2GUHA

Crystal structure of the putative tetr-family transcriptional regulator from rhodococcus sp. rha1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
RTAEQSRSLIVDAAGRAFATRPYREITLKDIAEDAGVSAPLIIKYFGSKEQLFDALVDFRAAAEIVFSGPLDGLGERMVSMFARPLEPYKPLSLNILFMSGPSEESSRKLRANYSAQMIDALAERLPGRDARLRAELVMSMLTGLAVMRRKMMQEHATGTPEEVVAHYAPLVQELLDGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal Structure of the Putative TetR-family Transcriptional Regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
total genus 60
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17920 TetR_C_16 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2guhA00
2IBDA 3QBMA 5F0CA 2G3BA 3MVPA 2Y31A 5F27A 3T6NA 2FX0A 3QQAA 4AF5A 2YVEA 3HGYA 2ZCMA 4YZEA 4ABZA 4AC6A 3O60A 3CJDA 2ZCNA 3Q3SA 4JKZA 3AQSA 5CXGA 3VVZA 2ZCXA 2DG8A 2GUHA 2XPVA 3G1LA 3FIWA 4GFKA 3NXCA 2W53A 4ACIA 1JUPA 3GZIA 2NP5A 5DAJA 4L62A 5F0HA 4I76A 2UXIA 5K58A 4M3FA 3BTLA 3PASA 3LSRA 1RKTA 3ZQIA 3BTJA 2QCOA 1JTXA 5FKNA 3BR3A 2ID6A 3BHQA 5F04A 2ID3A 3VPRA 4AUXA 2QTQA 2FJ1A 3F0CA 5D19A 4XK4A 3BCGA 3BQYA 5H9TA 3HE0A 3O8HA 5HBUA 5K7HA 3EUPA 3PPBA 3BR5A 2WUIA 3CCYA 2OPTA 4V2GA 3BTIA 2G7GA 3WHCA 2HXIA 3KNWA 3DCFA 2GFNA 2XB5A 3F1BA 4W97A 3HTAA 2JK3A 3G1OA 4D7NA 1QVUA 3ZQHA 5D18A 3CWRA 3IUVA 2Y30A 3G1MA 2QWTA 2ZOZA 4UDSA 3FK6A 3B6AA 5GPCA 2D6YA 1QPIA 3VVXA 4PXIA 5F0FA 1ZKGA 2DTZA 2TCTA 4V2FA 3HGGA 1ZK8A 4MO7A 3TP0A 2GBYA 2HKUA 3LJLA 3AQTA 3KZ9A 4GFLA 3KKCA 1U9NA 2FBQA 2VPRA 3CDLA 3IH3A 4NN1A 2FQ4A 3C07A 1Z77A 3ZQFA 5FMPA 3SDGA 2X6OA 4G12A 5J1YA 2IEKA 2OERA 3NRGA 3BQZA 3G56A 4D5FA 5FKKA 3LSPA 4JYKA 2IU5A 2XPWA 3KKDA 2VKEA 2QIBA 3MNLA 5K7FA 1VI0A 2XRLA 1T33A 5CXIA 3CRJA 5EZHA 5D1RA 2Y2ZA 2IAIA 3IH4A 2Q24A 3HTHA 3P9TA 2VKVA 4GCTA 3NI7A 2G7LA 2OI8A 2G0EA 3BRUA 2HYTA 2NX4A 4D7MA 4D5CA 3COLA 3VVYA 2UXPA 4KWAA 3O8GA 2OF7A 2V57A 5IOZA 3LWJA 3VW0A 3VIBA 3DEWA 1JTYA 5EYRA 2YVHA 2DG7A 2XGCA 3LOCA 1JUMA 5FKLA 3ZQLA 3C2BA 3VW1A 5GPAA 3QPLA 2QOPA 2O7TA 4GCKA 2WV1A 3BTCA 4ME9A 4M3GA 3DPJA 1RKWA 1QVTA 1A6IA 5FKMA 3VOKA 5IOYA 4NELA 1JUSA 5F1JA 3VOXA 4B3AA 2XDNA 3EGQA 2EH3A 5FKOA 2F07A 4ICHA 1UI5A 3NPIA 2XGEA 2XGDA 3ANGA 2O7OA 5GP9A 5HSZA 3ON2A 2TRTA 3G7RA 5J1UA 1RPWA 2QKOA 3BR1A 5IP6A 3RD3A 5FGLA 2JJ7A 5FHPA 4MK6A 2PBXA 3ZQGA 4M3EA 3RH2A 3JSJA 3ON4A 3Q0WA 4B1RA 1Z0XA 3IH2A 2I10A 2RHAA 3Q0VA 5J1RA 4CGRA 3TP3A 3VP5A 2X9DA 2GENA 5J3LA 1SGMA 3NNRA 5EFYA 3HIMA 4I6ZA 2UXOA 2REKA 3E7QA 4GCLA 4M3DA 3BNIA 3HTIA 2PZ9A 2UXHA 1JT0A 2NS8A 1JT6A 1T56A 3B6CA 3QKXA 4W1UA 2WGBA 2FD5A 1ORKA 1U9OA 1BJZA 3S5RA 3V6GA 3BR6A 2UXUA 3BR2A 2RAEA 3B81A 5F08A 3FRQA 5C4YA 3Q0UA 2HQ5A 4M3BA 3FK7A 3WHBA 2NP3A 2RASA 4HKUA 4AC0A 2ZOYA 3SFIA 3GEUA 3BR0A 4JNNA 5K7ZA 3PM1A 3VUQA 3VW2A 4DW6A 3LSJA 4JL3A 3LHQA 5CW8A 2G7SA 2HXOA 2XPUA 5AQCA 3BJBA 5IPAA 3QPSA 3V78A 2HYJA 3HTJA 4X1EA 5EZGA 2ZB9A 3BT9A 5HAWA 3ANPA 4MXMA 1UI6A 2NS7A
chains in the Genus database with same CATH superfamily
2IBDA 3QBMA 5F0CA 2G3BA 3MVPA 2Y31A 5F27A 3T6NA 2FX0A 3QQAA 4AF5A 2YVEA 3HGYA 2ZCMA 4YZEA 4ABZA 4AC6A 3O60A 3CJDA 2ZCNA 3Q3SA 2ZY9A 4JKZA 3AQSA 3K8PC 5CXGA 3VVZA 2ZCXA 2DG8A 2GUHA 2XPVA 3G1LA 3FIWA 4GFKA 3NXCA 2W53A 4ACIA 1JUPA 3GZIA 2NP5A 2B1EA 5DAJA 4L62A 5F0HA 4I76A 2A2FX 2UXIA 5K58A 4M3FA 3BTLA 3PASA 3LSRA 1RKTA 3ZQIA 3BTJA 2QCOA 1JTXA 5FKNA 3BR3A 2ID6A 3BHQA 5F04A 2ID3A 3VPRA 2PFVA 4AUXA 2QTQA 2FJ1A 3F0CA 5D19A 4XK4A 3BCGA 3BQYA 5H9TA 3HE0A 3O8HA 5HBUA 5K7HA 3EUPA 3PPBA 3BR5A 2WUIA 3CCYA 2OPTA 4V2GA 3BTIA 2G7GA 3WHCA 2HXIA 3KNWA 3DCFA 2GFNA 2XB5A 3F1BA 4IRVA 4W97A 3HTAA 2JK3A 3G1OA 4D7NA 1QVUA 3ZQHA 5D18A 3CWRA 3IUVA 2Y30A 3G1MA 2QWTA 2ZOZA 4UDSA 3FK6A 3B6AA 5GPCA 2D6YA 1QPIA 3VVXA 4PXIA 5F0FA 1ZKGA 2DTZA 2TCTA 4V2FA 3HGGA 1ZK8A 4MO7A 3TP0A 2GBYA 2HKUA 2YVXA 3LJLA 3AQTA 3KZ9A 4GFLA 3KKCA 2R7TA 1U9NA 2FBQA 2VPRA 3CDLA 3IH3A 4NN1A 2FQ4A 3C07A 1Z77A 3ZQFA 5FMPA 3SDGA 2X6OA 4G12A 5J1YA 2IEKA 2OERA 4U9NA 4OD4A 3NRGA 3BQZA 3G56A 4D5FA 5FKKA 3LSPA 4JYKA 2IU5A 2XPWA 3KKDA 2VKEA 2B3WA 2QIBA 3MNLA 5K7FA 1VI0A 2XRLA 1T33A 4WIBA 5CXIA 3CRJA 5EZHA 5D1RA 2Y2ZA 2R7UA 2IAIA 3IH4A 2Q24A 3HTHA 3P9TA 2VKVA 4GCTA 2R7OA 3NI7A 2G7LA 2OI8A 2G0EA 3BRUA 2HYTA 2NX4A 4D7MA 4D5CA 3COLA 3VVYA 2UXPA 4KWAA 3O8GA 2OF7A 2V57A 5IOZA 3LWJA 3VW0A 2R7VA 3VIBA 3DEWA 1JTYA 5EYRA 2YVHA 2DG7A 2XGCA 3LOCA 1JUMA 2R7QA 5CQGA 5FKLA 3ZQLA 3C2BA 3VW1A 5GPAA 3QPLA 2QOPA 2O7TA 4GCKA 2WV1A 3BTCA 4ME9A 4M3GA 3DPJA 1RKWA 1QVTA 1A6IA 4U9LA 5FKMA 3VOKA 5IOYA 4NELA 1JUSA 5F1JA 3VOXA 4B3AA 2XDNA 3EGQA 3SWHA 2R7SA 2EH3A 5FKOA 2F07A 4OD5A 4ICHA 4DVYP 1UI5A 3NPIA 2XGEA 2XGDA 4C2MA 3ANGA 2O7OA 5GP9A 5HSZA 3ON2A 2TRTA 3G7RA 5J1UA 1RPWA 3VTIA 2QKOA 3BR1A 5IP6A 3RD3A 5FGLA 2R7WA 2JJ7A 5FHPA 4MK6A 2PBXA 3ZQGA 4M3EA 3RH2A 3JSJA 3ON4A 3Q0WA 4B1RA 1Z0XA 3IH2A 2I10A 2RHAA 3Q0VA 5J1RA 2FJI1 4CGRA 3TP3A 3VP5A 3NS4A 2X9DA 2GENA 5J3LA 1SGMA 3NNRA 5EFYA 3HIMA 4I6ZA 2UXOA 2REKA 3KYLA 3E7QA 4GCLA 2R7RA 4M3DA 3BNIA 3HTIA 2PZ9A 2UXHA 1JT0A 2NS8A 1JT6A 1T56A 3B6CA 3QKXA 4W1UA 2WGBA 2FD5A 1ORKA 1U9OA 1BJZA 2R7XA 3S5RA 3V6GA 3BR6A 2UXUA 3BR2A 2RAEA 3B81A 5F08A 3FRQA 5C4YA 3Q0UA 2HQ5A 4M3BA 3FHNA 3FK7A 3DU6A 3WHBA 2NP3A 2RASA 4HKUA 4AC0A 2ZOYA 3SFIA 3GEUA 3BR0A 4JNNA 5K7ZA 3PM1A 3VUQA 3VW2A 4DW6A 3LSJA 4JL3A 3LHQA 5CW8A 2G7SA 2HXOA 2XPUA 5AQCA 3BJBA 5IPAA 3QPSA 3V78A 2HYJA 3HTJA 4X1EA 5EZGA 2ZB9A 3BT9A 3DU5A 5HAWA 3ANPA 4MXMA 1UI6A 2NS7A
chains in the Genus database with same CATH topology
2IBDA 3QBMA 5F0CA 2G3BA 3MVPA 2Y31A 5F27A 3T6NA 2FX0A 3QQAA 4AF5A 2YVEA 3HGYA 2ZCMA 4YZEA 4ABZA 4AC6A 3O60A 3CJDA 2ZCNA 3Q3SA 4JKZA 3AQSA 5CXGA 3VVZA 2ZCXA 2DG8A 2GUHA 2XPVA 3G1LA 3FIWA 4GFKA 3NXCA 2W53A 4ACIA 1JUPA 3GZIA 2NP5A 5DAJA 4L62A 5F0HA 4I76A 2UXIA 5K58A 4M3FA 3BTLA 3PASA 3LSRA 1RKTA 3ZQIA 3BTJA 2QCOA 1JTXA 5FKNA 3BR3A 2ID6A 3BHQA 5F04A 2ID3A 3VPRA 4AUXA 2QTQA 2FJ1A 3F0CA 5D19A 4XK4A 3BCGA 3BQYA 5H9TA 3HE0A 3O8HA 5HBUA 5K7HA 3EUPA 3PPBA 3BR5A 2WUIA 3CCYA 2OPTA 4V2GA 3BTIA 2G7GA 3WHCA 2HXIA 3KNWA 3DCFA 2GFNA 2XB5A 3F1BA 4W97A 3HTAA 2JK3A 3G1OA 4D7NA 1QVUA 3ZQHA 5D18A 3CWRA 3IUVA 2Y30A 3G1MA 2QWTA 2ZOZA 4UDSA 3FK6A 3B6AA 5GPCA 2D6YA 1QPIA 3VVXA 4PXIA 5F0FA 1ZKGA 2DTZA 2TCTA 4V2FA 3HGGA 1ZK8A 4MO7A 3TP0A 2GBYA 2HKUA 3LJLA 3AQTA 3KZ9A 4GFLA 3KKCA 1U9NA 2FBQA 2VPRA 3CDLA 3IH3A 4NN1A 2FQ4A 3C07A 1Z77A 3ZQFA 5FMPA 3SDGA 2X6OA 4G12A 5J1YA 2IEKA 2OERA 3NRGA 3BQZA 3G56A 4D5FA 5FKKA 3LSPA 4JYKA 2IU5A 2XPWA 3KKDA 2VKEA 2QIBA 3MNLA 5K7FA 1VI0A 2XRLA 1T33A 5CXIA 3CRJA 5EZHA 5D1RA 2Y2ZA 2IAIA 3IH4A 2Q24A 3HTHA 3P9TA 2VKVA 4GCTA 3NI7A 2G7LA 2OI8A 2G0EA 3BRUA 2HYTA 2NX4A 4D7MA 4D5CA 3COLA 3VVYA 2UXPA 4KWAA 3O8GA 2OF7A 2V57A 5IOZA 3LWJA 3VW0A 3VIBA 3DEWA 1JTYA 5EYRA 2YVHA 2DG7A 2XGCA 3LOCA 1JUMA 5FKLA 3ZQLA 3C2BA 3VW1A 5GPAA 3QPLA 2QOPA 2O7TA 4GCKA 2WV1A 3BTCA 4ME9A 4M3GA 3DPJA 1RKWA 1QVTA 1A6IA 5FKMA 3VOKA 5IOYA 4NELA 1JUSA 5F1JA 3VOXA 4B3AA 2XDNA 3EGQA 2EH3A 5FKOA 2F07A 4ICHA 1UI5A 3NPIA 2XGEA 2XGDA 3ANGA 2O7OA 5GP9A 5HSZA 3ON2A 2TRTA 3G7RA 5J1UA 1RPWA 2QKOA 3BR1A 5IP6A 3RD3A 5FGLA 2JJ7A 5FHPA 4MK6A 2PBXA 3ZQGA 4M3EA 3RH2A 3JSJA 3ON4A 3Q0WA 4B1RA 1Z0XA 3IH2A 2I10A 2RHAA 3Q0VA 5J1RA 4CGRA 3TP3A 3VP5A 2X9DA 2GENA 5J3LA 1SGMA 3NNRA 5EFYA 3HIMA 4I6ZA 2UXOA 2REKA 3E7QA 4GCLA 4M3DA 3BNIA 3HTIA 2PZ9A 2UXHA 1JT0A 2NS8A 1JT6A 1T56A 3B6CA 3QKXA 4W1UA 2WGBA 2FD5A 1ORKA 1U9OA 1BJZA 3S5RA 3V6GA 3BR6A 2UXUA 3BR2A 2RAEA 3B81A 5F08A 3FRQA 5C4YA 3Q0UA 2HQ5A 4M3BA 3FK7A 3WHBA 2NP3A 2RASA 4HKUA 4AC0A 2ZOYA 3SFIA 3GEUA 3BR0A 4JNNA 5K7ZA 3PM1A 3VUQA 3VW2A 4DW6A 3LSJA 4JL3A 3LHQA 5CW8A 2G7SA 2HXOA 2XPUA 5AQCA 3BJBA 5IPAA 3QPSA 3V78A 2HYJA 3HTJA 4X1EA 5EZGA 2ZB9A 3BT9A 5HAWA 3ANPA 4MXMA 1UI6A 2NS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBD A;  3QBM A;  5F0C A;  2G3B A;  3MVP A;  2Y31 A;  5F27 A;  3T6N A;  2FX0 A;  3QQA A;  4AF5 A;  2YVE A;  3HGY A;  2ZCM A;  4YZE A;  4ABZ A;  4AC6 A;  3O60 A;  3CJD A;  2ZCN A;  3Q3S A;  4JKZ A;  3AQS A;  5CXG A;  3VVZ A;  2ZCX A;  2DG8 A;  2GUH A;  2XPV A;  3G1L A;  3FIW A;  4GFK A;  3NXC A;  2W53 A;  4ACI A;  1JUP A;  3GZI A;  2NP5 A;  5DAJ A;  4L62 A;  5F0H A;  4I76 A;  2UXI A;  5K58 A;  4M3F A;  3BTL A;  3PAS A;  3LSR A;  1RKT A;  3ZQI A;  3BTJ A;  2QCO A;  1JTX A;  5FKN A;  3BR3 A;  2ID6 A;  3BHQ A;  5F04 A;  2ID3 A;  3VPR A;  4AUX A;  2QTQ A;  2FJ1 A;  3F0C A;  5D19 A;  4XK4 A;  3BCG A;  3BQY A;  5H9T A;  3HE0 A;  3O8H A;  5HBU A;  5K7H A;  3EUP A;  3PPB A;  3BR5 A;  2WUI A;  3CCY A;  2OPT A;  4V2G A;  3BTI A;  2G7G A;  3WHC A;  2HXI A;  3KNW A;  3DCF A;  2GFN A;  2XB5 A;  3F1B A;  4W97 A;  3HTA A;  2JK3 A;  3G1O A;  4D7N A;  1QVU A;  3ZQH A;  5D18 A;  3CWR A;  3IUV A;  2Y30 A;  3G1M A;  2QWT A;  2ZOZ A;  4UDS A;  3FK6 A;  3B6A A;  5GPC A;  2D6Y A;  1QPI A;  3VVX A;  4PXI A;  5F0F A;  1ZKG A;  2DTZ A;  2TCT A;  4V2F A;  3HGG A;  1ZK8 A;  4MO7 A;  3TP0 A;  2GBY A;  2HKU A;  3LJL A;  3AQT A;  3KZ9 A;  4GFL A;  3KKC A;  1U9N A;  2FBQ A;  2VPR A;  3CDL A;  3IH3 A;  4NN1 A;  2FQ4 A;  3C07 A;  1Z77 A;  3ZQF A;  5FMP A;  3SDG A;  2X6O A;  4G12 A;  5J1Y A;  2IEK A;  2OER A;  3NRG A;  3BQZ A;  3G56 A;  4D5F A;  5FKK A;  3LSP A;  4JYK A;  2IU5 A;  2XPW A;  3KKD A;  2VKE A;  2QIB A;  3MNL A;  5K7F A;  1VI0 A;  2XRL A;  1T33 A;  5CXI A;  3CRJ A;  5EZH A;  5D1R A;  2Y2Z A;  2IAI A;  3IH4 A;  2Q24 A;  3HTH A;  3P9T A;  2VKV A;  4GCT A;  3NI7 A;  2G7L A;  2OI8 A;  2G0E A;  3BRU A;  2HYT A;  2NX4 A;  4D7M A;  4D5C A;  3COL A;  3VVY A;  2UXP A;  4KWA A;  3O8G A;  2OF7 A;  2V57 A;  5IOZ A;  3LWJ A;  3VW0 A;  3VIB A;  3DEW A;  1JTY A;  5EYR A;  2YVH A;  2DG7 A;  2XGC A;  3LOC A;  1JUM A;  5FKL A;  3ZQL A;  3C2B A;  3VW1 A;  5GPA A;  3QPL A;  2QOP A;  2O7T A;  4GCK A;  2WV1 A;  3BTC A;  4ME9 A;  4M3G A;  3DPJ A;  1RKW A;  1QVT A;  1A6I A;  5FKM A;  3VOK A;  5IOY A;  4NEL A;  1JUS A;  5F1J A;  3VOX A;  4B3A A;  2XDN A;  3EGQ A;  2EH3 A;  5FKO A;  2F07 A;  4ICH A;  1UI5 A;  3NPI A;  2XGE A;  2XGD A;  3ANG A;  2O7O A;  5GP9 A;  5HSZ A;  3ON2 A;  2TRT A;  3G7R A;  5J1U A;  1RPW A;  2QKO A;  3BR1 A;  5IP6 A;  3RD3 A;  5FGL A;  2JJ7 A;  5FHP A;  4MK6 A;  2PBX A;  3ZQG A;  4M3E A;  3RH2 A;  3JSJ A;  3ON4 A;  3Q0W A;  4B1R A;  1Z0X A;  3IH2 A;  2I10 A;  2RHA A;  3Q0V A;  5J1R A;  4CGR A;  3TP3 A;  3VP5 A;  2X9D A;  2GEN A;  5J3L A;  1SGM A;  3NNR A;  5EFY A;  3HIM A;  4I6Z A;  2UXO A;  2REK A;  3E7Q A;  4GCL A;  4M3D A;  3BNI A;  3HTI A;  2PZ9 A;  2UXH A;  1JT0 A;  2NS8 A;  1JT6 A;  1T56 A;  3B6C A;  3QKX A;  4W1U A;  2WGB A;  2FD5 A;  1ORK A;  1U9O A;  1BJZ A;  3S5R A;  3V6G A;  3BR6 A;  2UXU A;  3BR2 A;  2RAE A;  3B81 A;  5F08 A;  3FRQ A;  5C4Y A;  3Q0U A;  2HQ5 A;  4M3B A;  3FK7 A;  3WHB A;  2NP3 A;  2RAS A;  4HKU A;  4AC0 A;  2ZOY A;  3SFI A;  3GEU A;  3BR0 A;  4JNN A;  5K7Z A;  3PM1 A;  3VUQ A;  3VW2 A;  4DW6 A;  3LSJ A;  4JL3 A;  3LHQ A;  5CW8 A;  2G7S A;  2HXO A;  2XPU A;  5AQC A;  3BJB A;  5IPA A;  3QPS A;  3V78 A;  2HYJ A;  3HTJ A;  4X1E A;  5EZG A;  2ZB9 A;  3BT9 A;  5HAW A;  3ANP A;  4MXM A;  1UI6 A;  2NS7 A; 
#chains in the Genus database with same CATH topology
 2IBD A;  3QBM A;  5F0C A;  2G3B A;  3MVP A;  2Y31 A;  5F27 A;  3T6N A;  2FX0 A;  3QQA A;  4AF5 A;  2YVE A;  3HGY A;  2ZCM A;  4YZE A;  4ABZ A;  4AC6 A;  3O60 A;  3CJD A;  2ZCN A;  3Q3S A;  2ZY9 A;  4JKZ A;  3AQS A;  3K8P C;  5CXG A;  3VVZ A;  2ZCX A;  2DG8 A;  2GUH A;  2XPV A;  3G1L A;  3FIW A;  4GFK A;  3NXC A;  2W53 A;  4ACI A;  1JUP A;  3GZI A;  2NP5 A;  2B1E A;  5DAJ A;  4L62 A;  5F0H A;  4I76 A;  2A2F X;  2UXI A;  5K58 A;  4M3F A;  3BTL A;  3PAS A;  3LSR A;  1RKT A;  3ZQI A;  3BTJ A;  2QCO A;  1JTX A;  5FKN A;  3BR3 A;  2ID6 A;  3BHQ A;  5F04 A;  2ID3 A;  3VPR A;  2PFV A;  4AUX A;  2QTQ A;  2FJ1 A;  3F0C A;  5D19 A;  4XK4 A;  3BCG A;  3BQY A;  5H9T A;  3HE0 A;  3O8H A;  5HBU A;  5K7H A;  3EUP A;  3PPB A;  3BR5 A;  2WUI A;  3CCY A;  2OPT A;  4V2G A;  3BTI A;  2G7G A;  3WHC A;  2HXI A;  3KNW A;  3DCF A;  2GFN A;  2XB5 A;  3F1B A;  4IRV A;  4W97 A;  3HTA A;  2JK3 A;  3G1O A;  4D7N A;  1QVU A;  3ZQH A;  5D18 A;  3CWR A;  3IUV A;  2Y30 A;  3G1M A;  2QWT A;  2ZOZ A;  4UDS A;  3FK6 A;  3B6A A;  5GPC A;  2D6Y A;  1QPI A;  3VVX A;  4PXI A;  5F0F A;  1ZKG A;  2DTZ A;  2TCT A;  4V2F A;  3HGG A;  1ZK8 A;  4MO7 A;  3TP0 A;  2GBY A;  2HKU A;  2YVX A;  3LJL A;  3AQT A;  3KZ9 A;  4GFL A;  3KKC A;  2R7T A;  1U9N A;  2FBQ A;  2VPR A;  3CDL A;  3IH3 A;  4NN1 A;  2FQ4 A;  3C07 A;  1Z77 A;  3ZQF A;  5FMP A;  3SDG A;  2X6O A;  4G12 A;  5J1Y A;  2IEK A;  2OER A;  4U9N A;  4OD4 A;  3NRG A;  3BQZ A;  3G56 A;  4D5F A;  5FKK A;  3LSP A;  4JYK A;  2IU5 A;  2XPW A;  3KKD A;  2VKE A;  2B3W A;  2QIB A;  3MNL A;  5K7F A;  1VI0 A;  2XRL A;  1T33 A;  4WIB A;  5CXI A;  3CRJ A;  5EZH A;  5D1R A;  2Y2Z A;  2R7U A;  2IAI A;  3IH4 A;  2Q24 A;  3HTH A;  3P9T A;  2VKV A;  4GCT A;  2R7O A;  3NI7 A;  2G7L A;  2OI8 A;  2G0E A;  3BRU A;  2HYT A;  2NX4 A;  4D7M A;  4D5C A;  3COL A;  3VVY A;  2UXP A;  4KWA A;  3O8G A;  2OF7 A;  2V57 A;  5IOZ A;  3LWJ A;  3VW0 A;  2R7V A;  3VIB A;  3DEW A;  1JTY A;  5EYR A;  2YVH A;  2DG7 A;  2XGC A;  3LOC A;  1JUM A;  2R7Q A;  5CQG A;  5FKL A;  3ZQL A;  3C2B A;  3VW1 A;  5GPA A;  3QPL A;  2QOP A;  2O7T A;  4GCK A;  2WV1 A;  3BTC A;  4ME9 A;  4M3G A;  3DPJ A;  1RKW A;  1QVT A;  1A6I A;  4U9L A;  5FKM A;  3VOK A;  5IOY A;  4NEL A;  1JUS A;  5F1J A;  3VOX A;  4B3A A;  2XDN A;  3EGQ A;  3SWH A;  2R7S A;  2EH3 A;  5FKO A;  2F07 A;  4OD5 A;  4ICH A;  4DVY P;  1UI5 A;  3NPI A;  2XGE A;  2XGD A;  4C2M A;  3ANG A;  2O7O A;  5GP9 A;  5HSZ A;  3ON2 A;  2TRT A;  3G7R A;  5J1U A;  1RPW A;  3VTI A;  2QKO A;  3BR1 A;  5IP6 A;  3RD3 A;  5FGL A;  2R7W A;  2JJ7 A;  5FHP A;  4MK6 A;  2PBX A;  3ZQG A;  4M3E A;  3RH2 A;  3JSJ A;  3ON4 A;  3Q0W A;  4B1R A;  1Z0X A;  3IH2 A;  2I10 A;  2RHA A;  3Q0V A;  5J1R A;  2FJI 1;  4CGR A;  3TP3 A;  3VP5 A;  3NS4 A;  2X9D A;  2GEN A;  5J3L A;  1SGM A;  3NNR A;  5EFY A;  3HIM A;  4I6Z A;  2UXO A;  2REK A;  3KYL A;  3E7Q A;  4GCL A;  2R7R A;  4M3D A;  3BNI A;  3HTI A;  2PZ9 A;  2UXH A;  1JT0 A;  2NS8 A;  1JT6 A;  1T56 A;  3B6C A;  3QKX A;  4W1U A;  2WGB A;  2FD5 A;  1ORK A;  1U9O A;  1BJZ A;  2R7X A;  3S5R A;  3V6G A;  3BR6 A;  2UXU A;  3BR2 A;  2RAE A;  3B81 A;  5F08 A;  3FRQ A;  5C4Y A;  3Q0U A;  2HQ5 A;  4M3B A;  3FHN A;  3FK7 A;  3DU6 A;  3WHB A;  2NP3 A;  2RAS A;  4HKU A;  4AC0 A;  2ZOY A;  3SFI A;  3GEU A;  3BR0 A;  4JNN A;  5K7Z A;  3PM1 A;  3VUQ A;  3VW2 A;  4DW6 A;  3LSJ A;  4JL3 A;  3LHQ A;  5CW8 A;  2G7S A;  2HXO A;  2XPU A;  5AQC A;  3BJB A;  5IPA A;  3QPS A;  3V78 A;  2HYJ A;  3HTJ A;  4X1E A;  5EZG A;  2ZB9 A;  3BT9 A;  3DU5 A;  5HAW A;  3ANP A;  4MXM A;  1UI6 A;  2NS7 A; 
#chains in the Genus database with same CATH homology
 2IBD A;  3QBM A;  5F0C A;  2G3B A;  3MVP A;  2Y31 A;  5F27 A;  3T6N A;  2FX0 A;  3QQA A;  4AF5 A;  2YVE A;  3HGY A;  2ZCM A;  4YZE A;  4ABZ A;  4AC6 A;  3O60 A;  3CJD A;  2ZCN A;  3Q3S A;  4JKZ A;  3AQS A;  5CXG A;  3VVZ A;  2ZCX A;  2DG8 A;  2GUH A;  2XPV A;  3G1L A;  3FIW A;  4GFK A;  3NXC A;  2W53 A;  4ACI A;  1JUP A;  3GZI A;  2NP5 A;  5DAJ A;  4L62 A;  5F0H A;  4I76 A;  2UXI A;  5K58 A;  4M3F A;  3BTL A;  3PAS A;  3LSR A;  1RKT A;  3ZQI A;  3BTJ A;  2QCO A;  1JTX A;  5FKN A;  3BR3 A;  2ID6 A;  3BHQ A;  5F04 A;  2ID3 A;  3VPR A;  4AUX A;  2QTQ A;  2FJ1 A;  3F0C A;  5D19 A;  4XK4 A;  3BCG A;  3BQY A;  5H9T A;  3HE0 A;  3O8H A;  5HBU A;  5K7H A;  3EUP A;  3PPB A;  3BR5 A;  2WUI A;  3CCY A;  2OPT A;  4V2G A;  3BTI A;  2G7G A;  3WHC A;  2HXI A;  3KNW A;  3DCF A;  2GFN A;  2XB5 A;  3F1B A;  4W97 A;  3HTA A;  2JK3 A;  3G1O A;  4D7N A;  1QVU A;  3ZQH A;  5D18 A;  3CWR A;  3IUV A;  2Y30 A;  3G1M A;  2QWT A;  2ZOZ A;  4UDS A;  3FK6 A;  3B6A A;  5GPC A;  2D6Y A;  1QPI A;  3VVX A;  4PXI A;  5F0F A;  1ZKG A;  2DTZ A;  2TCT A;  4V2F A;  3HGG A;  1ZK8 A;  4MO7 A;  3TP0 A;  2GBY A;  2HKU A;  3LJL A;  3AQT A;  3KZ9 A;  4GFL A;  3KKC A;  1U9N A;  2FBQ A;  2VPR A;  3CDL A;  3IH3 A;  4NN1 A;  2FQ4 A;  3C07 A;  1Z77 A;  3ZQF A;  5FMP A;  3SDG A;  2X6O A;  4G12 A;  5J1Y A;  2IEK A;  2OER A;  3NRG A;  3BQZ A;  3G56 A;  4D5F A;  5FKK A;  3LSP A;  4JYK A;  2IU5 A;  2XPW A;  3KKD A;  2VKE A;  2QIB A;  3MNL A;  5K7F A;  1VI0 A;  2XRL A;  1T33 A;  5CXI A;  3CRJ A;  5EZH A;  5D1R A;  2Y2Z A;  2IAI A;  3IH4 A;  2Q24 A;  3HTH A;  3P9T A;  2VKV A;  4GCT A;  3NI7 A;  2G7L A;  2OI8 A;  2G0E A;  3BRU A;  2HYT A;  2NX4 A;  4D7M A;  4D5C A;  3COL A;  3VVY A;  2UXP A;  4KWA A;  3O8G A;  2OF7 A;  2V57 A;  5IOZ A;  3LWJ A;  3VW0 A;  3VIB A;  3DEW A;  1JTY A;  5EYR A;  2YVH A;  2DG7 A;  2XGC A;  3LOC A;  1JUM A;  5FKL A;  3ZQL A;  3C2B A;  3VW1 A;  5GPA A;  3QPL A;  2QOP A;  2O7T A;  4GCK A;  2WV1 A;  3BTC A;  4ME9 A;  4M3G A;  3DPJ A;  1RKW A;  1QVT A;  1A6I A;  5FKM A;  3VOK A;  5IOY A;  4NEL A;  1JUS A;  5F1J A;  3VOX A;  4B3A A;  2XDN A;  3EGQ A;  2EH3 A;  5FKO A;  2F07 A;  4ICH A;  1UI5 A;  3NPI A;  2XGE A;  2XGD A;  3ANG A;  2O7O A;  5GP9 A;  5HSZ A;  3ON2 A;  2TRT A;  3G7R A;  5J1U A;  1RPW A;  2QKO A;  3BR1 A;  5IP6 A;  3RD3 A;  5FGL A;  2JJ7 A;  5FHP A;  4MK6 A;  2PBX A;  3ZQG A;  4M3E A;  3RH2 A;  3JSJ A;  3ON4 A;  3Q0W A;  4B1R A;  1Z0X A;  3IH2 A;  2I10 A;  2RHA A;  3Q0V A;  5J1R A;  4CGR A;  3TP3 A;  3VP5 A;  2X9D A;  2GEN A;  5J3L A;  1SGM A;  3NNR A;  5EFY A;  3HIM A;  4I6Z A;  2UXO A;  2REK A;  3E7Q A;  4GCL A;  4M3D A;  3BNI A;  3HTI A;  2PZ9 A;  2UXH A;  1JT0 A;  2NS8 A;  1JT6 A;  1T56 A;  3B6C A;  3QKX A;  4W1U A;  2WGB A;  2FD5 A;  1ORK A;  1U9O A;  1BJZ A;  3S5R A;  3V6G A;  3BR6 A;  2UXU A;  3BR2 A;  2RAE A;  3B81 A;  5F08 A;  3FRQ A;  5C4Y A;  3Q0U A;  2HQ5 A;  4M3B A;  3FK7 A;  3WHB A;  2NP3 A;  2RAS A;  4HKU A;  4AC0 A;  2ZOY A;  3SFI A;  3GEU A;  3BR0 A;  4JNN A;  5K7Z A;  3PM1 A;  3VUQ A;  3VW2 A;  4DW6 A;  3LSJ A;  4JL3 A;  3LHQ A;  5CW8 A;  2G7S A;  2HXO A;  2XPU A;  5AQC A;  3BJB A;  5IPA A;  3QPS A;  3V78 A;  2HYJ A;  3HTJ A;  4X1E A;  5EZG A;  2ZB9 A;  3BT9 A;  5HAW A;  3ANP A;  4MXM A;  1UI6 A;  2NS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...