3BTLA

Crystal structure of qacr(e58q) bound to malachite green
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 73
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btlA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btlA02
3A03A 4CYCA 3BR3A 2Y9YA 1JT0A 3BR6A 5FJ8J 4GCTA 3NRGA 1QVTA 5FLMJ 2ECBA 2ME0A 3UKGA 2LFBA 4ABZA 2GENA 4JL3A 4FE7A 5FLVA 4GFBA 2G7SA 3KKCA 2DA6A 1TC3C 1WH7A 5M5YJ 2ECCA 2GM4A 2OERA 2ZOZA 3NNRA 4X1EA 2R5YA 2QIBA 4IHYA 1FIPA 3MN2A 4M3EA 2Q24A 1PUFB 1U8BA 3ON4A 4C3IJ 3BQYA 3A01B 2CQXA 2Y31A 4QTRA 1BW5A 3O8GA 3TP3A 2JN6A 3BTCA 2WGBA 1U9OA 2GUHA 3QQAA 2NVXJ 2DMUA 2L9RA 1ZR4A 5AQCA 3GTLJ 2ZB9A 3HIMA 1NK2P 4BY7J 3LNQA 1IJWC 1K61A 3LSJA 2B63J 3P9TA 4HKUA 3C2BA 2DG8A 4YZEA 3VOKA 4PXIA 2NX4A 2WAQN 3E7LA 1I50J 5IOZA 2DA4A 5EFYA 3HOVJ 3S1MJ 4A3GJ 3HEFA 1JKOC 1JKQC 2QTQA 5EF6A 3H0GJ 2CRGA 1HOMA 1VNDA 3HOXJ 2JMWA 3EGQA 1X2NA 1ZR2A 2D5VA 1RESA 3GTPJ 2M9HA 3L1PA 1IUFA 3ANGA 1FIAA 1JUPA 3B6AA 2ME6A 3VOXA 3VVXA 5GPCA 4J19A 4BXXJ 4D5FA 2UXPA 4V2FA 1PUFA 2ELKA 3BJBA 4BBRJ 4AC0A 1BL0A 3O60A 3IH2A 2JA5J 1JKPC 3BTJA 2DA5A 3M3YJ 1VI0A 2I10A 3JRHA 2O7TA 4B4CA 3JRGA 3RZDJ 1T56A 3HOZJ 1ITYA 3BG3A 1WGXA 2YS9A 3HOWJ 2OI8A 1GUUA 2D6YA 1WCMJ 1ENHA 4M3FA 3PO2J 1WI3A 4KWAA 3JRIA 4Y7NJ 5HODA 3HDDA 5F0HA 1Y1VJ 4DYRA 3BTLA 3DEWA 1WH5A 4A3FJ 3GTOJ 4B3AA 2V57A 1UI5A 1JKRC 4A3DJ 3OOUA 5CXIA 3ZQCA 3IUVA 2QKOA 1Q1VA 3G7RA 3H3VK 2IU5A 1DU0A 1MBFA 4GCLA 4MXMA 2UXHA 2P81A 2N8GA 1MBGA 1CQTA 2XSDC 2Y30A 1BW6A 4QSHA 5EDNA 2DG7A 4M6VA 4M3GA 1BJZA 1FTZA 3WHBA 1EF4A 1K83J 5EZHA 5J1UA 3I4NJ 2M34A 2R7ZJ 1ETWA 5D18A 5EGOB 1U78A 5F27A 4A3BJ 4ACIA 3IH4A 1E3OC 3LWJA 4IEJA 3GTGJ 1TWHJ 3KZ9A 2FD5A 3HOUJ 3MNLA 3QBMA 3A02A 3HTJA 4A3MJ 2JA6J 4M3DA 3DCFA 3HOYJ 4NELA 1GV2A 3HGYA 2TCTA 5GPAA 1JUMA 2ZOYA 3V6GA 2IEKA 3C07A 2ZCMA 5IPAA 4Y52J 2HXIA 2ZCXA 2HXOA 1X2MA 2EBIA 1B8IA 3VIBA 3BG5A 5C4XJ 2PZ9A 3G1LA 2F07A 5HAWA 1RKWA 3FKIJ 1OJLA 2VUMJ 5EGOA 2K9QA 2OF7A 1XS9A 2XRLA 4B1RA 3JRCA 1UI6A 3QPLA 2NOGA 3IV5A 4BY1J 3GTKJ 2LP0A 2LLKA 3HBLA 3GTQJ 3BTIA 2HI3A 2HDDA 1JT6A 2MW8A 4HNVA 1UMQA 5EZGA 4MO7A 4XICA 1IGNA 2XGDA 3HTIA 2AHQA 4DW6A 4RDUA 3JSJA 2Y0SN 2XB5A 3CMYA 3PPBA 4QIWN 1IDYA 2L7FP 5K58A 1S7EA 1HCRA 4X6AJ 4UUTA 5M3MJ 2K9SA 1JUSA 5IOYA 2CUEA 4DZPA 2O7OA 3VUQA 2QCOA 4EEFG 3Q0WA 1ZK8A 4C3JJ 5IP9J 3JR9A 3VP5A 4MFEA 1IG7A 3HTAA 2R5ZB 3PO3J 3D1NI 4A3KJ 1WPKA 2W53A 2EH3A 5E3NA 1RR7A 2JA7J 1F36A 1D5YA 2PMZN 3ANPA 2NVYJ 1NTCA 1FJLA 2YU9J 5H9TA 1AKHB 1HF0A 4GFLA 1IC8A 3LSGA 2DA1A 2XB0X 3FK6A 1JTYA 3PM1A 5E3MA 1SGMA 5D19A 2GLOA 1TWFJ 3CQZJ 2E1OA 2MGQA 4XRSG 3HM5A 2UXUA 1ETYA 2UXOA 3RH2A 1UG2A 2VI6A 4JYKA 3NXCA 3MVPA 2XGEA 3VW1A 3OSGA 3GTJJ 3JRBA 3S5RA 4D5CA 2R5ZA 3ZQFA 5J1YA 2LY9A 2G0EA 2RAEA 4A3IJ 3BRUA 1MH3A 3BG9A 1QRYA 1ZTRA 2NP5A 1LFBA 4D7MA 4ICHA 1AKHA 2E19A 3VVZA 2LR8A 3ZOBA 2EZLA 5GP9A 2M8GX 1P7JA 3B81A 4A3LJ 1ETQA 3QKXA 3JRFA 1MBEA 3QPSA 5DAJA 3NAUA 4AUXA 5M5XJ 5EG0B 1VF9A 5C44J 4CGRA 4BKXA 3KKDA 1UHSA 2G7GA 5IYCJ 1Z77A 3OIOA 4W97A 2LKXA 1AU7A 2QF7A 3FRQA 1JJ6C 1LE8B 1GV5A 5K7ZA 4FCYA 1B8IB 2WUIA 3Q0UA 1G2HA 3Q0VA 2NP3A 2NVQJ 5J3LA 4UUSA 2L7ZA 3FISA 4IHWA 1HDPA 1U9NA 5D1RA 3BR2A 3F0CA 3Q3SA 4MLOA 3TP0A 1JJ8C 4I76A 2DA3A 2AO9A 1B72B 1YRNB 2DN0A 2XPWA 3S1QJ 2NS8A 5E3OA 1H89C 5CXGA 3G1MA 3S17J 1JGGA 1APLC 1F43A 2CUFA 3M4OJ 2RASA 1NK3P 2UXIA 4ME9A 1MBHA 2XPVA 3CCYA 2KDZA 2O8KA 5J1RA 2WB1N 5EG0A 5EYRA 2XPUA 2HOAA 3RD3A 2X6OA 4JKZA 2DMNA 1LE8A 3GTMJ 2LK2A 1BA5A 3B6CA 2VKEA 2NS7A 5IP6A 2DTZA 1R9TJ 2VPRA 3KNWA 2LTPA 5HSZA 4DYCA 2CU7A 5F0FA 2L7MP 3ZQGA 4L62A 5FMPA 4JNNA 4A3JJ 3GBGA 3BQZA 2O9LA 2HOSA 4DZJA 3VW2A 1ZGWA 9ANTA 2FQ4A 3SFIA 4BBSJ 3RZOJ 1B72A 1YRNA 3BHQA 3JRAA 3NPIA 2IAIA 5F08A 1I3QJ 5JLWA 1RETA 3GEUA 3T6NA 4NDLA 1MBKA 4RBOA 1XG1A 2Y9ZA 3S1RJ 5IP7J 5F1JA 2FJ1A 2DMTA 3LJLA 5FKNA 2KT0A 2GBYA 4I6ZA 1W0TA 4JX6A 2HOTA 3NI7A 1H88C 5IYDJ 2GFNA 4FTHA 2W48A 3G56A 1DU6A 3COLA 2YVHA 5IYBJ 1H8AC 3FIWA 1FEXA 3BT9A 2CQQA 2JWTA 3EUPA 3TW6A 5FKMA 3V78A 2EZIA 3IH3A 1TWCJ 4XRSA 2EZKA 1IV6A 3AQTA 4IHVA 2CJJA 5K7FA 1POGA 3BR0A 3VW0A 3LSPA 1O4XA 1VFCA 2LVSA 3HE0A 1RKTA 2L0KA 2WV1A 2M2EA 2FX0A 3GZIA 4GFKA 4GCKA 4FISA 2XGCA 4A3EJ 4DYQA 2K9NA 3S1NJ 1P7IA 4JX5A 1XC5A 3DPJA 3VVYA 5FKKA 5FKLA 4XIDA 1ETKA 4V2GA 2ID3A 1TWAJ 3TEDA 4JP0A 5FGLA 1GVDA 1T33A 1FTTA 1IRZA 5JLXA 4MK6A 4NN1A 3LSRA 4AYBN 2R93J 3NARA 2ZCNA 1OCPA 3K2AA 5HBUA 3BNIA 2IBDA 3HB9A 4UUSB 3OSFA 3CWRA 5EEAA 2DMPA 4L5EA 4MIMA 2G3BA 3BCGA 3HTHA 1ETOA 2HQ5A 3PASA 1GT0C 4A69C 5F0CA 1JTXA 1SANA 2DA7A 3WHCA 2R0QC 2QWTA 3BR1A 3SJMA 3A01A 2LD5A 2Y2ZA 2FBQA 2PBXA 1HLVA 2E2IJ 2EQRA 5C4JJ 5C3EJ 3W6VA 3G1OA 1QPIA 3S14J 3SDGA 2M0CA 1ETVA 1QVUA 4MFDA 3TW7A 1W0UA 2H8RA 4FE4A 1IDZA 5DTDA 2TRTA 2HYTA 4C3HJ 1ORKA 1ZQ3P 3ZQIA 3JREA 2MG4A 3RKQA 3K7AJ 2R92J 3CJDA 2XDNA 2HKUA 3CDLA 5CW8A 3LHQA 4A93J 4IHXA 1Y1WJ 5C4YA 3LOCA 4XRMA 3S16J 1OFCX 3ZQLA 4M3BA 4LOCA 4C2MJ 5K7HA 2H1KA 4XK4A 2X9DA 3FK7A 1Z0XA 2JJ7A 2RHAA 2MSYA 5FHPA 2COBA 2DJNA 2OPTA 3JRDA 2E2HJ 2REKA 1MSFC 2VKVA 1AHDP 2YVEA 1SFOJ 1ETXA 3HGGA 3BR5A 2YUSA 3S15J 3VPRA 3S2DJ 3E7QA 4CYCB 2HYJA 2JA8J 1A6IA 4A3CJ 5DS9A 1LFUP 3RQIA 5FKOA 1ZKGA 5M5WJ 3O8HA 2X48A 3S2HJ 5BNGA 4AF5A 1MBJA 3ON2A 4UDSA 2DMQA 1X58A 1MNMC 2ID6A 3MKLA 3I4MJ 1MH4A 2G7LA 4W1UA 2R5YB 4S0HB 2DA2A 4G12A 3HKZN 1A5JA 1OCTC 4JX4A 2K40A 1MSEC 2NVTJ 3CRJA 2E2JJ 1HDDC 1GDTA 5E3LA 1I6HJ 1RPWA 4AC6A 3ZQHA 5F04A 1TWGJ 5M3FJ 2EZHA 2JK3A 4D7NA 3F1BA 3AQSA 2QOPA
chains in the Genus database with same CATH superfamily
1WWXA 2P6SA 2XHKA 3CJQB 4RGXA 1FP2A 1BI0A 4L9TA 3BR6A 1W1WE 3WU0A 1QVTA 3K4NA 2NAZA 2E36A 2ECBA 3UKGA 1LQ1A 2LFBA 1W7PB 2OC6A 4U7DA 1J75A 4GFBA 5FLVA 3KKCA 2DA6A 1RIOH 3GF2A 5DCFA 3QU6A 3MN2A 5GTHC 1TQIA 3HXLA 3BQYA 3A01B 2CQXA 2MLGA 1UHMA 3QODA 3TP3A 1U9OA 2XAHA 2Z9OA 2GZWA 2L9RA 2FXAA 2GOXB 3C2HA 1LNWA 4HKUA 4Q5SF 3LSJA 4YZEA 5LFAA 3C2BA 2DG8A 1BIBA 1IW7F 4M73A 1TQMA 5CVVA 2WY8Q 1P4AA 1RNLA 2DA4A 3KP5A 3CCVI 3SFZA 4DOZA 1W7PA 1WSUA 5L3CA 3HOXJ 4FX4A 1VQPI 5FLXK 1X2NA 1ZR2A 4EJTA 2R7SA 3MKYB 4D0PA 2M9HA 1IUFA 1JUPA 4HDUA 4OAYA 3BY6A 3VFZA 3DLAA 3OIPA 4I0AA 1RC9A 4D5FA 4V2FA 3SYTA 5BMZA 3BJBA 2Z33A 2KFDA 5DCMB 1X19A 1FC3A 2EFOA 3QPHA 3TDUC 4A0ZA 4AC0A 5FB2A 4WCGA 1LKXA 2E7XA 2VKDA 4NC6A 1FYMA 3RZDJ 1ITYA 1T56A 3RKWA 3KIOA 5HS8A 1GUUA 3PQKA 4CDGA 4ZTFA 3HTSB 1ENHA 4M3FA 4IJAA 5E8IA 3KCCA 3FXQA 3JRIA 1UCRA 2HNHA 1WI9A 1Y1VJ 3BTLA 1WH5A 4B3AA 4HQMA 2HEOA 4A3DJ 1T8IA 5CXIA 2VIXA 4XONA 3ZQCA 4HV6A 3IUVA 1DU0A 2KMUA 1MBFA 3ZR8X 3TGNA 1XPXA 2BOLA 2K85A 1GVJA 5AIPA 5DCMA 2N8GA 1KU2A 1LDDA 1STZA 4HW0A 1FOKA 1T08B 2YPRA 2M7AA 1SD6A 4M3GA 5K5OA 1SVLA 1EF4A 2BEOA 3BCBA 2M34A 3KFWX 5EGOB 4HZFA 3PFYA 2QM3A 3V4GA 4A3BJ 3IH4A 1OMIA 4PZJA 3WE2A 1TWHJ 3SEZA 2X0LA 2CS3A 1USSA 5HDNA 3MNLA 2V1UA 3QBMA 2KPMA 4ENNA 2L02A 2UUZA 3HTJA 1I27A 3ROUA 3F21A 2K9LA 1XGMA 3HOYJ 4NELA 1GV2A 5GPAA 1R4NB 2TCTA 3M1CA 5EEHA 2R4GA 2ZOYA 4UVBA 2O03A 2IEKA 1R00A 4HF1A 1QA6A 4B47A 2BY1A 2HXOA 1DGWY 3K4LA 5LBQA 4WX9A 2IRFG 3HSFA 3DKYA 5C4XJ 1X1AA 2LYCA 1HBXG 5HAWA 3U9GA 3PSIA 5EGOA 4LIVA 1ZGJA 1YHQI 1WJDA 3OR2C 4CXFA 2X1CA 4ZDLA 4DQ2A 3CCJI 4EMSA 2M0MA 3GTKJ 3TMOA 4B3XA 2LLKA 4B43A 3CJRB 3BTIA 3LAPA 1YI2I 3DPLC 5D6EA 2DQRA 2HDDA 1JT6A 5JI6A 2FMYA 4HNVA 4MO7A 1I1SA 4Y15A 2AHQA 3HTIA 5HLGA 1E0EA 5FROA 1XDUA 5K1YA 5ILSA 1MKMA 2FOKA 3QP5A 2ZFWA 3SWHA 4BNCA 1SAXA 5K58A 5FD5A 3OWTA 5M3MJ 5L3EA 2LNBA 4EM1A 2CUEA 4DZPA 2O7OA 2V9VA 2B7EA 2DI3A 2QCOA 2A05A 5A2QZ 1ZK8A 3RIRA 5LLQA 1DP7P 1IG7A 3ASNH 4KA4A 3O6BB 4P9FA 5HS9A 3D1NI 1O7LA 2W53A 2CUZA 1D5YA 1W5CC 2Q0OA 3PFIA 3U21A 4E6KG 3L2WA 4FQGA 3ANPA 3HKZA 4EJOA 1K4TA 3K1NA 1HF0A 2RQPA 1RI7A 4G7OF 2D1HA 1Q1HA 4GFLA 1IC8A 2XB0X 5E3MA 1JTYA 2NNYA 2CO5A 2FA5A 3N97A 1SGMA 3CQZJ 2E1OA 2KJCA 3OL3A 4PJLA 2VXZA 3WTSC 4V19K 2RQQA 2DOFA 3FXLA 1TW2A 4ZJZA 2BHYA 1UB9A 1UG2A 1XGNA 5JHFA 2DK8A 2XGEA 3MVPA 3WTZA 3JRBA 3S5RA 4D5CA 4BH9A 3LSKA 3NQOA 3LSHA 2G0EA 1W4MA 2KIQA 5CKTA 4A3IJ 1VQ5I 1D8JA 3BG9A 4UVCA 3VODA 2GIZA 2A6EF 4CCNA 1R5ID 1LFBA 2R7DA 2EV5A 2K3FA 3GYHX 4I09A 3HZJA 2R7XA 1IXCA 1V54H 2YVXA 2J5OA 4YIFA 5L3FA 3B81A 4CICA 3HTUA 3ZRGA 3QYFA 4AUXA 1CGPA 3GXOA 1VF9A 5C44J 4BKXA 1TT5B 1UHSA 1QGPA 5IYCJ 1Z77A 3OIOA 2A69F 3J81K 2G7GA 1SAUA 2BV6A 2JPCA 2M5WA 5GTIC 1LE8B 3I58A 4P1WA 2WUIA 3I9V2 1G2HA 2NP3A 1Z3YA 1JGSA 1YG2A 2ZXJA 5J3LA 2OUMA 2L7ZA 3H9QA 1R1TA 5E1XA 3LSTA 1U9NA 5JHUA 4U7BA 3BG7A 4WK8F 3F0CA 1GXQA 5FRMA 4OIPF 4I76A 3E6MA 3ZQQA 3S1QJ 2DN0A 3TO7A 1BR2A 1G8XA 1H89C 2MABA 5IT9K 1F43A 2CUFA 4LB6B 5GADJ 1NK3P 1U5TC 5B5EC 3LSMA 1OLTA 3CP2A 3SQNA 3OYFA 3CCYA 3CCEI 1KQ8A 2O8KA 2IGOA 4IPAA 1SEUA 3BZ6A 4G7ZF 3BP8A 1T6SA 1ZHFA 2IGMA 5D5UB 4KDPA 4RB1A 4YFNF 2DMNA 3KPHA 1LE8A 2LK2A 1V5EA 2A5YB 3B6CA 2RGVA 2NS7A 2VKEA 3PL8A 2NVUB 4XLFA 1XMKA 4XOPA 2PMUA 2VBWA 1XD7A 2CU7A 4HNUA 1B4AA 4JNNA 3VW2A 4NBQA 5BOXA 2Z16A 2KRHA 2ZNYA 1MMGA 1BOBA 4IL6C 1ZH5A 3CCRI 4LLLA 2JUGA 3JRAA 3EUAA 4AIKA 2ZY9A 2MH2A 2BYVE 4GYGA 2P5KA 5J4YA 4IQJA 1UHWA 2FJ1A 3F23A 2L01A 5ED4A 3H0DA 1W0TA 2HTJA 2K3PA 3G56A 2YX7A 4ZYEA 3GWZA 4II3A 2VJ4A 1DUXC 2EFWA 3COLA 2YVHA 1F5TA 5IYBJ 1EH6A 4KJZA 4L9NA 2JWTA 1IN7A 4I99C 2B9SA 4HRIA 1TWCJ 4XRSA 3GLXA 5LGNA 3CUOA 5K7FA 5LHGA 1REPC 3LFUA 1LVKA 3VW0A 4Z6YA 3LL7A 2E1MB 5FFXA 2EFQA 1Y39A 4BJ6C 3HE0A 4HNTA 2L0KA 4R79A 2DJIA 1G4DA 2FX0A 1TLHB 4XSZF 5CVJA 4WWCA 4GCKA 1OYYA 4A3EJ 2F6CA 2VOPA 1LEBA 5HS7A 1BC8C 1X3ZB 4KMUX 2JRTA 4U9NA 1ETKA 2HYGD 3G71I 4LJZF 2MLKA 1P4WA 2ID3A 3W3CA 1XGOA 3CTAA 5LRSA 3RI4A 4GXOA 1T33A 1FTTA 1PVEA 1FT9A 4KT5C 3H92A 1MGTA 3IRQA 2OU2A 2VC0A 5HVQC 3EPZA 1IV8A 2MD5A 2FU4A 3BNIA 3HB9A 4KITB 2ELJA 1WJEA 5EEAA 2DMPA 1Z7LA 3Q9VA 4L5EA 5TISC 3M9AA 1X1DA 4UB6C 3PASA 1GT0C 1Z05A 4P55A 3HL2A 4P5OA 1SANA 2XC7A 1VTNC 2R0QC 2LD5A 2Y2ZA 2PBXA 2BY2A 4DVYP 4BACA 2OZUA 2ZXHA 3T8RA 2EQRA 2TDXA 4C2MA 3JTHA 3PSFA 3W6KB 3W6VA 4D1QA 3S14J 2IS1A 4HAMA 1ETVA 1QVUA 2H8RA 1W0UA 4FE4A 2OV7A 2DFIA 5CLSA 1ORKA 4MQ9F 2LREA 3CJDA 4BE0A 2XDNA 3PUFA 3JAMZ 4I2OA 4XMYA 2KRFA 4LGWA 3ULQB 5LEKA 3OYBA 1WJFA 1M1EB 3KEQA 3EUHC 2W25A 3HOSA 1TL8A 3LOCA 2XVCA 3K4CA 1OFCX 1P6RA 4LOCA 4M3BA 1B1BA 4BEHB 4BQNA 2H1KA 1D8KA 5HLIA 1Z0XA 3FXUA 2RHAA 3HG9A 2IS4A 3L9FA 2OPTA 4M72A 5E1WA 3J80Z 1MSFC 3FBIB 1OPCA 3S3MA 1AHDP 2YVEA 4OD4A 2PX9A 1VQNI 4BQQA 3S2DJ 3E7QA 4A12A 4CYCB 1WFXA 5CPRB 3RQIA 2HPIA 4M6YA 5B3SH 2X48A 1W36C 4BEHA 3NRVA 3ON2A 2VODA 1XSXA 4M9XA 1MNMC 2ID6A 2QKLB 3MKLA 3EDPA 1IO2A 4W1UA 2R5YB 5FRNA 4BHCA 1ZLKA 2DA2A 2NRAC 3HKZN 4ETSA 2BY0A 3HSRA 3VDXA 3EUKL 4E7IA 4F55A 3MKZA 4KMFA 1RPWA 4M9ZA 1FOWA 2HQAA 3ZQHA 1UJ8A 4R1HA 5M3FJ 2NYXA 4RM2A 2LF7A 1LDKB 4GDFA 3AQSA 3PQJA 3G3ZA 2QOPA 3IAM2 3GEUA 2VJJA 4BGDA 1OCCH 2OQGA 3W6JB 4RB0A 4CYCA 2PFVA 1J7KA 1RUNA 1JT0A 5J4VA 3NRGA 3WG9A 1MNDA 2HYFA 3ZMSA 1HC8A 3ZXSA 1R71A 3UR3C 4LLGF 2ZMEC 2WB1A 3BPXA 4F52A 2G7SA 4CA0A 1TC3C 5M5YJ 1O3RA 4BU2A 3NNRA 1ZRDA 3REOA 3E1SA 4ESFA 2R5YA 3MZHA 4IHYA 3ESWB 1KU9A 2LC2A 3S2WA 3GVAA 2Q24A 2IA1A 1PUFB 2K86A 3D5SC 1J9IA 1NG7A 4C3IJ 2CW7A 2RDPA 4YEJA 4QTRA 2MYSA 1LDJA 3O8GA 2HVRA 2WGBA 3OS0A 1QZYA 3AG3H 2K02A 5J8CA 3COAC 5AQCA 2NS0A 1QHHD 2V9KA 3MEXA 2ZB9A 3HIMA 1DGRM 4XN3A 1G3TA 2A6TA 4XKVA 2B63J 3BJOA 2VOOA 5ILVA 3P9TA 4PXIA 2E60A 3HRSA 4AVZA 2GA1A 5IOZA 5EFYA 1VZ0A 5EF6A 2CRGA 3OY9A 4MEXF 1VNDA 3S8PA 1I3AA 4CCKA 1RESA 3M07A 3QYEA 4KNYA 3GFLA 2GOMA 4PSXA 2ME6A 3ECHA 5CQGA 1GXPA 4BXXJ 1N78A 3P5JA 4CUGA 2HS5A 4KICA 3BLYA 2ELKA 1PUFA 2E7WA 1ZRFA 3F8BA 2EV6A 4PGGA 4BBRJ 4MNUA 3IH2A 1BBYA 2H6CA 1JKPC 4KISA 3BTJA 4L5JA 2MD0A 2Z3YA 3V8KA 4Y4RA 1VQKI 4B4CA 3RPUD 3HC7A 5E20A 3HOWJ 2OI8A 2D6YA 1WCMJ 2WTEA 3FHZA 3PO2J 1WI3A 4Y7NJ 4ENKA 4ZTJA 1E2XA 3OS1A 3HDDA 2M3AA 4UUVA 4DYRA 4A3FJ 2RREA 3HHHA 3G7RA 3CO7C 5AIQA 1DDNA 4G94A 5DDGA 2XAGA 1O7FA 4AYBA 2UXHA 4MXMA 2XSDC 1HKTA 4AIHA 1S29A 4E4HA 1BW6A 5EJCA 5D8LB 5EDNA 4NC7A 4M6VA 2DG7A 2X85A 3A1YA 4XOTA 5J1UA 4QLCU 2XAQA 4M74A 3CESA 3LWJA 3GTGJ 2OZ6A 3DTEA 2O5RA 2CV0A 1XN7A 3CMEI 1R6RA 2B0LA 3FX3A 4A3MJ 3I53A 4KT6A 2KHMA 1KU3A 4XLAA 1PYVA 3V6GA 4ZZDA 3OYHA 4DGWB 1T0FA 1PP8F 5LGTA 2VBYA 3J7AO 1D1CA 1DQUA 3SZGA 4HX4A 3OYMA 3BDDA 2DYSH 3OYGA 2BBYA 1IF1A 2EBIA 3VYTB 3FF5A 4XORA 3WTTC 2VKHA 2PZ9A 2KIFA 3L09A 3R60A 4HA8A 3B73A 4ZYDA 4Y3OA 2K9QA 4BQAA 2M45A 2HTSA 2IS6A 3J7YJ 1SD7A 1UI6A 2Q1ZB 4G6TB 2ELHA 4BY1J 1F1ZA 3TOAA 2DT5A 4XR6A 3NS4A 1X3UA 3HBLA 3QRFF 4ESBA 5TJJA 1SVMA 3CUQB 5EZGA 5KNLA 1IGNA 3K69A 2VC1A 2YR2A 3SEQA 2KL4A 2WBMA 4RDUA 4I0BA 3DKXA 2OCCH 1VQOI 3CMYA 1V5FA 1KA8A 3PPBA 1IDYA 3DPUA 1HCRA 3LQRA 4X6AJ 3ZP5A 1JUSA 2LH9A 3K4MA 5IOYA 1FYLA 3A0BC 5KCMA 2DO7A 4XLCA 1R4MB 2BVLA 3Q0WA 4Q4ZF 3QAHA 2KDOA 4MFEA 2RV8A 3CJTB 3HTAA 4PDKA 4N9HA 4A2UA 4U0WA 1WPKA 3CUQA 2W1OA 3KETA 2YSRA 5CVUA 2DDAA 2NVYJ 4ITVA 1FJLA 2VE8A 2MH9A 3HSEA 5ERIA 2YU9J 3HYIA 2DCEA 1H9TA 4HYEA 3FK6A 3F6OA 3F3XA 3PM1A 2GLOA 4FETA 2MGQA 1YX5A 2KZGA 1IN5A 3NWSA 1Z1DA 2VLAA 1HXDA 2UXXA 4JYKA 5D5XB 3I55I 3F22A 2H27A 4XBFA 4QPOA 3VW1A 3RKYA 1UG0A 3LFKA 2QEXI 2XF6A 2LY9A 4FT8A 1FBSA 1MH3A 5GAHJ 3G6EI 2IP2A 4D7MA 2HDCA 3KE2A 1Y8RB 4PJ0C 1MNEA 2E19A 1VQ8I 3VVZA 1Z3XA 2EZLA 3AL0B 1ZG3A 1K79A 3R6SA 2M8GX 1P7JA 2A3SA 2VE9A 1J59A 4GCVA 3JCUC 1MBEA 2O3FA 3QPSA 3NAUA 3ABUA 5DAJA 2P7CB 4NC8A 1EA3A 3FRQA 2QF7A 2WAQA 1JJ6C 1GV5A 3G4SI 2L9VA 4HG2A 3ONQA 5HDGA 4UUSA 1AWCA 4RA2A 2VPLA 5DV5A 3X2QH 4IHWA 2OCEA 2OD5A 4LK0F 1NG6A 2GWRA 1S7AA 3BR2A 4HOBA 2K27A 4MLOA 2WA0A 3TP0A 1JJ8C 4G6QA 2ZXIA 4RGUA 2STTA 2AO9A 3FDYA 5DD8A 1B72B 2XPWA 5FGMA 5KK1A 5A2QK 2KIMA 2NS8A 5E3OA 2DLLA 4GRIA 5CXGA 1XGSA 2PN6A 3OYIA 2RVCA 2UXIA 4ME9A 4I02A 1MBHA 2P8TA 1FOYA 1YOVB 2BXZA 4UV8A 1IAWA 2WB1N 2W85A 5EYRA 4YFKF 5B1AH 2I5UA 1UZCA 4DBRA 3F72A 4Y33A 4HDVA 1R9TJ 3DV8A 1YW7A 4WXDA 1YLFA 4A5NA 5HSZA 4IRHA 4DYCA 4AVPA 5IT3A 2VASA 4PGHA 4XLPF 3VYRB 3E6BA 1ZGWA 9ANTA 1YX3A 1B72A 1W5SA 1YYVA 5F08A 1I3QJ 2FNPA 1OCOH 1RETA 2M30A 5E8GA 3W2AA 2P7VB 3J7AY 4U9LA 4NDLA 1MBKA 4N4NB 2Y9ZA 1VQMI 1N75A 3S1RJ 2WADA 3LJLA 3CCLI 5FKNA 2KT0A 2GBYA 2E5ZA 2PI0A 4JX6A 2HOTA 3K1MA 3LSIA 2CYYA 2ZCWA 4LD5A 1DU6A 2MC3A 1OR7A 2M8EA 3FIWA 2HGCA 1FEXA 2ZJ2A 2CQQA 1R7JA 4LITA 4CSWA 3DLLF 3CO6C 3TW6A 2EINH 2PBIA 1FP1D 4YFXF 3V78A 2AXTC 3DQVC 2EZIA 2DBBA 4NB5A 2PFBA 4U87A 2YX4A 1Z21A 2LKPA 2EV0A 5F1RA 3LSPA 2RN7A 1V4RA 1IZ1A 2DOAA 1VFCA 3K4BA 4L18B 2QSGX 1ZN2A 4OAZA 1RKTA 4BDZA 1XTAA 2A68F 3GZIA 1F9NA 1QZEA 4DYQA 1XC5A 3OYKA 3VVYA 2EK5A 5FKKA 4XKBA 1A04A 2E34A 4P9UA 2LKSA 4OWRB 3TEDA 2KRCA 3WG7H 1IRZA 1P2FA 5JLXA 2DPUA 2CMPA 4MK6A 4NN1A 1IXSB 4AYBN 3HRUA 3HPGA 2R93J 3CP8A 1K78A 3NARA 1EKEA 3SXYA 3ZPLA 2M7BA 3M8JA 2ZCNA 3K2AA 1Y6IA 1FZPB 5HBUA 2V79A 3R0JA 2H1LA 2GA2A 3OSFA 1S9HA 2L4AA 5HNFA 2DFFA 3L2UA 2QSHX 4MIMA 4BXFA 1U3EM 2EB7A 2RC4A 3BCGA 3HTHA 3OOPA 2MBFA 2HQ5A 2F5EA 2G7UA 4A69C 4PJMA 1JTXA 3F8CA 2DA7A 3BR1A 3SJMA 3IP4B 2V1XA 1LJ9A 2FBQA 2E2IJ 1SD4A 5C4JJ 3HJEA 3G1OA 3NEUA 2M0CA 2H8WA 1IDZA 3TDZC 2BZTA 3D5LA 4H0EA 2V7FA 2HYTA 4R8HA 3AG2H 1W36D 3ZQIA 2MG4A 3K7AJ 3DFGA 2HKXA 2XAUA 3ZN1A 3RPUA 2PMZA 4ZC3A 3W2WA 3KP2A 3K9TA 4K2EA 2MFZA 2PEXA 4IHXA 4E7JA 2F5VA 2B3WA 3ECOA 1U8RA 2V9PA 1IRXA 1MIJA 3ZQLA 1O3QA 3MMYB 4H4KC 3ABKH 2X9DA 2E1MC 3E3VA 2JQ7A 3K70C 1KYZA 3CMMA 2L9SA 2MSYA 5H6QA 3CDIA 3HHGA 3T8TA 1TW3A 3QWLA 5LEJA 1R22A 4II2A 1YJNI 3IRRA 1S6LA 4BE1A 1MDMB 3IHUA 2MA3A 1ZELA 3K0LA 3EETA 3HGGA 3MFKA 2YUSA 3FXKA 5KAFC 5CYVA 2NOJB 3WTUC 3G2BA 1G59A 3S15J 3OYEA 2A61A 2XF7A 1RZ4A 2V26A 2HOEA 3GCMA 4A3CJ 2QA4I 2HDWA 4YIIA 4E7KA 5DM7F 4BE2A 4BHPA 1MBJA 4UDSA 3V42A 3IUOA 3OYCA 1MH4A 2G7LA 2JTVA 4RS8A 3AAFA 1J2XA 4S0HB 4G12A 4RLQA 4ZYAA 3I64A 2R7OA 4JX4A 1GDTA 1T39A 5HLTA 3MZ8A 5E3LA 4AC6A 1O57A 1MDMA 2M87A 1TWGJ 1ONVA 5ICEA 4D7NA 2L9NA 3H3UA 1FYKA 3ZMVA 3S3OA 3A4CA 4ZDOA 1YJWI 2KLOA 3A03A 3PIPF 3ABLH 3BR3A 4EGYA 1KQ0A 4XKCA 3LWFA 3S93A 4OMYA 5FLMJ 3J81Z 2ME0A 5B66C 2XAJA 4ABZA 2GENA 4JL3A 4D9JA 2G9WA 2IW5A 4WXHA 4C2TA 2GM4A 2ECCA 5L3DA 4CHUA 1YS6A 1WJCA 4X1EA 4C30A 2ZFUA 2QIBA 1FIPA 2DYRH 2IS2A 2WWYA 2X6XA 3QU3A 3CCQI 4YRVA 2XDVA 2IGNA 1R49A 5D8KB 1R1UA 2BY3A 2VQGA 3PUBA 2Y31A 2UWMA 3DBRB 1BW5A 1HW5A 2JN6A 3BTCA 3F8FA 2FE3A 3QQAA 3OYLA 2K5CA 3GZ5A 2DMUA 3TL4X 2DFHA 3OS2A 3DBHB 4ENJA 4DIQA 4F93B 1K61A 3VOKA 3H9GA 3V8JA 2WAQN 5BPDA 1S3JA 3HEFA 4A3GJ 2QTQA 2ICWG 1HOMA 1YITI 1HQCA 4A6EA 2JMWA 3I4PA 2D5VA 3GTPJ 4PJNA 3ANGA 2QZ8A 1FIAA 2LF8A 2EIJH 3B6AA 4L9VA 3IL2A 3VOXA 1K6YA 3DKWA 3VVXA 2UXPA 3CC2I 4XLNF 4XN0A 3ELKA 4AIDA 3O60A 5TGTA 1DPRA 3OL4A 3QYBA 1VI0A 3JRHA 1D1BA 4IRGA 1KZHA 5D4SA 4BYYA 3E0JB 3WGHA 5DUIA 2W24A 1ON2A 3WTYC 3E97A 4RGRA 1OKRA 1Y8QB 3HOTA 4LG0B 1MD0A 2DK5A 2JZYA 5F0HA 1G3SA 4AM3A 3DEWA 2DAOA 4WXCA 1LUJB 4OIOF 5HLHA 2XKOA 1JKRC 1UI5A 5KAIC 2QKOA 3H3VK 2DXIA 3A2KA 2H94A 1E17A 4ZDPA 2HKOA 2P81A 5ICCA 4BJTA 2Y30A 4QSHA 2QSFX 4PJJA 3L00A 1Y0UA 3W2VA 2BXYA 1A6QA 5EZHA 2R7ZJ 3WTWC 2ISZA 1MJ9A 3H5AA 5LHIA 3E5UA 1E3OC 2X4HA 4Q48A 3ZCOA 3CCMI 2FD5A 4LG0A 2ACJA 3KZ9A 4NHJA 3O2PE 4LFUA 1OCZH 1R1VA 3FXMA 1KYWA 3KP4A 4UHTA 5D6FA 2JA6J 4A0XA 4M3DA 1WKMA 2FBKA 2QQAA 4JQFA 4IKFA 3RJPA 3IAS2 4YELA 3LAJA 3C07A 3GFJA 2L4MA 5IPAA 4RGSA 2HXIA 3FM5A 2ZCXA 2P4WA 4WF2A 1FX7A 1B8IA 3VIBA 3HUGB 3DEEA 3LA3A 2OA4A 4OMZA 3DWLE 3B02A 4OD5A 2UXNA 4PSWA 2VUMJ 1TT0A 1XS9A 2OF7A 2XRLA 1SVOA 3GLLA 4B1RA 3JRCA 1ZARA 3QPLA 2NOGA 3E6DA 3I71A 3IV5A 1MZBA 4EM0B 1IXRC 1J0RA 3GTQJ 4Q47A 1IUYA 2HI3A 4IX7A 1L0OC 2JT1A 2GAUA 3KZIC 2C6YA 4HV5A 2MW8A 5H2FC 2O8XA 4XICA 4I01A 3BCAA 2XGDA 4DBQA 2CQNA 3IWFA 3JSJA 2XB5A 1WJBA 1ZGAA 2W57A 1R5GA 3RSNA 3E5QA 2L7FP 3P9CA 1S7EA 3HUGA 2K7LA 4CCOA 4GYIA 4UUTA 2K9SA 4ENMA 2VT2A 1AA7A 2AXLA 1T0FC 3VUQA 2LOOA 5JFRA 4B8XA 3ISPA 4EEFG 5K5RA 1K6OA 3ABTA 4KIBA 4LMYA 2JA2A 3P9KA 1X4PA 2JVHA 3PO3J 2X51A 3V7SA 3AKZA 4ZZLA 3V7CA 3F9KA 4EJUA 2JA7J 1F36A 2ESNA 2PMZN 3DP7A 4HLYA 1SFEA 1NTCA 2L54A 4RB2C 2V4JC 4YG2F 5H9TA 1BJAA 2DU9A 1BI2A 2QBYB 3SZTA 3OMYA 4B48A 1XSDA 1I6XA 2DA1A 4BS9A 1JHFA 5AONA 2FJI1 3G73A 4XRSG 2HWVA 2JSCA 4AU7A 1X1PA 4RAFA 1Z6RA 1ETYA 3ZMZA 3RH2A 4BXUA 2HVSA 1SFUA 4CCLA 3NXCA 2V6EA 3DXJF 1G3YA 3R4KA 1HKSA 3DTKA 3ERMA 4E7SA 2PG4A 3LA2A 1B59A 2OTJI 3VEPA 3BRUA 3IC7A 1BI1A 1YW8A 2K9MA 2WAFA 4DNCA 3HRTA 1QRYA 1E3HA 4XQFA 1ZTRA 2COMA 1VQLI 2VJIA 3KYDB 4ICHA 2QGUA 1S5LC 4EQQA 2LR8A 2DODA 3CCSI 2QBYA 3VB2A 4QPQA 3FMRA 3ZN0A 2P6TA 5GP9A 2A07F 4A3LJ 1IN4A 3QKXA 3CUQC 2OQRA 5E17F 2R7UA 4XNFA 5EG0B 4CGRA 3KZYA 4HX8A 2FSWA 2LKXA 3LA7A 1AU7A 1HSTA 5ICFA 4FCYA 4ZYGA 2WAEA 4J00A 2F48A 3Q0UA 4UY8I 3ZMUA 2NVQJ 3FHNA 4ZH4F 2R7RA 3FISA 1HDPA 1XCBA 3GFMA 4PFPA 1LB2A 1VQ9I 3ZMTA 2M4GA 3EQLF 2FQ3A 4KIFA 4JK1X 3Q3SA 1T2KA 4FHTA 3DEUA 2DA3A 2Z2SB 1YRNB 2M4KA 2DQLA 3G1MA 3M1EA 3U2RA 1JGGA 1APLC 3S17J 2VN2A 2H6BA 2RASA 3FKJA 3E5XA 3P9IA 2HFHA 3WGGA 2XPVA 5HOOA 1QZZA 1MJBA 5EG0A 1UELB 2KZVA 2X6OA 3OYJA 2A6HF 4JKZA 1BA5A 2QWWA 4MTEA 4S05A 3OYNA 2VPRA 2LTPA 2LY1A 1JI8A 1CF7B 3RCOA 3ZQGA 5F0FA 2CV1A 5FMPA 1QHGA 4A3JJ 3GBGA 2E1NA 3BQZA 2HOSA 4DZJA 2O9LA 1MMAA 3PJRA 3SFIA 4BBSJ 3RZOJ 1YRNA 1BI3A 4EATA 2WC2A 1VQ4I 1B9MA 3ERED 2IAIA 5JLWA 2HVQA 5GAGJ 2CSOA 3T6NA 1XDSA 2DT6A 3KLOA 4CH7A 5LD2C 2PQ8A 4MHGA 1YW9A 5F1JA 4BDYA 3BG6A 2CWEA 1OYIA 4I6ZA 2GXBA 3FMQA 2BW3B 4PK4A 4KFCA 5IYDJ 2GFNA 3AL0C 4U88A 1Y0NA 3I54A 4B44A 3BT9A 1U0JA 2EIMH 2E5NA 5DYMA 1CF7A 3CZ6A 3FBNB 5HNHA 1MMDA 5FFZA 4ZYHA 2STWA 1RUOA 3IH3A 2CGPA 2DDBA 3PIOF 1IV6A 3AQTA 4IHVA 2K4JA 1ZLJA 2CFOA 1POGA 3J7ZI 1O4XA 2R7FA 3I0TA 2EA2A 2L3DA 2V1DA 3BWGA 3CJNA 3JW4A 5H6RA 1SMYF 1WHUA 2Z99A 4OINF 2WV1A 4RM3A 2XF5A 1WJAA 4WIBA 5TRDA 2XGCA 3L2QA 4X0GA 5J6XA 3GZ6A 1O3SA 2BW3A 3TOBA 3C7JA 4XIDA 4BAYA 1FSEA 2CQKA 1BR1A 4JOMA 2P5LC 1TWAJ 2RKHA 2QVOA 2B1EA 2XV4S 1GVDA 2LMDA 5DD4A 4EVIA 4XLHA 4UNOA 4EJVA 4OU0A 5E1ZB 2GXGA 2KIUA 3E6CC 1OR7C 2VQLA 3K70D 2IBDA 3RQ4A 3UNGC 4UUSB 2XUBA 2Y0SA 4Y17A 3N4MA 2DW4A 2OAZA 1O3TA 1MMSA 3K4KA 5D5VB 5K5QA 1RR8C 1ETOA 3MZYA 5F0CA 1FMWA 4IRIA 3WHCA 2QWTA 2LDUA 3A01A 2RNJA 4IVNA 4Y13A 5L3BA 4UV9A 1V3FA 3KP3A 4IXAA 1LVAA 5C3EJ 1ZRCA 1D1AA 4G7HF 3VTIA 2IVMA 4MFDA 4PCQA 5DTDA 2EIKH 2TRTA 3C2GA 2VQHA 1FOXA 1ZQ3P 3JREA 1WJ5A 3RKQA 3C1DA 5F6FA 1D5VA 3AFHA 4RLFA 3BOQA 2HKUA 1R36A 3CDLA 4CCJA 3LHQA 2JRMA 2HZDA 2LSOA 3T5XA 4F91B 4A93J 1QO0D 4L9JA 4UB8C 1R23A 1Y1WJ 3CMAI 5C4YA 2WY7Q 1SC7A 4RAGA 1IN6A 2QUFA 3GEZA 2CW8A 2AS5F 5K7HA 3SDBA 4RMNA 3KYLA 1XB4A 3FK7A 2JJ7A 2PMHA 4F7ZA 5J40A 4S04A 3V8LA 5FHPA 1KONA 2RNGA 3WGIA 2DPDA 5GAEJ 1ZG5A 4OOIA 2R7QA 3JRDA 2E2HJ 1LFPA 3GX4X 2XIGA 3VYUB 1X1BA 3FM3A 2VBZA 5FLXZ 2PJPA 1TQPA 2X6YA 2ZNZA 1SFOJ 1ETXA 1FBQA 3TQNA 3BROA 3K2ZA 2UV1A 4IOCF 2LRDA 3ZMDA 2JA8J 3C3WA 3CC4I 3PNTA 3GW2A 1LFUP 5FKOA 1ZKGA 5M5WJ 3O8HA 1WZ2A 5BNGA 4BL0B 3S2HJ 2QQ9A 3WTVC 3I4MJ 2LY2A 4MGRA 2QKMB 2FUG2 4RAYA 1FWZA 2M1BA 3HRMA 3QOPA 3VOEA 1UAAA 3DF8A 2K40A 3Q9SA 2E2JJ 2H09A 1HSJA 3IWZA 1I6HJ 1B9NA 4MTDA 4G8XA 4PFOA 3TKYA 5F04A 2EZHA 2JK3A 2V1NA 5HDKA 2X1DA 4MQVA 4EM2A 3FWEA 2DT7B 1K78B 2Y9YA 3CC7I 4BQOA 5FJ8J 1EV7A 3L2RA 1PUEE 3LMMA 4GCTA 3EYYA 1TZLA 4PUSA 1YIOA 2OJED 2L7KA 4FE7A 1V55H 2OERA 1WH7A 2FBHA 2ZOZA 1KGSA 3AG4H 4FASD 3QPTA 2VBXA 5H20A 4M3EA 3K1PA 3KEYA 2QENA 1S72I 1U8BA 2Y48A 4AD9A 3ON4A 1WQ2A 1BR4A 4A0YA 2OBPA 1K4SA 2GUHA 2NVXJ 1QQIA 3M8EA 1ZR4A 1JXSA 2PLYA 2ESHA 3GTLJ 1NK2P 4BY7J 3LNQA 3DPTA 4I7HA 5BPIA 1IJWC 4L62A 2JPBA 4XL9A 2NX4A 4IHSA 3E7LA 1I50J 1QPMA 2EPFA 3AG1H 1MMNA 4IZZA 3HOVJ 3S1MJ 1JKOC 1JKQC 4L0ZB 3RDIA 3U1KA 3H0GJ 4M71A 2ZBKA 1XSVA 3EGQA 4CO8A 4F92B 2E1CA 3L1PA 3KEOA 3R0AA 3F8NA 4ON0A 5GPCA 4J19A 3GMEA 3BC8A 4HSTA 4IF4A 1X4OA 4J01A 1HKQA 2VQCA 2HZTA 4OIRF 3F8MA 1GHCA 3GUDA 1BL0A 2D45A 2JA5J 3RTRA 1ACIA 1I39A 1AOYA 2Z5UA 1SFKA 2DA5A 4A6DA 3H5NA 2I10A 3M3YJ 2O7TA 3JRGA 3HOZJ 3BG3A 1WGXA 2YS9A 3JTGA 2CV2A 3RYRA 3JSOA 4KWAA 4E7ZA 5HODA 2X1EA 1YS7A 3H3ZA 3WE3A 1C0WA 3GTOJ 2KJBA 2V57A 1L3LA 4L0YB 2DOEA 2F4IA 4C9YA 3OOUA 2HQNA 2W84A 2HR3A 4JBAA 2BE5F 5E18F 1Q1VA 2VB6A 4I98B 5CJ9A 5D4RA 2OTLI 4U0VA 2IU5A 1PP7U 4GCLA 2Q8KA 1RRJA 3CF5F 3WU2C 2R3SA 1CQTA 1MBGA 4EGZA 2VL8A 1SMTA 3D0SA 2ISYA 1BJZA 2EJRA 1FTZA 3WHBA 3I3LA 1K83J 5ILUA 3I4NJ 1FLIA 5D18A 1ETWA 3I5UA 1U78A 3FXJA 5F27A 3Q5FA 4ACIA 4IEJA 5CVRA 1D3YA 2ZSIB 3DTIA 1D0YA 3HOUJ 3QOEA 1MW7A 2VXDA 3GO5A 3FXOA 3A02A 5F64A 2IA0A 2LG4A 1TBXA 2JUCA 3DCFA 2IGKA 2PJRB 3HGYA 4IOAF 3MQ0A 1QBJA 1IN8A 4IHTA 1ULYA 1JUMA 1P9QC 5J47A 1DP3A 2ZCMA 4M6XA 4Y52J 1VQ7I 4UXNA 2Y69H 1X2MA 1P92A 3IKTA 3N05A 1HW2A 3WODF 1R5HA 2IJLA 3BG5A 3GFIA 3M7GA 3G1LA 2F07A 1RKWA 3FKIJ 1OJLA 4U0YA 2F2EA 4O3MA 2R7VA 3KLNA 1BOAA 1Z6TA 2KISA 2L2OA 4KIGA 4RAZA 2D1VA 2G7HA 2IA2A 3D5RC 2ZXWH 5J8FA 2LP0A 4N0BA 1S7OA 3F6VA 2FRHA 4NNJA 1BN5A 3O3KA 2PJRA 1EJ9A 3H36A 1TNSA 1UMQA 2F5CA 4DW6A 2J5PA 2ZKZA 4NUBA 3ASOH 3RPQA 2ZJQF 4QWQA 1ZREA 2Y0SN 3H35A 3JAMK 2ZSHB 4QIWN 3ZQ7A 2I8DA 2QQBA 1D0ZA 1YQAA 1N77A 1TTYA 2F4OB 4XRFA 1OQYA 4XSXF 3CCUI 1G6NA 3L2VA 2Y0MA 2UZKA 4BUPA 1YTYA 4C3JJ 3SHFA 5IP9J 3JR9A 1FY7A 3EYIA 5IT9Z 3VP5A 3OYDA 4XLEA 3VSLA 2ZC2A 2R5ZB 1A35A 3T1BA 4A3KJ 2L5QA 3CF2A 2EH3A 4LK1F 3FXRA 5E3NA 1RR7A 4IQ4A 1U5TB 4E70A 4CGZA 3K4JA 1YFHA 1W7PD 1GLNA 3J80K 2F4MB 4XM3A 4HBLA 3VSKA 4B09A 3CD6I 1IRGA 3I56I 1AKHB 1U6GA 1FBUA 3BZKA 1ZYRF 3SZPA 3H5RA 3LSGA 4N4OB 3RYPA 5LHHA 1USTA 5D19A 1TWFJ 3BZCA 2A2FX 1Y56A 3HM5A 2BHZA 2HPMA 2UXUA 2BVMA 3TO9A 2UXOA 2W00A 2NXNB 2VI6A 2F5DA 3ML6A 5DUKA 2W82A 2E35A 3OSGA 3GTJJ 3OYAA 2EWNA 2Q2EB 2R5ZA 2A5WA 3DU5A 1U2WA 3ZQFA 5J1YA 2GIVA 2RAEA 3KP7A 4HF0A 1U5TA 3L7WA 1BIAA 2NP5A 5JVGF 3BJ6A 3H1CA 1BM9A 4O5VA 2ADUA 1AKHA 2D2WA 3ZOBA 4O6JA 1G3WA 2ZJPF 2BGCA 1NH3A 4EJWA 4L5IA 1X1CA 2CH0A 1ETQA 1R58A 3OR1C 3P7NA 3K6GA 3JRFA 5M5XJ 2CQ7A 4M9SA 3KKDA 4W97A 3PNVA 3PNYA 5K7ZA 5JVTA 1B8IB 1MJAA 2Q2EA 1PDNC 3Q0VA 3NWTA 1Z67A 1B6AA 2HU9A 4LLNA 4AWXB 5D1RA 1A36A 6PAXA 3WU1B 2Z1DA 4CZZA 1HA8A 1QU3A 5EEGA 2XRNA 3M4OJ 2QLZA 2FMLA 2DFEA 4CZCA 2KDZA 2GXAA 3K8PC 2EFPA 5J1RA 2AQEA 4EV0A 2XPUA 2HOAA 3GZNB 3RKXA 3RD3A 2O0YA 1VQ6I 2IXSA 3GTMJ 4CYDA 5IP6A 2DTZA 1T38A 1OISA 3H9JA 3S32A 2R7TA 3KNWA 2L7MP 2XROA 2XGXA 2EFNA 2DTRA 3U1DA 3K10A 2CFXA 1T98A 5B1BH 3ZGKA 5ICGA 2FQ4A 3BHQA 3BJAA 2R7WA 1FMVA 3NPIA 1TP4A 2JVGA 4KYWA 5BS6A 4RBOA 1XG1A 4ANJA 5IP7J 2ZO4A 1W5TA 2DMTA 3WTXC 3NI7A 1EH8A 1LEAA 1H88C 4FTHA 2W48A 5DEQA 1H8AC 4OIQF 2Y75A 2E71A 2FNAA 3EUPA 2NNNA 1LPQA 1DPUA 2FOWA 5FKMA 1BC7C 3TO6A 4KN4X 2KP6A 1PJRA 5KVRA 4E7LA 2EZKA 1OYWA 5LRRA 2CJJA 2QQ8A 4LG3A 4GO1A 2X6WA 3BR0A 4TV7A 2O61A 4YIRX 4HLXA 4GGGA 1S8NA 4LIUA 2LVSA 4KUMA 1JHHA 1OCRH 1FSHA 2M2EA 4XKWA 3MD2A 4GFKA 1X3WB 3MAJA 3HPHA 4FISA 3S1NJ 2K9NA 1P7IA 4JX5A 2LBFB 4G6DA 3DPJA 1JE8A 2KKOA 3KX2A 5FKLA 1SD5A 4V2GA 1D0XA 2K4BA 4JP0A 5FGLA 1J5YA 1N25A 1XCVA 2P0WA 2ETHA 3LSRA 3EUHA 1Z9CA 3KP6A 3CLQA 4FX0A 1KQ9A 4HQEA 1OCPA 3V7RA 1I5ZA 4DJAA 3MWMA 2WV0A 4G9YA 3CWRA 1ON1A 1NHAA 2P5VA 1YJ9I 3M8FA 3LQQA 3VWBA 2G3BA 2CUJA 3S3NA 2EILH 1K7AA 2W4SA 3T0YA 3BPVA 5BQTA 1WVRA 1ERDA 2FBIA 2LBFA 2EA4A 3R61A 1KU7A 2V6CA 2FF4A 3I59B 4A5MA 2VONA 4NQWB 1HLVA 3FMSA 3MKWB 3C18A 5DM6F 2XSJC 2HQRA 1QPIA 1ODDA 3SDGA 3TW7A 3CDHA 5FO5A 3QP6A 2GQQA 4C3HJ 1WRJA 1E3PA 4HX7A 4ESJA 5E79C 2CG4A 2R92J 3DU6A 2KQRA 1V5GA 1F4KA 5IY5H 2VJ5A 2ZMEB 5CW8A 4Z2YA 3HIFA 3KZZA 4BJ5C 4XRMA 2XAFA 1UFMA 3S16J 3TBIA 4C2MJ 1Z91A 4XK4A 1A31A 1FNNA 3I59A 1ZAOA 4ASNA 5JR3A 3DBLB 4NQWA 1TNTA 4N9IA 1QNTA 2COBA 4HF2A 2DJNA 3OIQA 5CQEA 4RB3C 1H9GA 2W7NA 4KN7X 2REKA 4AIJA 4C2UA 1FPQA 2VKVA 3MCZA 4BHBA 4IRVA 2YU3A 2ZMEA 3BR5A 4HEA2 3L2CA 4P96A 2ZJRF 4IO9F 4LB5A 3VPRA 4UVAA 5CVIA 2O6GE 1HW1A 2HYJA 5KHDA 1A6IA 2IPQX 5DS9A 2IT0A 1P4XA 4F3QA 4HPQA 2JSPA 1T95A 1IRFA 1EH7A 3IKVA 1YO5C 3KYCB 4E7HA 4AF5A 2AQFA 5LGUA 2DMQA 1X58A 2XASA 3A0HC 2CW0F 1XX5A 1YIJI 5D5WB 4MEYF 2QYOA 3JSPA 1XMXA 5FD6A 2F5FA 1ZG1A 2MC4A 1H0MA 4HSRA 1A5JA 1OCTC 2NVTJ 3VYSB 1MSEC 3CRJA 1HDDC 1I1GA 4CCMA 1XMAA 2VT3A 3FZVA 3ABMH 2XKPA 1SFXA 1YE9A 3CLOA 1Z7UA 1J09A 2FEZA 3OV8A 3F1BA 5L3GA
chains in the Genus database with same CATH topology
3A03A 4CYCA 3BR3A 2Y9YA 1JT0A 3BR6A 5FJ8J 4GCTA 3NRGA 1QVTA 5FLMJ 2ECBA 2ME0A 3UKGA 2LFBA 4ABZA 2GENA 4JL3A 4FE7A 5FLVA 4GFBA 2G7SA 3KKCA 2DA6A 1TC3C 1WH7A 5M5YJ 2ECCA 2GM4A 2OERA 2ZOZA 3NNRA 4X1EA 2R5YA 2QIBA 4IHYA 1FIPA 3MN2A 4M3EA 2Q24A 1PUFB 1U8BA 3ON4A 4C3IJ 3BQYA 3A01B 2CQXA 2Y31A 4QTRA 1BW5A 3O8GA 3TP3A 2JN6A 3BTCA 2WGBA 1U9OA 2GUHA 3QQAA 2NVXJ 2DMUA 2L9RA 1ZR4A 5AQCA 3GTLJ 2ZB9A 3HIMA 1NK2P 4BY7J 3LNQA 1IJWC 1K61A 3LSJA 2B63J 3P9TA 4HKUA 3C2BA 2DG8A 4YZEA 3VOKA 4PXIA 2NX4A 2WAQN 3E7LA 1I50J 5IOZA 2DA4A 5EFYA 3HOVJ 3S1MJ 4A3GJ 3HEFA 1JKOC 1JKQC 2QTQA 5EF6A 3H0GJ 2CRGA 1HOMA 1VNDA 3HOXJ 2JMWA 3EGQA 1X2NA 1ZR2A 2D5VA 1RESA 3GTPJ 2M9HA 3L1PA 1IUFA 3ANGA 1FIAA 1JUPA 3B6AA 2ME6A 3VOXA 3VVXA 5GPCA 4J19A 4BXXJ 4D5FA 2UXPA 4V2FA 1PUFA 2ELKA 3BJBA 4BBRJ 4AC0A 1BL0A 3O60A 3IH2A 2JA5J 1JKPC 3BTJA 2DA5A 3M3YJ 1VI0A 2I10A 3JRHA 2O7TA 4B4CA 3JRGA 3RZDJ 1T56A 3HOZJ 1ITYA 3BG3A 1WGXA 2YS9A 3HOWJ 2OI8A 1GUUA 2D6YA 1WCMJ 1ENHA 4M3FA 3PO2J 1WI3A 4KWAA 3JRIA 4Y7NJ 5HODA 3HDDA 5F0HA 1Y1VJ 4DYRA 3BTLA 3DEWA 1WH5A 4A3FJ 3GTOJ 4B3AA 2V57A 1UI5A 1JKRC 4A3DJ 3OOUA 5CXIA 3ZQCA 3IUVA 2QKOA 1Q1VA 3G7RA 3H3VK 2IU5A 1DU0A 1MBFA 4GCLA 4MXMA 2UXHA 2P81A 2N8GA 1MBGA 1CQTA 2XSDC 2Y30A 1BW6A 4QSHA 5EDNA 2DG7A 4M6VA 4M3GA 1BJZA 1FTZA 3WHBA 1EF4A 1K83J 5EZHA 5J1UA 3I4NJ 2M34A 2R7ZJ 1ETWA 5D18A 5EGOB 1U78A 5F27A 4A3BJ 4ACIA 3IH4A 1E3OC 3LWJA 4IEJA 3GTGJ 1TWHJ 3KZ9A 2FD5A 3HOUJ 3MNLA 3QBMA 3A02A 3HTJA 4A3MJ 2JA6J 4M3DA 3DCFA 3HOYJ 4NELA 1GV2A 3HGYA 2TCTA 5GPAA 1JUMA 2ZOYA 3V6GA 2IEKA 3C07A 2ZCMA 5IPAA 4Y52J 2HXIA 2ZCXA 2HXOA 1X2MA 2EBIA 1B8IA 3VIBA 3BG5A 5C4XJ 2PZ9A 3G1LA 2F07A 5HAWA 1RKWA 3FKIJ 1OJLA 2VUMJ 5EGOA 2K9QA 2OF7A 1XS9A 2XRLA 4B1RA 3JRCA 1UI6A 3QPLA 2NOGA 3IV5A 4BY1J 3GTKJ 2LP0A 2LLKA 3HBLA 3GTQJ 3BTIA 2HI3A 2HDDA 1JT6A 2MW8A 4HNVA 1UMQA 5EZGA 4MO7A 4XICA 1IGNA 2XGDA 3HTIA 2AHQA 4DW6A 4RDUA 3JSJA 2Y0SN 2XB5A 3CMYA 3PPBA 4QIWN 1IDYA 2L7FP 5K58A 1S7EA 1HCRA 4X6AJ 4UUTA 5M3MJ 2K9SA 1JUSA 5IOYA 2CUEA 4DZPA 2O7OA 3VUQA 2QCOA 4EEFG 3Q0WA 1ZK8A 4C3JJ 5IP9J 3JR9A 3VP5A 4MFEA 1IG7A 3HTAA 2R5ZB 3PO3J 3D1NI 4A3KJ 1WPKA 2W53A 2EH3A 5E3NA 1RR7A 2JA7J 1F36A 1D5YA 2PMZN 3ANPA 2NVYJ 1NTCA 1FJLA 2YU9J 5H9TA 1AKHB 1HF0A 4GFLA 1IC8A 3LSGA 2DA1A 2XB0X 3FK6A 1JTYA 3PM1A 5E3MA 1SGMA 5D19A 2GLOA 1TWFJ 3CQZJ 2E1OA 2MGQA 4XRSG 3HM5A 2UXUA 1ETYA 2UXOA 3RH2A 1UG2A 2VI6A 4JYKA 3NXCA 3MVPA 2XGEA 3VW1A 3OSGA 3GTJJ 3JRBA 3S5RA 4D5CA 2R5ZA 3ZQFA 5J1YA 2LY9A 2G0EA 2RAEA 4A3IJ 3BRUA 1MH3A 3BG9A 1QRYA 1ZTRA 2NP5A 1LFBA 4D7MA 4ICHA 1AKHA 2E19A 3VVZA 2LR8A 3ZOBA 2EZLA 5GP9A 2M8GX 1P7JA 3B81A 4A3LJ 1ETQA 3QKXA 3JRFA 1MBEA 3QPSA 5DAJA 3NAUA 4AUXA 5M5XJ 5EG0B 1VF9A 5C44J 4CGRA 4BKXA 3KKDA 1UHSA 2G7GA 5IYCJ 1Z77A 3OIOA 4W97A 2LKXA 1AU7A 2QF7A 3FRQA 1JJ6C 1LE8B 1GV5A 5K7ZA 4FCYA 1B8IB 2WUIA 3Q0UA 1G2HA 3Q0VA 2NP3A 2NVQJ 5J3LA 4UUSA 2L7ZA 3FISA 4IHWA 1HDPA 1U9NA 5D1RA 3BR2A 3F0CA 3Q3SA 4MLOA 3TP0A 1JJ8C 4I76A 2DA3A 2AO9A 1B72B 1YRNB 2DN0A 2XPWA 3S1QJ 2NS8A 5E3OA 1H89C 5CXGA 3G1MA 3S17J 1JGGA 1APLC 1F43A 2CUFA 3M4OJ 2RASA 1NK3P 2UXIA 4ME9A 1MBHA 2XPVA 3CCYA 2KDZA 2O8KA 5J1RA 2WB1N 5EG0A 5EYRA 2XPUA 2HOAA 3RD3A 2X6OA 4JKZA 2DMNA 1LE8A 3GTMJ 2LK2A 1BA5A 3B6CA 2VKEA 2NS7A 5IP6A 2DTZA 1R9TJ 2VPRA 3KNWA 2LTPA 5HSZA 4DYCA 2CU7A 5F0FA 2L7MP 3ZQGA 4L62A 5FMPA 4JNNA 4A3JJ 3GBGA 3BQZA 2O9LA 2HOSA 4DZJA 3VW2A 1ZGWA 9ANTA 2FQ4A 3SFIA 4BBSJ 3RZOJ 1B72A 1YRNA 3BHQA 3JRAA 3NPIA 2IAIA 5F08A 1I3QJ 5JLWA 1RETA 3GEUA 3T6NA 4NDLA 1MBKA 4RBOA 1XG1A 2Y9ZA 3S1RJ 5IP7J 5F1JA 2FJ1A 2DMTA 3LJLA 5FKNA 2KT0A 2GBYA 4I6ZA 1W0TA 4JX6A 2HOTA 3NI7A 1H88C 5IYDJ 2GFNA 4FTHA 2W48A 3G56A 1DU6A 3COLA 2YVHA 5IYBJ 1H8AC 3FIWA 1FEXA 3BT9A 2CQQA 2JWTA 3EUPA 3TW6A 5FKMA 3V78A 2EZIA 3IH3A 1TWCJ 4XRSA 2EZKA 1IV6A 3AQTA 4IHVA 2CJJA 5K7FA 1POGA 3BR0A 3VW0A 3LSPA 1O4XA 1VFCA 2LVSA 3HE0A 1RKTA 2L0KA 2WV1A 2M2EA 2FX0A 3GZIA 4GFKA 4GCKA 4FISA 2XGCA 4A3EJ 4DYQA 2K9NA 3S1NJ 1P7IA 4JX5A 1XC5A 3DPJA 3VVYA 5FKKA 5FKLA 4XIDA 1ETKA 4V2GA 2ID3A 1TWAJ 3TEDA 4JP0A 5FGLA 1GVDA 1T33A 1FTTA 1IRZA 5JLXA 4MK6A 4NN1A 3LSRA 4AYBN 2R93J 3NARA 2ZCNA 1OCPA 3K2AA 5HBUA 3BNIA 2IBDA 3HB9A 4UUSB 3OSFA 3CWRA 5EEAA 2DMPA 4L5EA 4MIMA 2G3BA 3BCGA 3HTHA 1ETOA 2HQ5A 3PASA 1GT0C 4A69C 5F0CA 1JTXA 1SANA 2DA7A 3WHCA 2R0QC 2QWTA 3BR1A 3SJMA 3A01A 2LD5A 2Y2ZA 2FBQA 2PBXA 1HLVA 2E2IJ 2EQRA 5C4JJ 5C3EJ 3W6VA 3G1OA 1QPIA 3S14J 3SDGA 2M0CA 1ETVA 1QVUA 4MFDA 3TW7A 1W0UA 2H8RA 4FE4A 1IDZA 5DTDA 2TRTA 2HYTA 4C3HJ 1ORKA 1ZQ3P 3ZQIA 3JREA 2MG4A 3RKQA 3K7AJ 2R92J 3CJDA 2XDNA 2HKUA 3CDLA 5CW8A 3LHQA 4A93J 4IHXA 1Y1WJ 5C4YA 3LOCA 4XRMA 3S16J 1OFCX 3ZQLA 4M3BA 4LOCA 4C2MJ 5K7HA 2H1KA 4XK4A 2X9DA 3FK7A 1Z0XA 2JJ7A 2RHAA 2MSYA 5FHPA 2COBA 2DJNA 2OPTA 3JRDA 2E2HJ 2REKA 1MSFC 2VKVA 1AHDP 2YVEA 1SFOJ 1ETXA 3HGGA 3BR5A 2YUSA 3S15J 3VPRA 3S2DJ 3E7QA 4CYCB 2HYJA 2JA8J 1A6IA 4A3CJ 5DS9A 1LFUP 3RQIA 5FKOA 1ZKGA 5M5WJ 3O8HA 2X48A 3S2HJ 5BNGA 4AF5A 1MBJA 3ON2A 4UDSA 2DMQA 1X58A 1MNMC 2ID6A 3MKLA 3I4MJ 1MH4A 2G7LA 4W1UA 2R5YB 4S0HB 2DA2A 4G12A 3HKZN 1A5JA 1OCTC 4JX4A 2K40A 1MSEC 2NVTJ 3CRJA 2E2JJ 1HDDC 1GDTA 5E3LA 1I6HJ 1RPWA 4AC6A 3ZQHA 5F04A 1TWGJ 5M3FJ 2EZHA 2JK3A 4D7NA 3F1BA 3AQSA 2QOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A03 A;  4CYC A;  3BR3 A;  2Y9Y A;  1JT0 A;  3BR6 A;  5FJ8 J;  4GCT A;  3NRG A;  1QVT A;  5FLM J;  2ECB A;  2ME0 A;  3UKG A;  2LFB A;  4ABZ A;  2GEN A;  4JL3 A;  4FE7 A;  5FLV A;  4GFB A;  2G7S A;  3KKC A;  2DA6 A;  1TC3 C;  1WH7 A;  5M5Y J;  2ECC A;  2GM4 A;  2OER A;  2ZOZ A;  3NNR A;  4X1E A;  2R5Y A;  2QIB A;  4IHY A;  1FIP A;  3MN2 A;  4M3E A;  2Q24 A;  1PUF B;  1U8B A;  3ON4 A;  4C3I J;  3BQY A;  3A01 B;  2CQX A;  2Y31 A;  4QTR A;  1BW5 A;  3O8G A;  3TP3 A;  2JN6 A;  3BTC A;  2WGB A;  1U9O A;  2GUH A;  3QQA A;  2NVX J;  2DMU A;  2L9R A;  1ZR4 A;  5AQC A;  3GTL J;  2ZB9 A;  3HIM A;  1NK2 P;  4BY7 J;  3LNQ A;  1IJW C;  1K61 A;  3LSJ A;  2B63 J;  3P9T A;  4HKU A;  3C2B A;  2DG8 A;  4YZE A;  3VOK A;  4PXI A;  2NX4 A;  2WAQ N;  3E7L A;  1I50 J;  5IOZ A;  2DA4 A;  5EFY A;  3HOV J;  3S1M J;  4A3G J;  3HEF A;  1JKO C;  1JKQ C;  2QTQ A;  5EF6 A;  3H0G J;  2CRG A;  1HOM A;  1VND A;  3HOX J;  2JMW A;  3EGQ A;  1X2N A;  1ZR2 A;  2D5V A;  1RES A;  3GTP J;  2M9H A;  3L1P A;  1IUF A;  3ANG A;  1FIA A;  1JUP A;  3B6A A;  2ME6 A;  3VOX A;  3VVX A;  5GPC A;  4J19 A;  4BXX J;  4D5F A;  2UXP A;  4V2F A;  1PUF A;  2ELK A;  3BJB A;  4BBR J;  4AC0 A;  1BL0 A;  3O60 A;  3IH2 A;  2JA5 J;  1JKP C;  3BTJ A;  2DA5 A;  3M3Y J;  1VI0 A;  2I10 A;  3JRH A;  2O7T A;  4B4C A;  3JRG A;  3RZD J;  1T56 A;  3HOZ J;  1ITY A;  3BG3 A;  1WGX A;  2YS9 A;  3HOW J;  2OI8 A;  1GUU A;  2D6Y A;  1WCM J;  1ENH A;  4M3F A;  3PO2 J;  1WI3 A;  4KWA A;  3JRI A;  4Y7N J;  5HOD A;  3HDD A;  5F0H A;  1Y1V J;  4DYR A;  3BTL A;  3DEW A;  1WH5 A;  4A3F J;  3GTO J;  4B3A A;  2V57 A;  1UI5 A;  1JKR C;  4A3D J;  3OOU A;  5CXI A;  3ZQC A;  3IUV A;  2QKO A;  1Q1V A;  3G7R A;  3H3V K;  2IU5 A;  1DU0 A;  1MBF A;  4GCL A;  4MXM A;  2UXH A;  2P81 A;  2N8G A;  1MBG A;  1CQT A;  2XSD C;  2Y30 A;  1BW6 A;  4QSH A;  5EDN A;  2DG7 A;  4M6V A;  4M3G A;  1BJZ A;  1FTZ A;  3WHB A;  1EF4 A;  1K83 J;  5EZH A;  5J1U A;  3I4N J;  2M34 A;  2R7Z J;  1ETW A;  5D18 A;  5EGO B;  1U78 A;  5F27 A;  4A3B J;  4ACI A;  3IH4 A;  1E3O C;  3LWJ A;  4IEJ A;  3GTG J;  1TWH J;  3KZ9 A;  2FD5 A;  3HOU J;  3MNL A;  3QBM A;  3A02 A;  3HTJ A;  4A3M J;  2JA6 J;  4M3D A;  3DCF A;  3HOY J;  4NEL A;  1GV2 A;  3HGY A;  2TCT A;  5GPA A;  1JUM A;  2ZOY A;  3V6G A;  2IEK A;  3C07 A;  2ZCM A;  5IPA A;  4Y52 J;  2HXI A;  2ZCX A;  2HXO A;  1X2M A;  2EBI A;  1B8I A;  3VIB A;  3BG5 A;  5C4X J;  2PZ9 A;  3G1L A;  2F07 A;  5HAW A;  1RKW A;  3FKI J;  1OJL A;  2VUM J;  5EGO A;  2K9Q A;  2OF7 A;  1XS9 A;  2XRL A;  4B1R A;  3JRC A;  1UI6 A;  3QPL A;  2NOG A;  3IV5 A;  4BY1 J;  3GTK J;  2LP0 A;  2LLK A;  3HBL A;  3GTQ J;  3BTI A;  2HI3 A;  2HDD A;  1JT6 A;  2MW8 A;  4HNV A;  1UMQ A;  5EZG A;  4MO7 A;  4XIC A;  1IGN A;  2XGD A;  3HTI A;  2AHQ A;  4DW6 A;  4RDU A;  3JSJ A;  2Y0S N;  2XB5 A;  3CMY A;  3PPB A;  4QIW N;  1IDY A;  2L7F P;  5K58 A;  1S7E A;  1HCR A;  4X6A J;  4UUT A;  5M3M J;  2K9S A;  1JUS A;  5IOY A;  2CUE A;  4DZP A;  2O7O A;  3VUQ A;  2QCO A;  4EEF G;  3Q0W A;  1ZK8 A;  4C3J J;  5IP9 J;  3JR9 A;  3VP5 A;  4MFE A;  1IG7 A;  3HTA A;  2R5Z B;  3PO3 J;  3D1N I;  4A3K J;  1WPK A;  2W53 A;  2EH3 A;  5E3N A;  1RR7 A;  2JA7 J;  1F36 A;  1D5Y A;  2PMZ N;  3ANP A;  2NVY J;  1NTC A;  1FJL A;  2YU9 J;  5H9T A;  1AKH B;  1HF0 A;  4GFL A;  1IC8 A;  3LSG A;  2DA1 A;  2XB0 X;  3FK6 A;  1JTY A;  3PM1 A;  5E3M A;  1SGM A;  5D19 A;  2GLO A;  1TWF J;  3CQZ J;  2E1O A;  2MGQ A;  4XRS G;  3HM5 A;  2UXU A;  1ETY A;  2UXO A;  3RH2 A;  1UG2 A;  2VI6 A;  4JYK A;  3NXC A;  3MVP A;  2XGE A;  3VW1 A;  3OSG A;  3GTJ J;  3JRB A;  3S5R A;  4D5C A;  2R5Z A;  3ZQF A;  5J1Y A;  2LY9 A;  2G0E A;  2RAE A;  4A3I J;  3BRU A;  1MH3 A;  3BG9 A;  1QRY A;  1ZTR A;  2NP5 A;  1LFB A;  4D7M A;  4ICH A;  1AKH A;  2E19 A;  3VVZ A;  2LR8 A;  3ZOB A;  2EZL A;  5GP9 A;  2M8G X;  1P7J A;  3B81 A;  4A3L J;  1ETQ A;  3QKX A;  3JRF A;  1MBE A;  3QPS A;  5DAJ A;  3NAU A;  4AUX A;  5M5X J;  5EG0 B;  1VF9 A;  5C44 J;  4CGR A;  4BKX A;  3KKD A;  1UHS A;  2G7G A;  5IYC J;  1Z77 A;  3OIO A;  4W97 A;  2LKX A;  1AU7 A;  2QF7 A;  3FRQ A;  1JJ6 C;  1LE8 B;  1GV5 A;  5K7Z A;  4FCY A;  1B8I B;  2WUI A;  3Q0U A;  1G2H A;  3Q0V A;  2NP3 A;  2NVQ J;  5J3L A;  4UUS A;  2L7Z A;  3FIS A;  4IHW A;  1HDP A;  1U9N A;  5D1R A;  3BR2 A;  3F0C A;  3Q3S A;  4MLO A;  3TP0 A;  1JJ8 C;  4I76 A;  2DA3 A;  2AO9 A;  1B72 B;  1YRN B;  2DN0 A;  2XPW A;  3S1Q J;  2NS8 A;  5E3O A;  1H89 C;  5CXG A;  3G1M A;  3S17 J;  1JGG A;  1APL C;  1F43 A;  2CUF A;  3M4O J;  2RAS A;  1NK3 P;  2UXI A;  4ME9 A;  1MBH A;  2XPV A;  3CCY A;  2KDZ A;  2O8K A;  5J1R A;  2WB1 N;  5EG0 A;  5EYR A;  2XPU A;  2HOA A;  3RD3 A;  2X6O A;  4JKZ A;  2DMN A;  1LE8 A;  3GTM J;  2LK2 A;  1BA5 A;  3B6C A;  2VKE A;  2NS7 A;  5IP6 A;  2DTZ A;  1R9T J;  2VPR A;  3KNW A;  2LTP A;  5HSZ A;  4DYC A;  2CU7 A;  5F0F A;  2L7M P;  3ZQG A;  4L62 A;  5FMP A;  4JNN A;  4A3J J;  3GBG A;  3BQZ A;  2O9L A;  2HOS A;  4DZJ A;  3VW2 A;  1ZGW A;  9ANT A;  2FQ4 A;  3SFI A;  4BBS J;  3RZO J;  1B72 A;  1YRN A;  3BHQ A;  3JRA A;  3NPI A;  2IAI A;  5F08 A;  1I3Q J;  5JLW A;  1RET A;  3GEU A;  3T6N A;  4NDL A;  1MBK A;  4RBO A;  1XG1 A;  2Y9Z A;  3S1R J;  5IP7 J;  5F1J A;  2FJ1 A;  2DMT A;  3LJL A;  5FKN A;  2KT0 A;  2GBY A;  4I6Z A;  1W0T A;  4JX6 A;  2HOT A;  3NI7 A;  1H88 C;  5IYD J;  2GFN A;  4FTH A;  2W48 A;  3G56 A;  1DU6 A;  3COL A;  2YVH A;  5IYB J;  1H8A C;  3FIW A;  1FEX A;  3BT9 A;  2CQQ A;  2JWT A;  3EUP A;  3TW6 A;  5FKM A;  3V78 A;  2EZI A;  3IH3 A;  1TWC J;  4XRS A;  2EZK A;  1IV6 A;  3AQT A;  4IHV A;  2CJJ A;  5K7F A;  1POG A;  3BR0 A;  3VW0 A;  3LSP A;  1O4X A;  1VFC A;  2LVS A;  3HE0 A;  1RKT A;  2L0K A;  2WV1 A;  2M2E A;  2FX0 A;  3GZI A;  4GFK A;  4GCK A;  4FIS A;  2XGC A;  4A3E J;  4DYQ A;  2K9N A;  3S1N J;  1P7I A;  4JX5 A;  1XC5 A;  3DPJ A;  3VVY A;  5FKK A;  5FKL A;  4XID A;  1ETK A;  4V2G A;  2ID3 A;  1TWA J;  3TED A;  4JP0 A;  5FGL A;  1GVD A;  1T33 A;  1FTT A;  1IRZ A;  5JLX A;  4MK6 A;  4NN1 A;  3LSR A;  4AYB N;  2R93 J;  3NAR A;  2ZCN A;  1OCP A;  3K2A A;  5HBU A;  3BNI A;  2IBD A;  3HB9 A;  4UUS B;  3OSF A;  3CWR A;  5EEA A;  2DMP A;  4L5E A;  4MIM A;  2G3B A;  3BCG A;  3HTH A;  1ETO A;  2HQ5 A;  3PAS A;  1GT0 C;  4A69 C;  5F0C A;  1JTX A;  1SAN A;  2DA7 A;  3WHC A;  2R0Q C;  2QWT A;  3BR1 A;  3SJM A;  3A01 A;  2LD5 A;  2Y2Z A;  2FBQ A;  2PBX A;  1HLV A;  2E2I J;  2EQR A;  5C4J J;  5C3E J;  3W6V A;  3G1O A;  1QPI A;  3S14 J;  3SDG A;  2M0C A;  1ETV A;  1QVU A;  4MFD A;  3TW7 A;  1W0U A;  2H8R A;  4FE4 A;  1IDZ A;  5DTD A;  2TRT A;  2HYT A;  4C3H J;  1ORK A;  1ZQ3 P;  3ZQI A;  3JRE A;  2MG4 A;  3RKQ A;  3K7A J;  2R92 J;  3CJD A;  2XDN A;  2HKU A;  3CDL A;  5CW8 A;  3LHQ A;  4A93 J;  4IHX A;  1Y1W J;  5C4Y A;  3LOC A;  4XRM A;  3S16 J;  1OFC X;  3ZQL A;  4M3B A;  4LOC A;  4C2M J;  5K7H A;  2H1K A;  4XK4 A;  2X9D A;  3FK7 A;  1Z0X A;  2JJ7 A;  2RHA A;  2MSY A;  5FHP A;  2COB A;  2DJN A;  2OPT A;  3JRD A;  2E2H J;  2REK A;  1MSF C;  2VKV A;  1AHD P;  2YVE A;  1SFO J;  1ETX A;  3HGG A;  3BR5 A;  2YUS A;  3S15 J;  3VPR A;  3S2D J;  3E7Q A;  4CYC B;  2HYJ A;  2JA8 J;  1A6I A;  4A3C J;  5DS9 A;  1LFU P;  3RQI A;  5FKO A;  1ZKG A;  5M5W J;  3O8H A;  2X48 A;  3S2H J;  5BNG A;  4AF5 A;  1MBJ A;  3ON2 A;  4UDS A;  2DMQ A;  1X58 A;  1MNM C;  2ID6 A;  3MKL A;  3I4M J;  1MH4 A;  2G7L A;  4W1U A;  2R5Y B;  4S0H B;  2DA2 A;  4G12 A;  3HKZ N;  1A5J A;  1OCT C;  4JX4 A;  2K40 A;  1MSE C;  2NVT J;  3CRJ A;  2E2J J;  1HDD C;  1GDT A;  5E3L A;  1I6H J;  1RPW A;  4AC6 A;  3ZQH A;  5F04 A;  1TWG J;  5M3F J;  2EZH A;  2JK3 A;  4D7N A;  3F1B A;  3AQS A;  2QOP A; 
#chains in the Genus database with same CATH topology
 1WWX A;  2P6S A;  2XHK A;  3CJQ B;  4RGX A;  1FP2 A;  1BI0 A;  4L9T A;  3BR6 A;  1W1W E;  3WU0 A;  1QVT A;  3K4N A;  2NAZ A;  2E36 A;  2ECB A;  3UKG A;  1LQ1 A;  2LFB A;  1W7P B;  2OC6 A;  4U7D A;  1J75 A;  4GFB A;  5FLV A;  3KKC A;  2DA6 A;  1RIO H;  3GF2 A;  5DCF A;  3QU6 A;  3MN2 A;  5GTH C;  1TQI A;  3HXL A;  3BQY A;  3A01 B;  2CQX A;  2MLG A;  1UHM A;  3QOD A;  3TP3 A;  1U9O A;  2XAH A;  2Z9O A;  2GZW A;  2L9R A;  2FXA A;  2GOX B;  3C2H A;  1LNW A;  4HKU A;  4Q5S F;  3LSJ A;  4YZE A;  5LFA A;  3C2B A;  2DG8 A;  1BIB A;  1IW7 F;  4M73 A;  1TQM A;  5CVV A;  2WY8 Q;  1P4A A;  1RNL A;  2DA4 A;  3KP5 A;  3CCV I;  3SFZ A;  4DOZ A;  1W7P A;  1WSU A;  5L3C A;  3HOX J;  4FX4 A;  1VQP I;  5FLX K;  1X2N A;  1ZR2 A;  4EJT A;  2R7S A;  3MKY B;  4D0P A;  2M9H A;  1IUF A;  1JUP A;  4HDU A;  4OAY A;  3BY6 A;  3VFZ A;  3DLA A;  3OIP A;  4I0A A;  1RC9 A;  4D5F A;  4V2F A;  3SYT A;  5BMZ A;  3BJB A;  2Z33 A;  2KFD A;  5DCM B;  1X19 A;  1FC3 A;  2EFO A;  3QPH A;  3TDU C;  4A0Z A;  4AC0 A;  5FB2 A;  4WCG A;  1LKX A;  2E7X A;  2VKD A;  4NC6 A;  1FYM A;  3RZD J;  1ITY A;  1T56 A;  3RKW A;  3KIO A;  5HS8 A;  1GUU A;  3PQK A;  4CDG A;  4ZTF A;  3HTS B;  1ENH A;  4M3F A;  4IJA A;  5E8I A;  3KCC A;  3FXQ A;  3JRI A;  1UCR A;  2HNH A;  1WI9 A;  1Y1V J;  3BTL A;  1WH5 A;  4B3A A;  4HQM A;  2HEO A;  4A3D J;  1T8I A;  5CXI A;  2VIX A;  4XON A;  3ZQC A;  4HV6 A;  3IUV A;  1DU0 A;  2KMU A;  1MBF A;  3ZR8 X;  3TGN A;  1XPX A;  2BOL A;  2K85 A;  1GVJ A;  5AIP A;  5DCM A;  2N8G A;  1KU2 A;  1LDD A;  1STZ A;  4HW0 A;  1FOK A;  1T08 B;  2YPR A;  2M7A A;  1SD6 A;  4M3G A;  5K5O A;  1SVL A;  1EF4 A;  2BEO A;  3BCB A;  2M34 A;  3KFW X;  5EGO B;  4HZF A;  3PFY A;  2QM3 A;  3V4G A;  4A3B J;  3IH4 A;  1OMI A;  4PZJ A;  3WE2 A;  1TWH J;  3SEZ A;  2X0L A;  2CS3 A;  1USS A;  5HDN A;  3MNL A;  2V1U A;  3QBM A;  2KPM A;  4ENN A;  2L02 A;  2UUZ A;  3HTJ A;  1I27 A;  3ROU A;  3F21 A;  2K9L A;  1XGM A;  3HOY J;  4NEL A;  1GV2 A;  5GPA A;  1R4N B;  2TCT A;  3M1C A;  5EEH A;  2R4G A;  2ZOY A;  4UVB A;  2O03 A;  2IEK A;  1R00 A;  4HF1 A;  1QA6 A;  4B47 A;  2BY1 A;  2HXO A;  1DGW Y;  3K4L A;  5LBQ A;  4WX9 A;  2IRF G;  3HSF A;  3DKY A;  5C4X J;  1X1A A;  2LYC A;  1HBX G;  5HAW A;  3U9G A;  3PSI A;  5EGO A;  4LIV A;  1ZGJ A;  1YHQ I;  1WJD A;  3OR2 C;  4CXF A;  2X1C A;  4ZDL A;  4DQ2 A;  3CCJ I;  4EMS A;  2M0M A;  3GTK J;  3TMO A;  4B3X A;  2LLK A;  4B43 A;  3CJR B;  3BTI A;  3LAP A;  1YI2 I;  3DPL C;  5D6E A;  2DQR A;  2HDD A;  1JT6 A;  5JI6 A;  2FMY A;  4HNV A;  4MO7 A;  1I1S A;  4Y15 A;  2AHQ A;  3HTI A;  5HLG A;  1E0E A;  5FRO A;  1XDU A;  5K1Y A;  5ILS A;  1MKM A;  2FOK A;  3QP5 A;  2ZFW A;  3SWH A;  4BNC A;  1SAX A;  5K58 A;  5FD5 A;  3OWT A;  5M3M J;  5L3E A;  2LNB A;  4EM1 A;  2CUE A;  4DZP A;  2O7O A;  2V9V A;  2B7E A;  2DI3 A;  2QCO A;  2A05 A;  5A2Q Z;  1ZK8 A;  3RIR A;  5LLQ A;  1DP7 P;  1IG7 A;  3ASN H;  4KA4 A;  3O6B B;  4P9F A;  5HS9 A;  3D1N I;  1O7L A;  2W53 A;  2CUZ A;  1D5Y A;  1W5C C;  2Q0O A;  3PFI A;  3U21 A;  4E6K G;  3L2W A;  4FQG A;  3ANP A;  3HKZ A;  4EJO A;  1K4T A;  3K1N A;  1HF0 A;  2RQP A;  1RI7 A;  4G7O F;  2D1H A;  1Q1H A;  4GFL A;  1IC8 A;  2XB0 X;  5E3M A;  1JTY A;  2NNY A;  2CO5 A;  2FA5 A;  3N97 A;  1SGM A;  3CQZ J;  2E1O A;  2KJC A;  3OL3 A;  4PJL A;  2VXZ A;  3WTS C;  4V19 K;  2RQQ A;  2DOF A;  3FXL A;  1TW2 A;  4ZJZ A;  2BHY A;  1UB9 A;  1UG2 A;  1XGN A;  5JHF A;  2DK8 A;  2XGE A;  3MVP A;  3WTZ A;  3JRB A;  3S5R A;  4D5C A;  4BH9 A;  3LSK A;  3NQO A;  3LSH A;  2G0E A;  1W4M A;  2KIQ A;  5CKT A;  4A3I J;  1VQ5 I;  1D8J A;  3BG9 A;  4UVC A;  3VOD A;  2GIZ A;  2A6E F;  4CCN A;  1R5I D;  1LFB A;  2R7D A;  2EV5 A;  2K3F A;  3GYH X;  4I09 A;  3HZJ A;  2R7X A;  1IXC A;  1V54 H;  2YVX A;  2J5O A;  4YIF A;  5L3F A;  3B81 A;  4CIC A;  3HTU A;  3ZRG A;  3QYF A;  4AUX A;  1CGP A;  3GXO A;  1VF9 A;  5C44 J;  4BKX A;  1TT5 B;  1UHS A;  1QGP A;  5IYC J;  1Z77 A;  3OIO A;  2A69 F;  3J81 K;  2G7G A;  1SAU A;  2BV6 A;  2JPC A;  2M5W A;  5GTI C;  1LE8 B;  3I58 A;  4P1W A;  2WUI A;  3I9V 2;  1G2H A;  2NP3 A;  1Z3Y A;  1JGS A;  1YG2 A;  2ZXJ A;  5J3L A;  2OUM A;  2L7Z A;  3H9Q A;  1R1T A;  5E1X A;  3LST A;  1U9N A;  5JHU A;  4U7B A;  3BG7 A;  4WK8 F;  3F0C A;  1GXQ A;  5FRM A;  4OIP F;  4I76 A;  3E6M A;  3ZQQ A;  3S1Q J;  2DN0 A;  3TO7 A;  1BR2 A;  1G8X A;  1H89 C;  2MAB A;  5IT9 K;  1F43 A;  2CUF A;  4LB6 B;  5GAD J;  1NK3 P;  1U5T C;  5B5E C;  3LSM A;  1OLT A;  3CP2 A;  3SQN A;  3OYF A;  3CCY A;  3CCE I;  1KQ8 A;  2O8K A;  2IGO A;  4IPA A;  1SEU A;  3BZ6 A;  4G7Z F;  3BP8 A;  1T6S A;  1ZHF A;  2IGM A;  5D5U B;  4KDP A;  4RB1 A;  4YFN F;  2DMN A;  3KPH A;  1LE8 A;  2LK2 A;  1V5E A;  2A5Y B;  3B6C A;  2RGV A;  2NS7 A;  2VKE A;  3PL8 A;  2NVU B;  4XLF A;  1XMK A;  4XOP A;  2PMU A;  2VBW A;  1XD7 A;  2CU7 A;  4HNU A;  1B4A A;  4JNN A;  3VW2 A;  4NBQ A;  5BOX A;  2Z16 A;  2KRH A;  2ZNY A;  1MMG A;  1BOB A;  4IL6 C;  1ZH5 A;  3CCR I;  4LLL A;  2JUG A;  3JRA A;  3EUA A;  4AIK A;  2ZY9 A;  2MH2 A;  2BYV E;  4GYG A;  2P5K A;  5J4Y A;  4IQJ A;  1UHW A;  2FJ1 A;  3F23 A;  2L01 A;  5ED4 A;  3H0D A;  1W0T A;  2HTJ A;  2K3P A;  3G56 A;  2YX7 A;  4ZYE A;  3GWZ A;  4II3 A;  2VJ4 A;  1DUX C;  2EFW A;  3COL A;  2YVH A;  1F5T A;  5IYB J;  1EH6 A;  4KJZ A;  4L9N A;  2JWT A;  1IN7 A;  4I99 C;  2B9S A;  4HRI A;  1TWC J;  4XRS A;  3GLX A;  5LGN A;  3CUO A;  5K7F A;  5LHG A;  1REP C;  3LFU A;  1LVK A;  3VW0 A;  4Z6Y A;  3LL7 A;  2E1M B;  5FFX A;  2EFQ A;  1Y39 A;  4BJ6 C;  3HE0 A;  4HNT A;  2L0K A;  4R79 A;  2DJI A;  1G4D A;  2FX0 A;  1TLH B;  4XSZ F;  5CVJ A;  4WWC A;  4GCK A;  1OYY A;  4A3E J;  2F6C A;  2VOP A;  1LEB A;  5HS7 A;  1BC8 C;  1X3Z B;  4KMU X;  2JRT A;  4U9N A;  1ETK A;  2HYG D;  3G71 I;  4LJZ F;  2MLK A;  1P4W A;  2ID3 A;  3W3C A;  1XGO A;  3CTA A;  5LRS A;  3RI4 A;  4GXO A;  1T33 A;  1FTT A;  1PVE A;  1FT9 A;  4KT5 C;  3H92 A;  1MGT A;  3IRQ A;  2OU2 A;  2VC0 A;  5HVQ C;  3EPZ A;  1IV8 A;  2MD5 A;  2FU4 A;  3BNI A;  3HB9 A;  4KIT B;  2ELJ A;  1WJE A;  5EEA A;  2DMP A;  1Z7L A;  3Q9V A;  4L5E A;  5TIS C;  3M9A A;  1X1D A;  4UB6 C;  3PAS A;  1GT0 C;  1Z05 A;  4P55 A;  3HL2 A;  4P5O A;  1SAN A;  2XC7 A;  1VTN C;  2R0Q C;  2LD5 A;  2Y2Z A;  2PBX A;  2BY2 A;  4DVY P;  4BAC A;  2OZU A;  2ZXH A;  3T8R A;  2EQR A;  2TDX A;  4C2M A;  3JTH A;  3PSF A;  3W6K B;  3W6V A;  4D1Q A;  3S14 J;  2IS1 A;  4HAM A;  1ETV A;  1QVU A;  2H8R A;  1W0U A;  4FE4 A;  2OV7 A;  2DFI A;  5CLS A;  1ORK A;  4MQ9 F;  2LRE A;  3CJD A;  4BE0 A;  2XDN A;  3PUF A;  3JAM Z;  4I2O A;  4XMY A;  2KRF A;  4LGW A;  3ULQ B;  5LEK A;  3OYB A;  1WJF A;  1M1E B;  3KEQ A;  3EUH C;  2W25 A;  3HOS A;  1TL8 A;  3LOC A;  2XVC A;  3K4C A;  1OFC X;  1P6R A;  4LOC A;  4M3B A;  1B1B A;  4BEH B;  4BQN A;  2H1K A;  1D8K A;  5HLI A;  1Z0X A;  3FXU A;  2RHA A;  3HG9 A;  2IS4 A;  3L9F A;  2OPT A;  4M72 A;  5E1W A;  3J80 Z;  1MSF C;  3FBI B;  1OPC A;  3S3M A;  1AHD P;  2YVE A;  4OD4 A;  2PX9 A;  1VQN I;  4BQQ A;  3S2D J;  3E7Q A;  4A12 A;  4CYC B;  1WFX A;  5CPR B;  3RQI A;  2HPI A;  4M6Y A;  5B3S H;  2X48 A;  1W36 C;  4BEH A;  3NRV A;  3ON2 A;  2VOD A;  1XSX A;  4M9X A;  1MNM C;  2ID6 A;  2QKL B;  3MKL A;  3EDP A;  1IO2 A;  4W1U A;  2R5Y B;  5FRN A;  4BHC A;  1ZLK A;  2DA2 A;  2NRA C;  3HKZ N;  4ETS A;  2BY0 A;  3HSR A;  3VDX A;  3EUK L;  4E7I A;  4F55 A;  3MKZ A;  4KMF A;  1RPW A;  4M9Z A;  1FOW A;  2HQA A;  3ZQH A;  1UJ8 A;  4R1H A;  5M3F J;  2NYX A;  4RM2 A;  2LF7 A;  1LDK B;  4GDF A;  3AQS A;  3PQJ A;  3G3Z A;  2QOP A;  3IAM 2;  3GEU A;  2VJJ A;  4BGD A;  1OCC H;  2OQG A;  3W6J B;  4RB0 A;  4CYC A;  2PFV A;  1J7K A;  1RUN A;  1JT0 A;  5J4V A;  3NRG A;  3WG9 A;  1MND A;  2HYF A;  3ZMS A;  1HC8 A;  3ZXS A;  1R71 A;  3UR3 C;  4LLG F;  2ZME C;  2WB1 A;  3BPX A;  4F52 A;  2G7S A;  4CA0 A;  1TC3 C;  5M5Y J;  1O3R A;  4BU2 A;  3NNR A;  1ZRD A;  3REO A;  3E1S A;  4ESF A;  2R5Y A;  3MZH A;  4IHY A;  3ESW B;  1KU9 A;  2LC2 A;  3S2W A;  3GVA A;  2Q24 A;  2IA1 A;  1PUF B;  2K86 A;  3D5S C;  1J9I A;  1NG7 A;  4C3I J;  2CW7 A;  2RDP A;  4YEJ A;  4QTR A;  2MYS A;  1LDJ A;  3O8G A;  2HVR A;  2WGB A;  3OS0 A;  1QZY A;  3AG3 H;  2K02 A;  5J8C A;  3COA C;  5AQC A;  2NS0 A;  1QHH D;  2V9K A;  3MEX A;  2ZB9 A;  3HIM A;  1DGR M;  4XN3 A;  1G3T A;  2A6T A;  4XKV A;  2B63 J;  3BJO A;  2VOO A;  5ILV A;  3P9T A;  4PXI A;  2E60 A;  3HRS A;  4AVZ A;  2GA1 A;  5IOZ A;  5EFY A;  1VZ0 A;  5EF6 A;  2CRG A;  3OY9 A;  4MEX F;  1VND A;  3S8P A;  1I3A A;  4CCK A;  1RES A;  3M07 A;  3QYE A;  4KNY A;  3GFL A;  2GOM A;  4PSX A;  2ME6 A;  3ECH A;  5CQG A;  1GXP A;  4BXX J;  1N78 A;  3P5J A;  4CUG A;  2HS5 A;  4KIC A;  3BLY A;  2ELK A;  1PUF A;  2E7W A;  1ZRF A;  3F8B A;  2EV6 A;  4PGG A;  4BBR J;  4MNU A;  3IH2 A;  1BBY A;  2H6C A;  1JKP C;  4KIS A;  3BTJ A;  4L5J A;  2MD0 A;  2Z3Y A;  3V8K A;  4Y4R A;  1VQK I;  4B4C A;  3RPU D;  3HC7 A;  5E20 A;  3HOW J;  2OI8 A;  2D6Y A;  1WCM J;  2WTE A;  3FHZ A;  3PO2 J;  1WI3 A;  4Y7N J;  4ENK A;  4ZTJ A;  1E2X A;  3OS1 A;  3HDD A;  2M3A A;  4UUV A;  4DYR A;  4A3F J;  2RRE A;  3HHH A;  3G7R A;  3CO7 C;  5AIQ A;  1DDN A;  4G94 A;  5DDG A;  2XAG A;  1O7F A;  4AYB A;  2UXH A;  4MXM A;  2XSD C;  1HKT A;  4AIH A;  1S29 A;  4E4H A;  1BW6 A;  5EJC A;  5D8L B;  5EDN A;  4NC7 A;  4M6V A;  2DG7 A;  2X85 A;  3A1Y A;  4XOT A;  5J1U A;  4QLC U;  2XAQ A;  4M74 A;  3CES A;  3LWJ A;  3GTG J;  2OZ6 A;  3DTE A;  2O5R A;  2CV0 A;  1XN7 A;  3CME I;  1R6R A;  2B0L A;  3FX3 A;  4A3M J;  3I53 A;  4KT6 A;  2KHM A;  1KU3 A;  4XLA A;  1PYV A;  3V6G A;  4ZZD A;  3OYH A;  4DGW B;  1T0F A;  1PP8 F;  5LGT A;  2VBY A;  3J7A O;  1D1C A;  1DQU A;  3SZG A;  4HX4 A;  3OYM A;  3BDD A;  2DYS H;  3OYG A;  2BBY A;  1IF1 A;  2EBI A;  3VYT B;  3FF5 A;  4XOR A;  3WTT C;  2VKH A;  2PZ9 A;  2KIF A;  3L09 A;  3R60 A;  4HA8 A;  3B73 A;  4ZYD A;  4Y3O A;  2K9Q A;  4BQA A;  2M45 A;  2HTS A;  2IS6 A;  3J7Y J;  1SD7 A;  1UI6 A;  2Q1Z B;  4G6T B;  2ELH A;  4BY1 J;  1F1Z A;  3TOA A;  2DT5 A;  4XR6 A;  3NS4 A;  1X3U A;  3HBL A;  3QRF F;  4ESB A;  5TJJ A;  1SVM A;  3CUQ B;  5EZG A;  5KNL A;  1IGN A;  3K69 A;  2VC1 A;  2YR2 A;  3SEQ A;  2KL4 A;  2WBM A;  4RDU A;  4I0B A;  3DKX A;  2OCC H;  1VQO I;  3CMY A;  1V5F A;  1KA8 A;  3PPB A;  1IDY A;  3DPU A;  1HCR A;  3LQR A;  4X6A J;  3ZP5 A;  1JUS A;  2LH9 A;  3K4M A;  5IOY A;  1FYL A;  3A0B C;  5KCM A;  2DO7 A;  4XLC A;  1R4M B;  2BVL A;  3Q0W A;  4Q4Z F;  3QAH A;  2KDO A;  4MFE A;  2RV8 A;  3CJT B;  3HTA A;  4PDK A;  4N9H A;  4A2U A;  4U0W A;  1WPK A;  3CUQ A;  2W1O A;  3KET A;  2YSR A;  5CVU A;  2DDA A;  2NVY J;  4ITV A;  1FJL A;  2VE8 A;  2MH9 A;  3HSE A;  5ERI A;  2YU9 J;  3HYI A;  2DCE A;  1H9T A;  4HYE A;  3FK6 A;  3F6O A;  3F3X A;  3PM1 A;  2GLO A;  4FET A;  2MGQ A;  1YX5 A;  2KZG A;  1IN5 A;  3NWS A;  1Z1D A;  2VLA A;  1HXD A;  2UXX A;  4JYK A;  5D5X B;  3I55 I;  3F22 A;  2H27 A;  4XBF A;  4QPO A;  3VW1 A;  3RKY A;  1UG0 A;  3LFK A;  2QEX I;  2XF6 A;  2LY9 A;  4FT8 A;  1FBS A;  1MH3 A;  5GAH J;  3G6E I;  2IP2 A;  4D7M A;  2HDC A;  3KE2 A;  1Y8R B;  4PJ0 C;  1MNE A;  2E19 A;  1VQ8 I;  3VVZ A;  1Z3X A;  2EZL A;  3AL0 B;  1ZG3 A;  1K79 A;  3R6S A;  2M8G X;  1P7J A;  2A3S A;  2VE9 A;  1J59 A;  4GCV A;  3JCU C;  1MBE A;  2O3F A;  3QPS A;  3NAU A;  3ABU A;  5DAJ A;  2P7C B;  4NC8 A;  1EA3 A;  3FRQ A;  2QF7 A;  2WAQ A;  1JJ6 C;  1GV5 A;  3G4S I;  2L9V A;  4HG2 A;  3ONQ A;  5HDG A;  4UUS A;  1AWC A;  4RA2 A;  2VPL A;  5DV5 A;  3X2Q H;  4IHW A;  2OCE A;  2OD5 A;  4LK0 F;  1NG6 A;  2GWR A;  1S7A A;  3BR2 A;  4HOB A;  2K27 A;  4MLO A;  2WA0 A;  3TP0 A;  1JJ8 C;  4G6Q A;  2ZXI A;  4RGU A;  2STT A;  2AO9 A;  3FDY A;  5DD8 A;  1B72 B;  2XPW A;  5FGM A;  5KK1 A;  5A2Q K;  2KIM A;  2NS8 A;  5E3O A;  2DLL A;  4GRI A;  5CXG A;  1XGS A;  2PN6 A;  3OYI A;  2RVC A;  2UXI A;  4ME9 A;  4I02 A;  1MBH A;  2P8T A;  1FOY A;  1YOV B;  2BXZ A;  4UV8 A;  1IAW A;  2WB1 N;  2W85 A;  5EYR A;  4YFK F;  5B1A H;  2I5U A;  1UZC A;  4DBR A;  3F72 A;  4Y33 A;  4HDV A;  1R9T J;  3DV8 A;  1YW7 A;  4WXD A;  1YLF A;  4A5N A;  5HSZ A;  4IRH A;  4DYC A;  4AVP A;  5IT3 A;  2VAS A;  4PGH A;  4XLP F;  3VYR B;  3E6B A;  1ZGW A;  9ANT A;  1YX3 A;  1B72 A;  1W5S A;  1YYV A;  5F08 A;  1I3Q J;  2FNP A;  1OCO H;  1RET A;  2M30 A;  5E8G A;  3W2A A;  2P7V B;  3J7A Y;  4U9L A;  4NDL A;  1MBK A;  4N4N B;  2Y9Z A;  1VQM I;  1N75 A;  3S1R J;  2WAD A;  3LJL A;  3CCL I;  5FKN A;  2KT0 A;  2GBY A;  2E5Z A;  2PI0 A;  4JX6 A;  2HOT A;  3K1M A;  3LSI A;  2CYY A;  2ZCW A;  4LD5 A;  1DU6 A;  2MC3 A;  1OR7 A;  2M8E A;  3FIW A;  2HGC A;  1FEX A;  2ZJ2 A;  2CQQ A;  1R7J A;  4LIT A;  4CSW A;  3DLL F;  3CO6 C;  3TW6 A;  2EIN H;  2PBI A;  1FP1 D;  4YFX F;  3V78 A;  2AXT C;  3DQV C;  2EZI A;  2DBB A;  4NB5 A;  2PFB A;  4U87 A;  2YX4 A;  1Z21 A;  2LKP A;  2EV0 A;  5F1R A;  3LSP A;  2RN7 A;  1V4R A;  1IZ1 A;  2DOA A;  1VFC A;  3K4B A;  4L18 B;  2QSG X;  1ZN2 A;  4OAZ A;  1RKT A;  4BDZ A;  1XTA A;  2A68 F;  3GZI A;  1F9N A;  1QZE A;  4DYQ A;  1XC5 A;  3OYK A;  3VVY A;  2EK5 A;  5FKK A;  4XKB A;  1A04 A;  2E34 A;  4P9U A;  2LKS A;  4OWR B;  3TED A;  2KRC A;  3WG7 H;  1IRZ A;  1P2F A;  5JLX A;  2DPU A;  2CMP A;  4MK6 A;  4NN1 A;  1IXS B;  4AYB N;  3HRU A;  3HPG A;  2R93 J;  3CP8 A;  1K78 A;  3NAR A;  1EKE A;  3SXY A;  3ZPL A;  2M7B A;  3M8J A;  2ZCN A;  3K2A A;  1Y6I A;  1FZP B;  5HBU A;  2V79 A;  3R0J A;  2H1L A;  2GA2 A;  3OSF A;  1S9H A;  2L4A A;  5HNF A;  2DFF A;  3L2U A;  2QSH X;  4MIM A;  4BXF A;  1U3E M;  2EB7 A;  2RC4 A;  3BCG A;  3HTH A;  3OOP A;  2MBF A;  2HQ5 A;  2F5E A;  2G7U A;  4A69 C;  4PJM A;  1JTX A;  3F8C A;  2DA7 A;  3BR1 A;  3SJM A;  3IP4 B;  2V1X A;  1LJ9 A;  2FBQ A;  2E2I J;  1SD4 A;  5C4J J;  3HJE A;  3G1O A;  3NEU A;  2M0C A;  2H8W A;  1IDZ A;  3TDZ C;  2BZT A;  3D5L A;  4H0E A;  2V7F A;  2HYT A;  4R8H A;  3AG2 H;  1W36 D;  3ZQI A;  2MG4 A;  3K7A J;  3DFG A;  2HKX A;  2XAU A;  3ZN1 A;  3RPU A;  2PMZ A;  4ZC3 A;  3W2W A;  3KP2 A;  3K9T A;  4K2E A;  2MFZ A;  2PEX A;  4IHX A;  4E7J A;  2F5V A;  2B3W A;  3ECO A;  1U8R A;  2V9P A;  1IRX A;  1MIJ A;  3ZQL A;  1O3Q A;  3MMY B;  4H4K C;  3ABK H;  2X9D A;  2E1M C;  3E3V A;  2JQ7 A;  3K70 C;  1KYZ A;  3CMM A;  2L9S A;  2MSY A;  5H6Q A;  3CDI A;  3HHG A;  3T8T A;  1TW3 A;  3QWL A;  5LEJ A;  1R22 A;  4II2 A;  1YJN I;  3IRR A;  1S6L A;  4BE1 A;  1MDM B;  3IHU A;  2MA3 A;  1ZEL A;  3K0L A;  3EET A;  3HGG A;  3MFK A;  2YUS A;  3FXK A;  5KAF C;  5CYV A;  2NOJ B;  3WTU C;  3G2B A;  1G59 A;  3S15 J;  3OYE A;  2A61 A;  2XF7 A;  1RZ4 A;  2V26 A;  2HOE A;  3GCM A;  4A3C J;  2QA4 I;  2HDW A;  4YII A;  4E7K A;  5DM7 F;  4BE2 A;  4BHP A;  1MBJ A;  4UDS A;  3V42 A;  3IUO A;  3OYC A;  1MH4 A;  2G7L A;  2JTV A;  4RS8 A;  3AAF A;  1J2X A;  4S0H B;  4G12 A;  4RLQ A;  4ZYA A;  3I64 A;  2R7O A;  4JX4 A;  1GDT A;  1T39 A;  5HLT A;  3MZ8 A;  5E3L A;  4AC6 A;  1O57 A;  1MDM A;  2M87 A;  1TWG J;  1ONV A;  5ICE A;  4D7N A;  2L9N A;  3H3U A;  1FYK A;  3ZMV A;  3S3O A;  3A4C A;  4ZDO A;  1YJW I;  2KLO A;  3A03 A;  3PIP F;  3ABL H;  3BR3 A;  4EGY A;  1KQ0 A;  4XKC A;  3LWF A;  3S93 A;  4OMY A;  5FLM J;  3J81 Z;  2ME0 A;  5B66 C;  2XAJ A;  4ABZ A;  2GEN A;  4JL3 A;  4D9J A;  2G9W A;  2IW5 A;  4WXH A;  4C2T A;  2GM4 A;  2ECC A;  5L3D A;  4CHU A;  1YS6 A;  1WJC A;  4X1E A;  4C30 A;  2ZFU A;  2QIB A;  1FIP A;  2DYR H;  2IS2 A;  2WWY A;  2X6X A;  3QU3 A;  3CCQ I;  4YRV A;  2XDV A;  2IGN A;  1R49 A;  5D8K B;  1R1U A;  2BY3 A;  2VQG A;  3PUB A;  2Y31 A;  2UWM A;  3DBR B;  1BW5 A;  1HW5 A;  2JN6 A;  3BTC A;  3F8F A;  2FE3 A;  3QQA A;  3OYL A;  2K5C A;  3GZ5 A;  2DMU A;  3TL4 X;  2DFH A;  3OS2 A;  3DBH B;  4ENJ A;  4DIQ A;  4F93 B;  1K61 A;  3VOK A;  3H9G A;  3V8J A;  2WAQ N;  5BPD A;  1S3J A;  3HEF A;  4A3G J;  2QTQ A;  2ICW G;  1HOM A;  1YIT I;  1HQC A;  4A6E A;  2JMW A;  3I4P A;  2D5V A;  3GTP J;  4PJN A;  3ANG A;  2QZ8 A;  1FIA A;  2LF8 A;  2EIJ H;  3B6A A;  4L9V A;  3IL2 A;  3VOX A;  1K6Y A;  3DKW A;  3VVX A;  2UXP A;  3CC2 I;  4XLN F;  4XN0 A;  3ELK A;  4AID A;  3O60 A;  5TGT A;  1DPR A;  3OL4 A;  3QYB A;  1VI0 A;  3JRH A;  1D1B A;  4IRG A;  1KZH A;  5D4S A;  4BYY A;  3E0J B;  3WGH A;  5DUI A;  2W24 A;  1ON2 A;  3WTY C;  3E97 A;  4RGR A;  1OKR A;  1Y8Q B;  3HOT A;  4LG0 B;  1MD0 A;  2DK5 A;  2JZY A;  5F0H A;  1G3S A;  4AM3 A;  3DEW A;  2DAO A;  4WXC A;  1LUJ B;  4OIO F;  5HLH A;  2XKO A;  1JKR C;  1UI5 A;  5KAI C;  2QKO A;  3H3V K;  2DXI A;  3A2K A;  2H94 A;  1E17 A;  4ZDP A;  2HKO A;  2P81 A;  5ICC A;  4BJT A;  2Y30 A;  4QSH A;  2QSF X;  4PJJ A;  3L00 A;  1Y0U A;  3W2V A;  2BXY A;  1A6Q A;  5EZH A;  2R7Z J;  3WTW C;  2ISZ A;  1MJ9 A;  3H5A A;  5LHI A;  3E5U A;  1E3O C;  2X4H A;  4Q48 A;  3ZCO A;  3CCM I;  2FD5 A;  4LG0 A;  2ACJ A;  3KZ9 A;  4NHJ A;  3O2P E;  4LFU A;  1OCZ H;  1R1V A;  3FXM A;  1KYW A;  3KP4 A;  4UHT A;  5D6F A;  2JA6 J;  4A0X A;  4M3D A;  1WKM A;  2FBK A;  2QQA A;  4JQF A;  4IKF A;  3RJP A;  3IAS 2;  4YEL A;  3LAJ A;  3C07 A;  3GFJ A;  2L4M A;  5IPA A;  4RGS A;  2HXI A;  3FM5 A;  2ZCX A;  2P4W A;  4WF2 A;  1FX7 A;  1B8I A;  3VIB A;  3HUG B;  3DEE A;  3LA3 A;  2OA4 A;  4OMZ A;  3DWL E;  3B02 A;  4OD5 A;  2UXN A;  4PSW A;  2VUM J;  1TT0 A;  1XS9 A;  2OF7 A;  2XRL A;  1SVO A;  3GLL A;  4B1R A;  3JRC A;  1ZAR A;  3QPL A;  2NOG A;  3E6D A;  3I71 A;  3IV5 A;  1MZB A;  4EM0 B;  1IXR C;  1J0R A;  3GTQ J;  4Q47 A;  1IUY A;  2HI3 A;  4IX7 A;  1L0O C;  2JT1 A;  2GAU A;  3KZI C;  2C6Y A;  4HV5 A;  2MW8 A;  5H2F C;  2O8X A;  4XIC A;  4I01 A;  3BCA A;  2XGD A;  4DBQ A;  2CQN A;  3IWF A;  3JSJ A;  2XB5 A;  1WJB A;  1ZGA A;  2W57 A;  1R5G A;  3RSN A;  3E5Q A;  2L7F P;  3P9C A;  1S7E A;  3HUG A;  2K7L A;  4CCO A;  4GYI A;  4UUT A;  2K9S A;  4ENM A;  2VT2 A;  1AA7 A;  2AXL A;  1T0F C;  3VUQ A;  2LOO A;  5JFR A;  4B8X A;  3ISP A;  4EEF G;  5K5R A;  1K6O A;  3ABT A;  4KIB A;  4LMY A;  2JA2 A;  3P9K A;  1X4P A;  2JVH A;  3PO3 J;  2X51 A;  3V7S A;  3AKZ A;  4ZZL A;  3V7C A;  3F9K A;  4EJU A;  2JA7 J;  1F36 A;  2ESN A;  2PMZ N;  3DP7 A;  4HLY A;  1SFE A;  1NTC A;  2L54 A;  4RB2 C;  2V4J C;  4YG2 F;  5H9T A;  1BJA A;  2DU9 A;  1BI2 A;  2QBY B;  3SZT A;  3OMY A;  4B48 A;  1XSD A;  1I6X A;  2DA1 A;  4BS9 A;  1JHF A;  5AON A;  2FJI 1;  3G73 A;  4XRS G;  2HWV A;  2JSC A;  4AU7 A;  1X1P A;  4RAF A;  1Z6R A;  1ETY A;  3ZMZ A;  3RH2 A;  4BXU A;  2HVS A;  1SFU A;  4CCL A;  3NXC A;  2V6E A;  3DXJ F;  1G3Y A;  3R4K A;  1HKS A;  3DTK A;  3ERM A;  4E7S A;  2PG4 A;  3LA2 A;  1B59 A;  2OTJ I;  3VEP A;  3BRU A;  3IC7 A;  1BI1 A;  1YW8 A;  2K9M A;  2WAF A;  4DNC A;  3HRT A;  1QRY A;  1E3H A;  4XQF A;  1ZTR A;  2COM A;  1VQL I;  2VJI A;  3KYD B;  4ICH A;  2QGU A;  1S5L C;  4EQQ A;  2LR8 A;  2DOD A;  3CCS I;  2QBY A;  3VB2 A;  4QPQ A;  3FMR A;  3ZN0 A;  2P6T A;  5GP9 A;  2A07 F;  4A3L J;  1IN4 A;  3QKX A;  3CUQ C;  2OQR A;  5E17 F;  2R7U A;  4XNF A;  5EG0 B;  4CGR A;  3KZY A;  4HX8 A;  2FSW A;  2LKX A;  3LA7 A;  1AU7 A;  1HST A;  5ICF A;  4FCY A;  4ZYG A;  2WAE A;  4J00 A;  2F48 A;  3Q0U A;  4UY8 I;  3ZMU A;  2NVQ J;  3FHN A;  4ZH4 F;  2R7R A;  3FIS A;  1HDP A;  1XCB A;  3GFM A;  4PFP A;  1LB2 A;  1VQ9 I;  3ZMT A;  2M4G A;  3EQL F;  2FQ3 A;  4KIF A;  4JK1 X;  3Q3S A;  1T2K A;  4FHT A;  3DEU A;  2DA3 A;  2Z2S B;  1YRN B;  2M4K A;  2DQL A;  3G1M A;  3M1E A;  3U2R A;  1JGG A;  1APL C;  3S17 J;  2VN2 A;  2H6B A;  2RAS A;  3FKJ A;  3E5X A;  3P9I A;  2HFH A;  3WGG A;  2XPV A;  5HOO A;  1QZZ A;  1MJB A;  5EG0 A;  1UEL B;  2KZV A;  2X6O A;  3OYJ A;  2A6H F;  4JKZ A;  1BA5 A;  2QWW A;  4MTE A;  4S05 A;  3OYN A;  2VPR A;  2LTP A;  2LY1 A;  1JI8 A;  1CF7 B;  3RCO A;  3ZQG A;  5F0F A;  2CV1 A;  5FMP A;  1QHG A;  4A3J J;  3GBG A;  2E1N A;  3BQZ A;  2HOS A;  4DZJ A;  2O9L A;  1MMA A;  3PJR A;  3SFI A;  4BBS J;  3RZO J;  1YRN A;  1BI3 A;  4EAT A;  2WC2 A;  1VQ4 I;  1B9M A;  3ERE D;  2IAI A;  5JLW A;  2HVQ A;  5GAG J;  2CSO A;  3T6N A;  1XDS A;  2DT6 A;  3KLO A;  4CH7 A;  5LD2 C;  2PQ8 A;  4MHG A;  1YW9 A;  5F1J A;  4BDY A;  3BG6 A;  2CWE A;  1OYI A;  4I6Z A;  2GXB A;  3FMQ A;  2BW3 B;  4PK4 A;  4KFC A;  5IYD J;  2GFN A;  3AL0 C;  4U88 A;  1Y0N A;  3I54 A;  4B44 A;  3BT9 A;  1U0J A;  2EIM H;  2E5N A;  5DYM A;  1CF7 A;  3CZ6 A;  3FBN B;  5HNH A;  1MMD A;  5FFZ A;  4ZYH A;  2STW A;  1RUO A;  3IH3 A;  2CGP A;  2DDB A;  3PIO F;  1IV6 A;  3AQT A;  4IHV A;  2K4J A;  1ZLJ A;  2CFO A;  1POG A;  3J7Z I;  1O4X A;  2R7F A;  3I0T A;  2EA2 A;  2L3D A;  2V1D A;  3BWG A;  3CJN A;  3JW4 A;  5H6R A;  1SMY F;  1WHU A;  2Z99 A;  4OIN F;  2WV1 A;  4RM3 A;  2XF5 A;  1WJA A;  4WIB A;  5TRD A;  2XGC A;  3L2Q A;  4X0G A;  5J6X A;  3GZ6 A;  1O3S A;  2BW3 A;  3TOB A;  3C7J A;  4XID A;  4BAY A;  1FSE A;  2CQK A;  1BR1 A;  4JOM A;  2P5L C;  1TWA J;  2RKH A;  2QVO A;  2B1E A;  2XV4 S;  1GVD A;  2LMD A;  5DD4 A;  4EVI A;  4XLH A;  4UNO A;  4EJV A;  4OU0 A;  5E1Z B;  2GXG A;  2KIU A;  3E6C C;  1OR7 C;  2VQL A;  3K70 D;  2IBD A;  3RQ4 A;  3UNG C;  4UUS B;  2XUB A;  2Y0S A;  4Y17 A;  3N4M A;  2DW4 A;  2OAZ A;  1O3T A;  1MMS A;  3K4K A;  5D5V B;  5K5Q A;  1RR8 C;  1ETO A;  3MZY A;  5F0C A;  1FMW A;  4IRI A;  3WHC A;  2QWT A;  2LDU A;  3A01 A;  2RNJ A;  4IVN A;  4Y13 A;  5L3B A;  4UV9 A;  1V3F A;  3KP3 A;  4IXA A;  1LVA A;  5C3E J;  1ZRC A;  1D1A A;  4G7H F;  3VTI A;  2IVM A;  4MFD A;  4PCQ A;  5DTD A;  2EIK H;  2TRT A;  3C2G A;  2VQH A;  1FOX A;  1ZQ3 P;  3JRE A;  1WJ5 A;  3RKQ A;  3C1D A;  5F6F A;  1D5V A;  3AFH A;  4RLF A;  3BOQ A;  2HKU A;  1R36 A;  3CDL A;  4CCJ A;  3LHQ A;  2JRM A;  2HZD A;  2LSO A;  3T5X A;  4F91 B;  4A93 J;  1QO0 D;  4L9J A;  4UB8 C;  1R23 A;  1Y1W J;  3CMA I;  5C4Y A;  2WY7 Q;  1SC7 A;  4RAG A;  1IN6 A;  2QUF A;  3GEZ A;  2CW8 A;  2AS5 F;  5K7H A;  3SDB A;  4RMN A;  3KYL A;  1XB4 A;  3FK7 A;  2JJ7 A;  2PMH A;  4F7Z A;  5J40 A;  4S04 A;  3V8L A;  5FHP A;  1KON A;  2RNG A;  3WGI A;  2DPD A;  5GAE J;  1ZG5 A;  4OOI A;  2R7Q A;  3JRD A;  2E2H J;  1LFP A;  3GX4 X;  2XIG A;  3VYU B;  1X1B A;  3FM3 A;  2VBZ A;  5FLX Z;  2PJP A;  1TQP A;  2X6Y A;  2ZNZ A;  1SFO J;  1ETX A;  1FBQ A;  3TQN A;  3BRO A;  3K2Z A;  2UV1 A;  4IOC F;  2LRD A;  3ZMD A;  2JA8 J;  3C3W A;  3CC4 I;  3PNT A;  3GW2 A;  1LFU P;  5FKO A;  1ZKG A;  5M5W J;  3O8H A;  1WZ2 A;  5BNG A;  4BL0 B;  3S2H J;  2QQ9 A;  3WTV C;  3I4M J;  2LY2 A;  4MGR A;  2QKM B;  2FUG 2;  4RAY A;  1FWZ A;  2M1B A;  3HRM A;  3QOP A;  3VOE A;  1UAA A;  3DF8 A;  2K40 A;  3Q9S A;  2E2J J;  2H09 A;  1HSJ A;  3IWZ A;  1I6H J;  1B9N A;  4MTD A;  4G8X A;  4PFO A;  3TKY A;  5F04 A;  2EZH A;  2JK3 A;  2V1N A;  5HDK A;  2X1D A;  4MQV A;  4EM2 A;  3FWE A;  2DT7 B;  1K78 B;  2Y9Y A;  3CC7 I;  4BQO A;  5FJ8 J;  1EV7 A;  3L2R A;  1PUE E;  3LMM A;  4GCT A;  3EYY A;  1TZL A;  4PUS A;  1YIO A;  2OJE D;  2L7K A;  4FE7 A;  1V55 H;  2OER A;  1WH7 A;  2FBH A;  2ZOZ A;  1KGS A;  3AG4 H;  4FAS D;  3QPT A;  2VBX A;  5H20 A;  4M3E A;  3K1P A;  3KEY A;  2QEN A;  1S72 I;  1U8B A;  2Y48 A;  4AD9 A;  3ON4 A;  1WQ2 A;  1BR4 A;  4A0Y A;  2OBP A;  1K4S A;  2GUH A;  2NVX J;  1QQI A;  3M8E A;  1ZR4 A;  1JXS A;  2PLY A;  2ESH A;  3GTL J;  1NK2 P;  4BY7 J;  3LNQ A;  3DPT A;  4I7H A;  5BPI A;  1IJW C;  4L62 A;  2JPB A;  4XL9 A;  2NX4 A;  4IHS A;  3E7L A;  1I50 J;  1QPM A;  2EPF A;  3AG1 H;  1MMN A;  4IZZ A;  3HOV J;  3S1M J;  1JKO C;  1JKQ C;  4L0Z B;  3RDI A;  3U1K A;  3H0G J;  4M71 A;  2ZBK A;  1XSV A;  3EGQ A;  4CO8 A;  4F92 B;  2E1C A;  3L1P A;  3KEO A;  3R0A A;  3F8N A;  4ON0 A;  5GPC A;  4J19 A;  3GME A;  3BC8 A;  4HST A;  4IF4 A;  1X4O A;  4J01 A;  1HKQ A;  2VQC A;  2HZT A;  4OIR F;  3F8M A;  1GHC A;  3GUD A;  1BL0 A;  2D45 A;  2JA5 J;  3RTR A;  1ACI A;  1I39 A;  1AOY A;  2Z5U A;  1SFK A;  2DA5 A;  4A6D A;  3H5N A;  2I10 A;  3M3Y J;  2O7T A;  3JRG A;  3HOZ J;  3BG3 A;  1WGX A;  2YS9 A;  3JTG A;  2CV2 A;  3RYR A;  3JSO A;  4KWA A;  4E7Z A;  5HOD A;  2X1E A;  1YS7 A;  3H3Z A;  3WE3 A;  1C0W A;  3GTO J;  2KJB A;  2V57 A;  1L3L A;  4L0Y B;  2DOE A;  2F4I A;  4C9Y A;  3OOU A;  2HQN A;  2W84 A;  2HR3 A;  4JBA A;  2BE5 F;  5E18 F;  1Q1V A;  2VB6 A;  4I98 B;  5CJ9 A;  5D4R A;  2OTL I;  4U0V A;  2IU5 A;  1PP7 U;  4GCL A;  2Q8K A;  1RRJ A;  3CF5 F;  3WU2 C;  2R3S A;  1CQT A;  1MBG A;  4EGZ A;  2VL8 A;  1SMT A;  3D0S A;  2ISY A;  1BJZ A;  2EJR A;  1FTZ A;  3WHB A;  3I3L A;  1K83 J;  5ILU A;  3I4N J;  1FLI A;  5D18 A;  1ETW A;  3I5U A;  1U78 A;  3FXJ A;  5F27 A;  3Q5F A;  4ACI A;  4IEJ A;  5CVR A;  1D3Y A;  2ZSI B;  3DTI A;  1D0Y A;  3HOU J;  3QOE A;  1MW7 A;  2VXD A;  3GO5 A;  3FXO A;  3A02 A;  5F64 A;  2IA0 A;  2LG4 A;  1TBX A;  2JUC A;  3DCF A;  2IGK A;  2PJR B;  3HGY A;  4IOA F;  3MQ0 A;  1QBJ A;  1IN8 A;  4IHT A;  1ULY A;  1JUM A;  1P9Q C;  5J47 A;  1DP3 A;  2ZCM A;  4M6X A;  4Y52 J;  1VQ7 I;  4UXN A;  2Y69 H;  1X2M A;  1P92 A;  3IKT A;  3N05 A;  1HW2 A;  3WOD F;  1R5H A;  2IJL A;  3BG5 A;  3GFI A;  3M7G A;  3G1L A;  2F07 A;  1RKW A;  3FKI J;  1OJL A;  4U0Y A;  2F2E A;  4O3M A;  2R7V A;  3KLN A;  1BOA A;  1Z6T A;  2KIS A;  2L2O A;  4KIG A;  4RAZ A;  2D1V A;  2G7H A;  2IA2 A;  3D5R C;  2ZXW H;  5J8F A;  2LP0 A;  4N0B A;  1S7O A;  3F6V A;  2FRH A;  4NNJ A;  1BN5 A;  3O3K A;  2PJR A;  1EJ9 A;  3H36 A;  1TNS A;  1UMQ A;  2F5C A;  4DW6 A;  2J5P A;  2ZKZ A;  4NUB A;  3ASO H;  3RPQ A;  2ZJQ F;  4QWQ A;  1ZRE A;  2Y0S N;  3H35 A;  3JAM K;  2ZSH B;  4QIW N;  3ZQ7 A;  2I8D A;  2QQB A;  1D0Z A;  1YQA A;  1N77 A;  1TTY A;  2F4O B;  4XRF A;  1OQY A;  4XSX F;  3CCU I;  1G6N A;  3L2V A;  2Y0M A;  2UZK A;  4BUP A;  1YTY A;  4C3J J;  3SHF A;  5IP9 J;  3JR9 A;  1FY7 A;  3EYI A;  5IT9 Z;  3VP5 A;  3OYD A;  4XLE A;  3VSL A;  2ZC2 A;  2R5Z B;  1A35 A;  3T1B A;  4A3K J;  2L5Q A;  3CF2 A;  2EH3 A;  4LK1 F;  3FXR A;  5E3N A;  1RR7 A;  4IQ4 A;  1U5T B;  4E70 A;  4CGZ A;  3K4J A;  1YFH A;  1W7P D;  1GLN A;  3J80 K;  2F4M B;  4XM3 A;  4HBL A;  3VSK A;  4B09 A;  3CD6 I;  1IRG A;  3I56 I;  1AKH B;  1U6G A;  1FBU A;  3BZK A;  1ZYR F;  3SZP A;  3H5R A;  3LSG A;  4N4O B;  3RYP A;  5LHH A;  1UST A;  5D19 A;  1TWF J;  3BZC A;  2A2F X;  1Y56 A;  3HM5 A;  2BHZ A;  2HPM A;  2UXU A;  2BVM A;  3TO9 A;  2UXO A;  2W00 A;  2NXN B;  2VI6 A;  2F5D A;  3ML6 A;  5DUK A;  2W82 A;  2E35 A;  3OSG A;  3GTJ J;  3OYA A;  2EWN A;  2Q2E B;  2R5Z A;  2A5W A;  3DU5 A;  1U2W A;  3ZQF A;  5J1Y A;  2GIV A;  2RAE A;  3KP7 A;  4HF0 A;  1U5T A;  3L7W A;  1BIA A;  2NP5 A;  5JVG F;  3BJ6 A;  3H1C A;  1BM9 A;  4O5V A;  2ADU A;  1AKH A;  2D2W A;  3ZOB A;  4O6J A;  1G3W A;  2ZJP F;  2BGC A;  1NH3 A;  4EJW A;  4L5I A;  1X1C A;  2CH0 A;  1ETQ A;  1R58 A;  3OR1 C;  3P7N A;  3K6G A;  3JRF A;  5M5X J;  2CQ7 A;  4M9S A;  3KKD A;  4W97 A;  3PNV A;  3PNY A;  5K7Z A;  5JVT A;  1B8I B;  1MJA A;  2Q2E A;  1PDN C;  3Q0V A;  3NWT A;  1Z67 A;  1B6A A;  2HU9 A;  4LLN A;  4AWX B;  5D1R A;  1A36 A;  6PAX A;  3WU1 B;  2Z1D A;  4CZZ A;  1HA8 A;  1QU3 A;  5EEG A;  2XRN A;  3M4O J;  2QLZ A;  2FML A;  2DFE A;  4CZC A;  2KDZ A;  2GXA A;  3K8P C;  2EFP A;  5J1R A;  2AQE A;  4EV0 A;  2XPU A;  2HOA A;  3GZN B;  3RKX A;  3RD3 A;  2O0Y A;  1VQ6 I;  2IXS A;  3GTM J;  4CYD A;  5IP6 A;  2DTZ A;  1T38 A;  1OIS A;  3H9J A;  3S32 A;  2R7T A;  3KNW A;  2L7M P;  2XRO A;  2XGX A;  2EFN A;  2DTR A;  3U1D A;  3K10 A;  2CFX A;  1T98 A;  5B1B H;  3ZGK A;  5ICG A;  2FQ4 A;  3BHQ A;  3BJA A;  2R7W A;  1FMV A;  3NPI A;  1TP4 A;  2JVG A;  4KYW A;  5BS6 A;  4RBO A;  1XG1 A;  4ANJ A;  5IP7 J;  2ZO4 A;  1W5T A;  2DMT A;  3WTX C;  3NI7 A;  1EH8 A;  1LEA A;  1H88 C;  4FTH A;  2W48 A;  5DEQ A;  1H8A C;  4OIQ F;  2Y75 A;  2E71 A;  2FNA A;  3EUP A;  2NNN A;  1LPQ A;  1DPU A;  2FOW A;  5FKM A;  1BC7 C;  3TO6 A;  4KN4 X;  2KP6 A;  1PJR A;  5KVR A;  4E7L A;  2EZK A;  1OYW A;  5LRR A;  2CJJ A;  2QQ8 A;  4LG3 A;  4GO1 A;  2X6W A;  3BR0 A;  4TV7 A;  2O61 A;  4YIR X;  4HLX A;  4GGG A;  1S8N A;  4LIU A;  2LVS A;  4KUM A;  1JHH A;  1OCR H;  1FSH A;  2M2E A;  4XKW A;  3MD2 A;  4GFK A;  1X3W B;  3MAJ A;  3HPH A;  4FIS A;  3S1N J;  2K9N A;  1P7I A;  4JX5 A;  2LBF B;  4G6D A;  3DPJ A;  1JE8 A;  2KKO A;  3KX2 A;  5FKL A;  1SD5 A;  4V2G A;  1D0X A;  2K4B A;  4JP0 A;  5FGL A;  1J5Y A;  1N25 A;  1XCV A;  2P0W A;  2ETH A;  3LSR A;  3EUH A;  1Z9C A;  3KP6 A;  3CLQ A;  4FX0 A;  1KQ9 A;  4HQE A;  1OCP A;  3V7R A;  1I5Z A;  4DJA A;  3MWM A;  2WV0 A;  4G9Y A;  3CWR A;  1ON1 A;  1NHA A;  2P5V A;  1YJ9 I;  3M8F A;  3LQQ A;  3VWB A;  2G3B A;  2CUJ A;  3S3N A;  2EIL H;  1K7A A;  2W4S A;  3T0Y A;  3BPV A;  5BQT A;  1WVR A;  1ERD A;  2FBI A;  2LBF A;  2EA4 A;  3R61 A;  1KU7 A;  2V6C A;  2FF4 A;  3I59 B;  4A5M A;  2VON A;  4NQW B;  1HLV A;  3FMS A;  3MKW B;  3C18 A;  5DM6 F;  2XSJ C;  2HQR A;  1QPI A;  1ODD A;  3SDG A;  3TW7 A;  3CDH A;  5FO5 A;  3QP6 A;  2GQQ A;  4C3H J;  1WRJ A;  1E3P A;  4HX7 A;  4ESJ A;  5E79 C;  2CG4 A;  2R92 J;  3DU6 A;  2KQR A;  1V5G A;  1F4K A;  5IY5 H;  2VJ5 A;  2ZME B;  5CW8 A;  4Z2Y A;  3HIF A;  3KZZ A;  4BJ5 C;  4XRM A;  2XAF A;  1UFM A;  3S16 J;  3TBI A;  4C2M J;  1Z91 A;  4XK4 A;  1A31 A;  1FNN A;  3I59 A;  1ZAO A;  4ASN A;  5JR3 A;  3DBL B;  4NQW A;  1TNT A;  4N9I A;  1QNT A;  2COB A;  4HF2 A;  2DJN A;  3OIQ A;  5CQE A;  4RB3 C;  1H9G A;  2W7N A;  4KN7 X;  2REK A;  4AIJ A;  4C2U A;  1FPQ A;  2VKV A;  3MCZ A;  4BHB A;  4IRV A;  2YU3 A;  2ZME A;  3BR5 A;  4HEA 2;  3L2C A;  4P96 A;  2ZJR F;  4IO9 F;  4LB5 A;  3VPR A;  4UVA A;  5CVI A;  2O6G E;  1HW1 A;  2HYJ A;  5KHD A;  1A6I A;  2IPQ X;  5DS9 A;  2IT0 A;  1P4X A;  4F3Q A;  4HPQ A;  2JSP A;  1T95 A;  1IRF A;  1EH7 A;  3IKV A;  1YO5 C;  3KYC B;  4E7H A;  4AF5 A;  2AQF A;  5LGU A;  2DMQ A;  1X58 A;  2XAS A;  3A0H C;  2CW0 F;  1XX5 A;  1YIJ I;  5D5W B;  4MEY F;  2QYO A;  3JSP A;  1XMX A;  5FD6 A;  2F5F A;  1ZG1 A;  2MC4 A;  1H0M A;  4HSR A;  1A5J A;  1OCT C;  2NVT J;  3VYS B;  1MSE C;  3CRJ A;  1HDD C;  1I1G A;  4CCM A;  1XMA A;  2VT3 A;  3FZV A;  3ABM H;  2XKP A;  1SFX A;  1YE9 A;  3CLO A;  1Z7U A;  1J09 A;  2FEZ A;  3OV8 A;  3F1B A;  5L3G A; 
#chains in the Genus database with same CATH homology
 3A03 A;  4CYC A;  3BR3 A;  2Y9Y A;  1JT0 A;  3BR6 A;  5FJ8 J;  4GCT A;  3NRG A;  1QVT A;  5FLM J;  2ECB A;  2ME0 A;  3UKG A;  2LFB A;  4ABZ A;  2GEN A;  4JL3 A;  4FE7 A;  5FLV A;  4GFB A;  2G7S A;  3KKC A;  2DA6 A;  1TC3 C;  1WH7 A;  5M5Y J;  2ECC A;  2GM4 A;  2OER A;  2ZOZ A;  3NNR A;  4X1E A;  2R5Y A;  2QIB A;  4IHY A;  1FIP A;  3MN2 A;  4M3E A;  2Q24 A;  1PUF B;  1U8B A;  3ON4 A;  4C3I J;  3BQY A;  3A01 B;  2CQX A;  2Y31 A;  4QTR A;  1BW5 A;  3O8G A;  3TP3 A;  2JN6 A;  3BTC A;  2WGB A;  1U9O A;  2GUH A;  3QQA A;  2NVX J;  2DMU A;  2L9R A;  1ZR4 A;  5AQC A;  3GTL J;  2ZB9 A;  3HIM A;  1NK2 P;  4BY7 J;  3LNQ A;  1IJW C;  1K61 A;  3LSJ A;  2B63 J;  3P9T A;  4HKU A;  3C2B A;  2DG8 A;  4YZE A;  3VOK A;  4PXI A;  2NX4 A;  2WAQ N;  3E7L A;  1I50 J;  5IOZ A;  2DA4 A;  5EFY A;  3HOV J;  3S1M J;  4A3G J;  3HEF A;  1JKO C;  1JKQ C;  2QTQ A;  5EF6 A;  3H0G J;  2CRG A;  1HOM A;  1VND A;  3HOX J;  2JMW A;  3EGQ A;  1X2N A;  1ZR2 A;  2D5V A;  1RES A;  3GTP J;  2M9H A;  3L1P A;  1IUF A;  3ANG A;  1FIA A;  1JUP A;  3B6A A;  2ME6 A;  3VOX A;  3VVX A;  5GPC A;  4J19 A;  4BXX J;  4D5F A;  2UXP A;  4V2F A;  1PUF A;  2ELK A;  3BJB A;  4BBR J;  4AC0 A;  1BL0 A;  3O60 A;  3IH2 A;  2JA5 J;  1JKP C;  3BTJ A;  2DA5 A;  3M3Y J;  1VI0 A;  2I10 A;  3JRH A;  2O7T A;  4B4C A;  3JRG A;  3RZD J;  1T56 A;  3HOZ J;  1ITY A;  3BG3 A;  1WGX A;  2YS9 A;  3HOW J;  2OI8 A;  1GUU A;  2D6Y A;  1WCM J;  1ENH A;  4M3F A;  3PO2 J;  1WI3 A;  4KWA A;  3JRI A;  4Y7N J;  5HOD A;  3HDD A;  5F0H A;  1Y1V J;  4DYR A;  3BTL A;  3DEW A;  1WH5 A;  4A3F J;  3GTO J;  4B3A A;  2V57 A;  1UI5 A;  1JKR C;  4A3D J;  3OOU A;  5CXI A;  3ZQC A;  3IUV A;  2QKO A;  1Q1V A;  3G7R A;  3H3V K;  2IU5 A;  1DU0 A;  1MBF A;  4GCL A;  4MXM A;  2UXH A;  2P81 A;  2N8G A;  1MBG A;  1CQT A;  2XSD C;  2Y30 A;  1BW6 A;  4QSH A;  5EDN A;  2DG7 A;  4M6V A;  4M3G A;  1BJZ A;  1FTZ A;  3WHB A;  1EF4 A;  1K83 J;  5EZH A;  5J1U A;  3I4N J;  2M34 A;  2R7Z J;  1ETW A;  5D18 A;  5EGO B;  1U78 A;  5F27 A;  4A3B J;  4ACI A;  3IH4 A;  1E3O C;  3LWJ A;  4IEJ A;  3GTG J;  1TWH J;  3KZ9 A;  2FD5 A;  3HOU J;  3MNL A;  3QBM A;  3A02 A;  3HTJ A;  4A3M J;  2JA6 J;  4M3D A;  3DCF A;  3HOY J;  4NEL A;  1GV2 A;  3HGY A;  2TCT A;  5GPA A;  1JUM A;  2ZOY A;  3V6G A;  2IEK A;  3C07 A;  2ZCM A;  5IPA A;  4Y52 J;  2HXI A;  2ZCX A;  2HXO A;  1X2M A;  2EBI A;  1B8I A;  3VIB A;  3BG5 A;  5C4X J;  2PZ9 A;  3G1L A;  2F07 A;  5HAW A;  1RKW A;  3FKI J;  1OJL A;  2VUM J;  5EGO A;  2K9Q A;  2OF7 A;  1XS9 A;  2XRL A;  4B1R A;  3JRC A;  1UI6 A;  3QPL A;  2NOG A;  3IV5 A;  4BY1 J;  3GTK J;  2LP0 A;  2LLK A;  3HBL A;  3GTQ J;  3BTI A;  2HI3 A;  2HDD A;  1JT6 A;  2MW8 A;  4HNV A;  1UMQ A;  5EZG A;  4MO7 A;  4XIC A;  1IGN A;  2XGD A;  3HTI A;  2AHQ A;  4DW6 A;  4RDU A;  3JSJ A;  2Y0S N;  2XB5 A;  3CMY A;  3PPB A;  4QIW N;  1IDY A;  2L7F P;  5K58 A;  1S7E A;  1HCR A;  4X6A J;  4UUT A;  5M3M J;  2K9S A;  1JUS A;  5IOY A;  2CUE A;  4DZP A;  2O7O A;  3VUQ A;  2QCO A;  4EEF G;  3Q0W A;  1ZK8 A;  4C3J J;  5IP9 J;  3JR9 A;  3VP5 A;  4MFE A;  1IG7 A;  3HTA A;  2R5Z B;  3PO3 J;  3D1N I;  4A3K J;  1WPK A;  2W53 A;  2EH3 A;  5E3N A;  1RR7 A;  2JA7 J;  1F36 A;  1D5Y A;  2PMZ N;  3ANP A;  2NVY J;  1NTC A;  1FJL A;  2YU9 J;  5H9T A;  1AKH B;  1HF0 A;  4GFL A;  1IC8 A;  3LSG A;  2DA1 A;  2XB0 X;  3FK6 A;  1JTY A;  3PM1 A;  5E3M A;  1SGM A;  5D19 A;  2GLO A;  1TWF J;  3CQZ J;  2E1O A;  2MGQ A;  4XRS G;  3HM5 A;  2UXU A;  1ETY A;  2UXO A;  3RH2 A;  1UG2 A;  2VI6 A;  4JYK A;  3NXC A;  3MVP A;  2XGE A;  3VW1 A;  3OSG A;  3GTJ J;  3JRB A;  3S5R A;  4D5C A;  2R5Z A;  3ZQF A;  5J1Y A;  2LY9 A;  2G0E A;  2RAE A;  4A3I J;  3BRU A;  1MH3 A;  3BG9 A;  1QRY A;  1ZTR A;  2NP5 A;  1LFB A;  4D7M A;  4ICH A;  1AKH A;  2E19 A;  3VVZ A;  2LR8 A;  3ZOB A;  2EZL A;  5GP9 A;  2M8G X;  1P7J A;  3B81 A;  4A3L J;  1ETQ A;  3QKX A;  3JRF A;  1MBE A;  3QPS A;  5DAJ A;  3NAU A;  4AUX A;  5M5X J;  5EG0 B;  1VF9 A;  5C44 J;  4CGR A;  4BKX A;  3KKD A;  1UHS A;  2G7G A;  5IYC J;  1Z77 A;  3OIO A;  4W97 A;  2LKX A;  1AU7 A;  2QF7 A;  3FRQ A;  1JJ6 C;  1LE8 B;  1GV5 A;  5K7Z A;  4FCY A;  1B8I B;  2WUI A;  3Q0U A;  1G2H A;  3Q0V A;  2NP3 A;  2NVQ J;  5J3L A;  4UUS A;  2L7Z A;  3FIS A;  4IHW A;  1HDP A;  1U9N A;  5D1R A;  3BR2 A;  3F0C A;  3Q3S A;  4MLO A;  3TP0 A;  1JJ8 C;  4I76 A;  2DA3 A;  2AO9 A;  1B72 B;  1YRN B;  2DN0 A;  2XPW A;  3S1Q J;  2NS8 A;  5E3O A;  1H89 C;  5CXG A;  3G1M A;  3S17 J;  1JGG A;  1APL C;  1F43 A;  2CUF A;  3M4O J;  2RAS A;  1NK3 P;  2UXI A;  4ME9 A;  1MBH A;  2XPV A;  3CCY A;  2KDZ A;  2O8K A;  5J1R A;  2WB1 N;  5EG0 A;  5EYR A;  2XPU A;  2HOA A;  3RD3 A;  2X6O A;  4JKZ A;  2DMN A;  1LE8 A;  3GTM J;  2LK2 A;  1BA5 A;  3B6C A;  2VKE A;  2NS7 A;  5IP6 A;  2DTZ A;  1R9T J;  2VPR A;  3KNW A;  2LTP A;  5HSZ A;  4DYC A;  2CU7 A;  5F0F A;  2L7M P;  3ZQG A;  4L62 A;  5FMP A;  4JNN A;  4A3J J;  3GBG A;  3BQZ A;  2O9L A;  2HOS A;  4DZJ A;  3VW2 A;  1ZGW A;  9ANT A;  2FQ4 A;  3SFI A;  4BBS J;  3RZO J;  1B72 A;  1YRN A;  3BHQ A;  3JRA A;  3NPI A;  2IAI A;  5F08 A;  1I3Q J;  5JLW A;  1RET A;  3GEU A;  3T6N A;  4NDL A;  1MBK A;  4RBO A;  1XG1 A;  2Y9Z A;  3S1R J;  5IP7 J;  5F1J A;  2FJ1 A;  2DMT A;  3LJL A;  5FKN A;  2KT0 A;  2GBY A;  4I6Z A;  1W0T A;  4JX6 A;  2HOT A;  3NI7 A;  1H88 C;  5IYD J;  2GFN A;  4FTH A;  2W48 A;  3G56 A;  1DU6 A;  3COL A;  2YVH A;  5IYB J;  1H8A C;  3FIW A;  1FEX A;  3BT9 A;  2CQQ A;  2JWT A;  3EUP A;  3TW6 A;  5FKM A;  3V78 A;  2EZI A;  3IH3 A;  1TWC J;  4XRS A;  2EZK A;  1IV6 A;  3AQT A;  4IHV A;  2CJJ A;  5K7F A;  1POG A;  3BR0 A;  3VW0 A;  3LSP A;  1O4X A;  1VFC A;  2LVS A;  3HE0 A;  1RKT A;  2L0K A;  2WV1 A;  2M2E A;  2FX0 A;  3GZI A;  4GFK A;  4GCK A;  4FIS A;  2XGC A;  4A3E J;  4DYQ A;  2K9N A;  3S1N J;  1P7I A;  4JX5 A;  1XC5 A;  3DPJ A;  3VVY A;  5FKK A;  5FKL A;  4XID A;  1ETK A;  4V2G A;  2ID3 A;  1TWA J;  3TED A;  4JP0 A;  5FGL A;  1GVD A;  1T33 A;  1FTT A;  1IRZ A;  5JLX A;  4MK6 A;  4NN1 A;  3LSR A;  4AYB N;  2R93 J;  3NAR A;  2ZCN A;  1OCP A;  3K2A A;  5HBU A;  3BNI A;  2IBD A;  3HB9 A;  4UUS B;  3OSF A;  3CWR A;  5EEA A;  2DMP A;  4L5E A;  4MIM A;  2G3B A;  3BCG A;  3HTH A;  1ETO A;  2HQ5 A;  3PAS A;  1GT0 C;  4A69 C;  5F0C A;  1JTX A;  1SAN A;  2DA7 A;  3WHC A;  2R0Q C;  2QWT A;  3BR1 A;  3SJM A;  3A01 A;  2LD5 A;  2Y2Z A;  2FBQ A;  2PBX A;  1HLV A;  2E2I J;  2EQR A;  5C4J J;  5C3E J;  3W6V A;  3G1O A;  1QPI A;  3S14 J;  3SDG A;  2M0C A;  1ETV A;  1QVU A;  4MFD A;  3TW7 A;  1W0U A;  2H8R A;  4FE4 A;  1IDZ A;  5DTD A;  2TRT A;  2HYT A;  4C3H J;  1ORK A;  1ZQ3 P;  3ZQI A;  3JRE A;  2MG4 A;  3RKQ A;  3K7A J;  2R92 J;  3CJD A;  2XDN A;  2HKU A;  3CDL A;  5CW8 A;  3LHQ A;  4A93 J;  4IHX A;  1Y1W J;  5C4Y A;  3LOC A;  4XRM A;  3S16 J;  1OFC X;  3ZQL A;  4M3B A;  4LOC A;  4C2M J;  5K7H A;  2H1K A;  4XK4 A;  2X9D A;  3FK7 A;  1Z0X A;  2JJ7 A;  2RHA A;  2MSY A;  5FHP A;  2COB A;  2DJN A;  2OPT A;  3JRD A;  2E2H J;  2REK A;  1MSF C;  2VKV A;  1AHD P;  2YVE A;  1SFO J;  1ETX A;  3HGG A;  3BR5 A;  2YUS A;  3S15 J;  3VPR A;  3S2D J;  3E7Q A;  4CYC B;  2HYJ A;  2JA8 J;  1A6I A;  4A3C J;  5DS9 A;  1LFU P;  3RQI A;  5FKO A;  1ZKG A;  5M5W J;  3O8H A;  2X48 A;  3S2H J;  5BNG A;  4AF5 A;  1MBJ A;  3ON2 A;  4UDS A;  2DMQ A;  1X58 A;  1MNM C;  2ID6 A;  3MKL A;  3I4M J;  1MH4 A;  2G7L A;  4W1U A;  2R5Y B;  4S0H B;  2DA2 A;  4G12 A;  3HKZ N;  1A5J A;  1OCT C;  4JX4 A;  2K40 A;  1MSE C;  2NVT J;  3CRJ A;  2E2J J;  1HDD C;  1GDT A;  5E3L A;  1I6H J;  1RPW A;  4AC6 A;  3ZQH A;  5F04 A;  1TWG J;  5M3F J;  2EZH A;  2JK3 A;  4D7N A;  3F1B A;  3AQS A;  2QOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...