2GUHA

Crystal structure of the putative tetr-family transcriptional regulator from rhodococcus sp. rha1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
RTAEQSRSLIVDAAGRAFATRPYREITLKDIAEDAGVSAPLIIKYFGSKEQLFDALVDFRAAAEIVFSGPLDGLGERMVSMFARPLEPYKPLSLNILFMSGPSEESSRKLRANYSAQMIDALAERLPGRDARLRAELVMSMLTGLAVMRRKMMQEHATGTPEEVVAHYAPLVQELLDGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal Structure of the Putative TetR-family Transcriptional Regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
total genus 60
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17920 TetR_C_16 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2guhA00
5D18A 2NS7A 2V57A 2OF7A 2UXOA 2Y2ZA 3NNRA 5FKOA 2DTZA 3KKDA 3IUVA 2HXOA 3VW2A 2QCOA 2Y31A 5D19A 4G12A 2YVHA 3V6GA 4NN1A 3BNIA 5HSZA 2HYTA 1VI0A 3COLA 3HTAA 3C07A 3PM1A 2XPUA 5AQCA 3VW1A 3ANGA 1BJZA 2OERA 3G1LA 3IH3A 4AUXA 3VVYA 2GFNA 4GCTA 2TRTA 1RPWA 3O8GA 2GUHA 3PASA 2RHAA 4JKZA 1RKTA 3G7RA 2HQ5A 3ON2A 4JYKA 2ZCMA 3VIBA 5GPCA 4X1EA 3VVXA 3CJDA 5CW8A 3NPIA 2OPTA 5IP6A 2XRLA 2UXHA 3WHCA 2VPRA 3GEUA 2ZCXA 3QQAA 3IH2A 3LJLA 5K58A 3SFIA 5CXIA 3Q0VA 4M3GA 3Q0UA 4GFKA 5F0CA 3P9TA 2EH3A 5EYRA 5EFYA 2FQ4A 3VVZA 3O60A 2UXPA 5FMPA 1U9NA 5J1RA 4JL3A 3KZ9A 4GCKA 2QTQA 5D1RA 5F0HA 2IEKA 3QPLA 2XPWA 2DG8A 2UXIA 3CCYA 4ACIA 3VOKA 3HTIA 3PPBA 2QKOA 3E7QA 2G0EA 4M3BA 3BTJA 5IOZA 2QIBA 3B6AA 2XDNA 5K7ZA 4MO7A 2X6OA 2IU5A 3ZQIA 3ZQHA 3KKCA 2IAIA 3V78A 1JT0A 3LSJA 2FBQA 4I76A 2QOPA 3DEWA 3FRQA 2ZOZA 4AC6A 2G3BA 3BHQA 1T56A 5CXGA 4MXMA 2OI8A 2W53A 3VOXA 4L62A 3BRUA 2ID3A 2REKA 2QWTA 3VP5A 3AQTA 3WHBA 2JJ7A 3LOCA 3VUQA 1UI5A 5HBUA 3RH2A 3T6NA 4D7MA 4NELA 4AC0A 3QBMA 5J1YA 5DAJA 5H9TA 1ORKA 2NP3A 2HYJA 2JK3A 1JTYA 3FIWA 3F0CA 4W1UA 5K7FA 3BTCA 4B1RA 1U9OA 4I6ZA 3VW0A 4V2FA 5EZHA 3ANPA 3ON4A 3Q0WA 4XK4A 1Z0XA 5FKKA 2ZOYA 3VPRA 4KWAA 3BTLA 1Z77A 2FX0A 2O7OA 2XPVA 1A6IA 3BR2A 2XGDA 3HE0A 1JUSA 3ZQLA 2NX4A 4M3EA 2VKVA 3NI7A 3G1MA 5J1UA 2Y30A 4M3FA 2Q24A 2HXIA 1QVTA 1QVUA 3LWJA 3C2BA 3GZIA 3MNLA 3RD3A 2I10A 2G7GA 3BR0A 3EUPA 2XB5A 2IBDA 2DG7A 5K7HA 4CGRA 5C4YA 3IH4A 2X9DA 2NS8A 3BQYA 2WUIA 4D5CA 2XGEA 2GENA 3HIMA 3DPJA 3KNWA 1JUMA 3FK7A 3QKXA 3BCGA 2GBYA 4GCLA 5GP9A 1JTXA 4MK6A 4B3AA 1QPIA 4ABZA 4GFLA 5HAWA 5FHPA 3JSJA 1JUPA 3MVPA 5F04A 2WGBA 2RASA 1UI6A 3BR5A 3B81A 4AF5A 2ZB9A 5F08A 5EZGA 2PZ9A 2FJ1A 3CDLA 5IPAA 3BT9A 3HGYA 4ICHA 3FK6A 2YVEA 3O8HA 3ZQFA 3QPSA 2D6YA 4DW6A 5F0FA 1ZK8A 3BQZA 5FKNA 3LHQA 4YZEA 4ME9A 3G1OA 4W97A 5F27A 2ID6A 4PXIA 3BR3A 2FD5A 4D7NA 3BR6A 3TP0A 4HKUA 5J3LA 5F1JA 4JNNA 3S5RA 2HKUA 3AQSA 5GPAA 1SGMA 5IOYA 1JT6A 4D5FA 2VKEA 3G56A 1T33A 1ZKGA 3HGGA 3EGQA 1RKWA 2G7SA 5FKLA 4V2GA 2G7LA 2PBXA 2F07A 3BJBA 3BTIA 3HTHA 3SDGA 3TP3A 3DCFA 3B6CA 3BR1A 3F1BA 3CRJA 3NRGA 2O7TA 3HTJA 3ZQGA 2ZCNA 4M3DA 2WV1A 2UXUA 3LSRA 3NXCA 2NP5A 2TCTA 5FGLA 5FKMA 4UDSA 2RAEA 3LSPA 3CWRA 3Q3SA 2XGCA
chains in the Genus database with same CATH superfamily
5D18A 2NS7A 2V57A 2OF7A 2UXOA 2Y2ZA 3NNRA 5FKOA 2DTZA 3KKDA 3IUVA 2HXOA 3VW2A 2QCOA 2Y31A 5D19A 4G12A 2YVHA 4WIBA 3V6GA 4NN1A 3BNIA 5HSZA 2HYTA 1VI0A 3COLA 3HTAA 3C07A 3PM1A 2XPUA 5AQCA 3VW1A 3ANGA 1BJZA 2OERA 3G1LA 4IRVA 3IH3A 4AUXA 3VVYA 2GFNA 4GCTA 2TRTA 1RPWA 3K8PC 3O8GA 2GUHA 3PASA 2RHAA 4JKZA 1RKTA 3DU6A 3G7RA 2HQ5A 3ON2A 4JYKA 2ZCMA 3VIBA 3DU5A 5GPCA 4X1EA 3VVXA 3CJDA 5CW8A 3NPIA 2OPTA 5IP6A 2XRLA 2A2FX 2UXHA 3WHCA 2VPRA 3GEUA 2ZCXA 3QQAA 3IH2A 3LJLA 5K58A 3SFIA 5CXIA 3Q0VA 4M3GA 3Q0UA 4GFKA 5F0CA 3P9TA 2EH3A 5EYRA 5EFYA 2FQ4A 3VVZA 3O60A 2UXPA 5FMPA 1U9NA 5J1RA 4JL3A 3KZ9A 4GCKA 2QTQA 5D1RA 5F0HA 2IEKA 3QPLA 2XPWA 2DG8A 2UXIA 3CCYA 4ACIA 3VOKA 4C2MA 3HTIA 3PPBA 2B1EA 2QKOA 2R7SA 3E7QA 2G0EA 4M3BA 3BTJA 2R7WA 5IOZA 4U9LA 2QIBA 3B6AA 2XDNA 2B3WA 3VTIA 5K7ZA 4MO7A 2X6OA 2IU5A 3ZQIA 3ZQHA 3KKCA 2IAIA 3V78A 1JT0A 3LSJA 4DVYP 2FBQA 4I76A 2QOPA 3DEWA 3FRQA 2ZOZA 4AC6A 2G3BA 3BHQA 1T56A 5CXGA 4MXMA 2OI8A 2W53A 3VOXA 4L62A 3BRUA 2ID3A 2REKA 2QWTA 4OD4A 3VP5A 3AQTA 3WHBA 2JJ7A 2R7RA 2R7VA 3LOCA 3VUQA 1UI5A 5HBUA 3RH2A 3T6NA 4D7MA 4NELA 4AC0A 3QBMA 5J1YA 5DAJA 5H9TA 1ORKA 2NP3A 2HYJA 2JK3A 1JTYA 3FIWA 3F0CA 4W1UA 5K7FA 3BTCA 4B1RA 1U9OA 4I6ZA 3VW0A 4V2FA 5EZHA 3ANPA 3ON4A 3Q0WA 4XK4A 1Z0XA 4OD5A 5FKKA 2ZOYA 2PFVA 3VPRA 4KWAA 3BTLA 1Z77A 2FX0A 2O7OA 2XPVA 1A6IA 2R7OA 3BR2A 2XGDA 3HE0A 1JUSA 3ZQLA 2NX4A 4M3EA 2VKVA 3NI7A 3G1MA 5J1UA 2R7QA 2Y30A 4M3FA 2Q24A 2HXIA 1QVTA 1QVUA 2R7TA 3LWJA 3C2BA 3GZIA 3MNLA 3RD3A 2I10A 2G7GA 3BR0A 3EUPA 2XB5A 2FJI1 2IBDA 2DG7A 5K7HA 4CGRA 2R7XA 5C4YA 3IH4A 2X9DA 2NS8A 3BQYA 2WUIA 4D5CA 2XGEA 2GENA 3HIMA 3DPJA 3KNWA 1JUMA 3FK7A 3QKXA 3BCGA 2GBYA 4GCLA 5GP9A 1JTXA 4MK6A 4B3AA 1QPIA 4ABZA 4GFLA 5HAWA 3KYLA 5FHPA 3JSJA 1JUPA 3MVPA 5F04A 2WGBA 2RASA 1UI6A 3BR5A 3B81A 4AF5A 2ZB9A 5F08A 5EZGA 2PZ9A 2FJ1A 3CDLA 5IPAA 3BT9A 3HGYA 4ICHA 3FK6A 2YVEA 3O8HA 3ZQFA 3QPSA 2D6YA 4DW6A 5F0FA 3FHNA 3NS4A 1ZK8A 3BQZA 5FKNA 3LHQA 4YZEA 4ME9A 3G1OA 4W97A 5F27A 2ID6A 4PXIA 2ZY9A 3BR3A 2FD5A 4D7NA 3BR6A 3TP0A 4HKUA 5J3LA 5F1JA 4JNNA 3S5RA 2HKUA 3AQSA 5CQGA 5GPAA 1SGMA 2YVXA 5IOYA 1JT6A 4D5FA 2VKEA 3G56A 1T33A 1ZKGA 3HGGA 2R7UA 3EGQA 1RKWA 2G7SA 4U9NA 5FKLA 4V2GA 2G7LA 2PBXA 2F07A 3BJBA 3BTIA 3HTHA 3SDGA 3TP3A 3DCFA 3B6CA 3BR1A 3F1BA 3CRJA 3SWHA 3NRGA 2O7TA 3HTJA 3ZQGA 2ZCNA 4M3DA 2WV1A 2UXUA 3LSRA 3NXCA 2NP5A 2TCTA 5FGLA 5FKMA 4UDSA 2RAEA 3LSPA 3CWRA 3Q3SA 2XGCA
chains in the Genus database with same CATH topology
5D18A 2NS7A 2V57A 2OF7A 2UXOA 2Y2ZA 3NNRA 5FKOA 2DTZA 3KKDA 3IUVA 2HXOA 3VW2A 2QCOA 2Y31A 5D19A 4G12A 2YVHA 3V6GA 4NN1A 3BNIA 5HSZA 2HYTA 1VI0A 3COLA 3HTAA 3C07A 3PM1A 2XPUA 5AQCA 3VW1A 3ANGA 1BJZA 2OERA 3G1LA 3IH3A 4AUXA 3VVYA 2GFNA 4GCTA 2TRTA 1RPWA 3O8GA 2GUHA 3PASA 2RHAA 4JKZA 1RKTA 3G7RA 2HQ5A 3ON2A 4JYKA 2ZCMA 3VIBA 5GPCA 4X1EA 3VVXA 3CJDA 5CW8A 3NPIA 2OPTA 5IP6A 2XRLA 2UXHA 3WHCA 2VPRA 3GEUA 2ZCXA 3QQAA 3IH2A 3LJLA 5K58A 3SFIA 5CXIA 3Q0VA 4M3GA 3Q0UA 4GFKA 5F0CA 3P9TA 2EH3A 5EYRA 5EFYA 2FQ4A 3VVZA 3O60A 2UXPA 5FMPA 1U9NA 5J1RA 4JL3A 3KZ9A 4GCKA 2QTQA 5D1RA 5F0HA 2IEKA 3QPLA 2XPWA 2DG8A 2UXIA 3CCYA 4ACIA 3VOKA 3HTIA 3PPBA 2QKOA 3E7QA 2G0EA 4M3BA 3BTJA 5IOZA 2QIBA 3B6AA 2XDNA 5K7ZA 4MO7A 2X6OA 2IU5A 3ZQIA 3ZQHA 3KKCA 2IAIA 3V78A 1JT0A 3LSJA 2FBQA 4I76A 2QOPA 3DEWA 3FRQA 2ZOZA 4AC6A 2G3BA 3BHQA 1T56A 5CXGA 4MXMA 2OI8A 2W53A 3VOXA 4L62A 3BRUA 2ID3A 2REKA 2QWTA 3VP5A 3AQTA 3WHBA 2JJ7A 3LOCA 3VUQA 1UI5A 5HBUA 3RH2A 3T6NA 4D7MA 4NELA 4AC0A 3QBMA 5J1YA 5DAJA 5H9TA 1ORKA 2NP3A 2HYJA 2JK3A 1JTYA 3FIWA 3F0CA 4W1UA 5K7FA 3BTCA 4B1RA 1U9OA 4I6ZA 3VW0A 4V2FA 5EZHA 3ANPA 3ON4A 3Q0WA 4XK4A 1Z0XA 5FKKA 2ZOYA 3VPRA 4KWAA 3BTLA 1Z77A 2FX0A 2O7OA 2XPVA 1A6IA 3BR2A 2XGDA 3HE0A 1JUSA 3ZQLA 2NX4A 4M3EA 2VKVA 3NI7A 3G1MA 5J1UA 2Y30A 4M3FA 2Q24A 2HXIA 1QVTA 1QVUA 3LWJA 3C2BA 3GZIA 3MNLA 3RD3A 2I10A 2G7GA 3BR0A 3EUPA 2XB5A 2IBDA 2DG7A 5K7HA 4CGRA 5C4YA 3IH4A 2X9DA 2NS8A 3BQYA 2WUIA 4D5CA 2XGEA 2GENA 3HIMA 3DPJA 3KNWA 1JUMA 3FK7A 3QKXA 3BCGA 2GBYA 4GCLA 5GP9A 1JTXA 4MK6A 4B3AA 1QPIA 4ABZA 4GFLA 5HAWA 5FHPA 3JSJA 1JUPA 3MVPA 5F04A 2WGBA 2RASA 1UI6A 3BR5A 3B81A 4AF5A 2ZB9A 5F08A 5EZGA 2PZ9A 2FJ1A 3CDLA 5IPAA 3BT9A 3HGYA 4ICHA 3FK6A 2YVEA 3O8HA 3ZQFA 3QPSA 2D6YA 4DW6A 5F0FA 1ZK8A 3BQZA 5FKNA 3LHQA 4YZEA 4ME9A 3G1OA 4W97A 5F27A 2ID6A 4PXIA 3BR3A 2FD5A 4D7NA 3BR6A 3TP0A 4HKUA 5J3LA 5F1JA 4JNNA 3S5RA 2HKUA 3AQSA 5GPAA 1SGMA 5IOYA 1JT6A 4D5FA 2VKEA 3G56A 1T33A 1ZKGA 3HGGA 3EGQA 1RKWA 2G7SA 5FKLA 4V2GA 2G7LA 2PBXA 2F07A 3BJBA 3BTIA 3HTHA 3SDGA 3TP3A 3DCFA 3B6CA 3BR1A 3F1BA 3CRJA 3NRGA 2O7TA 3HTJA 3ZQGA 2ZCNA 4M3DA 2WV1A 2UXUA 3LSRA 3NXCA 2NP5A 2TCTA 5FGLA 5FKMA 4UDSA 2RAEA 3LSPA 3CWRA 3Q3SA 2XGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D18 A;  2NS7 A;  2V57 A;  2OF7 A;  2UXO A;  2Y2Z A;  3NNR A;  5FKO A;  2DTZ A;  3KKD A;  3IUV A;  2HXO A;  3VW2 A;  2QCO A;  2Y31 A;  5D19 A;  4G12 A;  2YVH A;  3V6G A;  4NN1 A;  3BNI A;  5HSZ A;  2HYT A;  1VI0 A;  3COL A;  3HTA A;  3C07 A;  3PM1 A;  2XPU A;  5AQC A;  3VW1 A;  3ANG A;  1BJZ A;  2OER A;  3G1L A;  3IH3 A;  4AUX A;  3VVY A;  2GFN A;  4GCT A;  2TRT A;  1RPW A;  3O8G A;  2GUH A;  3PAS A;  2RHA A;  4JKZ A;  1RKT A;  3G7R A;  2HQ5 A;  3ON2 A;  4JYK A;  2ZCM A;  3VIB A;  5GPC A;  4X1E A;  3VVX A;  3CJD A;  5CW8 A;  3NPI A;  2OPT A;  5IP6 A;  2XRL A;  2UXH A;  3WHC A;  2VPR A;  3GEU A;  2ZCX A;  3QQA A;  3IH2 A;  3LJL A;  5K58 A;  3SFI A;  5CXI A;  3Q0V A;  4M3G A;  3Q0U A;  4GFK A;  5F0C A;  3P9T A;  2EH3 A;  5EYR A;  5EFY A;  2FQ4 A;  3VVZ A;  3O60 A;  2UXP A;  5FMP A;  1U9N A;  5J1R A;  4JL3 A;  3KZ9 A;  4GCK A;  2QTQ A;  5D1R A;  5F0H A;  2IEK A;  3QPL A;  2XPW A;  2DG8 A;  2UXI A;  3CCY A;  4ACI A;  3VOK A;  3HTI A;  3PPB A;  2QKO A;  3E7Q A;  2G0E A;  4M3B A;  3BTJ A;  5IOZ A;  2QIB A;  3B6A A;  2XDN A;  5K7Z A;  4MO7 A;  2X6O A;  2IU5 A;  3ZQI A;  3ZQH A;  3KKC A;  2IAI A;  3V78 A;  1JT0 A;  3LSJ A;  2FBQ A;  4I76 A;  2QOP A;  3DEW A;  3FRQ A;  2ZOZ A;  4AC6 A;  2G3B A;  3BHQ A;  1T56 A;  5CXG A;  4MXM A;  2OI8 A;  2W53 A;  3VOX A;  4L62 A;  3BRU A;  2ID3 A;  2REK A;  2QWT A;  3VP5 A;  3AQT A;  3WHB A;  2JJ7 A;  3LOC A;  3VUQ A;  1UI5 A;  5HBU A;  3RH2 A;  3T6N A;  4D7M A;  4NEL A;  4AC0 A;  3QBM A;  5J1Y A;  5DAJ A;  5H9T A;  1ORK A;  2NP3 A;  2HYJ A;  2JK3 A;  1JTY A;  3FIW A;  3F0C A;  4W1U A;  5K7F A;  3BTC A;  4B1R A;  1U9O A;  4I6Z A;  3VW0 A;  4V2F A;  5EZH A;  3ANP A;  3ON4 A;  3Q0W A;  4XK4 A;  1Z0X A;  5FKK A;  2ZOY A;  3VPR A;  4KWA A;  3BTL A;  1Z77 A;  2FX0 A;  2O7O A;  2XPV A;  1A6I A;  3BR2 A;  2XGD A;  3HE0 A;  1JUS A;  3ZQL A;  2NX4 A;  4M3E A;  2VKV A;  3NI7 A;  3G1M A;  5J1U A;  2Y30 A;  4M3F A;  2Q24 A;  2HXI A;  1QVT A;  1QVU A;  3LWJ A;  3C2B A;  3GZI A;  3MNL A;  3RD3 A;  2I10 A;  2G7G A;  3BR0 A;  3EUP A;  2XB5 A;  2IBD A;  2DG7 A;  5K7H A;  4CGR A;  5C4Y A;  3IH4 A;  2X9D A;  2NS8 A;  3BQY A;  2WUI A;  4D5C A;  2XGE A;  2GEN A;  3HIM A;  3DPJ A;  3KNW A;  1JUM A;  3FK7 A;  3QKX A;  3BCG A;  2GBY A;  4GCL A;  5GP9 A;  1JTX A;  4MK6 A;  4B3A A;  1QPI A;  4ABZ A;  4GFL A;  5HAW A;  5FHP A;  3JSJ A;  1JUP A;  3MVP A;  5F04 A;  2WGB A;  2RAS A;  1UI6 A;  3BR5 A;  3B81 A;  4AF5 A;  2ZB9 A;  5F08 A;  5EZG A;  2PZ9 A;  2FJ1 A;  3CDL A;  5IPA A;  3BT9 A;  3HGY A;  4ICH A;  3FK6 A;  2YVE A;  3O8H A;  3ZQF A;  3QPS A;  2D6Y A;  4DW6 A;  5F0F A;  1ZK8 A;  3BQZ A;  5FKN A;  3LHQ A;  4YZE A;  4ME9 A;  3G1O A;  4W97 A;  5F27 A;  2ID6 A;  4PXI A;  3BR3 A;  2FD5 A;  4D7N A;  3BR6 A;  3TP0 A;  4HKU A;  5J3L A;  5F1J A;  4JNN A;  3S5R A;  2HKU A;  3AQS A;  5GPA A;  1SGM A;  5IOY A;  1JT6 A;  4D5F A;  2VKE A;  3G56 A;  1T33 A;  1ZKG A;  3HGG A;  3EGQ A;  1RKW A;  2G7S A;  5FKL A;  4V2G A;  2G7L A;  2PBX A;  2F07 A;  3BJB A;  3BTI A;  3HTH A;  3SDG A;  3TP3 A;  3DCF A;  3B6C A;  3BR1 A;  3F1B A;  3CRJ A;  3NRG A;  2O7T A;  3HTJ A;  3ZQG A;  2ZCN A;  4M3D A;  2WV1 A;  2UXU A;  3LSR A;  3NXC A;  2NP5 A;  2TCT A;  5FGL A;  5FKM A;  4UDS A;  2RAE A;  3LSP A;  3CWR A;  3Q3S A;  2XGC A; 
#chains in the Genus database with same CATH topology
 5D18 A;  2NS7 A;  2V57 A;  2OF7 A;  2UXO A;  2Y2Z A;  3NNR A;  5FKO A;  2DTZ A;  3KKD A;  3IUV A;  2HXO A;  3VW2 A;  2QCO A;  2Y31 A;  5D19 A;  4G12 A;  2YVH A;  4WIB A;  3V6G A;  4NN1 A;  3BNI A;  5HSZ A;  2HYT A;  1VI0 A;  3COL A;  3HTA A;  3C07 A;  3PM1 A;  2XPU A;  5AQC A;  3VW1 A;  3ANG A;  1BJZ A;  2OER A;  3G1L A;  4IRV A;  3IH3 A;  4AUX A;  3VVY A;  2GFN A;  4GCT A;  2TRT A;  1RPW A;  3K8P C;  3O8G A;  2GUH A;  3PAS A;  2RHA A;  4JKZ A;  1RKT A;  3DU6 A;  3G7R A;  2HQ5 A;  3ON2 A;  4JYK A;  2ZCM A;  3VIB A;  3DU5 A;  5GPC A;  4X1E A;  3VVX A;  3CJD A;  5CW8 A;  3NPI A;  2OPT A;  5IP6 A;  2XRL A;  2A2F X;  2UXH A;  3WHC A;  2VPR A;  3GEU A;  2ZCX A;  3QQA A;  3IH2 A;  3LJL A;  5K58 A;  3SFI A;  5CXI A;  3Q0V A;  4M3G A;  3Q0U A;  4GFK A;  5F0C A;  3P9T A;  2EH3 A;  5EYR A;  5EFY A;  2FQ4 A;  3VVZ A;  3O60 A;  2UXP A;  5FMP A;  1U9N A;  5J1R A;  4JL3 A;  3KZ9 A;  4GCK A;  2QTQ A;  5D1R A;  5F0H A;  2IEK A;  3QPL A;  2XPW A;  2DG8 A;  2UXI A;  3CCY A;  4ACI A;  3VOK A;  4C2M A;  3HTI A;  3PPB A;  2B1E A;  2QKO A;  2R7S A;  3E7Q A;  2G0E A;  4M3B A;  3BTJ A;  2R7W A;  5IOZ A;  4U9L A;  2QIB A;  3B6A A;  2XDN A;  2B3W A;  3VTI A;  5K7Z A;  4MO7 A;  2X6O A;  2IU5 A;  3ZQI A;  3ZQH A;  3KKC A;  2IAI A;  3V78 A;  1JT0 A;  3LSJ A;  4DVY P;  2FBQ A;  4I76 A;  2QOP A;  3DEW A;  3FRQ A;  2ZOZ A;  4AC6 A;  2G3B A;  3BHQ A;  1T56 A;  5CXG A;  4MXM A;  2OI8 A;  2W53 A;  3VOX A;  4L62 A;  3BRU A;  2ID3 A;  2REK A;  2QWT A;  4OD4 A;  3VP5 A;  3AQT A;  3WHB A;  2JJ7 A;  2R7R A;  2R7V A;  3LOC A;  3VUQ A;  1UI5 A;  5HBU A;  3RH2 A;  3T6N A;  4D7M A;  4NEL A;  4AC0 A;  3QBM A;  5J1Y A;  5DAJ A;  5H9T A;  1ORK A;  2NP3 A;  2HYJ A;  2JK3 A;  1JTY A;  3FIW A;  3F0C A;  4W1U A;  5K7F A;  3BTC A;  4B1R A;  1U9O A;  4I6Z A;  3VW0 A;  4V2F A;  5EZH A;  3ANP A;  3ON4 A;  3Q0W A;  4XK4 A;  1Z0X A;  4OD5 A;  5FKK A;  2ZOY A;  2PFV A;  3VPR A;  4KWA A;  3BTL A;  1Z77 A;  2FX0 A;  2O7O A;  2XPV A;  1A6I A;  2R7O A;  3BR2 A;  2XGD A;  3HE0 A;  1JUS A;  3ZQL A;  2NX4 A;  4M3E A;  2VKV A;  3NI7 A;  3G1M A;  5J1U A;  2R7Q A;  2Y30 A;  4M3F A;  2Q24 A;  2HXI A;  1QVT A;  1QVU A;  2R7T A;  3LWJ A;  3C2B A;  3GZI A;  3MNL A;  3RD3 A;  2I10 A;  2G7G A;  3BR0 A;  3EUP A;  2XB5 A;  2FJI 1;  2IBD A;  2DG7 A;  5K7H A;  4CGR A;  2R7X A;  5C4Y A;  3IH4 A;  2X9D A;  2NS8 A;  3BQY A;  2WUI A;  4D5C A;  2XGE A;  2GEN A;  3HIM A;  3DPJ A;  3KNW A;  1JUM A;  3FK7 A;  3QKX A;  3BCG A;  2GBY A;  4GCL A;  5GP9 A;  1JTX A;  4MK6 A;  4B3A A;  1QPI A;  4ABZ A;  4GFL A;  5HAW A;  3KYL A;  5FHP A;  3JSJ A;  1JUP A;  3MVP A;  5F04 A;  2WGB A;  2RAS A;  1UI6 A;  3BR5 A;  3B81 A;  4AF5 A;  2ZB9 A;  5F08 A;  5EZG A;  2PZ9 A;  2FJ1 A;  3CDL A;  5IPA A;  3BT9 A;  3HGY A;  4ICH A;  3FK6 A;  2YVE A;  3O8H A;  3ZQF A;  3QPS A;  2D6Y A;  4DW6 A;  5F0F A;  3FHN A;  3NS4 A;  1ZK8 A;  3BQZ A;  5FKN A;  3LHQ A;  4YZE A;  4ME9 A;  3G1O A;  4W97 A;  5F27 A;  2ID6 A;  4PXI A;  2ZY9 A;  3BR3 A;  2FD5 A;  4D7N A;  3BR6 A;  3TP0 A;  4HKU A;  5J3L A;  5F1J A;  4JNN A;  3S5R A;  2HKU A;  3AQS A;  5CQG A;  5GPA A;  1SGM A;  2YVX A;  5IOY A;  1JT6 A;  4D5F A;  2VKE A;  3G56 A;  1T33 A;  1ZKG A;  3HGG A;  2R7U A;  3EGQ A;  1RKW A;  2G7S A;  4U9N A;  5FKL A;  4V2G A;  2G7L A;  2PBX A;  2F07 A;  3BJB A;  3BTI A;  3HTH A;  3SDG A;  3TP3 A;  3DCF A;  3B6C A;  3BR1 A;  3F1B A;  3CRJ A;  3SWH A;  3NRG A;  2O7T A;  3HTJ A;  3ZQG A;  2ZCN A;  4M3D A;  2WV1 A;  2UXU A;  3LSR A;  3NXC A;  2NP5 A;  2TCT A;  5FGL A;  5FKM A;  4UDS A;  2RAE A;  3LSP A;  3CWR A;  3Q3S A;  2XGC A; 
#chains in the Genus database with same CATH homology
 5D18 A;  2NS7 A;  2V57 A;  2OF7 A;  2UXO A;  2Y2Z A;  3NNR A;  5FKO A;  2DTZ A;  3KKD A;  3IUV A;  2HXO A;  3VW2 A;  2QCO A;  2Y31 A;  5D19 A;  4G12 A;  2YVH A;  3V6G A;  4NN1 A;  3BNI A;  5HSZ A;  2HYT A;  1VI0 A;  3COL A;  3HTA A;  3C07 A;  3PM1 A;  2XPU A;  5AQC A;  3VW1 A;  3ANG A;  1BJZ A;  2OER A;  3G1L A;  3IH3 A;  4AUX A;  3VVY A;  2GFN A;  4GCT A;  2TRT A;  1RPW A;  3O8G A;  2GUH A;  3PAS A;  2RHA A;  4JKZ A;  1RKT A;  3G7R A;  2HQ5 A;  3ON2 A;  4JYK A;  2ZCM A;  3VIB A;  5GPC A;  4X1E A;  3VVX A;  3CJD A;  5CW8 A;  3NPI A;  2OPT A;  5IP6 A;  2XRL A;  2UXH A;  3WHC A;  2VPR A;  3GEU A;  2ZCX A;  3QQA A;  3IH2 A;  3LJL A;  5K58 A;  3SFI A;  5CXI A;  3Q0V A;  4M3G A;  3Q0U A;  4GFK A;  5F0C A;  3P9T A;  2EH3 A;  5EYR A;  5EFY A;  2FQ4 A;  3VVZ A;  3O60 A;  2UXP A;  5FMP A;  1U9N A;  5J1R A;  4JL3 A;  3KZ9 A;  4GCK A;  2QTQ A;  5D1R A;  5F0H A;  2IEK A;  3QPL A;  2XPW A;  2DG8 A;  2UXI A;  3CCY A;  4ACI A;  3VOK A;  3HTI A;  3PPB A;  2QKO A;  3E7Q A;  2G0E A;  4M3B A;  3BTJ A;  5IOZ A;  2QIB A;  3B6A A;  2XDN A;  5K7Z A;  4MO7 A;  2X6O A;  2IU5 A;  3ZQI A;  3ZQH A;  3KKC A;  2IAI A;  3V78 A;  1JT0 A;  3LSJ A;  2FBQ A;  4I76 A;  2QOP A;  3DEW A;  3FRQ A;  2ZOZ A;  4AC6 A;  2G3B A;  3BHQ A;  1T56 A;  5CXG A;  4MXM A;  2OI8 A;  2W53 A;  3VOX A;  4L62 A;  3BRU A;  2ID3 A;  2REK A;  2QWT A;  3VP5 A;  3AQT A;  3WHB A;  2JJ7 A;  3LOC A;  3VUQ A;  1UI5 A;  5HBU A;  3RH2 A;  3T6N A;  4D7M A;  4NEL A;  4AC0 A;  3QBM A;  5J1Y A;  5DAJ A;  5H9T A;  1ORK A;  2NP3 A;  2HYJ A;  2JK3 A;  1JTY A;  3FIW A;  3F0C A;  4W1U A;  5K7F A;  3BTC A;  4B1R A;  1U9O A;  4I6Z A;  3VW0 A;  4V2F A;  5EZH A;  3ANP A;  3ON4 A;  3Q0W A;  4XK4 A;  1Z0X A;  5FKK A;  2ZOY A;  3VPR A;  4KWA A;  3BTL A;  1Z77 A;  2FX0 A;  2O7O A;  2XPV A;  1A6I A;  3BR2 A;  2XGD A;  3HE0 A;  1JUS A;  3ZQL A;  2NX4 A;  4M3E A;  2VKV A;  3NI7 A;  3G1M A;  5J1U A;  2Y30 A;  4M3F A;  2Q24 A;  2HXI A;  1QVT A;  1QVU A;  3LWJ A;  3C2B A;  3GZI A;  3MNL A;  3RD3 A;  2I10 A;  2G7G A;  3BR0 A;  3EUP A;  2XB5 A;  2IBD A;  2DG7 A;  5K7H A;  4CGR A;  5C4Y A;  3IH4 A;  2X9D A;  2NS8 A;  3BQY A;  2WUI A;  4D5C A;  2XGE A;  2GEN A;  3HIM A;  3DPJ A;  3KNW A;  1JUM A;  3FK7 A;  3QKX A;  3BCG A;  2GBY A;  4GCL A;  5GP9 A;  1JTX A;  4MK6 A;  4B3A A;  1QPI A;  4ABZ A;  4GFL A;  5HAW A;  5FHP A;  3JSJ A;  1JUP A;  3MVP A;  5F04 A;  2WGB A;  2RAS A;  1UI6 A;  3BR5 A;  3B81 A;  4AF5 A;  2ZB9 A;  5F08 A;  5EZG A;  2PZ9 A;  2FJ1 A;  3CDL A;  5IPA A;  3BT9 A;  3HGY A;  4ICH A;  3FK6 A;  2YVE A;  3O8H A;  3ZQF A;  3QPS A;  2D6Y A;  4DW6 A;  5F0F A;  1ZK8 A;  3BQZ A;  5FKN A;  3LHQ A;  4YZE A;  4ME9 A;  3G1O A;  4W97 A;  5F27 A;  2ID6 A;  4PXI A;  3BR3 A;  2FD5 A;  4D7N A;  3BR6 A;  3TP0 A;  4HKU A;  5J3L A;  5F1J A;  4JNN A;  3S5R A;  2HKU A;  3AQS A;  5GPA A;  1SGM A;  5IOY A;  1JT6 A;  4D5F A;  2VKE A;  3G56 A;  1T33 A;  1ZKG A;  3HGG A;  3EGQ A;  1RKW A;  2G7S A;  5FKL A;  4V2G A;  2G7L A;  2PBX A;  2F07 A;  3BJB A;  3BTI A;  3HTH A;  3SDG A;  3TP3 A;  3DCF A;  3B6C A;  3BR1 A;  3F1B A;  3CRJ A;  3NRG A;  2O7T A;  3HTJ A;  3ZQG A;  2ZCN A;  4M3D A;  2WV1 A;  2UXU A;  3LSR A;  3NXC A;  2NP5 A;  2TCT A;  5FGL A;  5FKM A;  4UDS A;  2RAE A;  3LSP A;  3CWR A;  3Q3S A;  2XGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...