3BTLA

Crystal structure of qacr(e58q) bound to malachite green
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 73
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btlA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btlA02
3FISA 5JLXA 1MNMC 4HKUA 2WGBA 1I50J 3S16J 1ZTRA 2DJNA 3S2DJ 1JKPC 3NARA 2AO9A 4DYRA 3HB9A 3FKIJ 2NVTJ 2DG8A 2NX4A 2H1KA 2REKA 3PO2J 4JYKA 3P9TA 1A5JA 4FISA 4GCTA 3JRDA 3VVZA 3VIBA 1EF4A 3I4NJ 4A3BJ 3O60A 4JKZA 3D1NI 1F36A 4M6VA 4BKXA 3VPRA 4D5CA 3BHQA 2NP3A 3HIMA 1I3QJ 3HOZJ 3KNWA 2DMUA 2FQ4A 2CRGA 3G7RA 2XGDA 2JA5J 3LJLA 1TWGJ 4XRMA 2GUHA 2ZB9A 3JRIA 2L9RA 3CJDA 2COBA 2VI6A 5E3LA 5K7HA 3QPSA 2R93J 5EFYA 4BBRJ 4DYQA 1RR7A 3S2HJ 4BBSJ 2LD5A 3BTIA 4A3IJ 2LTPA 1CQTA 2WUIA 4GCLA 2UXPA 3CQZJ 2M9HA 4IHVA 3BG3A 1NTCA 5D1RA 3HOYJ 1FTTA 1Y1VJ 3K7AJ 4UUSB 1B72A 1IRZA 1OCTC 2VUMJ 1AU7A 1W0UA 1RKWA 2DA5A 1RPWA 1IJWC 1ITYA 1MBKA 2LY9A 3BR6A 4L5EA 2EH3A 2E19A 3JRFA 2DA3A 1R9TJ 2K9SA 1U9OA 3WHBA 5EGOB 1YRNB 9ANTA 1LFUP 2NOGA 2ZCXA 4LOCA 2EZKA 3SDGA 4ICHA 5GP9A 2HI3A 3IH3A 1UG2A 3MVPA 3LSPA 3G1MA 3OSGA 2XDNA 3ZQGA 3BR1A 3LSGA 2N8GA 3ZQIA 5EDNA 3RZDJ 1XS9A 5C4XJ 2GFNA 2HYTA 1PUFB 2DMNA 3ZOBA 2W53A 4AF5A 4Y7NJ 2ZCNA 4M3BA 3G1OA 5EG0B 3HOUJ 3CWRA 1AKHA 4FE7A 2FJ1A 3BG9A 3HDDA 2E2JJ 1JGGA 3S5RA 2VKVA 4DZPA 2MG4A 1GVDA 5F0HA 1ORKA 1QVUA 1B8IB 3G56A 5F08A 2P81A 4GFLA 1MBGA 1MBHA 5E3NA 1VFCA 2D5VA 2HYJA 2H8RA 2JA7J 2QIBA 2OI8A 3HEFA 3S17J 1WGXA 2ZOZA 2UXOA 4DYCA 4MIMA 2YVHA 1IG7A 3CRJA 2O7TA 4G12A 5D18A 4GCKA 2G7SA 1U9NA 2CQQA 4XIDA 4S0HB 1NK3P 4A3EJ 5IPAA 2D6YA 5DTDA 3B6CA 4I6ZA 1Q1VA 2M8GX 4PXIA 5IP9J 2MW8A 3C2BA 5EG0A 3OSFA 5CXIA 3I4MJ 2F07A 1F43A 2G7LA 5E3MA 1JTYA 2G0EA 1P7JA 1TWCJ 3KKDA 3HGYA 3JR9A 1ETWA 3A01A 3A02A 1IDZA 2RHAA 3NXCA 2DA4A 4RBOA 3IH2A 2ECCA 5IYDJ 3HOXJ 3HE0A 5HSZA 2HXOA 4A3LJ 1T56A 5M5YJ 4GFBA 2XGEA 1MBFA 3DEWA 4W97A 4A93J 2DTZA 1WH5A 5IOZA 1U78A 2UXIA 5M3MJ 1S7EA 2R7ZJ 5FLMJ 1WCMJ 4FCYA 2ME6A 4AYBN 1VI0A 1TWHJ 3LWJA 4Y52J 3B6AA 3F0CA 5GPCA 1GT0C 3NRGA 3IH4A 2NS7A 2FX0A 1ETOA 2L7ZA 4JX6A 5M3FJ 1LE8B 2R5ZB 3S1QJ 1HOMA 1GUUA 3QQAA 3O8HA 5F1JA 2DA7A 1X2NA 1X2MA 2PBXA 3GZIA 3SJMA 3F1BA 3BQZA 2ECBA 2XPWA 3LHQA 2XRLA 5F27A 1UI5A 2L7MP 3HKZN 5EYRA 3S14J 1BW6A 3FIWA 4XK4A 2DG7A 4D5FA 3TEDA 2GLOA 2ELKA 2YS9A 3JSJA 5D19A 3HOVJ 1QVTA 2PZ9A 1XG1A 2JK3A 4JX5A 5M5XJ 2ID6A 1HCRA 2VKEA 5EZGA 4KWAA 2NVQJ 4RDUA 4XICA 4XRSG 3VVXA 4D7MA 1DU0A 1Y1WJ 4A3GJ 3MN2A 3JRHA 1ETKA 4D7NA 1D5YA 3FK7A 4A3DJ 2PMZN 3LSJA 1IGNA 4MK6A 3JRBA 4ACIA 4M3EA 2R5ZA 2CUEA 3BR2A 4NN1A 3LOCA 4JL3A 2LP0A 2LK2A 5F0FA 3KKCA 2M2EA 1MBEA 2K9NA 4FTHA 3CMYA 2JA6J 1GV5A 1WPKA 3ANPA 2HXIA 4QIWN 1JUMA 2Y2ZA 3QPLA 3S1MJ 1W0TA 3JRGA 2QKOA 2IBDA 3ZQLA 4BY1J 3BR0A 1JUSA 2L0KA 5FKOA 3GTQJ 3COLA 2WV1A 3ZQCA 4L62A 2CUFA 5C44J 2EZLA 2NS8A 3PM1A 1IC8A 1RETA 5F04A 2YUSA 4B4CA 4UUTA 3PO3J 1UHSA 1FTZA 3S1NJ 2K9QA 1ZR2A 2EBIA 5HODA 2UXHA 2E2HJ 3QKXA 3BQYA 5CXGA 4UUSA 2VPRA 2X48A 1TWAJ 2ZOYA 3VW0A 5FKLA 2YVEA 3KZ9A 1P7IA 4CYCB 5FMPA 4JX4A 3ON2A 3RQIA 1K83J 1JKQC 1MSEC 5FGLA 3BR3A 3GTKJ 2Y30A 2FBQA 1YRNA 3BR5A 2WB1N 5EGOA 1HF0A 3S1RJ 1JJ8C 2EZHA 1GV2A 4CGRA 5FKMA 1BJZA 1JT0A 4MXMA 4B1RA 1WI3A 2X6OA 3HBLA 2YU9J 2XB5A 1UI6A 3HTAA 3GEUA 5C4JJ 3NI7A 3TP3A 2JA8J 3FRQA 3O8GA 5C3EJ 4UDSA 1JTXA 1ETQA 3FK6A 4B3AA 4IEJA 1AHDP 3UKGA 5F0CA 1PUFA 3HM5A 5FKNA 3RH2A 1H8AC 2M0CA 3RD3A 4DW6A 2O8KA 4A3KJ 2E2IJ 4IHXA 1A6IA 2HOTA 3Q0VA 3GTJJ 2DA1A 3ZQFA 1B8IA 3BNIA 2JWTA 5CW8A 2HOSA 3MKLA 5K58A 1HDDC 2CQXA 2QOPA 2IAIA 1ETXA 1VF9A 1O4XA 5HBUA 4A3MJ 3Q3SA 2G3BA 3C07A 1G2HA 2NVYJ 1FIPA 2XPVA 4FE4A 2NP5A 1HLVA 4NELA 2KDZA 2ZCMA 1QRYA 1JKOC 3AQSA 1VNDA 4MO7A 2RASA 4HNVA 2LKXA 5IYBJ 3QBMA 2HKUA 4BXXJ 4C3JJ 5EZHA 5AQCA 3VW2A 1QPIA 4C3HJ 3GTOJ 5J3LA 1JKRC 5J1UA 5JLWA 3VUQA 5IYCJ 1OJLA 2TRTA 5FJ8J 5FHPA 4MFEA 1IUFA 2CJJA 5H9TA 1E3OC 5DAJA 3H0GJ 2O7OA 1ETYA 3A03A 3HGGA 3JREA 2XPUA 4A69C 1FJLA 3LSRA 5E3OA 1B72B 3S15J 1BW5A 2RAEA 3JRCA 2EQRA 3OOUA 2JMWA 1HDPA 4QSHA 1SGMA 5EF6A 3IUVA 2NVXJ 3AQTA 1ZKGA 3DCFA 1IDYA 2WAQN 4EEFG 1WH7A 2L7FP 4NDLA 1TC3C 2OF7A 1BA5A 4M3DA 1SFOJ 1MSFC 4IHYA 2LR8A 4DZJA 5C4YA 1H89C 3BTCA 1H88C 2I10A 3HTHA 1LE8A 5IP7J 5EEAA 3VP5A 1RKTA 3BT9A 1RESA 3VOKA 3BG5A 3ZQHA 1ENHA 4A3JJ 3M3YJ 3VOXA 4AC6A 4X6AJ 3W6VA 1T33A 3L1PA 3ON4A 2QCOA 4YZEA 1XC5A 3E7QA 2FD5A 3VVYA 1AKHB 5IOYA 1UMQA 2M34A 2XB0X 2AHQA 5J1YA 4C3IJ 2Q24A 2ID3A 3BJBA 4X1EA 5FKKA 1MBJA 2QWTA 1U8BA 3H3VK 3GBGA 2MSYA 3MNLA 2Y31A 3RZOJ 3SFIA 3BCGA 3EGQA 3VW1A 1I6HJ 1X58A 3K2AA 2DA2A 2QTQA 2X9DA 4XRSA 2LLKA 2LVSA 3E7LA 1ZGWA 3ANGA 4ABZA 5FLVA 2TCTA 2Y0SN 3B81A 4MLOA 4A3FJ 2DN0A 2QF7A 1SANA 4AC0A 2GM4A 4AUXA 5BNGA 1MH4A 1OCPA 3OIOA 2KT0A 1ZQ3P 2DA6A 2DMQA 2K40A 2HOAA 3HOWJ 2IU5A 3BTJA 1JJ6C 4JP0A 2HQ5A 2CU7A 2JJ7A 2R5YB 5K7FA 1APLC 1Z0XA 4MFDA 1GDTA 3LNQA 1MH3A 3GTLJ 3GTMJ 2GBYA 1JT6A 4M3GA 4V2FA 4IHWA 2UXUA 3A01B 2XSDC 4ME9A 3G1LA 3NPIA 1POGA 2E1OA 3DPJA 3WHCA 2DMTA 5GPAA 2W48A 3CCYA 4C2MJ 2Y9ZA 5DS9A 2GENA 3NNRA 3PPBA 3CDLA 3PASA 4M3FA 1JUPA 2JN6A 3Q0UA 1ETVA 1ZR4A 3Q0WA 3TW6A 4A3CJ 4JNNA 1BL0A 2DMPA 2MGQA 3T6NA 3V6GA 5J1RA 2OERA 2LFBA 3M4OJ 4CYCA 3HTJA 5M5WJ 5HAWA 3NAUA 1OFCX 5IP6A 1DU6A 1ZK8A 2Y9YA 2XGCA 3BTLA 1IV6A 2R0QC 2R5YA 2R92J 3GTPJ 4GFKA 1FIAA 3RKQA 1Z77A 2O9LA 3GTGJ 2IEKA 2OPTA 3TP0A 1LFBA 3HTIA 4W1UA 2ME0A 3EUPA 3JRAA 5K7ZA 2HDDA 3IV5A 4V2GA 2B63J 4I76A 4BY7J 1FEXA 1TWFJ 4J19A 2EZIA 3BRUA 4QTRA 1NK2P 3V78A 3TW7A 1K61A 2V57A 2G7GA
chains in the Genus database with same CATH superfamily
2EFQA 1CF7A 4HKUA 1I50J 5AIQA 3S16J 2XGXA 2A68F 1OCZH 2AO9A 4OIOF 1XDUA 2BY3A 2V1NA 3IKTA 4FISA 3JRDA 3VVZA 3WG9A 2KRFA 1IN5A 1F36A 4EATA 3VPRA 2NP3A 4HDUA 4L9JA 4M74A 3OV8A 2BXZA 3LQQA 4QWQA 3HOZJ 3KNWA 2CRGA 2BE5F 2F5CA 5K1YA 3OOPA 2O8XA 3GEZA 1Y8RB 1QGPA 2OAZA 5DDGA 1G3SA 1J0RA 1FBUA 2O03A 2PMUA 3QPSA 3HYIA 2R93J 2M0MA 5EFYA 2DCEA 3S2HJ 1HA8A 4RA2A 1VQOI 2V57A 4O6JA 4XQFA 2B9SA 4GDFA 3FBIB 1MMSA 1NTCA 1FTTA 1Y1VJ 5JVGF 2DDAA 4FHTA 2XASA 1B72A 1IRZA 2ZXWH 4L5JA 1YX3A 1B9NA 2VUMJ 1IW7F 2QM3A 4XSZF 5FB2A 2ZNYA 4RAZA 1YW8A 5F64A 1YFHA 1RPWA 1R1UA 4OAYA 3KYDB 4L5EA 2L02A 3JRFA 2DA3A 2LY1A 1YRNB 4KA4A 2O0YA 2HPIA 1LFUP 1W7PA 2OQGA 2IA1A 1TT5B 5CPRB 5GP9A 4E7JA 1SVLA 1VQ6I 2CUZA 4LG0A 3G1MA 3IRQA 2XDNA 1OYYA 2QKLB 3D5LA 2QQ8A 2RQQA 4J00A 4RB3C 2CMPA 2HYTA 2E5ZA 2DMNA 1PUFB 4AF5A 3F8CA 4Y7NJ 4HDVA 1XD7A 4N0BA 1AKHA 3I55I 1SEUA 3GLLA 3EUAA 1ZRCA 3QP6A 4BJTA 3GWZA 1QVUA 1QU3A 2V7FA 3HHHA 4YEJA 4BE2A 4BDZA 3CCMI 4GFLA 1D8KA 3LAPA 1X3WB 5E3NA 1VFCA 3ZRGA 2D5VA 1K4SA 1FT9A 5LEJA 2QIBA 2OI8A 3W6KB 4KIGA 2K27A 2OQRA 2ZY9A 3BP8A 3M07A 1J59A 2KP6A 4TV7A 3GZNB 4MIMA 2YVHA 4DGWB 4FX0A 3ZXSA 4G12A 1FNNA 4S0HB 1NK3P 3E5XA 4A3EJ 2M7AA 4C30A 1X4PA 5DTDA 5IP9J 2MW8A 2EA4A 5K5RA 3OSFA 5CXIA 2J5OA 3HSRA 1LDKB 4UV9A 3DP7A 1E17A 5J40A 4PGHA 4BUPA 2UZKA 3QRFF 1JTYA 4MEYF 4UVBA 3ECHA 1P7JA 3KKDA 3HGYA 1HQCA 2XF5A 4OD4A 2YR2A 1GHCA 5HS8A 2DA4A 2L9NA 2P5LC 2DT7B 2DK8A 5IYDJ 3HOXJ 4A0XA 4A5NA 1U6GA 3BPVA 1J75A 3ZN1A 2QSHX 2X1CA 2GXGA 1S7EA 3ML6A 3CTAA 4UXNA 1S9HA 2R7ZJ 3HXLA 4JOMA 4E6KG 2ME6A 1LNWA 2DTRA 3LWJA 3EQLF 3PL8A 2JQ7A 1O3TA 1LE8B 5FD6A 2HDWA 1ETOA 3KZYA 4E7KA 2WWYA 3ZMZA 4GO1A 3PIOF 1VQNI 2ZJQF 5F1JA 4HBLA 3WE2A 3SJMA 5HS9A 1FSEA 4LITA 3TGNA 1VQ8I 1M1EB 4HSRA 1B59A 2XPWA 3I64A 4CGZA 1A31A 2L7MP 4H4KC 4XM3A 3QPTA 3FIWA 4D5FA 3RI4A 4D1QA 5DUKA 2BVMA 2YS9A 2FE3A 1ZRDA 4OINF 4PDKA 3MAJA 1XB4A 1WJCA 2JK3A 5M5XJ 2WTEA 1KQ0A 2JVGA 4I09A 4RDUA 2CV1A 2EV6A 4XICA 3CF2A 1KA8A 2RDPA 1Y1WJ 3GF2A 2LBFA 2F2EA 3N97A 3O2PE 1JE8A 3LSJA 4ACIA 3ESWB 2R5ZA 2CUEA 4GRIA 2Z5UA 2FNPA 2ZMEB 4MQ9F 3T0YA 4JL3A 4A6DA 2LK2A 4KDPA 3VWBA 3F3XA 2VPLA 2LDUA 3KKCA 5CVIA 2M2EA 2Z2SB 2OTJI 3SXYA 4FTHA 4LIVA 2M7BA 2X1EA 3K4JA 4IJAA 4BEHA 1X3UA 3QPLA 3MKZA 2W4SA 3JRGA 4PZJA 4BL0B 3ZQLA 4BY1J 1JUSA 3IP4B 5AONA 4EGZA 3C1DA 1G3TA 3ZQCA 1I5ZA 2JVHA 3FBNB 3K6GA 5CKTA 1Z6TA 5F04A 2IS1A 4UUTA 2CW0F 1MJ9A 1UHSA 2HGCA 2EBIA 3FDYA 1VQ5I 4Z2YA 5CVUA 2E2HJ 5E1XA 4IRHA 3UR3C 2DW4A 5CXGA 2PLYA 5J4VA 1HBXG 1TWAJ 3VW0A 3KZ9A 2JA2A 4JX4A 1MSEC 5D6FA 1UFMA 2A6EF 2FOWA 3MZ8A 2LH9A 2L9VA 3BR5A 2KKOA 2IP2A 1YIOA 3RYPA 4CGRA 2RKHA 2R3SA 3CCVI 1BN5A 5FKMA 1BJZA 4MXMA 3PNVA 3CCQI 2FQ3A 2AS5F 1WI3A 2X6OA 3NWTA 3OS2A 1KYWA 5C4JJ 1L3LA 3NI7A 1DDNA 2JA8J 3FRQA 1TQIA 2XHKA 5C3EJ 1WJDA 3V8LA 1ETQA 2DODA 3M1EA 4B3AA 1DUXC 4BQOA 3FXJA 3ZCOA 4BACA 3O6BB 3HM5A 3GLXA 1DGRM 3RH2A 2H6BA 3MZHA 2FU4A 2M0CA 2HPMA 3BZCA 3RD3A 2KLOA 2E2IJ 3ZMDA 1YO5C 3TO6A 2HOTA 1VQ9I 1P6RA 4ZYAA 5KCMA 4HQMA 3TO9A 1OCCH 2JUCA 2JWTA 1V5EA 2HNHA 3MKLA 3PUFA 4CA0A 1ETXA 2HKOA 4DQ2A 3SZPA 4A3MJ 3L7WA 1Y8QB 3MQ0A 3C07A 4IHSA 3DKYA 4ZDPA 1W36C 3N05A 4V19K 4B43A 1AA7A 1OYWA 4E7HA 2NNYA 3VB2A 2W1OA 1X1AA 4KICA 1B9MA 3U9GA 4BH9A 3FZVA 2A07F 3LSKA 3ZQQA 2LKXA 1KU7A 3QBMA 2KPMA 3DWLE 4BXXJ 3R6SA 4BXUA 3SQNA 4C3HJ 3GTOJ 1JKRC 3VUQA 2TRTA 3FM5A 1IF1A 4CUGA 5IT9Z 1X1BA 2KMUA 2E36A 2HVSA 5F1RA 2FBIA 2XPUA 1YITI 1G8XA 4HLYA 4IQ4A 3OL4A 2VBWA 2EQRA 3OOUA 2JMWA 1IRFA 2XF6A 2WY8Q 1V55H 1HDPA 4HV5A 4CDGA 1SGMA 5EF6A 4CCJA 3IUVA 1LB2A 2NVXJ 3AQTA 4WF2A 3OYAA 2FXAA 3LWFA 2QQBA 1F4KA 5CQGA 1WH7A 4S04A 1XSVA 1MSFC 3RSNA 5KNLA 2XAJA 4HF0A 4XR6A 5C4YA 4PFOA 1H89C 2BY2A 1RNLA 3FXUA 5EEAA 5HS7A 1WZ2A 3F6VA 4LB6B 1LFPA 3TKYA 1YX5A 3IL2A 3J7AO 5GTIC 4HX4A 3JTHA 4RGSA 4IQJA 4AC6A 4FETA 1WSUA 4GGGA 4BS9A 5LHHA 3ON4A 4YZEA 4B09A 5ILUA 5DV5A 5B3SH 2M87A 1JGSA 3R60A 3K4LA 2M34A 5LHIA 3K0LA 1IXCA 3K8PC 2L2OA 2ID3A 3BJOA 1P9QC 2HWVA 3HJEA 1J09A 4ZH4F 1X3ZB 2MSYA 4RLFA 4CH7A 4L9NA 1JI8A 2A69F 3M7GA 3EGQA 2CW7A 2W25A 2BVLA 1MKMA 2IS2A 2QTQA 2WC2A 3J81Z 3ANGA 2LVSA 5DYMA 2TCTA 2PFVA 2Z3YA 3C3WA 5GAHJ 3LMMA 4L9TA 3A0HC 4AVZA 1TW3A 2KFDA 4IF4A 4XORA 2A5WA 1MH4A 5CQEA 5CJ9A 1U0JA 2DA6A 2DMQA 5FO5A 3IKVA 2M8EA 4FT8A 2IU5A 2A61A 2P5KA 1BOBA 2JJ7A 2PEXA 4FQGA 5K7FA 1Z0XA 1TNTA 4MFDA 3ZN0A 3CF5F 3CJNA 2JT1A 3GTLJ 3T1BA 2A2FX 1X19A 4M3GA 5TJJA 1A35A 4V2FA 5FLXZ 1IRXA 4ME9A 1R7JA 3TDZC 1IN4A 1K79A 2X6WA 4BHCA 4D9JA 1G4DA 4HG2A 3PPBA 2W48A 4C2MJ 4AIHA 5L3GA 3CDLA 4BDYA 1Y39A 3PASA 5D5XB 1ETVA 3DKWA 4ON0A 2E1MC 2RREA 3Q0WA 3TW6A 3JAMZ 5J47A 1KQ8A 5B5EC 1BL0A 1FC3A 2DMPA 2MGQA 1ZH5A 1YG2A 4P1WA 3V6GA 2P4WA 2RN7A 2EFPA 1BI0A 3SEQA 4PJJA 3SFZA 2UXNA 3NAUA 4ZDOA 3L09A 1ZK8A 3IAM2 3C7JA 4G94A 1XTAA 4RS8A 3A0BC 4R1HA 2LYCA 2R5YA 2Q1ZB 4ZYGA 3D5SC 2VBYA 1FP2A 3B02A 4PCQA 2CGPA 1XSDA 3JSPA 2LOOA 3M8FA 1QNTA 3HTIA 2NYXA 2ME0A 3J7AY 2RC4A 3HPHA 4V2GA 5BQTA 1PUEE 2IJLA 4BY7J 3EETA 3CMAI 2RVCA 3BRUA 2FBHA 2OJED 2WAEA 1HW5A 2IXSA 4U7BA 3TL4X 3FISA 4EJUA 2V1UA 2OBPA 2BOLA 2RQPA 4OIRF 2WGBA 2MD0A 1ZTRA 2HFHA 4XOPA 2GIZA 3I59A 4DYRA 4AYBA 2REKA 2H1KA 4JYKA 1ON2A 2L4MA 1A5JA 4I7HA 4DOZA 3BY6A 3CMEI 4HQEA 3VIBA 4IL6C 3I4NJ 2P5VA 4MNUA 4HPQA 4BKXA 3BHQA 1W5SA 5ICGA 3HIMA 3H92A 2ZO4A 1XMKA 1OYIA 1T0FA 5LGTA 2JA5J 1TWGJ 1MMAA 1FWZA 1R23A 2F5DA 4XRMA 2GUHA 2QQAA 1SMYF 4G7HF 3RKWA 3S93A 2ESHA 2VI6A 2NRAC 2I5UA 1LDJA 4XLCA 1U5TA 4BBRJ 5CVVA 1RR7A 4DYQA 2R7XA 2KZGA 4YG2F 1B4AA 5JVTA 1CQTA 3RIRA 1FMVA 1LQ1A 1UHWA 2H27A 5J4YA 5GAEJ 3CQZJ 1IXSB 1USSA 3RPUA 3ABTA 5J8CA 3E3VA 4UUSB 4EMSA 3OS1A 2VL8A 3FXRA 3WODF 3VSKA 1O7LA 1PVEA 2HU9A 1W0UA 4BNCA 4XLNF 1EV7A 3BLYA 1MBKA 1ITYA 5FFXA 3WHBA 1U9OA 2AQFA 1LDDA 2NOGA 3OR2C 2QA4I 2RV8A 4CCMA 1J5YA 3QU3A 5L3CA 4NB5A 1VQ4I 2KIUA 3KP3A 3E97A 1ZG5A 4IKFA 1UG2A 3MVPA 4II3A 5DCFA 2N8GA 3WU1B 1LUJB 4E7LA 2VBZA 4UHTA 1XS9A 4EJTA 5C4XJ 2G9WA 2R7FA 2UWMA 2GFNA 2W53A 3ZOBA 4FX4A 4RGXA 2ZCNA 2R7SA 1K78A 5EG0B 3HOUJ 3CWRA 5EJCA 1G3WA 2E35A 4FE7A 4XOTA 3U2RA 3HDDA 4G9YA 2MLGA 3VYUB 2EFOA 1I1GA 4XLAA 4ZC3A 5KVRA 4F52A 3L2WA 2VKVA 2E2JJ 3W2AA 5ICCA 4DZPA 2MG4A 1I3AA 4XMYA 3OWTA 1GVDA 3HC7A 2KIMA 3DTEA 3TOBA 3ERED 3S3MA 3G4SI 2P81A 4XLHA 2R7VA 5HLIA 4AVPA 1FLIA 4WX9A 2VE8A 3LFKA 1MBHA 1W4MA 2P6TA 3CLQA 2MH9A 2WB1A 2W57A 1MDMB 2C6YA 4C9YA 4B48A 1KGSA 2M45A 3B73A 3K10A 2W7NA 2CV0A 4C2UA 2EV0A 4OMYA 1FY7A 1K7AA 5FRMA 2UXOA 1IG7A 1EKEA 3U1KA 3E1SA 2O7TA 5D18A 2CQQA 2EFWA 4F93B 3A1YA 3WGIA 2OZUA 2STTA 3WG7H 1ZAOA 1Q1VA 2M8GX 3S2WA 3GFJA 4PXIA 2V26A 3E6CC 2VJJA 1SC7A 2FMYA 4YFXF 1H9GA 3JR9A 3A01A 2DFFA 2JTVA 5LRSA 2RHAA 4LJZF 5DCMA 3SZGA 2ECCA 4OAZA 2DDBA 1R5HA 1S8NA 2XGEA 4UVCA 1D1AA 1R71A 5IOZA 1BBYA 1GVJA 3KP4A 3V8KA 3CO6C 3ECOA 4FCYA 1T38A 1ODDA 1MNDA 2DT5A 1VI0A 1TWHJ 1RR8C 4KUMA 4RB0A 2I8DA 4Y52J 4YELA 4GXOA 2FX0A 4JX6A 4CO8A 5M3FJ 1HOMA 1WHUA 4BJ6C 1HW1A 3S3OA 3QQAA 4L0YB 5FD5A 1X1PA 3CC2I 4B44A 4ESJA 3WTZA 2DA7A 1X2NA 4BHBA 1UELB 2M3AA 5CLSA 5GAGJ 3F1BA 4HSTA 4H0EA 3LHQA 1FBSA 2BBYA 3DEUA 5D4RA 1BW6A 1BJAA 2DG7A 1I27A 3TEDA 3I56I 2ELKA 4P96A 2RGVA 1REPC 3REOA 5D19A 3HOVJ 4CCKA 2VXDA 1YTYA 2PZ9A 4CICA 3MMYB 3LFUA 3VVXA 2E60A 3QWLA 1DU0A 2STWA 1Z9CA 1MNEA 3JRHA 2QEXI 1ETKA 1HC8A 4ANJA 3FK7A 1IGNA 2XSJC 4HW0A 4M3EA 3JRBA 3GYHX 3A4CA 1H0MA 2K3FA 1QQIA 3NS4A 4JBAA 4KNYA 1CGPA 4NN1A 5J8FA 5F0FA 3LL7A 2KJCA 1MBEA 4J01A 3OIPA 5E79C 2DYSH 1WPKA 2HXIA 4QIWN 2Y2ZA 3HUGA 2QKOA 2DPDA 3CCSI 3HSFA 3DLLF 3COLA 2WV1A 1FOXA 2CUFA 2NS8A 1IC8A 2HTJA 2VC1A 2YUSA 4M73A 3OYIA 4LG3A 5H6RA 4F3QA 3GFIA 2Y75A 4RAGA 3AG3H 1S5LC 3S1NJ 1FTZA 1KONA 3F8BA 5HODA 2Z1DA 2CH0A 4DIQA 2ZSHB 3BQYA 3OIQA 3F22A 4B3XA 2ZOYA 4CYCB 5A2QZ 3N4MA 2V9KA 1JKQC 3IWZA 4AIKA 3BR3A 5LLQA 3GTKJ 4UY8I 1YS6A 4PJMA 1IN7A 2ESNA 4DNCA 1Z7UA 1TLHB 1Z3XA 2HTSA 5EGOA 1HF0A 2EZHA 1GV2A 1JT0A 2W82A 2XB5A 3E5UA 1S72I 2BY1A 3LA7A 2E1MB 4MEXF 2ETHA 2ELHA 2XIGA 4UNOA 5F0CA 2RNJA 3KZIC 1MZBA 2VE9A 4HRIA 5FKNA 3CUQC 2QVOA 2A6HF 2E71A 2WV0A 1BM9A 1A6IA 4WIBA 3VDXA 3GMEA 2V79A 4N9HA 1R6RA 2DA1A 1BOAA 4ZTFA 1B8IA 2BHZA 5CW8A 1N25A 4CHUA 3HRUA 3K4KA 4X0GA 3K9TA 1HDDC 3H5NA 5DD4A 4I02A 3RDIA 1SAXA 1ACIA 2CQNA 4YIFA 2JPCA 3HRSA 1DGWY 4M6XA 1PJRA 3Q3SA 3R61A 1IAWA 2XPVA 1HLVA 2X4HA 2ACJA 1Y6IA 2H1LA 2VJ4A 2KDZA 2DXIA 2ZCMA 3EDPA 3LQRA 3F8NA 2CWEA 1TP4A 2R7UA 5DEQA 1VNDA 2BEOA 3WU2C 1S29A 4MO7A 2V4JC 5IT9K 3FXLA 3ZR8X 3O3KA 4HNVA 3JTGA 3H0DA 2VKHA 3F23A 2HKUA 4IXAA 2KDOA 5KHDA 3VW2A 2K7LA 2V9PA 1FYLA 3E6BA 2CSOA 3AAFA 2HDCA 5IYCJ 1OJLA 3PFYA 1IUFA 2CJJA 3K70C 2K86A 1E3OC 5D8LB 1ERDA 2LKSA 3H0GJ 3KYCB 3IRRA 2EIKH 3OYGA 1ETYA 3ROUA 3JREA 2IS4A 4P9FA 1IN6A 1D0ZA 1R00A 2PI0A 2EPFA 1E3PA 3LSRA 5E3OA 1B72B 2XC7A 5IY5H 4Y17A 2IW5A 2K5CA 4XRFA 3K1PA 1BI3A 1R22A 3SYTA 2MC4A 4QSHA 4L5IA 4Q48A 4G8XA 1ZARA 3J80Z 2EIMH 4EEFG 1W7PB 2CV2A 2CQKA 2A5YB 3F8FA 1GXQA 1H88C 4LLNA 5D8KB 2ISYA 2I10A 3HTHA 5IP7J 1RESA 1D1CA 1R1VA 4YIIA 4BE0A 3BG5A 3TQNA 2A05A 1ENHA 3QPHA 3CO7C 4A3JJ 3M3YJ 1T33A 2VJ5A 3CC4I 1WJBA 3GXOA 4XSXF 2EFNA 3BPXA 3JSOA 4GYGA 3L00A 3ZQ7A 1YLFA 2E34A 1R4NB 3T5XA 4AIDA 5H20A 1AKHB 4IX7A 4DBQA 3S3NA 3ONQA 4HEA2 3VYSB 1ZLJA 3EPZA 4M71A 4X1EA 4HF1A 3J81K 1MBJA 1ZYRF 2QWTA 1J7KA 5E1ZB 1W7PD 3K4CA 4CZCA 2IPQX 3WTVC 2K85A 3BCGA 3VW1A 1X58A 4AD9A 1W5CC 4LD5A 2VJIA 2NAZA 2X9DA 2LLKA 1MW7A 4WXDA 2XAGA 1YW9A 4ABZA 2E1CA 3B81A 2DN0A 3FXMA 3CCJI 4LIUA 5GADJ 3D0SA 4AUXA 2XAQA 2JSCA 4PSXA 2CUJA 4QLCU 5BNGA 4OD5A 1OCPA 3OIOA 4XN0A 2MABA 3H36A 1S6LA 3J7ZI 2K9LA 3KEQA 2K40A 3ULQB 2HOAA 1MIJA 3LSIA 1BIAA 5FLXK 2HQ5A 2CU7A 3KEOA 3RTRA 2QBYA 2VLAA 1GDTA 5ICEA 3WTYC 1MH3A 2V9VA 1U2WA 3ABMH 3A2KA 2GBYA 3JAMK 2VOOA 2PJRA 1EH7A 2UXUA 5FFZA 3G1LA 3DTIA 2YPRA 4ESFA 2WADA 2DMTA 3CCYA 2CG4A 1Z7LA 4KISA 1JUPA 2JN6A 2L5QA 1ZR4A 4YIRX 4BU2A 3MFKA 4JNNA 3BJAA 3OR1C 2EV5A 5E18F 2JPBA 1EA3A 2X51A 5J1RA 2O6GE 3CESA 1MMDA 2LFBA 5CVJA 4YRVA 2KZVA 3AKZA 2RNGA 1KU2A 4G7ZF 3W3CA 3WTUC 3DPUA 1K6YA 3FMRA 4L18B 2VODA 3GTPJ 4GFKA 3BG6A 3WTXC 4F91B 3CUQA 2O9LA 4PJLA 3GTGJ 3G73A 1E3HA 3TP0A 3EUPA 2HDDA 3IV5A 2JZYA 5TGTA 4HF2A 4HYEA 4QTRA 1NK2P 1T0FC 4PFPA 3JW4A 3DTKA 3TW7A 2GZWA 4PSWA 4E7SA 4I01A 2TDXA 2DJNA 2QENA 2BYVE 4LGWA 1JKPC 3SWHA 1U5TC 4II2A 2XAUA 3MKYB 2LBFB 2NVTJ 2NX4A 3PO2J 4RB1A 2Q2EA 4ESBA 1NG7A 3D1NI 3U1DA 4JKZA 3WU0A 4D5CA 2F5EA 4IOAF 1XSXA 1RRJA 2QQ9A 1YQAA 2KISA 5D5VB 2R4GA 3QU6A 2FQ4A 3OS0A 5LBQA 2H8WA 2FNAA 4NQWA 2CFXA 4XN3A 3SEZA 2GWRA 3T8RA 3V7CA 1R4MB 5B1BH 4BEHB 4Q4ZF 3JRIA 2VB6A 1KYZA 3CJDA 4CSWA 3QOEA 2COBA 5ILVA 3EUHA 2Q0OA 2LD5A 1O7FA 2LTPA 2WUIA 4WK8F 3ABLH 3EUKL 4GCLA 2UXPA 3M1CA 4BQQA 2HYGD 4NC8A 4IHVA 2HS5A 4U87A 1LJ9A 1GLNA 4M9XA 3HOYJ 2F5FA 4PGGA 3C18A 4A0YA 1SFKA 4G7OF 1A04A 1QHHD 1AU7A 6PAXA 2PN6A 3KPHA 1IJWC 1LVKA 3BR6A 3CUOA 2EH3A 2E19A 2DQLA 2HKXA 5KAFC 9ANTA 2ZCXA 3HRMA 3MCZA 2HI3A 5LHGA 2IT0A 2PG4A 2QSFX 5BOXA 3ISPA 3OSGA 3ZQGA 2VT3A 3ZQIA 1HKTA 3C2GA 3K4NA 2VKDA 1SD5A 1K4TA 1MMNA 3H9GA 3QP5A 3G1OA 3QYBA 2HYFA 5B66C 2ZXHA 4AWXB 5DUIA 3S5RA 1I39A 5LFAA 3BC8A 2NNNA 1WI9A 1O3RA 5F0HA 3EYYA 1B1BA 4XKCA 5F08A 3R0JA 4XLPF 2EIJH 4KIFA 5LEKA 1MBGA 4WCGA 4AIJA 3QODA 2H8RA 3KP6A 3DLAA 2JA7J 4Y13A 3V8JA 2VASA 3G71I 3HEFA 3PJRA 1OMIA 3S17J 4RAFA 2MLKA 4DYCA 2NVUB 1UZCA 1V5FA 1H9TA 4GCKA 3LSTA 1U9NA 2DU9A 4G6DA 2BW3A 3GO5A 4M9ZA 5IPAA 4Y15A 3F6OA 2D6YA 3B6CA 4G6TB 4I6ZA 1USTA 4CXFA 2OTLI 1DQUA 3C2BA 3RYRA 5EG0A 3M8JA 3W6JB 3I4MJ 1F43A 3ABUA 1UCRA 3HSEA 4LLGF 4B47A 5L3FA 2G7LA 1HSTA 2G0EA 3S8PA 1HW2A 2JRMA 1SMTA 1ETWA 1IDZA 2DT6A 3A02A 1N77A 3T8TA 2YSRA 3DU6A 4WXCA 3CJRB 2DFHA 5CVRA 4RBOA 1SD7A 3X2QH 3BOQA 1R58A 3HE0A 2HXOA 4A12A 2UV1A 5HDGA 1MMGA 3DEWA 1MDMA 3OYNA 2XVCA 5E1WA 2UXIA 4RAYA 5M3MJ 3CP8A 4OIQF 2YX4A 2LSOA 4QPOA 1WCMJ 1XX5A 2R7OA 2GAUA 3FXQA 1XCBA 5H6QA 4AYBN 5LGUA 2DPUA 3DV8A 3SZTA 3B6AA 3KETA 3F0CA 3IH4A 3OYBA 3BWGA 2L7ZA 3S1QJ 1YW7A 1KZHA 1WRJA 3I3LA 4F92B 2M5WA 1SVOA 3MD2A 2PBXA 1S3JA 1UJ8A 4E7IA 1FOWA 1JXSA 3FHZA 2ECBA 2VQHA 3WTWC 4A0ZA 1I1SA 1FP1D 1Z6RA 3HIFA 5EYRA 1ZGJA 4XKWA 4XK4A 4KMUX 4U88A 3JSJA 5HLGA 5GTHC 3NRVA 2EINH 3CD6I 1QVTA 1IN8A 4PUSA 1LEBA 2OD5A 2ID6A 2EILH 2GA1A 4MGRA 4P9UA 2VKEA 5EZGA 4KWAA 1WJFA 2ZJ2A 5L3EA 4EQQA 1D3YA 3ASNH 2ELJA 5JR3A 3CMMA 2QZ8A 4D7MA 4A3GJ 4NNJA 1VQLI 1B6AA 1XGNA 1OISA 3F8MA 4D7NA 4BXFA 1D5YA 3LA3A 2JSPA 1G6NA 3LOCA 1MGTA 4K2EA 2HQNA 1WJ5A 3U21A 5HOOA 2XRNA 3CP2A 2K9NA 3CMYA 2VXZA 4N4NB 2KQRA 1X1DA 4DJAA 2JA6J 1GV5A 1V4RA 1F5TA 2A6TA 2KIQA 4C2TA 1JUMA 1O57A 3S1MJ 2FUG2 1W0TA 4BYYA 2VN2A 1N75A 2L0KA 5FKOA 1D1BA 3GTQJ 4U0YA 1WFXA 1BI1A 1A36A 2EZLA 3PM1A 1T08B 2O3FA 4B4CA 2PJPA 1SD6A 3RKXA 2Y69H 5KK1A 4IO9F 4EGYA 3IC7A 2ADUA 5A2QK 3PO3J 1DPUA 1ZR2A 1L0OC 3QYEA 4WXHA 1PDNC 2DAOA 2M1BA 3BDDA 2Y0SA 4U0WA 2X48A 3L2RA 2CW8A 5FKLA 2BXYA 2HQRA 1P7IA 4BHPA 2X6XA 2DOFA 2Y30A 2FBQA 1YRNA 2WB1N 3WGGA 5HNHA 2FEZA 2HQAA 3H9JA 3HBLA 2CS3A 2YU9J 1RUOA 2PBIA 1XGSA 2FOKA 2IGMA 1KU3A 2AXLA 3O8GA 1JTXA 2R7WA 2LG4A 4IOCF 2VC0A 4IEJA 1R49A 1G59A 1GXPA 3UKGA 3DU5A 1PUFA 1YIJI 3G6EI 5EEGA 1FBQA 1YJWI 1UG0A 3KYLA 4ZZLA 4DW6A 2A3SA 2O8KA 4IHXA 3KP7A 4KN4X 2K02A 1ZN2A 3QOPA 2UXXA 4S05A 1EJ9A 4O5VA 2VQCA 2M4KA 4ZDLA 4AM3A 3BNIA 2PMHA 1VTNC 3I59B 2HOSA 1SAUA 1FSHA 2CQXA 1Z21A 2IA2A 3VSLA 2QOPA 3L2CA 1VF9A 1DP3A 5HBUA 3CJTB 3Q9SA 1T6SA 4BGDA 2G3BA 1G2HA 2NVYJ 4EJVA 1E2XA 3F21A 3AG2H 3D5RC 4BJ5C 1QRYA 1JKOC 2K4JA 2E7XA 3AQSA 1HSJA 3K2ZA 2QSGX 2M30A 1DPRA 2QLZA 5EZHA 4C3JJ 4GYIA 1QPIA 1U5TB 1OQYA 5J3LA 5JLWA 4UB8C 1DP7P 5JI6A 2ISZA 3MZYA 1OR7C 1I6XA 1QZEA 1UB9A 5FJ8J 1WJAA 4XBFA 4U7DA 1W36D 4PJNA 5FHPA 3W2WA 5H9TA 1OCOH 3GZ5A 1FPQA 1VQMI 2D45A 1O3QA 1IRGA 2PFBA 4XL9A 3P9IA 1UAAA 1XCVA 3J80K 1BC8C 1FJLA 4IPAA 2K4BA 1FMWA 3L9FA 3FF5A 3S15J 1BW5A 1BR2A 1WJEA 1TQPA 2GA2A 2OA4A 4NBQA 4UV8A 4ZYDA 3L2VA 2M4GA 3FMQA 5DD8A 1W1WE 1TTYA 3BZKA 3FM3A 5E20A 4A2UA 3DBRB 4EVIA 3CCUI 3DKXA 2XF7A 1TC3C 4A5MA 1PP8F 1BA5A 4M3DA 3FXOA 2LR8A 4D0PA 1IO2A 1W5TA 2IVMA 2MD5A 3BTCA 2H94A 2QKMB 1LE8A 3BT9A 3ZQHA 3P9KA 5BPDA 1YS7A 2MH2A 3RPUD 1VQPI 4X6AJ 1LPQA 3GFMA 1LVAA 3W6VA 2QCOA 2IGOA 3BZ6A 1XC5A 1V54H 3KZZA 1K78B 3E7QA 4IRVA 2FD5A 2D1VA 5IOYA 3Q9VA 2VIXA 2L4AA 3VYRB 1YYVA 3HG9A 2D2WA 4C3IJ 2Q24A 1OPCA 3BJBA 3NQOA 2XAHA 3VYTB 2IA0A 4Z6YA 1U8BA 2ZJPF 4EJOA 3H3VK 3GBGA 2OU2A 3RZOJ 4CCNA 3SFIA 3DF8A 1XPXA 3DBLB 3K2AA 2DLLA 2LF7A 2VQLA 3HTUA 5HNFA 3OL3A 3H9QA 1ZGWA 3COAC 2DYRH 4MLOA 2OCEA 2ZKZA 3P5JA 2F4MB 1TQMA 1SANA 2VONA 2DFEA 4AC0A 2GM4A 2L01A 2DBBA 2ZMEA 4R79A 1T39A 2KT0A 1BC7C 2V6EA 1ZQ3P 2WY7Q 5HLHA 4IRIA 2Q8KA 5K5QA 1WVRA 3UNGC 3WGHA 3HOWJ 3BTJA 1JJ6C 2G7HA 2OUMA 2R7QA 1APLC 3AL0C 3PQJA 1ONVA 1IZ1A 2JRTA 5CYVA 4KT6A 3FXKA 4LK0F 1JT6A 1BI2A 4IVNA 1MJBA 3A01B 2XSDC 3NPIA 2E1OA 2OC6A 3DPJA 5DCMB 1OLTA 3LA2A 2Y9ZA 1X4OA 2F4OB 2E7WA 4XLEA 2R7DA 3VODA 5JHUA 2GXAA 1CF7B 3T6NA 5ILSA 1BR1A 3HOSA 2OERA 3HTJA 3SDBA 5HAWA 2J5PA 1FYMA 2L3DA 1QZZA 5IP6A 3FMSA 2HVRA 2Y9YA 2XGCA 3BTLA 4N9IA 1IV6A 2MFZA 2R0QC 4YFKF 2R92J 3RKQA 3L2UA 3DBHB 1ZREA 3ZMTA 2IEKA 2OV7A 3FX3A 3GVAA 3AFHA 2OPTA 4ENKA 2CO5A 3JRAA 2FMLA 3I9V2 1SFXA 2B63J 1P4WA 2HZDA 1TWFJ 4J19A 2EZIA 1D0XA 2QWWA 1Z3YA 3V78A 4HNUA 3OYEA 1IUYA 2NS0A 2V1XA 1K61A 3GW2A 1VQKI 4Q5SF 3BCAA 2V6CA 3PNTA 2G7GA 5JLXA 1MNMC 4XKBA 3CC7I 1HXDA 3TO7A 2WAFA 4ITVA 3S2DJ 3EUHC 4OU0A 4LMYA 3K1NA 3NARA 2E5NA 2GIVA 3HB9A 3FKIJ 2DG8A 3IUOA 3MKWB 3P9TA 4E70A 4GCTA 1EF4A 1YHQI 4A3BJ 1STZA 3O60A 1BIBA 2JUGA 2P7CB 4M6VA 3K4MA 2VOPA 2CFOA 3DFGA 1I3QJ 3DPTA 2DMUA 2LMDA 2COMA 3DEEA 3MWMA 3G7RA 1OR7A 1LEAA 2OCCH 2XGDA 3H5AA 3LJLA 1Q1HA 2ZJRF 2O61A 3RCOA 2ZB9A 2ZBKA 4LG0B 2L9RA 4ZZDA 3HUGB 3OYJA 5JHFA 1A6QA 1QHGA 5E3LA 3CCLI 5K7HA 3HOTA 1R1TA 3HHGA 4BBSJ 4NC6A 1P92A 2L54A 3BTIA 4A3IJ 3HZJA 2X0LA 1V5GA 2M9HA 5E8GA 2ZXIA 4EM0B 2YX7A 5ED4A 3BG3A 5D1RA 2NOJB 2QGUA 3K7AJ 2FSWA 1E0EA 3PFIA 1TL8A 2VQGA 3SHFA 3GCMA 1OCTC 3BG7A 1RKWA 2P8TA 2DA5A 5LD2C 2CYYA 3ZPLA 2LY9A 4MTEA 2BZTA 1R9TJ 2K9SA 5EGOB 3BCBA 1U3EM 1NHAA 1QA6A 4HOBA 1S7AA 3H35A 2EZKA 4LOCA 3SDGA 4ICHA 5HVQC 5KAIC 3IHUA 5BMZA 2W00A 1T98A 3IH3A 3LSPA 3M9AA 3BR1A 3LSGA 5BPIA 1PP7U 5EDNA 3RZDJ 1R36A 3HTSB 4GCVA 4U9LA 1JHHA 4M3BA 5J6XA 5FRNA 3R0AA 2FJ1A 3BG9A 1JGGA 4IRGA 4KIBA 2Z16A 2UUZA 1ORKA 1B8IB 3G56A 4HX8A 5FGMA 4RM2A 4ETSA 2BGCA 4P55A 2XDVA 2EWNA 1Z67A 4HX7A 3GX4X 2HYJA 4XONA 4XKVA 5FROA 1WGXA 1KU9A 1QBJA 2ZOZA 2Y48A 2LF8A 4R8HA 3CRJA 2WBMA 1XGMA 2LC2A 4EJWA 4F55A 2G7SA 1P4AA 4XIDA 1BR4A 4ZTJA 1F1ZA 2Y0MA 3V42A 1RI7A 2Z33A 1TT0A 2F4IA 2F07A 2BY0A 5E3MA 3LAJA 1TBXA 3I53A 4PJ0C 1O3SA 1TWCJ 2P7VB 2XKPA 1ZLKA 2X85A 5BS6A 3I5UA 2H6CA 4HLXA 2K9MA 3HPGA 2XKOA 2XV4S 3NXCA 1MJAA 2PX9A 1Z91A 2AXTC 1T95A 3I0TA 5K5OA 1G3YA 3BROA 3IH2A 3OYFA 5HSZA 1P4XA 4A3LJ 1T56A 3EYIA 5M5YJ 4GFBA 1MBFA 1WQ2A 4W97A 4A93J 2DTZA 1WH5A 1XDSA 1U78A 5D5WB 2X6YA 3FHNA 3G2BA 5JFRA 4L0ZB 4BQAA 5FLMJ 2XUBA 5ICFA 3P7NA 1ULYA 2PQ8A 2ZSIB 5TISC 2VBXA 5GPCA 1GT0C 1FOKA 3NRGA 2NS7A 3OMYA 2DQRA 3KFWX 2DI3A 5D4SA 2R5ZB 1GUUA 4Y4RA 4A6EA 1ZHFA 3O8HA 1Z1DA 1X2MA 3WTSC 3GZIA 2X1DA 2ZCWA 1PYVA 5LRRA 3BQZA 5H2FC 1J9IA 1JHFA 3TMOA 1OKRA 2XRLA 5F27A 1T2KA 2LRDA 1UI5A 1TZLA 3HKZN 3HKZA 4IHTA 3S14J 1UHMA 2GLOA 2DFIA 3K4BA 4ZJZA 2HVQA 3OY9A 2XAFA 1Y56A 1XG1A 3HL2A 4JX5A 1HCRA 4I0BA 4KJZA 1R5ID 2NVQJ 3LSHA 3QAHA 4XLFA 2P6SA 1RIOH 2NXNB 4XRSG 4OOIA 2DK5A 4KT5C 3MN2A 3KX2A 1D8JA 1QPMA 2PMZN 4UUVA 2KIFA 2PMZA 4A3DJ 4MK6A 4RB2C 2W24A 3BR2A 2LP0A 4I98B 4HNTA 2B1EA 4AU7A 3IAS2 4NC7A 2F6CA 1N78A 3R4KA 3FWEA 4LK1F 2DOEA 2MA3A 3QYFA 2QBYB 3PSFA 2E1NA 3ANPA 2B0LA 2HR3A 5DM6F 2GXBA 3OYDA 3KEYA 2IBDA 3W2VA 4WWCA 3BR0A 1RZ4A 2PJRB 2R7TA 4Q47A 4L62A 1FX7A 2IGNA 5C44J 3VTIA 3CCRI 2MC3A 1RETA 1K6OA 1RUNA 1VZ0A 2EA2A 5IT3A 4DVYP 3DPLC 1XMAA 5L3BA 2K9QA 4OIPF 2UXHA 4KN7X 5F6FA 3QKXA 3NWSA 3VEPA 3PQKA 2IRFG 1OCRH 5LGNA 4UUSA 3ZMSA 4N4OB 2VPRA 4NUBA 3TDUC 2YVEA 5E17F 2IGKA 2KHMA 3AG1H 5FMPA 2G7UA 4BAYA 3RQIA 3ON2A 1K83J 3AL0B 3OYCA 3H1CA 3GZ6A 5FGLA 2DO7A 4UB6C 4YFNF 1D0YA 4MTDA 3OYLA 4M6YA 2VT2A 3S1RJ 1JJ8C 1J2XA 5HLTA 4DBRA 3CDHA 3ERMA 2CQ7A 4B1RA 5ERIA 1UI6A 3HTAA 4QPQA 1NH3A 2LNBA 4HZFA 4I2OA 3GEUA 3F9KA 3I71A 2KRHA 3CUQB 3TP3A 2GQQA 4UDSA 3VOEA 1XGOA 1Y0UA 3FK6A 3BJ6A 1FYKA 3FKJA 1AHDP 4U0VA 2D1HA 2FJI1 1NG6A 4FASD 2HEOA 3AG4H 2ZXJA 1HKQA 3M8EA 4BE1A 1YJ9I 1XMXA 3PSIA 1H8AC 3E6DA 4A3KJ 2R7RA 5TRDA 1QZYA 3Q0VA 2Z9OA 2KL4A 3KIOA 3GTJJ 3I4PA 3CDIA 1TW2A 3ZQFA 1ZRFA 3L2QA 5K58A 3NEUA 4PK4A 4E7ZA 2EB7A 4MHGA 3OYKA 3WE3A 4KFCA 2IAIA 4ZYEA 1O4XA 1XN7A 2Q2EB 4NHJA 5B1AH 1FIPA 4FE4A 2NP5A 4NELA 3LSMA 1SD4A 4G6QA 3P9CA 5D5UB 2BHYA 4NQWB 2FF4A 2W85A 1EH6A 1LKXA 1YOVB 4RMNA 2RASA 4Y33A 1AOYA 4ENNA 4HV6A 5DM7F 5IYBJ 3ZGKA 4C2MA 2XROA 4CCLA 5AQCA 3JCUC 2MYSA 4OWRB 5J1UA 4L9VA 2FA5A 4MFEA 2H09A 4Y3OA 1WKMA 3V7RA 5DAJA 2O7OA 4EV0A 5E8IA 3A03A 2FRHA 3HGGA 4CCOA 3RQ4A 4A69C 2O5RA 3KLNA 2RAEA 3JRCA 3KE2A 2GOMA 3KCCA 4RM3A 2BV6A 4MQVA 1ZKGA 2IS6A 3DCFA 4IZZA 4I99C 2EJRA 1IDYA 2WAQN 5HDKA 3PIPF 2L7FP 2WAQA 4NDLA 2DOAA 3K70D 1VQ7I 2OF7A 1QO0D 1Z05A 1MD0A 1TNSA 1RC9A 4ASNA 3KP2A 1SFOJ 4IHYA 4DZJA 1IV8A 2ZNZA 3VP5A 1C0WA 1RKTA 4HA8A 4M72A 2FBKA 3CCEI 3ASOH 4JK1X 3VOKA 2AQEA 2KJBA 4UVAA 3CJQB 4CZZA 1YJNI 3S32A 3VOXA 1ZELA 3PUBA 4EM1A 3L1PA 3E0JB 4KYWA 3ZP5A 3H3ZA 3ZMVA 2F5VA 3VVYA 1ON1A 3H3UA 4LFUA 2ZMEC 3IWFA 1UMQA 2XB0X 3GFLA 3ELKA 3G3ZA 2AHQA 5J1YA 1YI2I 2LY2A 3WTTC 3RJPA 2YVXA 5FKKA 2HOEA 5HDNA 3K69A 1AWCA 1EH8A 4HAMA 4OMZA 3MNLA 1X1CA 2ICWG 2Y31A 2B7EA 2V1DA 2LKPA 1I6HJ 5EEHA 2DA2A 2B3WA 3E6MA 2DJIA 4XRSA 4XNFA 3E7LA 4CYDA 4RLQA 1V3FA 2K3PA 2MBFA 2Y0SN 1ZG1A 2Z99A 5FLVA 4M9SA 4A3FJ 3VFZA 2QF7A 2YU3A 4E4HA 3ABKH 4EM2A 3RPQA 4ENJA 2BW3B 1D5VA 3MEXA 3F72A 3ZMUA 2F48A 4JP0A 1R5GA 2HZTA 1IXRC 1Y0NA 3I58A 3KP5A 4I0AA 4RGUA 3CZ6A 2LREA 5L3DA 2ZC2A 4BQNA 2GOXB 4KITB 1F9NA 3LNQA 1FZPB 3OYHA 3GTMJ 3PNYA 4LLLA 3TOAA 4IHWA 1KQ9A 1POGA 1ZGAA 3H5RA 4F7ZA 1P2FA 3RKYA 2L9SA 3WHCA 5GPAA 4ENMA 2GENA 4LB5A 5DS9A 3NNRA 4M3FA 2QUFA 3Q0UA 4A3CJ 4JQFA 1S7OA 1U8RA 3DQVC 3TBIA 3E5QA 1SFEA 5AIPA 4CYCA 5M5WJ 4O3MA 3M4OJ 1FOYA 2R5YB 1OFCX 4ZYHA 1DU6A 1ZG3A 2KRCA 2ZFUA 1WWXA 4U9NA 3I54A 3GUDA 2EK5A 2W84A 3V7SA 1SFUA 3Q5FA 3OYMA 5D6EA 1FIAA 1Z77A 3DXJF 1SVMA 4P5OA 1HKSA 1LFBA 3CLOA 3KLOA 4W1UA 5K7ZA 3HRTA 2ZFWA 3K1MA 3C2HA 4I76A 3V4GA 1FEXA 1T8IA 4RGRA 4B8XA 2WA0A 2QYOA 2L7KA 1YE9A 3J7YJ 4KMFA 2OZ6A 2P0WA
chains in the Genus database with same CATH topology
3FISA 5JLXA 1MNMC 4HKUA 2WGBA 1I50J 3S16J 1ZTRA 2DJNA 3S2DJ 1JKPC 3NARA 2AO9A 4DYRA 3HB9A 3FKIJ 2NVTJ 2DG8A 2NX4A 2H1KA 2REKA 3PO2J 4JYKA 3P9TA 1A5JA 4FISA 4GCTA 3JRDA 3VVZA 3VIBA 1EF4A 3I4NJ 4A3BJ 3O60A 4JKZA 3D1NI 1F36A 4M6VA 4BKXA 3VPRA 4D5CA 3BHQA 2NP3A 3HIMA 1I3QJ 3HOZJ 3KNWA 2DMUA 2FQ4A 2CRGA 3G7RA 2XGDA 2JA5J 3LJLA 1TWGJ 4XRMA 2GUHA 2ZB9A 3JRIA 2L9RA 3CJDA 2COBA 2VI6A 5E3LA 5K7HA 3QPSA 2R93J 5EFYA 4BBRJ 4DYQA 1RR7A 3S2HJ 4BBSJ 2LD5A 3BTIA 4A3IJ 2LTPA 1CQTA 2WUIA 4GCLA 2UXPA 3CQZJ 2M9HA 4IHVA 3BG3A 1NTCA 5D1RA 3HOYJ 1FTTA 1Y1VJ 3K7AJ 4UUSB 1B72A 1IRZA 1OCTC 2VUMJ 1AU7A 1W0UA 1RKWA 2DA5A 1RPWA 1IJWC 1ITYA 1MBKA 2LY9A 3BR6A 4L5EA 2EH3A 2E19A 3JRFA 2DA3A 1R9TJ 2K9SA 1U9OA 3WHBA 5EGOB 1YRNB 9ANTA 1LFUP 2NOGA 2ZCXA 4LOCA 2EZKA 3SDGA 4ICHA 5GP9A 2HI3A 3IH3A 1UG2A 3MVPA 3LSPA 3G1MA 3OSGA 2XDNA 3ZQGA 3BR1A 3LSGA 2N8GA 3ZQIA 5EDNA 3RZDJ 1XS9A 5C4XJ 2GFNA 2HYTA 1PUFB 2DMNA 3ZOBA 2W53A 4AF5A 4Y7NJ 2ZCNA 4M3BA 3G1OA 5EG0B 3HOUJ 3CWRA 1AKHA 4FE7A 2FJ1A 3BG9A 3HDDA 2E2JJ 1JGGA 3S5RA 2VKVA 4DZPA 2MG4A 1GVDA 5F0HA 1ORKA 1QVUA 1B8IB 3G56A 5F08A 2P81A 4GFLA 1MBGA 1MBHA 5E3NA 1VFCA 2D5VA 2HYJA 2H8RA 2JA7J 2QIBA 2OI8A 3HEFA 3S17J 1WGXA 2ZOZA 2UXOA 4DYCA 4MIMA 2YVHA 1IG7A 3CRJA 2O7TA 4G12A 5D18A 4GCKA 2G7SA 1U9NA 2CQQA 4XIDA 4S0HB 1NK3P 4A3EJ 5IPAA 2D6YA 5DTDA 3B6CA 4I6ZA 1Q1VA 2M8GX 4PXIA 5IP9J 2MW8A 3C2BA 5EG0A 3OSFA 5CXIA 3I4MJ 2F07A 1F43A 2G7LA 5E3MA 1JTYA 2G0EA 1P7JA 1TWCJ 3KKDA 3HGYA 3JR9A 1ETWA 3A01A 3A02A 1IDZA 2RHAA 3NXCA 2DA4A 4RBOA 3IH2A 2ECCA 5IYDJ 3HOXJ 3HE0A 5HSZA 2HXOA 4A3LJ 1T56A 5M5YJ 4GFBA 2XGEA 1MBFA 3DEWA 4W97A 4A93J 2DTZA 1WH5A 5IOZA 1U78A 2UXIA 5M3MJ 1S7EA 2R7ZJ 5FLMJ 1WCMJ 4FCYA 2ME6A 4AYBN 1VI0A 1TWHJ 3LWJA 4Y52J 3B6AA 3F0CA 5GPCA 1GT0C 3NRGA 3IH4A 2NS7A 2FX0A 1ETOA 2L7ZA 4JX6A 5M3FJ 1LE8B 2R5ZB 3S1QJ 1HOMA 1GUUA 3QQAA 3O8HA 5F1JA 2DA7A 1X2NA 1X2MA 2PBXA 3GZIA 3SJMA 3F1BA 3BQZA 2ECBA 2XPWA 3LHQA 2XRLA 5F27A 1UI5A 2L7MP 3HKZN 5EYRA 3S14J 1BW6A 3FIWA 4XK4A 2DG7A 4D5FA 3TEDA 2GLOA 2ELKA 2YS9A 3JSJA 5D19A 3HOVJ 1QVTA 2PZ9A 1XG1A 2JK3A 4JX5A 5M5XJ 2ID6A 1HCRA 2VKEA 5EZGA 4KWAA 2NVQJ 4RDUA 4XICA 4XRSG 3VVXA 4D7MA 1DU0A 1Y1WJ 4A3GJ 3MN2A 3JRHA 1ETKA 4D7NA 1D5YA 3FK7A 4A3DJ 2PMZN 3LSJA 1IGNA 4MK6A 3JRBA 4ACIA 4M3EA 2R5ZA 2CUEA 3BR2A 4NN1A 3LOCA 4JL3A 2LP0A 2LK2A 5F0FA 3KKCA 2M2EA 1MBEA 2K9NA 4FTHA 3CMYA 2JA6J 1GV5A 1WPKA 3ANPA 2HXIA 4QIWN 1JUMA 2Y2ZA 3QPLA 3S1MJ 1W0TA 3JRGA 2QKOA 2IBDA 3ZQLA 4BY1J 3BR0A 1JUSA 2L0KA 5FKOA 3GTQJ 3COLA 2WV1A 3ZQCA 4L62A 2CUFA 5C44J 2EZLA 2NS8A 3PM1A 1IC8A 1RETA 5F04A 2YUSA 4B4CA 4UUTA 3PO3J 1UHSA 1FTZA 3S1NJ 2K9QA 1ZR2A 2EBIA 5HODA 2UXHA 2E2HJ 3QKXA 3BQYA 5CXGA 4UUSA 2VPRA 2X48A 1TWAJ 2ZOYA 3VW0A 5FKLA 2YVEA 3KZ9A 1P7IA 4CYCB 5FMPA 4JX4A 3ON2A 3RQIA 1K83J 1JKQC 1MSEC 5FGLA 3BR3A 3GTKJ 2Y30A 2FBQA 1YRNA 3BR5A 2WB1N 5EGOA 1HF0A 3S1RJ 1JJ8C 2EZHA 1GV2A 4CGRA 5FKMA 1BJZA 1JT0A 4MXMA 4B1RA 1WI3A 2X6OA 3HBLA 2YU9J 2XB5A 1UI6A 3HTAA 3GEUA 5C4JJ 3NI7A 3TP3A 2JA8J 3FRQA 3O8GA 5C3EJ 4UDSA 1JTXA 1ETQA 3FK6A 4B3AA 4IEJA 1AHDP 3UKGA 5F0CA 1PUFA 3HM5A 5FKNA 3RH2A 1H8AC 2M0CA 3RD3A 4DW6A 2O8KA 4A3KJ 2E2IJ 4IHXA 1A6IA 2HOTA 3Q0VA 3GTJJ 2DA1A 3ZQFA 1B8IA 3BNIA 2JWTA 5CW8A 2HOSA 3MKLA 5K58A 1HDDC 2CQXA 2QOPA 2IAIA 1ETXA 1VF9A 1O4XA 5HBUA 4A3MJ 3Q3SA 2G3BA 3C07A 1G2HA 2NVYJ 1FIPA 2XPVA 4FE4A 2NP5A 1HLVA 4NELA 2KDZA 2ZCMA 1QRYA 1JKOC 3AQSA 1VNDA 4MO7A 2RASA 4HNVA 2LKXA 5IYBJ 3QBMA 2HKUA 4BXXJ 4C3JJ 5EZHA 5AQCA 3VW2A 1QPIA 4C3HJ 3GTOJ 5J3LA 1JKRC 5J1UA 5JLWA 3VUQA 5IYCJ 1OJLA 2TRTA 5FJ8J 5FHPA 4MFEA 1IUFA 2CJJA 5H9TA 1E3OC 5DAJA 3H0GJ 2O7OA 1ETYA 3A03A 3HGGA 3JREA 2XPUA 4A69C 1FJLA 3LSRA 5E3OA 1B72B 3S15J 1BW5A 2RAEA 3JRCA 2EQRA 3OOUA 2JMWA 1HDPA 4QSHA 1SGMA 5EF6A 3IUVA 2NVXJ 3AQTA 1ZKGA 3DCFA 1IDYA 2WAQN 4EEFG 1WH7A 2L7FP 4NDLA 1TC3C 2OF7A 1BA5A 4M3DA 1SFOJ 1MSFC 4IHYA 2LR8A 4DZJA 5C4YA 1H89C 3BTCA 1H88C 2I10A 3HTHA 1LE8A 5IP7J 5EEAA 3VP5A 1RKTA 3BT9A 1RESA 3VOKA 3BG5A 3ZQHA 1ENHA 4A3JJ 3M3YJ 3VOXA 4AC6A 4X6AJ 3W6VA 1T33A 3L1PA 3ON4A 2QCOA 4YZEA 1XC5A 3E7QA 2FD5A 3VVYA 1AKHB 5IOYA 1UMQA 2M34A 2XB0X 2AHQA 5J1YA 4C3IJ 2Q24A 2ID3A 3BJBA 4X1EA 5FKKA 1MBJA 2QWTA 1U8BA 3H3VK 3GBGA 2MSYA 3MNLA 2Y31A 3RZOJ 3SFIA 3BCGA 3EGQA 3VW1A 1I6HJ 1X58A 3K2AA 2DA2A 2QTQA 2X9DA 4XRSA 2LLKA 2LVSA 3E7LA 1ZGWA 3ANGA 4ABZA 5FLVA 2TCTA 2Y0SN 3B81A 4MLOA 4A3FJ 2DN0A 2QF7A 1SANA 4AC0A 2GM4A 4AUXA 5BNGA 1MH4A 1OCPA 3OIOA 2KT0A 1ZQ3P 2DA6A 2DMQA 2K40A 2HOAA 3HOWJ 2IU5A 3BTJA 1JJ6C 4JP0A 2HQ5A 2CU7A 2JJ7A 2R5YB 5K7FA 1APLC 1Z0XA 4MFDA 1GDTA 3LNQA 1MH3A 3GTLJ 3GTMJ 2GBYA 1JT6A 4M3GA 4V2FA 4IHWA 2UXUA 3A01B 2XSDC 4ME9A 3G1LA 3NPIA 1POGA 2E1OA 3DPJA 3WHCA 2DMTA 5GPAA 2W48A 3CCYA 4C2MJ 2Y9ZA 5DS9A 2GENA 3NNRA 3PPBA 3CDLA 3PASA 4M3FA 1JUPA 2JN6A 3Q0UA 1ETVA 1ZR4A 3Q0WA 3TW6A 4A3CJ 4JNNA 1BL0A 2DMPA 2MGQA 3T6NA 3V6GA 5J1RA 2OERA 2LFBA 3M4OJ 4CYCA 3HTJA 5M5WJ 5HAWA 3NAUA 1OFCX 5IP6A 1DU6A 1ZK8A 2Y9YA 2XGCA 3BTLA 1IV6A 2R0QC 2R5YA 2R92J 3GTPJ 4GFKA 1FIAA 3RKQA 1Z77A 2O9LA 3GTGJ 2IEKA 2OPTA 3TP0A 1LFBA 3HTIA 4W1UA 2ME0A 3EUPA 3JRAA 5K7ZA 2HDDA 3IV5A 4V2GA 2B63J 4I76A 4BY7J 1FEXA 1TWFJ 4J19A 2EZIA 3BRUA 4QTRA 1NK2P 3V78A 3TW7A 1K61A 2V57A 2G7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIS A;  5JLX A;  1MNM C;  4HKU A;  2WGB A;  1I50 J;  3S16 J;  1ZTR A;  2DJN A;  3S2D J;  1JKP C;  3NAR A;  2AO9 A;  4DYR A;  3HB9 A;  3FKI J;  2NVT J;  2DG8 A;  2NX4 A;  2H1K A;  2REK A;  3PO2 J;  4JYK A;  3P9T A;  1A5J A;  4FIS A;  4GCT A;  3JRD A;  3VVZ A;  3VIB A;  1EF4 A;  3I4N J;  4A3B J;  3O60 A;  4JKZ A;  3D1N I;  1F36 A;  4M6V A;  4BKX A;  3VPR A;  4D5C A;  3BHQ A;  2NP3 A;  3HIM A;  1I3Q J;  3HOZ J;  3KNW A;  2DMU A;  2FQ4 A;  2CRG A;  3G7R A;  2XGD A;  2JA5 J;  3LJL A;  1TWG J;  4XRM A;  2GUH A;  2ZB9 A;  3JRI A;  2L9R A;  3CJD A;  2COB A;  2VI6 A;  5E3L A;  5K7H A;  3QPS A;  2R93 J;  5EFY A;  4BBR J;  4DYQ A;  1RR7 A;  3S2H J;  4BBS J;  2LD5 A;  3BTI A;  4A3I J;  2LTP A;  1CQT A;  2WUI A;  4GCL A;  2UXP A;  3CQZ J;  2M9H A;  4IHV A;  3BG3 A;  1NTC A;  5D1R A;  3HOY J;  1FTT A;  1Y1V J;  3K7A J;  4UUS B;  1B72 A;  1IRZ A;  1OCT C;  2VUM J;  1AU7 A;  1W0U A;  1RKW A;  2DA5 A;  1RPW A;  1IJW C;  1ITY A;  1MBK A;  2LY9 A;  3BR6 A;  4L5E A;  2EH3 A;  2E19 A;  3JRF A;  2DA3 A;  1R9T J;  2K9S A;  1U9O A;  3WHB A;  5EGO B;  1YRN B;  9ANT A;  1LFU P;  2NOG A;  2ZCX A;  4LOC A;  2EZK A;  3SDG A;  4ICH A;  5GP9 A;  2HI3 A;  3IH3 A;  1UG2 A;  3MVP A;  3LSP A;  3G1M A;  3OSG A;  2XDN A;  3ZQG A;  3BR1 A;  3LSG A;  2N8G A;  3ZQI A;  5EDN A;  3RZD J;  1XS9 A;  5C4X J;  2GFN A;  2HYT A;  1PUF B;  2DMN A;  3ZOB A;  2W53 A;  4AF5 A;  4Y7N J;  2ZCN A;  4M3B A;  3G1O A;  5EG0 B;  3HOU J;  3CWR A;  1AKH A;  4FE7 A;  2FJ1 A;  3BG9 A;  3HDD A;  2E2J J;  1JGG A;  3S5R A;  2VKV A;  4DZP A;  2MG4 A;  1GVD A;  5F0H A;  1ORK A;  1QVU A;  1B8I B;  3G56 A;  5F08 A;  2P81 A;  4GFL A;  1MBG A;  1MBH A;  5E3N A;  1VFC A;  2D5V A;  2HYJ A;  2H8R A;  2JA7 J;  2QIB A;  2OI8 A;  3HEF A;  3S17 J;  1WGX A;  2ZOZ A;  2UXO A;  4DYC A;  4MIM A;  2YVH A;  1IG7 A;  3CRJ A;  2O7T A;  4G12 A;  5D18 A;  4GCK A;  2G7S A;  1U9N A;  2CQQ A;  4XID A;  4S0H B;  1NK3 P;  4A3E J;  5IPA A;  2D6Y A;  5DTD A;  3B6C A;  4I6Z A;  1Q1V A;  2M8G X;  4PXI A;  5IP9 J;  2MW8 A;  3C2B A;  5EG0 A;  3OSF A;  5CXI A;  3I4M J;  2F07 A;  1F43 A;  2G7L A;  5E3M A;  1JTY A;  2G0E A;  1P7J A;  1TWC J;  3KKD A;  3HGY A;  3JR9 A;  1ETW A;  3A01 A;  3A02 A;  1IDZ A;  2RHA A;  3NXC A;  2DA4 A;  4RBO A;  3IH2 A;  2ECC A;  5IYD J;  3HOX J;  3HE0 A;  5HSZ A;  2HXO A;  4A3L J;  1T56 A;  5M5Y J;  4GFB A;  2XGE A;  1MBF A;  3DEW A;  4W97 A;  4A93 J;  2DTZ A;  1WH5 A;  5IOZ A;  1U78 A;  2UXI A;  5M3M J;  1S7E A;  2R7Z J;  5FLM J;  1WCM J;  4FCY A;  2ME6 A;  4AYB N;  1VI0 A;  1TWH J;  3LWJ A;  4Y52 J;  3B6A A;  3F0C A;  5GPC A;  1GT0 C;  3NRG A;  3IH4 A;  2NS7 A;  2FX0 A;  1ETO A;  2L7Z A;  4JX6 A;  5M3F J;  1LE8 B;  2R5Z B;  3S1Q J;  1HOM A;  1GUU A;  3QQA A;  3O8H A;  5F1J A;  2DA7 A;  1X2N A;  1X2M A;  2PBX A;  3GZI A;  3SJM A;  3F1B A;  3BQZ A;  2ECB A;  2XPW A;  3LHQ A;  2XRL A;  5F27 A;  1UI5 A;  2L7M P;  3HKZ N;  5EYR A;  3S14 J;  1BW6 A;  3FIW A;  4XK4 A;  2DG7 A;  4D5F A;  3TED A;  2GLO A;  2ELK A;  2YS9 A;  3JSJ A;  5D19 A;  3HOV J;  1QVT A;  2PZ9 A;  1XG1 A;  2JK3 A;  4JX5 A;  5M5X J;  2ID6 A;  1HCR A;  2VKE A;  5EZG A;  4KWA A;  2NVQ J;  4RDU A;  4XIC A;  4XRS G;  3VVX A;  4D7M A;  1DU0 A;  1Y1W J;  4A3G J;  3MN2 A;  3JRH A;  1ETK A;  4D7N A;  1D5Y A;  3FK7 A;  4A3D J;  2PMZ N;  3LSJ A;  1IGN A;  4MK6 A;  3JRB A;  4ACI A;  4M3E A;  2R5Z A;  2CUE A;  3BR2 A;  4NN1 A;  3LOC A;  4JL3 A;  2LP0 A;  2LK2 A;  5F0F A;  3KKC A;  2M2E A;  1MBE A;  2K9N A;  4FTH A;  3CMY A;  2JA6 J;  1GV5 A;  1WPK A;  3ANP A;  2HXI A;  4QIW N;  1JUM A;  2Y2Z A;  3QPL A;  3S1M J;  1W0T A;  3JRG A;  2QKO A;  2IBD A;  3ZQL A;  4BY1 J;  3BR0 A;  1JUS A;  2L0K A;  5FKO A;  3GTQ J;  3COL A;  2WV1 A;  3ZQC A;  4L62 A;  2CUF A;  5C44 J;  2EZL A;  2NS8 A;  3PM1 A;  1IC8 A;  1RET A;  5F04 A;  2YUS A;  4B4C A;  4UUT A;  3PO3 J;  1UHS A;  1FTZ A;  3S1N J;  2K9Q A;  1ZR2 A;  2EBI A;  5HOD A;  2UXH A;  2E2H J;  3QKX A;  3BQY A;  5CXG A;  4UUS A;  2VPR A;  2X48 A;  1TWA J;  2ZOY A;  3VW0 A;  5FKL A;  2YVE A;  3KZ9 A;  1P7I A;  4CYC B;  5FMP A;  4JX4 A;  3ON2 A;  3RQI A;  1K83 J;  1JKQ C;  1MSE C;  5FGL A;  3BR3 A;  3GTK J;  2Y30 A;  2FBQ A;  1YRN A;  3BR5 A;  2WB1 N;  5EGO A;  1HF0 A;  3S1R J;  1JJ8 C;  2EZH A;  1GV2 A;  4CGR A;  5FKM A;  1BJZ A;  1JT0 A;  4MXM A;  4B1R A;  1WI3 A;  2X6O A;  3HBL A;  2YU9 J;  2XB5 A;  1UI6 A;  3HTA A;  3GEU A;  5C4J J;  3NI7 A;  3TP3 A;  2JA8 J;  3FRQ A;  3O8G A;  5C3E J;  4UDS A;  1JTX A;  1ETQ A;  3FK6 A;  4B3A A;  4IEJ A;  1AHD P;  3UKG A;  5F0C A;  1PUF A;  3HM5 A;  5FKN A;  3RH2 A;  1H8A C;  2M0C A;  3RD3 A;  4DW6 A;  2O8K A;  4A3K J;  2E2I J;  4IHX A;  1A6I A;  2HOT A;  3Q0V A;  3GTJ J;  2DA1 A;  3ZQF A;  1B8I A;  3BNI A;  2JWT A;  5CW8 A;  2HOS A;  3MKL A;  5K58 A;  1HDD C;  2CQX A;  2QOP A;  2IAI A;  1ETX A;  1VF9 A;  1O4X A;  5HBU A;  4A3M J;  3Q3S A;  2G3B A;  3C07 A;  1G2H A;  2NVY J;  1FIP A;  2XPV A;  4FE4 A;  2NP5 A;  1HLV A;  4NEL A;  2KDZ A;  2ZCM A;  1QRY A;  1JKO C;  3AQS A;  1VND A;  4MO7 A;  2RAS A;  4HNV A;  2LKX A;  5IYB J;  3QBM A;  2HKU A;  4BXX J;  4C3J J;  5EZH A;  5AQC A;  3VW2 A;  1QPI A;  4C3H J;  3GTO J;  5J3L A;  1JKR C;  5J1U A;  5JLW A;  3VUQ A;  5IYC J;  1OJL A;  2TRT A;  5FJ8 J;  5FHP A;  4MFE A;  1IUF A;  2CJJ A;  5H9T A;  1E3O C;  5DAJ A;  3H0G J;  2O7O A;  1ETY A;  3A03 A;  3HGG A;  3JRE A;  2XPU A;  4A69 C;  1FJL A;  3LSR A;  5E3O A;  1B72 B;  3S15 J;  1BW5 A;  2RAE A;  3JRC A;  2EQR A;  3OOU A;  2JMW A;  1HDP A;  4QSH A;  1SGM A;  5EF6 A;  3IUV A;  2NVX J;  3AQT A;  1ZKG A;  3DCF A;  1IDY A;  2WAQ N;  4EEF G;  1WH7 A;  2L7F P;  4NDL A;  1TC3 C;  2OF7 A;  1BA5 A;  4M3D A;  1SFO J;  1MSF C;  4IHY A;  2LR8 A;  4DZJ A;  5C4Y A;  1H89 C;  3BTC A;  1H88 C;  2I10 A;  3HTH A;  1LE8 A;  5IP7 J;  5EEA A;  3VP5 A;  1RKT A;  3BT9 A;  1RES A;  3VOK A;  3BG5 A;  3ZQH A;  1ENH A;  4A3J J;  3M3Y J;  3VOX A;  4AC6 A;  4X6A J;  3W6V A;  1T33 A;  3L1P A;  3ON4 A;  2QCO A;  4YZE A;  1XC5 A;  3E7Q A;  2FD5 A;  3VVY A;  1AKH B;  5IOY A;  1UMQ A;  2M34 A;  2XB0 X;  2AHQ A;  5J1Y A;  4C3I J;  2Q24 A;  2ID3 A;  3BJB A;  4X1E A;  5FKK A;  1MBJ A;  2QWT A;  1U8B A;  3H3V K;  3GBG A;  2MSY A;  3MNL A;  2Y31 A;  3RZO J;  3SFI A;  3BCG A;  3EGQ A;  3VW1 A;  1I6H J;  1X58 A;  3K2A A;  2DA2 A;  2QTQ A;  2X9D A;  4XRS A;  2LLK A;  2LVS A;  3E7L A;  1ZGW A;  3ANG A;  4ABZ A;  5FLV A;  2TCT A;  2Y0S N;  3B81 A;  4MLO A;  4A3F J;  2DN0 A;  2QF7 A;  1SAN A;  4AC0 A;  2GM4 A;  4AUX A;  5BNG A;  1MH4 A;  1OCP A;  3OIO A;  2KT0 A;  1ZQ3 P;  2DA6 A;  2DMQ A;  2K40 A;  2HOA A;  3HOW J;  2IU5 A;  3BTJ A;  1JJ6 C;  4JP0 A;  2HQ5 A;  2CU7 A;  2JJ7 A;  2R5Y B;  5K7F A;  1APL C;  1Z0X A;  4MFD A;  1GDT A;  3LNQ A;  1MH3 A;  3GTL J;  3GTM J;  2GBY A;  1JT6 A;  4M3G A;  4V2F A;  4IHW A;  2UXU A;  3A01 B;  2XSD C;  4ME9 A;  3G1L A;  3NPI A;  1POG A;  2E1O A;  3DPJ A;  3WHC A;  2DMT A;  5GPA A;  2W48 A;  3CCY A;  4C2M J;  2Y9Z A;  5DS9 A;  2GEN A;  3NNR A;  3PPB A;  3CDL A;  3PAS A;  4M3F A;  1JUP A;  2JN6 A;  3Q0U A;  1ETV A;  1ZR4 A;  3Q0W A;  3TW6 A;  4A3C J;  4JNN A;  1BL0 A;  2DMP A;  2MGQ A;  3T6N A;  3V6G A;  5J1R A;  2OER A;  2LFB A;  3M4O J;  4CYC A;  3HTJ A;  5M5W J;  5HAW A;  3NAU A;  1OFC X;  5IP6 A;  1DU6 A;  1ZK8 A;  2Y9Y A;  2XGC A;  3BTL A;  1IV6 A;  2R0Q C;  2R5Y A;  2R92 J;  3GTP J;  4GFK A;  1FIA A;  3RKQ A;  1Z77 A;  2O9L A;  3GTG J;  2IEK A;  2OPT A;  3TP0 A;  1LFB A;  3HTI A;  4W1U A;  2ME0 A;  3EUP A;  3JRA A;  5K7Z A;  2HDD A;  3IV5 A;  4V2G A;  2B63 J;  4I76 A;  4BY7 J;  1FEX A;  1TWF J;  4J19 A;  2EZI A;  3BRU A;  4QTR A;  1NK2 P;  3V78 A;  3TW7 A;  1K61 A;  2V57 A;  2G7G A; 
#chains in the Genus database with same CATH topology
 2EFQ A;  1CF7 A;  4HKU A;  1I50 J;  5AIQ A;  3S16 J;  2XGX A;  2A68 F;  1OCZ H;  2AO9 A;  4OIO F;  1XDU A;  2BY3 A;  2V1N A;  3IKT A;  4FIS A;  3JRD A;  3VVZ A;  3WG9 A;  2KRF A;  1IN5 A;  1F36 A;  4EAT A;  3VPR A;  2NP3 A;  4HDU A;  4L9J A;  4M74 A;  3OV8 A;  2BXZ A;  3LQQ A;  4QWQ A;  3HOZ J;  3KNW A;  2CRG A;  2BE5 F;  2F5C A;  5K1Y A;  3OOP A;  2O8X A;  3GEZ A;  1Y8R B;  1QGP A;  2OAZ A;  5DDG A;  1G3S A;  1J0R A;  1FBU A;  2O03 A;  2PMU A;  3QPS A;  3HYI A;  2R93 J;  2M0M A;  5EFY A;  2DCE A;  3S2H J;  1HA8 A;  4RA2 A;  1VQO I;  2V57 A;  4O6J A;  4XQF A;  2B9S A;  4GDF A;  3FBI B;  1MMS A;  1NTC A;  1FTT A;  1Y1V J;  5JVG F;  2DDA A;  4FHT A;  2XAS A;  1B72 A;  1IRZ A;  2ZXW H;  4L5J A;  1YX3 A;  1B9N A;  2VUM J;  1IW7 F;  2QM3 A;  4XSZ F;  5FB2 A;  2ZNY A;  4RAZ A;  1YW8 A;  5F64 A;  1YFH A;  1RPW A;  1R1U A;  4OAY A;  3KYD B;  4L5E A;  2L02 A;  3JRF A;  2DA3 A;  2LY1 A;  1YRN B;  4KA4 A;  2O0Y A;  2HPI A;  1LFU P;  1W7P A;  2OQG A;  2IA1 A;  1TT5 B;  5CPR B;  5GP9 A;  4E7J A;  1SVL A;  1VQ6 I;  2CUZ A;  4LG0 A;  3G1M A;  3IRQ A;  2XDN A;  1OYY A;  2QKL B;  3D5L A;  2QQ8 A;  2RQQ A;  4J00 A;  4RB3 C;  2CMP A;  2HYT A;  2E5Z A;  2DMN A;  1PUF B;  4AF5 A;  3F8C A;  4Y7N J;  4HDV A;  1XD7 A;  4N0B A;  1AKH A;  3I55 I;  1SEU A;  3GLL A;  3EUA A;  1ZRC A;  3QP6 A;  4BJT A;  3GWZ A;  1QVU A;  1QU3 A;  2V7F A;  3HHH A;  4YEJ A;  4BE2 A;  4BDZ A;  3CCM I;  4GFL A;  1D8K A;  3LAP A;  1X3W B;  5E3N A;  1VFC A;  3ZRG A;  2D5V A;  1K4S A;  1FT9 A;  5LEJ A;  2QIB A;  2OI8 A;  3W6K B;  4KIG A;  2K27 A;  2OQR A;  2ZY9 A;  3BP8 A;  3M07 A;  1J59 A;  2KP6 A;  4TV7 A;  3GZN B;  4MIM A;  2YVH A;  4DGW B;  4FX0 A;  3ZXS A;  4G12 A;  1FNN A;  4S0H B;  1NK3 P;  3E5X A;  4A3E J;  2M7A A;  4C30 A;  1X4P A;  5DTD A;  5IP9 J;  2MW8 A;  2EA4 A;  5K5R A;  3OSF A;  5CXI A;  2J5O A;  3HSR A;  1LDK B;  4UV9 A;  3DP7 A;  1E17 A;  5J40 A;  4PGH A;  4BUP A;  2UZK A;  3QRF F;  1JTY A;  4MEY F;  4UVB A;  3ECH A;  1P7J A;  3KKD A;  3HGY A;  1HQC A;  2XF5 A;  4OD4 A;  2YR2 A;  1GHC A;  5HS8 A;  2DA4 A;  2L9N A;  2P5L C;  2DT7 B;  2DK8 A;  5IYD J;  3HOX J;  4A0X A;  4A5N A;  1U6G A;  3BPV A;  1J75 A;  3ZN1 A;  2QSH X;  2X1C A;  2GXG A;  1S7E A;  3ML6 A;  3CTA A;  4UXN A;  1S9H A;  2R7Z J;  3HXL A;  4JOM A;  4E6K G;  2ME6 A;  1LNW A;  2DTR A;  3LWJ A;  3EQL F;  3PL8 A;  2JQ7 A;  1O3T A;  1LE8 B;  5FD6 A;  2HDW A;  1ETO A;  3KZY A;  4E7K A;  2WWY A;  3ZMZ A;  4GO1 A;  3PIO F;  1VQN I;  2ZJQ F;  5F1J A;  4HBL A;  3WE2 A;  3SJM A;  5HS9 A;  1FSE A;  4LIT A;  3TGN A;  1VQ8 I;  1M1E B;  4HSR A;  1B59 A;  2XPW A;  3I64 A;  4CGZ A;  1A31 A;  2L7M P;  4H4K C;  4XM3 A;  3QPT A;  3FIW A;  4D5F A;  3RI4 A;  4D1Q A;  5DUK A;  2BVM A;  2YS9 A;  2FE3 A;  1ZRD A;  4OIN F;  4PDK A;  3MAJ A;  1XB4 A;  1WJC A;  2JK3 A;  5M5X J;  2WTE A;  1KQ0 A;  2JVG A;  4I09 A;  4RDU A;  2CV1 A;  2EV6 A;  4XIC A;  3CF2 A;  1KA8 A;  2RDP A;  1Y1W J;  3GF2 A;  2LBF A;  2F2E A;  3N97 A;  3O2P E;  1JE8 A;  3LSJ A;  4ACI A;  3ESW B;  2R5Z A;  2CUE A;  4GRI A;  2Z5U A;  2FNP A;  2ZME B;  4MQ9 F;  3T0Y A;  4JL3 A;  4A6D A;  2LK2 A;  4KDP A;  3VWB A;  3F3X A;  2VPL A;  2LDU A;  3KKC A;  5CVI A;  2M2E A;  2Z2S B;  2OTJ I;  3SXY A;  4FTH A;  4LIV A;  2M7B A;  2X1E A;  3K4J A;  4IJA A;  4BEH A;  1X3U A;  3QPL A;  3MKZ A;  2W4S A;  3JRG A;  4PZJ A;  4BL0 B;  3ZQL A;  4BY1 J;  1JUS A;  3IP4 B;  5AON A;  4EGZ A;  3C1D A;  1G3T A;  3ZQC A;  1I5Z A;  2JVH A;  3FBN B;  3K6G A;  5CKT A;  1Z6T A;  5F04 A;  2IS1 A;  4UUT A;  2CW0 F;  1MJ9 A;  1UHS A;  2HGC A;  2EBI A;  3FDY A;  1VQ5 I;  4Z2Y A;  5CVU A;  2E2H J;  5E1X A;  4IRH A;  3UR3 C;  2DW4 A;  5CXG A;  2PLY A;  5J4V A;  1HBX G;  1TWA J;  3VW0 A;  3KZ9 A;  2JA2 A;  4JX4 A;  1MSE C;  5D6F A;  1UFM A;  2A6E F;  2FOW A;  3MZ8 A;  2LH9 A;  2L9V A;  3BR5 A;  2KKO A;  2IP2 A;  1YIO A;  3RYP A;  4CGR A;  2RKH A;  2R3S A;  3CCV I;  1BN5 A;  5FKM A;  1BJZ A;  4MXM A;  3PNV A;  3CCQ I;  2FQ3 A;  2AS5 F;  1WI3 A;  2X6O A;  3NWT A;  3OS2 A;  1KYW A;  5C4J J;  1L3L A;  3NI7 A;  1DDN A;  2JA8 J;  3FRQ A;  1TQI A;  2XHK A;  5C3E J;  1WJD A;  3V8L A;  1ETQ A;  2DOD A;  3M1E A;  4B3A A;  1DUX C;  4BQO A;  3FXJ A;  3ZCO A;  4BAC A;  3O6B B;  3HM5 A;  3GLX A;  1DGR M;  3RH2 A;  2H6B A;  3MZH A;  2FU4 A;  2M0C A;  2HPM A;  3BZC A;  3RD3 A;  2KLO A;  2E2I J;  3ZMD A;  1YO5 C;  3TO6 A;  2HOT A;  1VQ9 I;  1P6R A;  4ZYA A;  5KCM A;  4HQM A;  3TO9 A;  1OCC H;  2JUC A;  2JWT A;  1V5E A;  2HNH A;  3MKL A;  3PUF A;  4CA0 A;  1ETX A;  2HKO A;  4DQ2 A;  3SZP A;  4A3M J;  3L7W A;  1Y8Q B;  3MQ0 A;  3C07 A;  4IHS A;  3DKY A;  4ZDP A;  1W36 C;  3N05 A;  4V19 K;  4B43 A;  1AA7 A;  1OYW A;  4E7H A;  2NNY A;  3VB2 A;  2W1O A;  1X1A A;  4KIC A;  1B9M A;  3U9G A;  4BH9 A;  3FZV A;  2A07 F;  3LSK A;  3ZQQ A;  2LKX A;  1KU7 A;  3QBM A;  2KPM A;  3DWL E;  4BXX J;  3R6S A;  4BXU A;  3SQN A;  4C3H J;  3GTO J;  1JKR C;  3VUQ A;  2TRT A;  3FM5 A;  1IF1 A;  4CUG A;  5IT9 Z;  1X1B A;  2KMU A;  2E36 A;  2HVS A;  5F1R A;  2FBI A;  2XPU A;  1YIT I;  1G8X A;  4HLY A;  4IQ4 A;  3OL4 A;  2VBW A;  2EQR A;  3OOU A;  2JMW A;  1IRF A;  2XF6 A;  2WY8 Q;  1V55 H;  1HDP A;  4HV5 A;  4CDG A;  1SGM A;  5EF6 A;  4CCJ A;  3IUV A;  1LB2 A;  2NVX J;  3AQT A;  4WF2 A;  3OYA A;  2FXA A;  3LWF A;  2QQB A;  1F4K A;  5CQG A;  1WH7 A;  4S04 A;  1XSV A;  1MSF C;  3RSN A;  5KNL A;  2XAJ A;  4HF0 A;  4XR6 A;  5C4Y A;  4PFO A;  1H89 C;  2BY2 A;  1RNL A;  3FXU A;  5EEA A;  5HS7 A;  1WZ2 A;  3F6V A;  4LB6 B;  1LFP A;  3TKY A;  1YX5 A;  3IL2 A;  3J7A O;  5GTI C;  4HX4 A;  3JTH A;  4RGS A;  4IQJ A;  4AC6 A;  4FET A;  1WSU A;  4GGG A;  4BS9 A;  5LHH A;  3ON4 A;  4YZE A;  4B09 A;  5ILU A;  5DV5 A;  5B3S H;  2M87 A;  1JGS A;  3R60 A;  3K4L A;  2M34 A;  5LHI A;  3K0L A;  1IXC A;  3K8P C;  2L2O A;  2ID3 A;  3BJO A;  1P9Q C;  2HWV A;  3HJE A;  1J09 A;  4ZH4 F;  1X3Z B;  2MSY A;  4RLF A;  4CH7 A;  4L9N A;  1JI8 A;  2A69 F;  3M7G A;  3EGQ A;  2CW7 A;  2W25 A;  2BVL A;  1MKM A;  2IS2 A;  2QTQ A;  2WC2 A;  3J81 Z;  3ANG A;  2LVS A;  5DYM A;  2TCT A;  2PFV A;  2Z3Y A;  3C3W A;  5GAH J;  3LMM A;  4L9T A;  3A0H C;  4AVZ A;  1TW3 A;  2KFD A;  4IF4 A;  4XOR A;  2A5W A;  1MH4 A;  5CQE A;  5CJ9 A;  1U0J A;  2DA6 A;  2DMQ A;  5FO5 A;  3IKV A;  2M8E A;  4FT8 A;  2IU5 A;  2A61 A;  2P5K A;  1BOB A;  2JJ7 A;  2PEX A;  4FQG A;  5K7F A;  1Z0X A;  1TNT A;  4MFD A;  3ZN0 A;  3CF5 F;  3CJN A;  2JT1 A;  3GTL J;  3T1B A;  2A2F X;  1X19 A;  4M3G A;  5TJJ A;  1A35 A;  4V2F A;  5FLX Z;  1IRX A;  4ME9 A;  1R7J A;  3TDZ C;  1IN4 A;  1K79 A;  2X6W A;  4BHC A;  4D9J A;  1G4D A;  4HG2 A;  3PPB A;  2W48 A;  4C2M J;  4AIH A;  5L3G A;  3CDL A;  4BDY A;  1Y39 A;  3PAS A;  5D5X B;  1ETV A;  3DKW A;  4ON0 A;  2E1M C;  2RRE A;  3Q0W A;  3TW6 A;  3JAM Z;  5J47 A;  1KQ8 A;  5B5E C;  1BL0 A;  1FC3 A;  2DMP A;  2MGQ A;  1ZH5 A;  1YG2 A;  4P1W A;  3V6G A;  2P4W A;  2RN7 A;  2EFP A;  1BI0 A;  3SEQ A;  4PJJ A;  3SFZ A;  2UXN A;  3NAU A;  4ZDO A;  3L09 A;  1ZK8 A;  3IAM 2;  3C7J A;  4G94 A;  1XTA A;  4RS8 A;  3A0B C;  4R1H A;  2LYC A;  2R5Y A;  2Q1Z B;  4ZYG A;  3D5S C;  2VBY A;  1FP2 A;  3B02 A;  4PCQ A;  2CGP A;  1XSD A;  3JSP A;  2LOO A;  3M8F A;  1QNT A;  3HTI A;  2NYX A;  2ME0 A;  3J7A Y;  2RC4 A;  3HPH A;  4V2G A;  5BQT A;  1PUE E;  2IJL A;  4BY7 J;  3EET A;  3CMA I;  2RVC A;  3BRU A;  2FBH A;  2OJE D;  2WAE A;  1HW5 A;  2IXS A;  4U7B A;  3TL4 X;  3FIS A;  4EJU A;  2V1U A;  2OBP A;  2BOL A;  2RQP A;  4OIR F;  2WGB A;  2MD0 A;  1ZTR A;  2HFH A;  4XOP A;  2GIZ A;  3I59 A;  4DYR A;  4AYB A;  2REK A;  2H1K A;  4JYK A;  1ON2 A;  2L4M A;  1A5J A;  4I7H A;  4DOZ A;  3BY6 A;  3CME I;  4HQE A;  3VIB A;  4IL6 C;  3I4N J;  2P5V A;  4MNU A;  4HPQ A;  4BKX A;  3BHQ A;  1W5S A;  5ICG A;  3HIM A;  3H92 A;  2ZO4 A;  1XMK A;  1OYI A;  1T0F A;  5LGT A;  2JA5 J;  1TWG J;  1MMA A;  1FWZ A;  1R23 A;  2F5D A;  4XRM A;  2GUH A;  2QQA A;  1SMY F;  4G7H F;  3RKW A;  3S93 A;  2ESH A;  2VI6 A;  2NRA C;  2I5U A;  1LDJ A;  4XLC A;  1U5T A;  4BBR J;  5CVV A;  1RR7 A;  4DYQ A;  2R7X A;  2KZG A;  4YG2 F;  1B4A A;  5JVT A;  1CQT A;  3RIR A;  1FMV A;  1LQ1 A;  1UHW A;  2H27 A;  5J4Y A;  5GAE J;  3CQZ J;  1IXS B;  1USS A;  3RPU A;  3ABT A;  5J8C A;  3E3V A;  4UUS B;  4EMS A;  3OS1 A;  2VL8 A;  3FXR A;  3WOD F;  3VSK A;  1O7L A;  1PVE A;  2HU9 A;  1W0U A;  4BNC A;  4XLN F;  1EV7 A;  3BLY A;  1MBK A;  1ITY A;  5FFX A;  3WHB A;  1U9O A;  2AQF A;  1LDD A;  2NOG A;  3OR2 C;  2QA4 I;  2RV8 A;  4CCM A;  1J5Y A;  3QU3 A;  5L3C A;  4NB5 A;  1VQ4 I;  2KIU A;  3KP3 A;  3E97 A;  1ZG5 A;  4IKF A;  1UG2 A;  3MVP A;  4II3 A;  5DCF A;  2N8G A;  3WU1 B;  1LUJ B;  4E7L A;  2VBZ A;  4UHT A;  1XS9 A;  4EJT A;  5C4X J;  2G9W A;  2R7F A;  2UWM A;  2GFN A;  2W53 A;  3ZOB A;  4FX4 A;  4RGX A;  2ZCN A;  2R7S A;  1K78 A;  5EG0 B;  3HOU J;  3CWR A;  5EJC A;  1G3W A;  2E35 A;  4FE7 A;  4XOT A;  3U2R A;  3HDD A;  4G9Y A;  2MLG A;  3VYU B;  2EFO A;  1I1G A;  4XLA A;  4ZC3 A;  5KVR A;  4F52 A;  3L2W A;  2VKV A;  2E2J J;  3W2A A;  5ICC A;  4DZP A;  2MG4 A;  1I3A A;  4XMY A;  3OWT A;  1GVD A;  3HC7 A;  2KIM A;  3DTE A;  3TOB A;  3ERE D;  3S3M A;  3G4S I;  2P81 A;  4XLH A;  2R7V A;  5HLI A;  4AVP A;  1FLI A;  4WX9 A;  2VE8 A;  3LFK A;  1MBH A;  1W4M A;  2P6T A;  3CLQ A;  2MH9 A;  2WB1 A;  2W57 A;  1MDM B;  2C6Y A;  4C9Y A;  4B48 A;  1KGS A;  2M45 A;  3B73 A;  3K10 A;  2W7N A;  2CV0 A;  4C2U A;  2EV0 A;  4OMY A;  1FY7 A;  1K7A A;  5FRM A;  2UXO A;  1IG7 A;  1EKE A;  3U1K A;  3E1S A;  2O7T A;  5D18 A;  2CQQ A;  2EFW A;  4F93 B;  3A1Y A;  3WGI A;  2OZU A;  2STT A;  3WG7 H;  1ZAO A;  1Q1V A;  2M8G X;  3S2W A;  3GFJ A;  4PXI A;  2V26 A;  3E6C C;  2VJJ A;  1SC7 A;  2FMY A;  4YFX F;  1H9G A;  3JR9 A;  3A01 A;  2DFF A;  2JTV A;  5LRS A;  2RHA A;  4LJZ F;  5DCM A;  3SZG A;  2ECC A;  4OAZ A;  2DDB A;  1R5H A;  1S8N A;  2XGE A;  4UVC A;  1D1A A;  1R71 A;  5IOZ A;  1BBY A;  1GVJ A;  3KP4 A;  3V8K A;  3CO6 C;  3ECO A;  4FCY A;  1T38 A;  1ODD A;  1MND A;  2DT5 A;  1VI0 A;  1TWH J;  1RR8 C;  4KUM A;  4RB0 A;  2I8D A;  4Y52 J;  4YEL A;  4GXO A;  2FX0 A;  4JX6 A;  4CO8 A;  5M3F J;  1HOM A;  1WHU A;  4BJ6 C;  1HW1 A;  3S3O A;  3QQA A;  4L0Y B;  5FD5 A;  1X1P A;  3CC2 I;  4B44 A;  4ESJ A;  3WTZ A;  2DA7 A;  1X2N A;  4BHB A;  1UEL B;  2M3A A;  5CLS A;  5GAG J;  3F1B A;  4HST A;  4H0E A;  3LHQ A;  1FBS A;  2BBY A;  3DEU A;  5D4R A;  1BW6 A;  1BJA A;  2DG7 A;  1I27 A;  3TED A;  3I56 I;  2ELK A;  4P96 A;  2RGV A;  1REP C;  3REO A;  5D19 A;  3HOV J;  4CCK A;  2VXD A;  1YTY A;  2PZ9 A;  4CIC A;  3MMY B;  3LFU A;  3VVX A;  2E60 A;  3QWL A;  1DU0 A;  2STW A;  1Z9C A;  1MNE A;  3JRH A;  2QEX I;  1ETK A;  1HC8 A;  4ANJ A;  3FK7 A;  1IGN A;  2XSJ C;  4HW0 A;  4M3E A;  3JRB A;  3GYH X;  3A4C A;  1H0M A;  2K3F A;  1QQI A;  3NS4 A;  4JBA A;  4KNY A;  1CGP A;  4NN1 A;  5J8F A;  5F0F A;  3LL7 A;  2KJC A;  1MBE A;  4J01 A;  3OIP A;  5E79 C;  2DYS H;  1WPK A;  2HXI A;  4QIW N;  2Y2Z A;  3HUG A;  2QKO A;  2DPD A;  3CCS I;  3HSF A;  3DLL F;  3COL A;  2WV1 A;  1FOX A;  2CUF A;  2NS8 A;  1IC8 A;  2HTJ A;  2VC1 A;  2YUS A;  4M73 A;  3OYI A;  4LG3 A;  5H6R A;  4F3Q A;  3GFI A;  2Y75 A;  4RAG A;  3AG3 H;  1S5L C;  3S1N J;  1FTZ A;  1KON A;  3F8B A;  5HOD A;  2Z1D A;  2CH0 A;  4DIQ A;  2ZSH B;  3BQY A;  3OIQ A;  3F22 A;  4B3X A;  2ZOY A;  4CYC B;  5A2Q Z;  3N4M A;  2V9K A;  1JKQ C;  3IWZ A;  4AIK A;  3BR3 A;  5LLQ A;  3GTK J;  4UY8 I;  1YS6 A;  4PJM A;  1IN7 A;  2ESN A;  4DNC A;  1Z7U A;  1TLH B;  1Z3X A;  2HTS A;  5EGO A;  1HF0 A;  2EZH A;  1GV2 A;  1JT0 A;  2W82 A;  2XB5 A;  3E5U A;  1S72 I;  2BY1 A;  3LA7 A;  2E1M B;  4MEX F;  2ETH A;  2ELH A;  2XIG A;  4UNO A;  5F0C A;  2RNJ A;  3KZI C;  1MZB A;  2VE9 A;  4HRI A;  5FKN A;  3CUQ C;  2QVO A;  2A6H F;  2E71 A;  2WV0 A;  1BM9 A;  1A6I A;  4WIB A;  3VDX A;  3GME A;  2V79 A;  4N9H A;  1R6R A;  2DA1 A;  1BOA A;  4ZTF A;  1B8I A;  2BHZ A;  5CW8 A;  1N25 A;  4CHU A;  3HRU A;  3K4K A;  4X0G A;  3K9T A;  1HDD C;  3H5N A;  5DD4 A;  4I02 A;  3RDI A;  1SAX A;  1ACI A;  2CQN A;  4YIF A;  2JPC A;  3HRS A;  1DGW Y;  4M6X A;  1PJR A;  3Q3S A;  3R61 A;  1IAW A;  2XPV A;  1HLV A;  2X4H A;  2ACJ A;  1Y6I A;  2H1L A;  2VJ4 A;  2KDZ A;  2DXI A;  2ZCM A;  3EDP A;  3LQR A;  3F8N A;  2CWE A;  1TP4 A;  2R7U A;  5DEQ A;  1VND A;  2BEO A;  3WU2 C;  1S29 A;  4MO7 A;  2V4J C;  5IT9 K;  3FXL A;  3ZR8 X;  3O3K A;  4HNV A;  3JTG A;  3H0D A;  2VKH A;  3F23 A;  2HKU A;  4IXA A;  2KDO A;  5KHD A;  3VW2 A;  2K7L A;  2V9P A;  1FYL A;  3E6B A;  2CSO A;  3AAF A;  2HDC A;  5IYC J;  1OJL A;  3PFY A;  1IUF A;  2CJJ A;  3K70 C;  2K86 A;  1E3O C;  5D8L B;  1ERD A;  2LKS A;  3H0G J;  3KYC B;  3IRR A;  2EIK H;  3OYG A;  1ETY A;  3ROU A;  3JRE A;  2IS4 A;  4P9F A;  1IN6 A;  1D0Z A;  1R00 A;  2PI0 A;  2EPF A;  1E3P A;  3LSR A;  5E3O A;  1B72 B;  2XC7 A;  5IY5 H;  4Y17 A;  2IW5 A;  2K5C A;  4XRF A;  3K1P A;  1BI3 A;  1R22 A;  3SYT A;  2MC4 A;  4QSH A;  4L5I A;  4Q48 A;  4G8X A;  1ZAR A;  3J80 Z;  2EIM H;  4EEF G;  1W7P B;  2CV2 A;  2CQK A;  2A5Y B;  3F8F A;  1GXQ A;  1H88 C;  4LLN A;  5D8K B;  2ISY A;  2I10 A;  3HTH A;  5IP7 J;  1RES A;  1D1C A;  1R1V A;  4YII A;  4BE0 A;  3BG5 A;  3TQN A;  2A05 A;  1ENH A;  3QPH A;  3CO7 C;  4A3J J;  3M3Y J;  1T33 A;  2VJ5 A;  3CC4 I;  1WJB A;  3GXO A;  4XSX F;  2EFN A;  3BPX A;  3JSO A;  4GYG A;  3L00 A;  3ZQ7 A;  1YLF A;  2E34 A;  1R4N B;  3T5X A;  4AID A;  5H20 A;  1AKH B;  4IX7 A;  4DBQ A;  3S3N A;  3ONQ A;  4HEA 2;  3VYS B;  1ZLJ A;  3EPZ A;  4M71 A;  4X1E A;  4HF1 A;  3J81 K;  1MBJ A;  1ZYR F;  2QWT A;  1J7K A;  5E1Z B;  1W7P D;  3K4C A;  4CZC A;  2IPQ X;  3WTV C;  2K85 A;  3BCG A;  3VW1 A;  1X58 A;  4AD9 A;  1W5C C;  4LD5 A;  2VJI A;  2NAZ A;  2X9D A;  2LLK A;  1MW7 A;  4WXD A;  2XAG A;  1YW9 A;  4ABZ A;  2E1C A;  3B81 A;  2DN0 A;  3FXM A;  3CCJ I;  4LIU A;  5GAD J;  3D0S A;  4AUX A;  2XAQ A;  2JSC A;  4PSX A;  2CUJ A;  4QLC U;  5BNG A;  4OD5 A;  1OCP A;  3OIO A;  4XN0 A;  2MAB A;  3H36 A;  1S6L A;  3J7Z I;  2K9L A;  3KEQ A;  2K40 A;  3ULQ B;  2HOA A;  1MIJ A;  3LSI A;  1BIA A;  5FLX K;  2HQ5 A;  2CU7 A;  3KEO A;  3RTR A;  2QBY A;  2VLA A;  1GDT A;  5ICE A;  3WTY C;  1MH3 A;  2V9V A;  1U2W A;  3ABM H;  3A2K A;  2GBY A;  3JAM K;  2VOO A;  2PJR A;  1EH7 A;  2UXU A;  5FFZ A;  3G1L A;  3DTI A;  2YPR A;  4ESF A;  2WAD A;  2DMT A;  3CCY A;  2CG4 A;  1Z7L A;  4KIS A;  1JUP A;  2JN6 A;  2L5Q A;  1ZR4 A;  4YIR X;  4BU2 A;  3MFK A;  4JNN A;  3BJA A;  3OR1 C;  2EV5 A;  5E18 F;  2JPB A;  1EA3 A;  2X51 A;  5J1R A;  2O6G E;  3CES A;  1MMD A;  2LFB A;  5CVJ A;  4YRV A;  2KZV A;  3AKZ A;  2RNG A;  1KU2 A;  4G7Z F;  3W3C A;  3WTU C;  3DPU A;  1K6Y A;  3FMR A;  4L18 B;  2VOD A;  3GTP J;  4GFK A;  3BG6 A;  3WTX C;  4F91 B;  3CUQ A;  2O9L A;  4PJL A;  3GTG J;  3G73 A;  1E3H A;  3TP0 A;  3EUP A;  2HDD A;  3IV5 A;  2JZY A;  5TGT A;  4HF2 A;  4HYE A;  4QTR A;  1NK2 P;  1T0F C;  4PFP A;  3JW4 A;  3DTK A;  3TW7 A;  2GZW A;  4PSW A;  4E7S A;  4I01 A;  2TDX A;  2DJN A;  2QEN A;  2BYV E;  4LGW A;  1JKP C;  3SWH A;  1U5T C;  4II2 A;  2XAU A;  3MKY B;  2LBF B;  2NVT J;  2NX4 A;  3PO2 J;  4RB1 A;  2Q2E A;  4ESB A;  1NG7 A;  3D1N I;  3U1D A;  4JKZ A;  3WU0 A;  4D5C A;  2F5E A;  4IOA F;  1XSX A;  1RRJ A;  2QQ9 A;  1YQA A;  2KIS A;  5D5V B;  2R4G A;  3QU6 A;  2FQ4 A;  3OS0 A;  5LBQ A;  2H8W A;  2FNA A;  4NQW A;  2CFX A;  4XN3 A;  3SEZ A;  2GWR A;  3T8R A;  3V7C A;  1R4M B;  5B1B H;  4BEH B;  4Q4Z F;  3JRI A;  2VB6 A;  1KYZ A;  3CJD A;  4CSW A;  3QOE A;  2COB A;  5ILV A;  3EUH A;  2Q0O A;  2LD5 A;  1O7F A;  2LTP A;  2WUI A;  4WK8 F;  3ABL H;  3EUK L;  4GCL A;  2UXP A;  3M1C A;  4BQQ A;  2HYG D;  4NC8 A;  4IHV A;  2HS5 A;  4U87 A;  1LJ9 A;  1GLN A;  4M9X A;  3HOY J;  2F5F A;  4PGG A;  3C18 A;  4A0Y A;  1SFK A;  4G7O F;  1A04 A;  1QHH D;  1AU7 A;  6PAX A;  2PN6 A;  3KPH A;  1IJW C;  1LVK A;  3BR6 A;  3CUO A;  2EH3 A;  2E19 A;  2DQL A;  2HKX A;  5KAF C;  9ANT A;  2ZCX A;  3HRM A;  3MCZ A;  2HI3 A;  5LHG A;  2IT0 A;  2PG4 A;  2QSF X;  5BOX A;  3ISP A;  3OSG A;  3ZQG A;  2VT3 A;  3ZQI A;  1HKT A;  3C2G A;  3K4N A;  2VKD A;  1SD5 A;  1K4T A;  1MMN A;  3H9G A;  3QP5 A;  3G1O A;  3QYB A;  2HYF A;  5B66 C;  2ZXH A;  4AWX B;  5DUI A;  3S5R A;  1I39 A;  5LFA A;  3BC8 A;  2NNN A;  1WI9 A;  1O3R A;  5F0H A;  3EYY A;  1B1B A;  4XKC A;  5F08 A;  3R0J A;  4XLP F;  2EIJ H;  4KIF A;  5LEK A;  1MBG A;  4WCG A;  4AIJ A;  3QOD A;  2H8R A;  3KP6 A;  3DLA A;  2JA7 J;  4Y13 A;  3V8J A;  2VAS A;  3G71 I;  3HEF A;  3PJR A;  1OMI A;  3S17 J;  4RAF A;  2MLK A;  4DYC A;  2NVU B;  1UZC A;  1V5F A;  1H9T A;  4GCK A;  3LST A;  1U9N A;  2DU9 A;  4G6D A;  2BW3 A;  3GO5 A;  4M9Z A;  5IPA A;  4Y15 A;  3F6O A;  2D6Y A;  3B6C A;  4G6T B;  4I6Z A;  1UST A;  4CXF A;  2OTL I;  1DQU A;  3C2B A;  3RYR A;  5EG0 A;  3M8J A;  3W6J B;  3I4M J;  1F43 A;  3ABU A;  1UCR A;  3HSE A;  4LLG F;  4B47 A;  5L3F A;  2G7L A;  1HST A;  2G0E A;  3S8P A;  1HW2 A;  2JRM A;  1SMT A;  1ETW A;  1IDZ A;  2DT6 A;  3A02 A;  1N77 A;  3T8T A;  2YSR A;  3DU6 A;  4WXC A;  3CJR B;  2DFH A;  5CVR A;  4RBO A;  1SD7 A;  3X2Q H;  3BOQ A;  1R58 A;  3HE0 A;  2HXO A;  4A12 A;  2UV1 A;  5HDG A;  1MMG A;  3DEW A;  1MDM A;  3OYN A;  2XVC A;  5E1W A;  2UXI A;  4RAY A;  5M3M J;  3CP8 A;  4OIQ F;  2YX4 A;  2LSO A;  4QPO A;  1WCM J;  1XX5 A;  2R7O A;  2GAU A;  3FXQ A;  1XCB A;  5H6Q A;  4AYB N;  5LGU A;  2DPU A;  3DV8 A;  3SZT A;  3B6A A;  3KET A;  3F0C A;  3IH4 A;  3OYB A;  3BWG A;  2L7Z A;  3S1Q J;  1YW7 A;  1KZH A;  1WRJ A;  3I3L A;  4F92 B;  2M5W A;  1SVO A;  3MD2 A;  2PBX A;  1S3J A;  1UJ8 A;  4E7I A;  1FOW A;  1JXS A;  3FHZ A;  2ECB A;  2VQH A;  3WTW C;  4A0Z A;  1I1S A;  1FP1 D;  1Z6R A;  3HIF A;  5EYR A;  1ZGJ A;  4XKW A;  4XK4 A;  4KMU X;  4U88 A;  3JSJ A;  5HLG A;  5GTH C;  3NRV A;  2EIN H;  3CD6 I;  1QVT A;  1IN8 A;  4PUS A;  1LEB A;  2OD5 A;  2ID6 A;  2EIL H;  2GA1 A;  4MGR A;  4P9U A;  2VKE A;  5EZG A;  4KWA A;  1WJF A;  2ZJ2 A;  5L3E A;  4EQQ A;  1D3Y A;  3ASN H;  2ELJ A;  5JR3 A;  3CMM A;  2QZ8 A;  4D7M A;  4A3G J;  4NNJ A;  1VQL I;  1B6A A;  1XGN A;  1OIS A;  3F8M A;  4D7N A;  4BXF A;  1D5Y A;  3LA3 A;  2JSP A;  1G6N A;  3LOC A;  1MGT A;  4K2E A;  2HQN A;  1WJ5 A;  3U21 A;  5HOO A;  2XRN A;  3CP2 A;  2K9N A;  3CMY A;  2VXZ A;  4N4N B;  2KQR A;  1X1D A;  4DJA A;  2JA6 J;  1GV5 A;  1V4R A;  1F5T A;  2A6T A;  2KIQ A;  4C2T A;  1JUM A;  1O57 A;  3S1M J;  2FUG 2;  1W0T A;  4BYY A;  2VN2 A;  1N75 A;  2L0K A;  5FKO A;  1D1B A;  3GTQ J;  4U0Y A;  1WFX A;  1BI1 A;  1A36 A;  2EZL A;  3PM1 A;  1T08 B;  2O3F A;  4B4C A;  2PJP A;  1SD6 A;  3RKX A;  2Y69 H;  5KK1 A;  4IO9 F;  4EGY A;  3IC7 A;  2ADU A;  5A2Q K;  3PO3 J;  1DPU A;  1ZR2 A;  1L0O C;  3QYE A;  4WXH A;  1PDN C;  2DAO A;  2M1B A;  3BDD A;  2Y0S A;  4U0W A;  2X48 A;  3L2R A;  2CW8 A;  5FKL A;  2BXY A;  2HQR A;  1P7I A;  4BHP A;  2X6X A;  2DOF A;  2Y30 A;  2FBQ A;  1YRN A;  2WB1 N;  3WGG A;  5HNH A;  2FEZ A;  2HQA A;  3H9J A;  3HBL A;  2CS3 A;  2YU9 J;  1RUO A;  2PBI A;  1XGS A;  2FOK A;  2IGM A;  1KU3 A;  2AXL A;  3O8G A;  1JTX A;  2R7W A;  2LG4 A;  4IOC F;  2VC0 A;  4IEJ A;  1R49 A;  1G59 A;  1GXP A;  3UKG A;  3DU5 A;  1PUF A;  1YIJ I;  3G6E I;  5EEG A;  1FBQ A;  1YJW I;  1UG0 A;  3KYL A;  4ZZL A;  4DW6 A;  2A3S A;  2O8K A;  4IHX A;  3KP7 A;  4KN4 X;  2K02 A;  1ZN2 A;  3QOP A;  2UXX A;  4S05 A;  1EJ9 A;  4O5V A;  2VQC A;  2M4K A;  4ZDL A;  4AM3 A;  3BNI A;  2PMH A;  1VTN C;  3I59 B;  2HOS A;  1SAU A;  1FSH A;  2CQX A;  1Z21 A;  2IA2 A;  3VSL A;  2QOP A;  3L2C A;  1VF9 A;  1DP3 A;  5HBU A;  3CJT B;  3Q9S A;  1T6S A;  4BGD A;  2G3B A;  1G2H A;  2NVY J;  4EJV A;  1E2X A;  3F21 A;  3AG2 H;  3D5R C;  4BJ5 C;  1QRY A;  1JKO C;  2K4J A;  2E7X A;  3AQS A;  1HSJ A;  3K2Z A;  2QSG X;  2M30 A;  1DPR A;  2QLZ A;  5EZH A;  4C3J J;  4GYI A;  1QPI A;  1U5T B;  1OQY A;  5J3L A;  5JLW A;  4UB8 C;  1DP7 P;  5JI6 A;  2ISZ A;  3MZY A;  1OR7 C;  1I6X A;  1QZE A;  1UB9 A;  5FJ8 J;  1WJA A;  4XBF A;  4U7D A;  1W36 D;  4PJN A;  5FHP A;  3W2W A;  5H9T A;  1OCO H;  3GZ5 A;  1FPQ A;  1VQM I;  2D45 A;  1O3Q A;  1IRG A;  2PFB A;  4XL9 A;  3P9I A;  1UAA A;  1XCV A;  3J80 K;  1BC8 C;  1FJL A;  4IPA A;  2K4B A;  1FMW A;  3L9F A;  3FF5 A;  3S15 J;  1BW5 A;  1BR2 A;  1WJE A;  1TQP A;  2GA2 A;  2OA4 A;  4NBQ A;  4UV8 A;  4ZYD A;  3L2V A;  2M4G A;  3FMQ A;  5DD8 A;  1W1W E;  1TTY A;  3BZK A;  3FM3 A;  5E20 A;  4A2U A;  3DBR B;  4EVI A;  3CCU I;  3DKX A;  2XF7 A;  1TC3 C;  4A5M A;  1PP8 F;  1BA5 A;  4M3D A;  3FXO A;  2LR8 A;  4D0P A;  1IO2 A;  1W5T A;  2IVM A;  2MD5 A;  3BTC A;  2H94 A;  2QKM B;  1LE8 A;  3BT9 A;  3ZQH A;  3P9K A;  5BPD A;  1YS7 A;  2MH2 A;  3RPU D;  1VQP I;  4X6A J;  1LPQ A;  3GFM A;  1LVA A;  3W6V A;  2QCO A;  2IGO A;  3BZ6 A;  1XC5 A;  1V54 H;  3KZZ A;  1K78 B;  3E7Q A;  4IRV A;  2FD5 A;  2D1V A;  5IOY A;  3Q9V A;  2VIX A;  2L4A A;  3VYR B;  1YYV A;  3HG9 A;  2D2W A;  4C3I J;  2Q24 A;  1OPC A;  3BJB A;  3NQO A;  2XAH A;  3VYT B;  2IA0 A;  4Z6Y A;  1U8B A;  2ZJP F;  4EJO A;  3H3V K;  3GBG A;  2OU2 A;  3RZO J;  4CCN A;  3SFI A;  3DF8 A;  1XPX A;  3DBL B;  3K2A A;  2DLL A;  2LF7 A;  2VQL A;  3HTU A;  5HNF A;  3OL3 A;  3H9Q A;  1ZGW A;  3COA C;  2DYR H;  4MLO A;  2OCE A;  2ZKZ A;  3P5J A;  2F4M B;  1TQM A;  1SAN A;  2VON A;  2DFE A;  4AC0 A;  2GM4 A;  2L01 A;  2DBB A;  2ZME A;  4R79 A;  1T39 A;  2KT0 A;  1BC7 C;  2V6E A;  1ZQ3 P;  2WY7 Q;  5HLH A;  4IRI A;  2Q8K A;  5K5Q A;  1WVR A;  3UNG C;  3WGH A;  3HOW J;  3BTJ A;  1JJ6 C;  2G7H A;  2OUM A;  2R7Q A;  1APL C;  3AL0 C;  3PQJ A;  1ONV A;  1IZ1 A;  2JRT A;  5CYV A;  4KT6 A;  3FXK A;  4LK0 F;  1JT6 A;  1BI2 A;  4IVN A;  1MJB A;  3A01 B;  2XSD C;  3NPI A;  2E1O A;  2OC6 A;  3DPJ A;  5DCM B;  1OLT A;  3LA2 A;  2Y9Z A;  1X4O A;  2F4O B;  2E7W A;  4XLE A;  2R7D A;  3VOD A;  5JHU A;  2GXA A;  1CF7 B;  3T6N A;  5ILS A;  1BR1 A;  3HOS A;  2OER A;  3HTJ A;  3SDB A;  5HAW A;  2J5P A;  1FYM A;  2L3D A;  1QZZ A;  5IP6 A;  3FMS A;  2HVR A;  2Y9Y A;  2XGC A;  3BTL A;  4N9I A;  1IV6 A;  2MFZ A;  2R0Q C;  4YFK F;  2R92 J;  3RKQ A;  3L2U A;  3DBH B;  1ZRE A;  3ZMT A;  2IEK A;  2OV7 A;  3FX3 A;  3GVA A;  3AFH A;  2OPT A;  4ENK A;  2CO5 A;  3JRA A;  2FML A;  3I9V 2;  1SFX A;  2B63 J;  1P4W A;  2HZD A;  1TWF J;  4J19 A;  2EZI A;  1D0X A;  2QWW A;  1Z3Y A;  3V78 A;  4HNU A;  3OYE A;  1IUY A;  2NS0 A;  2V1X A;  1K61 A;  3GW2 A;  1VQK I;  4Q5S F;  3BCA A;  2V6C A;  3PNT A;  2G7G A;  5JLX A;  1MNM C;  4XKB A;  3CC7 I;  1HXD A;  3TO7 A;  2WAF A;  4ITV A;  3S2D J;  3EUH C;  4OU0 A;  4LMY A;  3K1N A;  3NAR A;  2E5N A;  2GIV A;  3HB9 A;  3FKI J;  2DG8 A;  3IUO A;  3MKW B;  3P9T A;  4E70 A;  4GCT A;  1EF4 A;  1YHQ I;  4A3B J;  1STZ A;  3O60 A;  1BIB A;  2JUG A;  2P7C B;  4M6V A;  3K4M A;  2VOP A;  2CFO A;  3DFG A;  1I3Q J;  3DPT A;  2DMU A;  2LMD A;  2COM A;  3DEE A;  3MWM A;  3G7R A;  1OR7 A;  1LEA A;  2OCC H;  2XGD A;  3H5A A;  3LJL A;  1Q1H A;  2ZJR F;  2O61 A;  3RCO A;  2ZB9 A;  2ZBK A;  4LG0 B;  2L9R A;  4ZZD A;  3HUG B;  3OYJ A;  5JHF A;  1A6Q A;  1QHG A;  5E3L A;  3CCL I;  5K7H A;  3HOT A;  1R1T A;  3HHG A;  4BBS J;  4NC6 A;  1P92 A;  2L54 A;  3BTI A;  4A3I J;  3HZJ A;  2X0L A;  1V5G A;  2M9H A;  5E8G A;  2ZXI A;  4EM0 B;  2YX7 A;  5ED4 A;  3BG3 A;  5D1R A;  2NOJ B;  2QGU A;  3K7A J;  2FSW A;  1E0E A;  3PFI A;  1TL8 A;  2VQG A;  3SHF A;  3GCM A;  1OCT C;  3BG7 A;  1RKW A;  2P8T A;  2DA5 A;  5LD2 C;  2CYY A;  3ZPL A;  2LY9 A;  4MTE A;  2BZT A;  1R9T J;  2K9S A;  5EGO B;  3BCB A;  1U3E M;  1NHA A;  1QA6 A;  4HOB A;  1S7A A;  3H35 A;  2EZK A;  4LOC A;  3SDG A;  4ICH A;  5HVQ C;  5KAI C;  3IHU A;  5BMZ A;  2W00 A;  1T98 A;  3IH3 A;  3LSP A;  3M9A A;  3BR1 A;  3LSG A;  5BPI A;  1PP7 U;  5EDN A;  3RZD J;  1R36 A;  3HTS B;  4GCV A;  4U9L A;  1JHH A;  4M3B A;  5J6X A;  5FRN A;  3R0A A;  2FJ1 A;  3BG9 A;  1JGG A;  4IRG A;  4KIB A;  2Z16 A;  2UUZ A;  1ORK A;  1B8I B;  3G56 A;  4HX8 A;  5FGM A;  4RM2 A;  4ETS A;  2BGC A;  4P55 A;  2XDV A;  2EWN A;  1Z67 A;  4HX7 A;  3GX4 X;  2HYJ A;  4XON A;  4XKV A;  5FRO A;  1WGX A;  1KU9 A;  1QBJ A;  2ZOZ A;  2Y48 A;  2LF8 A;  4R8H A;  3CRJ A;  2WBM A;  1XGM A;  2LC2 A;  4EJW A;  4F55 A;  2G7S A;  1P4A A;  4XID A;  1BR4 A;  4ZTJ A;  1F1Z A;  2Y0M A;  3V42 A;  1RI7 A;  2Z33 A;  1TT0 A;  2F4I A;  2F07 A;  2BY0 A;  5E3M A;  3LAJ A;  1TBX A;  3I53 A;  4PJ0 C;  1O3S A;  1TWC J;  2P7V B;  2XKP A;  1ZLK A;  2X85 A;  5BS6 A;  3I5U A;  2H6C A;  4HLX A;  2K9M A;  3HPG A;  2XKO A;  2XV4 S;  3NXC A;  1MJA A;  2PX9 A;  1Z91 A;  2AXT C;  1T95 A;  3I0T A;  5K5O A;  1G3Y A;  3BRO A;  3IH2 A;  3OYF A;  5HSZ A;  1P4X A;  4A3L J;  1T56 A;  3EYI A;  5M5Y J;  4GFB A;  1MBF A;  1WQ2 A;  4W97 A;  4A93 J;  2DTZ A;  1WH5 A;  1XDS A;  1U78 A;  5D5W B;  2X6Y A;  3FHN A;  3G2B A;  5JFR A;  4L0Z B;  4BQA A;  5FLM J;  2XUB A;  5ICF A;  3P7N A;  1ULY A;  2PQ8 A;  2ZSI B;  5TIS C;  2VBX A;  5GPC A;  1GT0 C;  1FOK A;  3NRG A;  2NS7 A;  3OMY A;  2DQR A;  3KFW X;  2DI3 A;  5D4S A;  2R5Z B;  1GUU A;  4Y4R A;  4A6E A;  1ZHF A;  3O8H A;  1Z1D A;  1X2M A;  3WTS C;  3GZI A;  2X1D A;  2ZCW A;  1PYV A;  5LRR A;  3BQZ A;  5H2F C;  1J9I A;  1JHF A;  3TMO A;  1OKR A;  2XRL A;  5F27 A;  1T2K A;  2LRD A;  1UI5 A;  1TZL A;  3HKZ N;  3HKZ A;  4IHT A;  3S14 J;  1UHM A;  2GLO A;  2DFI A;  3K4B A;  4ZJZ A;  2HVQ A;  3OY9 A;  2XAF A;  1Y56 A;  1XG1 A;  3HL2 A;  4JX5 A;  1HCR A;  4I0B A;  4KJZ A;  1R5I D;  2NVQ J;  3LSH A;  3QAH A;  4XLF A;  2P6S A;  1RIO H;  2NXN B;  4XRS G;  4OOI A;  2DK5 A;  4KT5 C;  3MN2 A;  3KX2 A;  1D8J A;  1QPM A;  2PMZ N;  4UUV A;  2KIF A;  2PMZ A;  4A3D J;  4MK6 A;  4RB2 C;  2W24 A;  3BR2 A;  2LP0 A;  4I98 B;  4HNT A;  2B1E A;  4AU7 A;  3IAS 2;  4NC7 A;  2F6C A;  1N78 A;  3R4K A;  3FWE A;  4LK1 F;  2DOE A;  2MA3 A;  3QYF A;  2QBY B;  3PSF A;  2E1N A;  3ANP A;  2B0L A;  2HR3 A;  5DM6 F;  2GXB A;  3OYD A;  3KEY A;  2IBD A;  3W2V A;  4WWC A;  3BR0 A;  1RZ4 A;  2PJR B;  2R7T A;  4Q47 A;  4L62 A;  1FX7 A;  2IGN A;  5C44 J;  3VTI A;  3CCR I;  2MC3 A;  1RET A;  1K6O A;  1RUN A;  1VZ0 A;  2EA2 A;  5IT3 A;  4DVY P;  3DPL C;  1XMA A;  5L3B A;  2K9Q A;  4OIP F;  2UXH A;  4KN7 X;  5F6F A;  3QKX A;  3NWS A;  3VEP A;  3PQK A;  2IRF G;  1OCR H;  5LGN A;  4UUS A;  3ZMS A;  4N4O B;  2VPR A;  4NUB A;  3TDU C;  2YVE A;  5E17 F;  2IGK A;  2KHM A;  3AG1 H;  5FMP A;  2G7U A;  4BAY A;  3RQI A;  3ON2 A;  1K83 J;  3AL0 B;  3OYC A;  3H1C A;  3GZ6 A;  5FGL A;  2DO7 A;  4UB6 C;  4YFN F;  1D0Y A;  4MTD A;  3OYL A;  4M6Y A;  2VT2 A;  3S1R J;  1JJ8 C;  1J2X A;  5HLT A;  4DBR A;  3CDH A;  3ERM A;  2CQ7 A;  4B1R A;  5ERI A;  1UI6 A;  3HTA A;  4QPQ A;  1NH3 A;  2LNB A;  4HZF A;  4I2O A;  3GEU A;  3F9K A;  3I71 A;  2KRH A;  3CUQ B;  3TP3 A;  2GQQ A;  4UDS A;  3VOE A;  1XGO A;  1Y0U A;  3FK6 A;  3BJ6 A;  1FYK A;  3FKJ A;  1AHD P;  4U0V A;  2D1H A;  2FJI 1;  1NG6 A;  4FAS D;  2HEO A;  3AG4 H;  2ZXJ A;  1HKQ A;  3M8E A;  4BE1 A;  1YJ9 I;  1XMX A;  3PSI A;  1H8A C;  3E6D A;  4A3K J;  2R7R A;  5TRD A;  1QZY A;  3Q0V A;  2Z9O A;  2KL4 A;  3KIO A;  3GTJ J;  3I4P A;  3CDI A;  1TW2 A;  3ZQF A;  1ZRF A;  3L2Q A;  5K58 A;  3NEU A;  4PK4 A;  4E7Z A;  2EB7 A;  4MHG A;  3OYK A;  3WE3 A;  4KFC A;  2IAI A;  4ZYE A;  1O4X A;  1XN7 A;  2Q2E B;  4NHJ A;  5B1A H;  1FIP A;  4FE4 A;  2NP5 A;  4NEL A;  3LSM A;  1SD4 A;  4G6Q A;  3P9C A;  5D5U B;  2BHY A;  4NQW B;  2FF4 A;  2W85 A;  1EH6 A;  1LKX A;  1YOV B;  4RMN A;  2RAS A;  4Y33 A;  1AOY A;  4ENN A;  4HV6 A;  5DM7 F;  5IYB J;  3ZGK A;  4C2M A;  2XRO A;  4CCL A;  5AQC A;  3JCU C;  2MYS A;  4OWR B;  5J1U A;  4L9V A;  2FA5 A;  4MFE A;  2H09 A;  4Y3O A;  1WKM A;  3V7R A;  5DAJ A;  2O7O A;  4EV0 A;  5E8I A;  3A03 A;  2FRH A;  3HGG A;  4CCO A;  3RQ4 A;  4A69 C;  2O5R A;  3KLN A;  2RAE A;  3JRC A;  3KE2 A;  2GOM A;  3KCC A;  4RM3 A;  2BV6 A;  4MQV A;  1ZKG A;  2IS6 A;  3DCF A;  4IZZ A;  4I99 C;  2EJR A;  1IDY A;  2WAQ N;  5HDK A;  3PIP F;  2L7F P;  2WAQ A;  4NDL A;  2DOA A;  3K70 D;  1VQ7 I;  2OF7 A;  1QO0 D;  1Z05 A;  1MD0 A;  1TNS A;  1RC9 A;  4ASN A;  3KP2 A;  1SFO J;  4IHY A;  4DZJ A;  1IV8 A;  2ZNZ A;  3VP5 A;  1C0W A;  1RKT A;  4HA8 A;  4M72 A;  2FBK A;  3CCE I;  3ASO H;  4JK1 X;  3VOK A;  2AQE A;  2KJB A;  4UVA A;  3CJQ B;  4CZZ A;  1YJN I;  3S32 A;  3VOX A;  1ZEL A;  3PUB A;  4EM1 A;  3L1P A;  3E0J B;  4KYW A;  3ZP5 A;  3H3Z A;  3ZMV A;  2F5V A;  3VVY A;  1ON1 A;  3H3U A;  4LFU A;  2ZME C;  3IWF A;  1UMQ A;  2XB0 X;  3GFL A;  3ELK A;  3G3Z A;  2AHQ A;  5J1Y A;  1YI2 I;  2LY2 A;  3WTT C;  3RJP A;  2YVX A;  5FKK A;  2HOE A;  5HDN A;  3K69 A;  1AWC A;  1EH8 A;  4HAM A;  4OMZ A;  3MNL A;  1X1C A;  2ICW G;  2Y31 A;  2B7E A;  2V1D A;  2LKP A;  1I6H J;  5EEH A;  2DA2 A;  2B3W A;  3E6M A;  2DJI A;  4XRS A;  4XNF A;  3E7L A;  4CYD A;  4RLQ A;  1V3F A;  2K3P A;  2MBF A;  2Y0S N;  1ZG1 A;  2Z99 A;  5FLV A;  4M9S A;  4A3F J;  3VFZ A;  2QF7 A;  2YU3 A;  4E4H A;  3ABK H;  4EM2 A;  3RPQ A;  4ENJ A;  2BW3 B;  1D5V A;  3MEX A;  3F72 A;  3ZMU A;  2F48 A;  4JP0 A;  1R5G A;  2HZT A;  1IXR C;  1Y0N A;  3I58 A;  3KP5 A;  4I0A A;  4RGU A;  3CZ6 A;  2LRE A;  5L3D A;  2ZC2 A;  4BQN A;  2GOX B;  4KIT B;  1F9N A;  3LNQ A;  1FZP B;  3OYH A;  3GTM J;  3PNY A;  4LLL A;  3TOA A;  4IHW A;  1KQ9 A;  1POG A;  1ZGA A;  3H5R A;  4F7Z A;  1P2F A;  3RKY A;  2L9S A;  3WHC A;  5GPA A;  4ENM A;  2GEN A;  4LB5 A;  5DS9 A;  3NNR A;  4M3F A;  2QUF A;  3Q0U A;  4A3C J;  4JQF A;  1S7O A;  1U8R A;  3DQV C;  3TBI A;  3E5Q A;  1SFE A;  5AIP A;  4CYC A;  5M5W J;  4O3M A;  3M4O J;  1FOY A;  2R5Y B;  1OFC X;  4ZYH A;  1DU6 A;  1ZG3 A;  2KRC A;  2ZFU A;  1WWX A;  4U9N A;  3I54 A;  3GUD A;  2EK5 A;  2W84 A;  3V7S A;  1SFU A;  3Q5F A;  3OYM A;  5D6E A;  1FIA A;  1Z77 A;  3DXJ F;  1SVM A;  4P5O A;  1HKS A;  1LFB A;  3CLO A;  3KLO A;  4W1U A;  5K7Z A;  3HRT A;  2ZFW A;  3K1M A;  3C2H A;  4I76 A;  3V4G A;  1FEX A;  1T8I A;  4RGR A;  4B8X A;  2WA0 A;  2QYO A;  2L7K A;  1YE9 A;  3J7Y J;  4KMF A;  2OZ6 A;  2P0W A; 
#chains in the Genus database with same CATH homology
 3FIS A;  5JLX A;  1MNM C;  4HKU A;  2WGB A;  1I50 J;  3S16 J;  1ZTR A;  2DJN A;  3S2D J;  1JKP C;  3NAR A;  2AO9 A;  4DYR A;  3HB9 A;  3FKI J;  2NVT J;  2DG8 A;  2NX4 A;  2H1K A;  2REK A;  3PO2 J;  4JYK A;  3P9T A;  1A5J A;  4FIS A;  4GCT A;  3JRD A;  3VVZ A;  3VIB A;  1EF4 A;  3I4N J;  4A3B J;  3O60 A;  4JKZ A;  3D1N I;  1F36 A;  4M6V A;  4BKX A;  3VPR A;  4D5C A;  3BHQ A;  2NP3 A;  3HIM A;  1I3Q J;  3HOZ J;  3KNW A;  2DMU A;  2FQ4 A;  2CRG A;  3G7R A;  2XGD A;  2JA5 J;  3LJL A;  1TWG J;  4XRM A;  2GUH A;  2ZB9 A;  3JRI A;  2L9R A;  3CJD A;  2COB A;  2VI6 A;  5E3L A;  5K7H A;  3QPS A;  2R93 J;  5EFY A;  4BBR J;  4DYQ A;  1RR7 A;  3S2H J;  4BBS J;  2LD5 A;  3BTI A;  4A3I J;  2LTP A;  1CQT A;  2WUI A;  4GCL A;  2UXP A;  3CQZ J;  2M9H A;  4IHV A;  3BG3 A;  1NTC A;  5D1R A;  3HOY J;  1FTT A;  1Y1V J;  3K7A J;  4UUS B;  1B72 A;  1IRZ A;  1OCT C;  2VUM J;  1AU7 A;  1W0U A;  1RKW A;  2DA5 A;  1RPW A;  1IJW C;  1ITY A;  1MBK A;  2LY9 A;  3BR6 A;  4L5E A;  2EH3 A;  2E19 A;  3JRF A;  2DA3 A;  1R9T J;  2K9S A;  1U9O A;  3WHB A;  5EGO B;  1YRN B;  9ANT A;  1LFU P;  2NOG A;  2ZCX A;  4LOC A;  2EZK A;  3SDG A;  4ICH A;  5GP9 A;  2HI3 A;  3IH3 A;  1UG2 A;  3MVP A;  3LSP A;  3G1M A;  3OSG A;  2XDN A;  3ZQG A;  3BR1 A;  3LSG A;  2N8G A;  3ZQI A;  5EDN A;  3RZD J;  1XS9 A;  5C4X J;  2GFN A;  2HYT A;  1PUF B;  2DMN A;  3ZOB A;  2W53 A;  4AF5 A;  4Y7N J;  2ZCN A;  4M3B A;  3G1O A;  5EG0 B;  3HOU J;  3CWR A;  1AKH A;  4FE7 A;  2FJ1 A;  3BG9 A;  3HDD A;  2E2J J;  1JGG A;  3S5R A;  2VKV A;  4DZP A;  2MG4 A;  1GVD A;  5F0H A;  1ORK A;  1QVU A;  1B8I B;  3G56 A;  5F08 A;  2P81 A;  4GFL A;  1MBG A;  1MBH A;  5E3N A;  1VFC A;  2D5V A;  2HYJ A;  2H8R A;  2JA7 J;  2QIB A;  2OI8 A;  3HEF A;  3S17 J;  1WGX A;  2ZOZ A;  2UXO A;  4DYC A;  4MIM A;  2YVH A;  1IG7 A;  3CRJ A;  2O7T A;  4G12 A;  5D18 A;  4GCK A;  2G7S A;  1U9N A;  2CQQ A;  4XID A;  4S0H B;  1NK3 P;  4A3E J;  5IPA A;  2D6Y A;  5DTD A;  3B6C A;  4I6Z A;  1Q1V A;  2M8G X;  4PXI A;  5IP9 J;  2MW8 A;  3C2B A;  5EG0 A;  3OSF A;  5CXI A;  3I4M J;  2F07 A;  1F43 A;  2G7L A;  5E3M A;  1JTY A;  2G0E A;  1P7J A;  1TWC J;  3KKD A;  3HGY A;  3JR9 A;  1ETW A;  3A01 A;  3A02 A;  1IDZ A;  2RHA A;  3NXC A;  2DA4 A;  4RBO A;  3IH2 A;  2ECC A;  5IYD J;  3HOX J;  3HE0 A;  5HSZ A;  2HXO A;  4A3L J;  1T56 A;  5M5Y J;  4GFB A;  2XGE A;  1MBF A;  3DEW A;  4W97 A;  4A93 J;  2DTZ A;  1WH5 A;  5IOZ A;  1U78 A;  2UXI A;  5M3M J;  1S7E A;  2R7Z J;  5FLM J;  1WCM J;  4FCY A;  2ME6 A;  4AYB N;  1VI0 A;  1TWH J;  3LWJ A;  4Y52 J;  3B6A A;  3F0C A;  5GPC A;  1GT0 C;  3NRG A;  3IH4 A;  2NS7 A;  2FX0 A;  1ETO A;  2L7Z A;  4JX6 A;  5M3F J;  1LE8 B;  2R5Z B;  3S1Q J;  1HOM A;  1GUU A;  3QQA A;  3O8H A;  5F1J A;  2DA7 A;  1X2N A;  1X2M A;  2PBX A;  3GZI A;  3SJM A;  3F1B A;  3BQZ A;  2ECB A;  2XPW A;  3LHQ A;  2XRL A;  5F27 A;  1UI5 A;  2L7M P;  3HKZ N;  5EYR A;  3S14 J;  1BW6 A;  3FIW A;  4XK4 A;  2DG7 A;  4D5F A;  3TED A;  2GLO A;  2ELK A;  2YS9 A;  3JSJ A;  5D19 A;  3HOV J;  1QVT A;  2PZ9 A;  1XG1 A;  2JK3 A;  4JX5 A;  5M5X J;  2ID6 A;  1HCR A;  2VKE A;  5EZG A;  4KWA A;  2NVQ J;  4RDU A;  4XIC A;  4XRS G;  3VVX A;  4D7M A;  1DU0 A;  1Y1W J;  4A3G J;  3MN2 A;  3JRH A;  1ETK A;  4D7N A;  1D5Y A;  3FK7 A;  4A3D J;  2PMZ N;  3LSJ A;  1IGN A;  4MK6 A;  3JRB A;  4ACI A;  4M3E A;  2R5Z A;  2CUE A;  3BR2 A;  4NN1 A;  3LOC A;  4JL3 A;  2LP0 A;  2LK2 A;  5F0F A;  3KKC A;  2M2E A;  1MBE A;  2K9N A;  4FTH A;  3CMY A;  2JA6 J;  1GV5 A;  1WPK A;  3ANP A;  2HXI A;  4QIW N;  1JUM A;  2Y2Z A;  3QPL A;  3S1M J;  1W0T A;  3JRG A;  2QKO A;  2IBD A;  3ZQL A;  4BY1 J;  3BR0 A;  1JUS A;  2L0K A;  5FKO A;  3GTQ J;  3COL A;  2WV1 A;  3ZQC A;  4L62 A;  2CUF A;  5C44 J;  2EZL A;  2NS8 A;  3PM1 A;  1IC8 A;  1RET A;  5F04 A;  2YUS A;  4B4C A;  4UUT A;  3PO3 J;  1UHS A;  1FTZ A;  3S1N J;  2K9Q A;  1ZR2 A;  2EBI A;  5HOD A;  2UXH A;  2E2H J;  3QKX A;  3BQY A;  5CXG A;  4UUS A;  2VPR A;  2X48 A;  1TWA J;  2ZOY A;  3VW0 A;  5FKL A;  2YVE A;  3KZ9 A;  1P7I A;  4CYC B;  5FMP A;  4JX4 A;  3ON2 A;  3RQI A;  1K83 J;  1JKQ C;  1MSE C;  5FGL A;  3BR3 A;  3GTK J;  2Y30 A;  2FBQ A;  1YRN A;  3BR5 A;  2WB1 N;  5EGO A;  1HF0 A;  3S1R J;  1JJ8 C;  2EZH A;  1GV2 A;  4CGR A;  5FKM A;  1BJZ A;  1JT0 A;  4MXM A;  4B1R A;  1WI3 A;  2X6O A;  3HBL A;  2YU9 J;  2XB5 A;  1UI6 A;  3HTA A;  3GEU A;  5C4J J;  3NI7 A;  3TP3 A;  2JA8 J;  3FRQ A;  3O8G A;  5C3E J;  4UDS A;  1JTX A;  1ETQ A;  3FK6 A;  4B3A A;  4IEJ A;  1AHD P;  3UKG A;  5F0C A;  1PUF A;  3HM5 A;  5FKN A;  3RH2 A;  1H8A C;  2M0C A;  3RD3 A;  4DW6 A;  2O8K A;  4A3K J;  2E2I J;  4IHX A;  1A6I A;  2HOT A;  3Q0V A;  3GTJ J;  2DA1 A;  3ZQF A;  1B8I A;  3BNI A;  2JWT A;  5CW8 A;  2HOS A;  3MKL A;  5K58 A;  1HDD C;  2CQX A;  2QOP A;  2IAI A;  1ETX A;  1VF9 A;  1O4X A;  5HBU A;  4A3M J;  3Q3S A;  2G3B A;  3C07 A;  1G2H A;  2NVY J;  1FIP A;  2XPV A;  4FE4 A;  2NP5 A;  1HLV A;  4NEL A;  2KDZ A;  2ZCM A;  1QRY A;  1JKO C;  3AQS A;  1VND A;  4MO7 A;  2RAS A;  4HNV A;  2LKX A;  5IYB J;  3QBM A;  2HKU A;  4BXX J;  4C3J J;  5EZH A;  5AQC A;  3VW2 A;  1QPI A;  4C3H J;  3GTO J;  5J3L A;  1JKR C;  5J1U A;  5JLW A;  3VUQ A;  5IYC J;  1OJL A;  2TRT A;  5FJ8 J;  5FHP A;  4MFE A;  1IUF A;  2CJJ A;  5H9T A;  1E3O C;  5DAJ A;  3H0G J;  2O7O A;  1ETY A;  3A03 A;  3HGG A;  3JRE A;  2XPU A;  4A69 C;  1FJL A;  3LSR A;  5E3O A;  1B72 B;  3S15 J;  1BW5 A;  2RAE A;  3JRC A;  2EQR A;  3OOU A;  2JMW A;  1HDP A;  4QSH A;  1SGM A;  5EF6 A;  3IUV A;  2NVX J;  3AQT A;  1ZKG A;  3DCF A;  1IDY A;  2WAQ N;  4EEF G;  1WH7 A;  2L7F P;  4NDL A;  1TC3 C;  2OF7 A;  1BA5 A;  4M3D A;  1SFO J;  1MSF C;  4IHY A;  2LR8 A;  4DZJ A;  5C4Y A;  1H89 C;  3BTC A;  1H88 C;  2I10 A;  3HTH A;  1LE8 A;  5IP7 J;  5EEA A;  3VP5 A;  1RKT A;  3BT9 A;  1RES A;  3VOK A;  3BG5 A;  3ZQH A;  1ENH A;  4A3J J;  3M3Y J;  3VOX A;  4AC6 A;  4X6A J;  3W6V A;  1T33 A;  3L1P A;  3ON4 A;  2QCO A;  4YZE A;  1XC5 A;  3E7Q A;  2FD5 A;  3VVY A;  1AKH B;  5IOY A;  1UMQ A;  2M34 A;  2XB0 X;  2AHQ A;  5J1Y A;  4C3I J;  2Q24 A;  2ID3 A;  3BJB A;  4X1E A;  5FKK A;  1MBJ A;  2QWT A;  1U8B A;  3H3V K;  3GBG A;  2MSY A;  3MNL A;  2Y31 A;  3RZO J;  3SFI A;  3BCG A;  3EGQ A;  3VW1 A;  1I6H J;  1X58 A;  3K2A A;  2DA2 A;  2QTQ A;  2X9D A;  4XRS A;  2LLK A;  2LVS A;  3E7L A;  1ZGW A;  3ANG A;  4ABZ A;  5FLV A;  2TCT A;  2Y0S N;  3B81 A;  4MLO A;  4A3F J;  2DN0 A;  2QF7 A;  1SAN A;  4AC0 A;  2GM4 A;  4AUX A;  5BNG A;  1MH4 A;  1OCP A;  3OIO A;  2KT0 A;  1ZQ3 P;  2DA6 A;  2DMQ A;  2K40 A;  2HOA A;  3HOW J;  2IU5 A;  3BTJ A;  1JJ6 C;  4JP0 A;  2HQ5 A;  2CU7 A;  2JJ7 A;  2R5Y B;  5K7F A;  1APL C;  1Z0X A;  4MFD A;  1GDT A;  3LNQ A;  1MH3 A;  3GTL J;  3GTM J;  2GBY A;  1JT6 A;  4M3G A;  4V2F A;  4IHW A;  2UXU A;  3A01 B;  2XSD C;  4ME9 A;  3G1L A;  3NPI A;  1POG A;  2E1O A;  3DPJ A;  3WHC A;  2DMT A;  5GPA A;  2W48 A;  3CCY A;  4C2M J;  2Y9Z A;  5DS9 A;  2GEN A;  3NNR A;  3PPB A;  3CDL A;  3PAS A;  4M3F A;  1JUP A;  2JN6 A;  3Q0U A;  1ETV A;  1ZR4 A;  3Q0W A;  3TW6 A;  4A3C J;  4JNN A;  1BL0 A;  2DMP A;  2MGQ A;  3T6N A;  3V6G A;  5J1R A;  2OER A;  2LFB A;  3M4O J;  4CYC A;  3HTJ A;  5M5W J;  5HAW A;  3NAU A;  1OFC X;  5IP6 A;  1DU6 A;  1ZK8 A;  2Y9Y A;  2XGC A;  3BTL A;  1IV6 A;  2R0Q C;  2R5Y A;  2R92 J;  3GTP J;  4GFK A;  1FIA A;  3RKQ A;  1Z77 A;  2O9L A;  3GTG J;  2IEK A;  2OPT A;  3TP0 A;  1LFB A;  3HTI A;  4W1U A;  2ME0 A;  3EUP A;  3JRA A;  5K7Z A;  2HDD A;  3IV5 A;  4V2G A;  2B63 J;  4I76 A;  4BY7 J;  1FEX A;  1TWF J;  4J19 A;  2EZI A;  3BRU A;  4QTR A;  1NK2 P;  3V78 A;  3TW7 A;  1K61 A;  2V57 A;  2G7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...