  4HKU A;  3HGY A;  3AQT A;  2ID3 A;  4MK6 A;  3CDL A;  2I10 A;  1JTX A;  1ORK A;  2DTZ A;  1Z0X A;  2X6O A;  5FGL A;  3KKC A;  3T6N A;  3SDG A;  1QPI A;  2G0E A;  2ZCM A;  3O8H A;  3G7R A;  4AUX A;  2JK3 A;  4GCL A;  3BR0 A;  1RPW A;  2WV1 A;  3ON2 A;  4B1R A;  2ZCX A;  1SGM A;  3LJL A;  5F0H A;  2XGD A;  3ANP A;  3BR2 A;  3BR1 A;  2YVH A;  3PM1 A;  1ZKG A;  3FK7 A;  2X9D A;  2PZ9 A;  4B3A A;  2HYT A;  3VVZ A;  5EFY A;  2OER A;  3BR5 A;  3Q0V A;  1U9N A;  3ON4 A;  2XRL A;  1JTY A;  1UI6 A;  2OI8 A;  4ABZ A;  2HYJ A;  2D6Y A;  3Q0U A;  4YZE A;  3QKX A;  2IU5 A;  3CJD A;  2HKU A;  3BRU A;  3HGG A;  5GP9 A;  3VOX A;  2G7L A;  3VVY A;  2XB5 A;  3VW1 A;  3BR6 A;  3FK6 A;  3VIB A;  3VUQ A;  3CCY A;  2WUI A;  3PAS A;  4D7M A;  3BNI A;  5FKO A;  3Q0W A;  5K7F A;  3VW0 A;  5FMP A;  4L62 A;  3NXC A;  3P9T A;  3WHB A;  2QCO A;  3G1O A;  3HIM A;  1RKT A;  3KZ9 A;  3HE0 A;  1JT0 A;  2ZCN A;  5GPC A;  4JNN A;  5J3L A;  2EH3 A;  4ICH A;  3BT9 A;  4GCK A;  2VKE A;  2G7G A;  5HSZ A;  3MNL A;  5IPA A;  2HXO A;  2XDN A;  2XPU A;  1JUS A;  2G7S A;  2VPR A;  3LWJ A;  3ZQF A;  3RD3 A;  5EYR A;  3IH3 A;  4D5F A;  3O60 A;  2REK A;  2GFN A;  3LSJ A;  2W53 A;  5F04 A;  4ME9 A;  5HAW A;  3MVP A;  4G12 A;  2OPT A;  2RAE A;  2Y2Z A;  2PBX A;  2NS7 A;  3LSR A;  3DPJ A;  3HTI A;  5D18 A;  3VW2 A;  5H9T A;  3ZQI A;  3B81 A;  3FIW A;  4NEL A;  1QVT A;  5K58 A;  4MXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...