3BTLA

Crystal structure of qacr(e58q) bound to malachite green
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 73
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btlA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btlA02
3V78A 2DJNA 5IYBJ 1GV2A 5JLWA 2XSDC 4G12A 5DAJA 5E3NA 3GTOJ 4M3DA 3HGYA 2DA6A 1UMQA 5EDNA 4JKZA 4W97A 3HDDA 4CGRA 4GFLA 3BT9A 3BG3A 3AQTA 1FTZA 1I3QJ 2L7MP 1B8IA 2LVSA 2H1KA 3Q3SA 2O8KA 1CQTA 3TP0A 5J1YA 1IG7A 5E3OA 2XDNA 3ON2A 3RD3A 4M3GA 5FKLA 3LSJA 2L7ZA 4AUXA 1F36A 5CW8A 1ZTRA 2OPTA 3B6CA 5EEAA 5FLVA 3JSJA 2GLOA 5F0CA 1GUUA 2QCOA 3BTLA 2X9DA 1HLVA 4UDSA 2EQRA 3OIOA 3WHCA 1ETOA 3BR6A 3JRFA 5FGLA 2XGCA 1PUFB 4AF5A 4IHXA 3TW6A 5HAWA 5IYCJ 5D19A 1HCRA 2FX0A 3HBLA 1JJ6C 5J1UA 2CRGA 1U9NA 5GPCA 1OJLA 2RASA 3G56A 3HTIA 2REKA 4DYCA 2CUEA 3S17J 2JA7J 1Y1VJ 3B6AA 3EGQA 4I6ZA 2HDDA 2LFBA 2O7OA 4DYQA 1X58A 5IOZA 3TW7A 4A3KJ 3C2BA 2JJ7A 1AKHB 3HTJA 4JYKA 2ZOZA 3RZOJ 2KDZA 3UKGA 2R5ZA 3K7AJ 1JKQC 3BTIA 2WUIA 5M5XJ 3IUVA 2EZIA 2LY9A 3LSGA 2XB0X 4GFKA 2IBDA 2NX4A 4V2FA 3ZQIA 2M2EA 1MBEA 2NS8A 4A3JJ 4B3AA 1W0UA 4JNNA 2GM4A 2LK2A 1GVDA 3JRGA 3S1MJ 2VPRA 2XPUA 2QF7A 1HDDC 5J1RA 2KT0A 3HOXJ 5F08A 2ECBA 1OFCX 3RH2A 1NTCA 2PZ9A 2AO9A 3MN2A 3VVZA 3CCYA 3GTMJ 1MBFA 4NN1A 3IV5A 1Z0XA 4MIMA 1QVUA 3NAUA 1BW6A 1JUPA 4I76A 3H0GJ 1HDPA 5BNGA 3HB9A 5M5YJ 5IYDJ 1IJWC 2R93J 2R5YB 5M3FJ 1MBKA 1P7JA 3FIWA 3GTJJ 2K9QA 2WGBA 3BR3A 5EZHA 3V6GA 1WH7A 3Q0WA 3MVPA 3RKQA 1LE8B 3E7QA 4JL3A 4A3GJ 3BR2A 4ACIA 2D6YA 3BRUA 3G1LA 3HTAA 4IEJA 4B4CA 3BR1A 3P9TA 5DS9A 2D5VA 2VI6A 1T56A 1ZGWA 3HOVJ 4FISA 3GBGA 3VVYA 4EEFG 2I10A 1MSEC 2NP5A 4A3IJ 5C4XJ 1SGMA 2UXIA 1BJZA 1O4XA 2ZOYA 2ECCA 3MNLA 3DCFA 3TP3A 2DG8A 1LFUP 4A3BJ 4BY1J 1SFOJ 1UI5A 2OERA 1W0TA 4KWAA 3FK6A 4AYBN 2CU7A 4Y7NJ 2MG4A 3S5RA 2GBYA 1ZQ3P 2ZCMA 1IV6A 1PUFA 3PPBA 1K83J 3RZDJ 2YS9A 5HSZA 3LNQA 2YUSA 1A6IA 1RKTA 3HOWJ 4HKUA 2ID6A 2JN6A 4AC0A 5F1JA 5FKNA 2R0QC 2NVXJ 1JJ8C 4AC6A 1ETVA 3QQAA 1MH4A 3ANGA 1MH3A 2XRLA 3ANPA 5FHPA 3HKZN 5FKOA 1UI6A 4PXIA 1Q1VA 1UG2A 1ETQA 2XPWA 3BR0A 2GUHA 5M3MJ 2O9LA 1JKRC 4L5EA 2WV1A 3VW0A 4L62A 3K2AA 3VVXA 1GT0C 1WCMJ 1FTTA 2E19A 1QPIA 2MGQA 1ZKGA 2LTPA 3HOYJ 1IDZA 2LLKA 1JT6A 1RPWA 3HTHA 3SDGA 4BBRJ 2M8GX 2P81A 3BTJA 4QTRA 5H9TA 3PO2J 5EZGA 1I6HJ 2JA8J 4IHVA 3VUQA 4V2GA 2IU5A 3IH3A 1RKWA 2VUMJ 2COBA 2H8RA 4D7MA 1XC5A 3E7LA 4UUTA 3KKDA 5E3MA 2UXPA 3LSPA 2HI3A 1POGA 3VPRA 2L7FP 4JX6A 3ZQFA 4XRMA 3I4NJ 2L0KA 1U78A 2DMPA 3PM1A 4M3EA 5JLXA 2R92J 1X2MA 3F1BA 2DMUA 4ME9A 1ENHA 5C4YA 2R5YA 1VI0A 4DZJA 4A3DJ 3JRDA 1MBGA 2WB1N 4B1RA 1S7EA 2JK3A 3IH2A 3NRGA 3VOKA 3S1NJ 3B81A 1LE8A 4MK6A 2N8GA 4UUSB 2HOSA 1RESA 1APLC 1RETA 5EG0B 3H3VK 4BBSJ 3AQSA 2NVYJ 1WH5A 2IEKA 4XICA 1U9OA 5EF6A 4HNVA 2TCTA 4NDLA 2M0CA 4ABZA 5FKKA 5FLMJ 2Y0SN 2G7LA 3JRIA 3NI7A 1FJLA 4XIDA 1B72B 2NVQJ 2JMWA 2NP3A 2CJJA 1Z77A 4S0HB 4ICHA 3FK7A 5DTDA 1Y1WJ 3HIMA 3BTCA 1H88C 3HOZJ 4FE4A 2NOGA 4DW6A 1WI3A 2DMNA 5M5WJ 2CQQA 4MLOA 2MSYA 1BW5A 3ZQGA 4X6AJ 1E3OC 5F0HA 1ZR2A 4JX5A 2HYTA 4CYCB 2G0EA 3Q0VA 3DEWA 4DYRA 3LOCA 4YZEA 1ETYA 1MSFC 1G2HA 1I50J 1IC8A 3CMYA 4C3JJ 3CQZJ 2G7GA 1VF9A 3GTKJ 4LOCA 3BQYA 2Y2ZA 2ZB9A 3C07A 3NXCA 3GEUA 2YVHA 1FIPA 4A3FJ 3ZQLA 4GCTA 3QBMA 3G1OA 3GTQJ 5D1RA 1UHSA 2EBIA 3M4OJ 2LP0A 5IOYA 1X2NA 4BXXJ 2DA5A 2B63J 2X6OA 1VFCA 4C2MJ 1WPKA 2Y30A 1RR7A 5C44J 2DA3A 3Q0UA 3I4MJ 2ZCNA 2R7ZJ 3QKXA 3A01B 1ETWA 5F04A 1F43A 4JX4A 4FCYA 1R9TJ 3D1NI 1FEXA 2CUFA 3BG5A 4XK4A 2F07A 3FISA 5EGOB 3S2HJ 3IH4A 2XGDA 2DG7A 1OCTC 1AHDP 1ITYA 1QRYA 4M3BA 4NELA 2M34A 1JT0A 3PO3J 4C3IJ 4RBOA 3S1QJ 2YVEA 1NK3P 3BQZA 2WAQN 4MFDA 2X48A 1AKHA 1FIAA 4M6VA 2DMTA 1JKPC 4A3MJ 2E2HJ 2DA7A 1XG1A 2ELKA 3F0CA 1MBHA 3KZ9A 1GV5A 2K40A 3SFIA 4XRSG 5IP7J 3SJMA 1EF4A 3LJLA 4UUSA 4IHYA 3GZIA 3COLA 2QKOA 3FKIJ 3TEDA 3G1MA 2FJ1A 5EG0A 2HOAA 1DU0A 1ETKA 3ON4A 2YU9J 3PASA 2FBQA 2JWTA 2E2IJ 2AHQA 1YRNB 2CQXA 4M3FA 3NNRA 1NK2P 2PBXA 1OCPA 3S1RJ 3VP5A 2G7SA 4A69C 3ZQCA 1H89C 1B72A 3KKCA 2HXIA 1TWCJ 2TRTA 2W48A 3VOXA 4BKXA 2MW8A 4FE7A 1AU7A 1BA5A 3JRCA 4A3LJ 5HODA 3LSRA 2DA2A 1ETXA 4XRSA 3L1PA 1HF0A 1QVTA 1TC3C 5D18A 2JA5J 3NARA 3KNWA 5K7FA 2DN0A 4CYCA 1ZR4A 4GFBA 1H8AC 3S14J 3BR5A 4Y52J 4JP0A 2RHAA 5FMPA 4QIWN 4X1EA 4D7NA 3HOUJ 3CJDA 1T33A 3OOUA 5K7ZA 3RQIA 2OI8A 3HGGA 3S16J 5K58A 2OF7A 2M9HA 3ZOBA 4J19A 3QPLA 2ZCXA 3EUPA 2FQ4A 5FKMA 4BY7J 2ME6A 3NPIA 1JUSA 3G7RA 2HQ5A 3O8GA 3CDLA 3FRQA 3T6NA 4GCKA 2UXHA 1B8IB 2QOPA 1JKOC 2EZKA 4D5CA 2QWTA 2RAEA 3S15J 1IGNA 2XGEA 5GP9A 3HEFA 3ZQHA 2E1OA 5C3EJ 3A03A 4FTHA 2L9RA 5F27A 3GTGJ 3BHQA 3CWRA 1HOMA 4GCLA 3VIBA 3MKLA 1GDTA 2GFNA 2Y9YA 2VKEA 2K9SA 1IUFA 2LR8A 4MFEA 4W1UA 5IP9J 3A01A 4IHWA 3HM5A 1TWAJ 1IRZA 1A5JA 2PMZN 2EZLA 3HE0A 2XB5A 2DA1A 2HOTA 2JA6J 1D5YA 5EGOA 1MBJA 2XPVA 1ORKA 5IP6A 2EH3A 2O7TA 2VKVA 1JGGA 1XS9A 2GENA 2NVTJ 3M3YJ 4D5FA 2HXOA 1VNDA 1BL0A 9ANTA 2HKUA 3A02A 5GPAA 4MXMA 3GTLJ 3WHBA 5FJ8J 1TWHJ 3BG9A 3OSFA 1TWGJ 2DMQA 4C3HJ 3JR9A 5E3LA 2NS7A 2QIBA 5CXGA 3GTPJ 5C4JJ 2R5ZB 2EZHA 1LFBA 4RDUA 1JTYA 3S2DJ 2FD5A 4A3CJ 2K9NA 3W6VA 2DTZA 1K61A 5J3LA 5EFYA 5AQCA 4A3EJ 2Y9ZA 3CRJA 1MNMC 1WGXA 4DZPA 1YRNA 5IPAA 3BCGA 3OSGA 3JREA 2LKXA 1JUMA 2ME0A 1U8BA 3O8HA 3BJBA 3LWJA 5HBUA 2IAIA 3VW2A 1P7IA 2E2JJ 5CXIA 1DU6A 2UXOA 3JRBA 4A93J 3JRHA 3QPSA 2DA4A 2W53A 2LD5A 3DPJA 2ID3A 3JRAA 2Q24A 3BNIA 2V57A 5F0FA 1SANA 1TWFJ 2Y31A 5K7HA 2QTQA 3O60A 3VW1A 4QSHA 1JTXA 3LHQA 2UXUA 1ZK8A 1IDYA 4MO7A 2HYJA 2G3BA 5EYRA
chains in the Genus database with same CATH superfamily
3V78A 2DJNA 2XSDC 3ZN0A 2XAJA 4F52A 1FMVA 2OA4A 1BC7C 2DA6A 5EDNA 2WY7Q 3B02A 4U0WA 2HR3A 1JGSA 3CUOA 1B8IA 5D6FA 3D5RC 2H1KA 2O8KA 4PJJA 1XDUA 3FXJA 4HNTA 3K1PA 5J1YA 1MZBA 2D45A 5E3OA 2L7ZA 4AUXA 2OUMA 2PMHA 5CW8A 1RC9A 2DODA 1JE8A 1YOVB 3ZMUA 1D8KA 2IT0A 1ONVA 2KRFA 1R6RA 1HLVA 4UDSA 2IXSA 2R7OA 2EQRA 4FT8A 5CLSA 3WHCA 3KPHA 2HVQA 4UVAA 2IS4A 2XGCA 1PUFB 4AF5A 3ASNH 2YR2A 3CO7C 4YIFA 5D19A 1V54H 4AIHA 2K4JA 5ERIA 2X1DA 2FX0A 1XSXA 1SFUA 2R7TA 1U9NA 3J7ZI 5GPCA 1UZCA 4HZFA 4U9LA 2GA1A 4YFNF 4G7OF 2E1NA 1FYLA 2HDDA 2BY0A 2LFBA 2O7OA 4KJZA 4DYQA 4UUVA 2KIMA 2XAGA 3TW7A 3ERED 3C2BA 4DJAA 1Z05A 1B4AA 2ZOZA 3RZOJ 1O7FA 1D1AA 1U5TC 2GXGA 1K4SA 2MH9A 3PFYA 3I71A 3O6BB 3IUVA 1BBYA 1R36A 2M8EA 2IW5A 4RB2C 2A2FX 1USTA 4V2FA 3GLLA 2M2EA 2DFFA 1MBEA 2NS8A 4G94A 4IX7A 2M7BA 4EJTA 1I39A 5FRMA 2KHMA 1W0UA 2DU9A 1Z9CA 1GXPA 1GVDA 3CD6I 2QBYB 3AG2H 2ZSIB 5F08A 3OYCA 3R4KA 1NTCA 1YJWI 2PZ9A 4GYIA 1VQ6I 2LY1A 2RNJA 3MMYB 1P2FA 5EEGA 3VYRB 4BACA 4PJ0C 1JUPA 1WRJA 3H5RA 5BNGA 3PIOF 1K4TA 1W36D 5FGMA 2R5YB 1YX5A 2JPCA 1MMGA 2VL8A 1YS7A 3PFIA 3JSPA 3Q0WA 3V6GA 2ZO4A 3E7QA 2KPMA 2D6YA 4HF2A 4IEJA 3LQQA 1J5YA 2VBZA 2FOKA 3J80K 1T56A 4Z6YA 4N9HA 1WJBA 5HLTA 1X19A 1X4PA 2DOFA 2XAFA 4A0YA 2R7VA 4A12A 1RUOA 2RVCA 3K70D 2ECCA 3TP3A 1LFUP 4G6TB 3E3VA 1SFOJ 4KA4A 5HDNA 3KE2A 5GAHJ 1W0TA 3W3CA 3FK6A 4KWAA 3E6CC 2W00A 4AYBN 4ZDOA 3WTZA 2OQRA 2MG4A 3CZ6A 5KK1A 4PJMA 1XPXA 2K27A 2XUBA 2KP6A 1PUFA 1ZQ3P 3DLAA 1K83J 4LIVA 3OL4A 3QWLA 4H4KC 4ENJA 1M1EB 3LNQA 3RI4A 4BH9A 2A69F 3J81Z 2JN6A 1D0XA 4GGGA 5E18F 1VQLI 2E34A 3U21A 1JJ8C 3BROA 3F9KA 3HRSA 3QQAA 2BHZA 1MH3A 2PFBA 3ANPA 3CC2I 1FOYA 3NWSA 3W2AA 1SD5A 1S9HA 2BOLA 4JOMA 2VBWA 3F6OA 2J5OA 3BR0A 4M9SA 2M4GA 3WTSC 2WBMA 1TT0A 4LMYA 2Z5UA 3VW0A 4BAYA 4KICA 3VVXA 3HRMA 2DT7B 1EKEA 2ZNYA 1EJ9A 3HOYJ 4MQVA 1S7OA 2HGCA 1JT6A 2LLKA 1RPWA 4I0BA 5CVVA 3VYTB 2PBIA 2M8GX 2ZCWA 2VONA 4IOAF 1I6HJ 2QBYA 4IHVA 3K6GA 3VUQA 1HBXG 3L09A 1W5TA 1EH8A 2KIQA 3SDBA 5ICCA 4BE1A 2LMDA 4UHTA 2QA4I 4DOZA 3OWTA 2UXPA 2HI3A 1FC3A 3M8EA 3VB2A 4HW0A 4CH7A 1LUJB 3A4CA 4ME9A 2IPQX 1TTYA 3K4LA 1OCZH 5HS9A 1HW2A 5DUIA 1KONA 2R5YA 2MC4A 4DZJA 2UXNA 1MBGA 3OYHA 3PIPF 4M9XA 3IAM2 1BOAA 3BCAA 3IH2A 4MK6A 3JCUC 1NHAA 3BG7A 3AG4H 1T38A 3EPZA 1ZG5A 4NUBA 2CGPA 4IOCF 4I01A 2KIUA 4BEHB 4MTDA 5EF6A 2TCTA 4BJTA 2ZFWA 1ZRCA 2KIFA 4ZYEA 2JUGA 5GAEJ 2Y0SN 5FLMJ 2ELJA 2AXLA 2JSCA 1G3SA 1YHQI 2JMWA 3S2WA 2HZDA 1VQ8I 2CJJA 4S0HB 1U2WA 3IWZA 5DTDA 5F1RA 3BTCA 3W2WA 4GDFA 2L4MA 3S3MA 2KL4A 1KYZA 2DMNA 2ZC2A 4X6AJ 1E3OC 1MJAA 3FXMA 4PDKA 5L3FA 4IL6C 2JPBA 2P4WA 2X6XA 3R0JA 4CYCB 1SFKA 1WJEA 2G0EA 1I5ZA 1W5CC 3DV8A 1YX3A 3LMMA 3Q0VA 3WU1B 4DYRA 3LOCA 2GOMA 3R6SA 4RGSA 3MZHA 2ZXHA 3GFIA 1G59A 1I50J 2M5WA 5LGTA 2WA0A 1R23A 2A61A 3VOEA 1D8JA 4C9YA 3GTKJ 3D5LA 4EM0B 5LD2C 1B9NA 3HUGA 3NXCA 3GEUA 3CLQA 2YVHA 3VSKA 5LHIA 2A5WA 1S3JA 1FIPA 3BPXA 1FOKA 1FWZA 3LSTA 4UNOA 4GCTA 5BS6A 3QBMA 2X1EA 4XN0A 5IT3A 3WU2C 5FFZA 3FF5A 2ZFUA 3KP7A 2Z2SB 1H9TA 4BXFA 1VFCA 3H5NA 1LNWA 2P0WA 1WPKA 4EVIA 1RR7A 2EWNA 4JBAA 4FASD 1GHCA 1ETWA 2CQKA 3SQNA 4UB8C 3I56I 2CO5A 1SVOA 4HG2A 4HLXA 2F07A 4ZDLA 4I02A 2XGDA 2DDBA 5CQEA 2EFPA 1T2KA 2DBBA 4U88A 2XIGA 3M8FA 2CV1A 2XV4S 1JT0A 1PUEE 5DM7F 4NELA 4HBLA 3BQZA 3HZJA 2NNNA 4M6VA 1R4MB 2PJRB 4A3MJ 3QPHA 3RCOA 2R7RA 2QSGX 4CCKA 2QQAA 2LG4A 2DFHA 2LF8A 3MZ8A 1MBHA 4OAYA 1GV5A 2L9NA 5IP7J 3QRFF 4HX8A 4IQ4A 1FSEA 1EF4A 5D6EA 1YW7A 1YTYA 1ETKA 1XSDA 4HV6A 3PASA 1P6RA 4BEHA 5GADJ 5HS8A 2BGCA 5L3DA 1VQKI 3LSHA 4ZYHA 2Y0SA 2F5CA 5FFXA 2COMA 3LFUA 2B1EA 1OCPA 3NRVA 3PSFA 3ZQCA 3DTKA 2R7WA 2YVXA 2A5YB 2HXIA 5BOXA 2IA2A 2W48A 4N9IA 1W7PB 3ZR8X 2QKMB 3OL3A 2XROA 4A3LJ 5HODA 3LQRA 1LDDA 3SHFA 4XRSA 3ABLH 3L1PA 1HA8A 2K02A 4HX7A 3ZXSA 4HSRA 1TC3C 3GX4X 2DN0A 4CYCA 4GFBA 1LDJA 4Q47A 3SXYA 3S14J 3BR5A 4Y52J 3FHZA 5FMPA 3HOUJ 2WC2A 4LK0F 1FSHA 2IA1A 3RQIA 3GYHX 1XTAA 3FXUA 3F8NA 2VN2A 3ZOBA 2H1LA 4IVNA 1DGRM 3MWMA 4M9ZA 4BE2A 3E97A 5FKMA 2ME6A 3IRRA 1JUSA 3J80Z 1SAXA 2XDVA 1WJAA 3O8GA 2EIJH 3CDLA 2ICWG 2EZKA 1IN7A 4HAMA 1G8XA 2IP2A 1REPC 4RA2A 3QYBA 3PJRA 2X6WA 5DM6F 4ESJA 3CWRA 2FF4A 4G7HF 4GCLA 3TO9A 4L9NA 2P7CB 2LR8A 1YIOA 5IY5H 2VQHA 2H27A 3MKZA 2XF5A 1IRZA 4ENKA 3LFKA 1WJCA 1XD7A 1PDNC 3KP2A 4NBQA 2PMZN 1B6AA 3EYIA 2KISA 1HC8A 1LPQA 1D5YA 4XLNF 3P9IA 2L02A 5JVGF 4E7HA 1QU3A 1YJ9I 2DTRA 3V7SA 3F21A 2GENA 2F5EA 1TNTA 4D5FA 2HXOA 1VNDA 2KJBA 1O7LA 2J5PA 4GXOA 4RM2A 2DPDA 4WWCA 4C3HJ 2DYSH 1LKXA 2F5FA 1N25A 1WJDA 5C4JJ 4C2MA 2HQNA 3HHGA 5JFRA 3AL0C 4ZDPA 5HOOA 4II3A 3FX3A 3L2WA 3N05A 4Y15A 2P5LC 5J3LA 4BHCA 2ETHA 1IXCA 2KRCA 3I64A 3GO5A 4AIJA 4XMYA 1PYVA 1UELB 3O8HA 4BHBA 2IAIA 2QQBA 1T6SA 1BC8C 1S29A 1W7PA 3BJAA 3QPSA 2MLGA 2EA4A 3HYIA 4LGWA 2W53A 2BY2A 2Q8KA 3DPJA 2ADUA 4AIKA 1UB9A 3BNIA 3NWTA 5F0FA 2IRFG 2QSHX 3RKXA 1TWFJ 5K7HA 2QTQA 2WV0A 4LLGF 4QSHA 5KAIC 1JTXA 1ZK8A 1IDYA 4MO7A 3CUQB 3H35A 5EYRA 4E4HA 2R7QA 2G7HA 5IYBJ 2GOXB 2VJJA 4WXHA 2V6EA 5DAJA 4ITVA 1NG7A 3A0BC 5E3NA 2OV7A 2UV1A 2HWVA 3HGYA 4EJOA 1UMQA 4JKZA 5FLXK 4U7DA 3BG3A 3V8LA 2X51A 4LLNA 1U8RA 3VTIA 2P8TA 3Q3SA 2VKHA 5B66C 2LY2A 1OKRA 3IKTA 3WODF 1YYVA 4YIRX 2VBYA 2XDNA 1FP1D 4M3GA 5FKLA 3H1CA 1J7KA 1XGNA 3ZQQA 2OPTA 1R7JA 2W84A 2DLLA 3RDIA 5EEAA 5LEJA 1GLNA 1UHMA 4L9JA 3REOA 3KP4A 3CP2A 1ETOA 4PSWA 5FGLA 2LOOA 1U3EM 4IHXA 5DDGA 2PMZA 2YU3A 2V9PA 5IYCJ 3JAMK 1A36A 3E6MA 3T8RA 3ULQB 3CESA 4U0YA 1OPCA 1JJ6C 4HRIA 2CRGA 1XCBA 4EMSA 2RASA 2CUEA 4Z2YA 4B48A 4HQMA 3B6AA 4I6ZA 3OS0A 5BMZA 1D1BA 3FBIB 5IOZA 4I99C 4A3KJ 4CYDA 5CJ9A 1AKHB 4QLCU 5KAFC 4IZZA 4WIBA 1BIAA 2DCEA 3K7AJ 1JKQC 2VXZA 1YS6A 2FOWA 1OYWA 3BTIA 3PUBA 3SZPA 2WUIA 2EZIA 4CICA 3LSGA 1Y56A 4GFKA 2IBDA 1R49A 3KLNA 3VYUB 4XL9A 3ZQIA 1YIJI 3T0YA 4C2UA 4B3AA 4JNNA 5HNFA 3WGHA 2VPRA 1HDDC 3HOXJ 2R4GA 1LEAA 3RH2A 2ECBA 2HQRA 4YEJA 1T95A 4ZZDA 3PL8A 2CQNA 4BGDA 1MBFA 4CXFA 1DDNA 1RI7A 4MIMA 4PFPA 1WWXA 1LDKB 3T5XA 2ZXIA 1A6QA 4I76A 2VIXA 3OV8A 3F8CA 3CUQA 1IJWC 2R93J 3C7JA 1P7JA 3H36A 4XLCA 2M4KA 3CMEI 3E5QA 3GTJJ 4RB3C 2K9QA 1L0OC 1D5VA 1FPQA 1WH7A 3RKQA 1MMNA 4RGXA 1TL8A 2DYRH 2BY1A 2X1CA 4ACIA 3WE2A 3G1LA 1ZG1A 4YFXF 1V5FA 4RM3A 1W7PD 3P9TA 3RPQA 1SVLA 4E6KG 1BI0A 1ZGWA 1VQ7I 3OY9A 2D5VA 5GTIC 3GFJA 2PG4A 2EK5A 3E6DA 3VVYA 4EEFG 2I10A 4LG3A 4AVZA 1MMSA 2XF7A 3FHNA 4EM1A 1Y0UA 1FMWA 3HPHA 4KITB 4BY1J 2OERA 4DIQA 4KMFA 2ZSHB 1D0ZA 1B1BA 3UR3C 4CGZA 5CKTA 4Y7NJ 4RAYA 2H6BA 4OIPF 2ZCMA 1IV6A 3QP5A 3O2PE 3CJRB 1FYKA 1TT5B 2YUSA 1A6IA 2ESNA 3HOWJ 2BW3B 1W36C 1T0FC 1X1DA 3ABMH 1SC7A 3QU3A 5F1JA 2HFHA 2WY8Q 3MZYA 3K4CA 4AC6A 4XKCA 1ODDA 3B73A 4M71A 3DFGA 5JR3A 1OR7C 4Q4ZF 5ICFA 2X0LA 3W6KB 5LFAA 3S8PA 3MQ0A 1I6XA 5A2QK 5J4YA 3I0TA 1W5SA 3K4NA 4PXIA 1XMAA 1Q1VA 1UG2A 1ETQA 5D5UB 1KZHA 2O9LA 1JKRC 4L5EA 3K70C 2CG4A 3S3OA 2GAUA 2GWRA 4OINF 2WV1A 2QENA 1ZRFA 3S32A 1PJRA 2FXAA 3G3ZA 4XORA 1FTTA 4HV5A 1ZKGA 2KFDA 2LTPA 3OS2A 5D8LB 2FRHA 4F92B 2QZ8A 3HTHA 3SDGA 5H9TA 4MGRA 5E8GA 2E1MB 3FM3A 2O6GE 2JVGA 4I2OA 1ZN2A 4V2GA 3CCSI 2ZXWH 4CZCA 4QPOA 1EV7A 2DO7A 2V7FA 4UY8I 3GEZA 3QOEA 4D7MA 4UUTA 3E7LA 3RKYA 4HA8A 2DK5A 1QNTA 3VYSB 3VPRA 3ZQFA 1SAUA 4OIRF 3I4NJ 2L0KA 2W1OA 1U78A 2HS5A 3GUDA 4A6DA 4ZYAA 2BV6A 2R92J 1ENHA 5C4YA 4LG0B 1VI0A 5J8CA 3GLXA 3IC7A 3JRDA 2WB1N 1RIOH 1S7EA 2QVOA 3KEYA 3VEPA 4UUSB 2HOSA 1KU2A 4AVPA 5EG0B 5HS7A 1VQ4I 3H3VK 2NVYJ 1WH5A 3J7AY 1IV8A 2CYYA 3MEXA 4XICA 1U9OA 3ZN1A 1X4OA 2L4AA 3KP6A 4HNVA 4Y13A 5DV5A 2STWA 2MA3A 1S8NA 4BDZA 4O3MA 2KRHA 2LF7A 4KDPA 4A5NA 2P5VA 2E7WA 5K5RA 4ICHA 4OMYA 2DT5A 3E6BA 1Y1WJ 4CCLA 1H88C 3HOZJ 4HPQA 2NOGA 4DW6A 1V5EA 2CQQA 4MLOA 2MSYA 2CW7A 4HF0A 5J47A 2FQ3A 5F0HA 3ZGKA 2EIKH 2UXXA 3F72A 4KISA 2BW3A 3PNVA 2MC3A 3BZKA 1TQPA 2X4HA 1PP7U 4YZEA 3CCJI 3NS4A 5D5WB 1G2HA 2AQEA 1BR2A 3OOPA 3AFHA 2BZTA 3CMYA 5FLXZ 4R8HA 2LH9A 2ZB9A 3D0SA 2MH2A 2CFXA 4BYYA 2Y0MA 4DNCA 3OYJA 3ERMA 2HDCA 1WJFA 5D1RA 1K6OA 4XOTA 4BHPA 2F5DA 4O6JA 2LSOA 5IOYA 2OU2A 3QYEA 5E79C 4M74A 4C2MJ 5C44J 3M1EA 2EFWA 3V4GA 2VLAA 1WJ5A 3Q0UA 2ZCNA 3FMQA 2R7ZJ 3QKXA 1V55H 2IS1A 3IRQA 3J7AO 5HVQC 1FEXA 1R5GA 2QQ8A 3JAMZ 5HLGA 4C2TA 3BG5A 2F6CA 4OWRB 5GTHC 3FISA 1FZPB 2K7LA 3S2HJ 3IH4A 2DG7A 1AHDP 1FLIA 1OISA 1QRYA 3DLLF 3SFZA 2M34A 1TBXA 1XDSA 3KETA 3KP3A 5KNLA 4AM3A 1NK3P 2HQAA 4L18B 4MFDA 4RB0A 5CYVA 2IGKA 2DMTA 3DEUA 1I1GA 1YE9A 2WB1A 3L00A 2E2HJ 4GYGA 3L7WA 1ZYRF 3DPLC 2QEXI 1GVJA 4BXUA 1SMYF 3SFIA 2K40A 1SFXA 2AS5F 2WTEA 3KZ9A 2MFZA 1A31A 4UUSA 4IHYA 2QKOA 5EG0A 2KLOA 1DU0A 3ON4A 2YU9J 1P9QC 4BQAA 2JWTA 2DXIA 3FXQA 2AHQA 2BXZA 2CQXA 3H9QA 5J6XA 3S1RJ 1P4AA 2WADA 2G7SA 4A69C 4Y3OA 4FHTA 4L0ZB 2KZVA 3OYLA 2EINH 4M6XA 2Z9OA 1KQ0A 3VOXA 4BKXA 2Y75A 4FE7A 4Q5SF 2DOAA 3DPUA 3JRCA 4BE0A 2A6TA 3F8BA 4OAZA 2FMLA 3CJTB 4G8XA 4AIDA 5E1ZB 1QVTA 4XSZF 1JI8A 4ZC3A 4MEXF 3NARA 4II2A 3HPGA 3IWFA 2R3SA 3CJQB 1VTNC 4WXDA 5HDKA 2ACJA 2RHAA 3ZP5A 1Y0NA 3OOUA 5TJJA 3AG1H 1TW3A 3S16J 3ESWB 4Y17A 5FRNA 2V26A 2M9HA 2FMYA 3QPLA 4J19A 3EUPA 3F23A 4BY7J 1HQCA 2VODA 1QZYA 4CCNA 3TOAA 4ENNA 1Z7LA 4LJZF 3PUFA 2HQ5A 2W4SA 3JW4A 4WX9A 4ASNA 2FE3A 1XMXA 4R1HA 5B1BH 2QWTA 4LB5A 1WI9A 2XGEA 3F8MA 1E17A 3ZQHA 2OC6A 2G9WA 2L9RA 2RV8A 3GTGJ 1AOYA 3VIBA 2CW0F 1G6NA 1S7AA 1XGSA 2GFNA 2K9SA 1IUFA 3BG6A 4IRVA 5ILVA 4MFEA 5IP9J 2HDWA 5K5QA 4I98B 1D0YA 4E7SA 5E17F 5JHUA 1TWAJ 1ZELA 1FNNA 4LK1F 4B44A 4WCGA 5L3GA 3DU6A 1MJ9A 3EUHA 2PQ8A 2A3SA 2A68F 3HE0A 2XB5A 4PZJA 4PCQA 2HOTA 2V9KA 1ORKA 2EH3A 2O7TA 2YPRA 1JGGA 5F6FA 2LBFB 3M3YJ 2FNPA 4ESFA 1Z91A 4XNFA 2JUCA 2HKUA 3A02A 5GPAA 1ACIA 1T98A 4EJWA 5FJ8J 5A2QZ 2CMPA 3JR9A 3Q9VA 5E3LA 1HW5A 2ZMEB 2GIZA 3QP6A 5LLQA 3V7RA 3HSRA 1LFBA 3K0LA 4RDUA 3WTVC 1JTYA 1VQ9I 2PEXA 3DWLE 3EUHC 2V79A 2DTZA 2OJED 5FD6A 4E7ZA 4M73A 2WAFA 3FMRA 5AQCA 2Y9ZA 1LVAA 1YG2A 5IPAA 2RNGA 4PGGA 3OSGA 1ZH5A 2LKXA 3ZPLA 2FSWA 1FYMA 1JUMA 1D3YA 2XAHA 1O3TA 2GA2A 4MQ9F 3BJBA 5LHHA 1V5GA 3NQOA 3K4BA 5BQTA 3V42A 5FD5A 2OAZA 5AIPA 2DA4A 4YG2F 1Z21A 2ZJQF 3CCMI 2XASA 3JRAA 4NHJA 2L7KA 3K1NA 5L3BA 2QSFX 3VW1A 1KGSA 2VQGA 1MJBA 2HYJA 3E1SA 3KYLA 1QO0D 3LSMA 3V7CA 2MD5A 3AAFA 2D1HA 3BCBA 4G12A 2Z3YA 1X1PA 4W97A 4CGRA 4GFLA 3BT9A 1CF7B 3AQTA 2GQQA 2R7DA 1FTZA 3KZIC 3LSIA 2KMUA 4BJ5C 4AU7A 2E5ZA 1CQTA 3K8PC 1IG7A 5CVRA 2W24A 1Q1HA 2R7SA 3LA7A 3LSJA 4FX4A 3BLYA 1F36A 1R5ID 2OCEA 2L9SA 5L3EA 3B6CA 3FXKA 1KU7A 3JSJA 2RDPA 3BTLA 1MGTA 1LVKA 3KX2A 5H6RA 3QYFA 2Z1DA 3JRFA 3TDZC 4XSXF 1RRJA 2CQ7A 2DK8A 2IA0A 4LITA 3TW6A 2E71A 2XAUA 3VWBA 5HAWA 4C30A 3OR2C 3ZCOA 4I0AA 3NEUA 2B0LA 1YW8A 5LRSA 2DJIA 3KYDB 5J1UA 1B59A 1SVMA 2L5QA 1UAAA 2V1XA 1F9NA 3U1KA 2LBFA 3HTIA 4DYCA 1J75A 3HXLA 1LFPA 3S17J 2JA7J 1DPUA 1IN4A 2L3DA 1QGPA 3PNTA 1V3FA 3BDDA 2HVSA 1X3WB 3IL2A 2JJ7A 2DI3A 4NQWB 4YELA 4JYKA 2MLKA 1OYYA 2K4BA 2ZMEA 1DP7P 2KDZA 4V19K 1JHHA 3P9KA 2V1DA 1DPRA 2R7FA 2A6EF 5M5XJ 3RTRA 1EH7A 2LY9A 1T8IA 2XB0X 4RB1A 3WE3A 2IVMA 2M3AA 2NX4A 1BI2A 2HKOA 4IKFA 1H0MA 4YRVA 1SMTA 3MD2A 3K4JA 4E7LA 2BVMA 4OD4A 2VE9A 1WFXA 4ZZLA 4P5OA 4EV0A 4MTEA 4P96A 3HOTA 3JRGA 3S1MJ 4P55A 2R7UA 5J1RA 2KT0A 2A6HF 1T39A 4XLEA 3GFLA 3N97A 3MN2A 1VQMI 2HKXA 5HLIA 1R5HA 2V4JC 3GTMJ 2XC7A 1Z0XA 3ZMTA 5EJCA 3G6EI 4QWQA 3NAUA 4S05A 2DAOA 1BW6A 2QWWA 5EEHA 5BPDA 2PJRA 3HC7A 1MDMB 2WAEA 3HB9A 4PJLA 2LRDA 3DP7A 4OU0A 3H9GA 2F2EA 1TP4A 3BR3A 5EZHA 3MVPA 3WGGA 2IGOA 2L9VA 2OTLI 4KNYA 2RQQA 3BR2A 2K3FA 3C2GA 4B4CA 1CF7A 4G6DA 4HNUA 2VI6A 3HOVJ 3GFMA 3HKZA 4FISA 3GBGA 2EPFA 2H6CA 2JRTA 4CDGA 1A04A 2E35A 3OYMA 2FEZA 1MSEC 2NP5A 4A3IJ 2MYSA 5C4XJ 2JVHA 2UXIA 1BJZA 1TW2A 3SWHA 3MNLA 3CDIA 5CVIA 1N78A 4CHUA 1UI5A 2DW4A 4N4OB 3L2QA 2BYVE 4RMNA 5DD4A 2GBYA 3U1DA 3CTAA 3WG7H 2YX4A 3RZDJ 3LSKA 3Q5FA 5HSZA 4KN7X 3OYAA 3GZ6A 3KEOA 4HKUA 3IHUA 2AXTC 2W85A 4G7ZF 2F4IA 4AWXB 3OYDA 4LB6B 2R0QC 1EA3A 5FROA 2OZUA 1ETVA 3I59B 2QM3A 2XRLA 2M30A 2ZJRF 3W6JB 2XSJC 5FHPA 2VOOA 2E5NA 3AG3H 4P9UA 1SFEA 4NQWA 1UI6A 4XRFA 2FBIA 1N77A 4KT6A 4ZYDA 2GUHA 2PX9A 3I9V2 5H6QA 2Y69H 1F1ZA 1IN6A 2VKDA 4L62A 2FBHA 1GT0C 4OIOF 5J8FA 1WCMJ 4U0VA 2VOPA 1QPIA 2MGQA 2DT6A 3QPTA 2DQRA 1G3YA 1IDZA 1SD6A 4F7ZA 2HOEA 4KIGA 3OYNA 3F6VA 2OZ6A 1YQAA 4BBRJ 2P81A 3BTJA 4QPQA 1FBSA 3ROUA 3HIFA 4PUSA 4IQJA 3I53A 2IU5A 3WU0A 3EUAA 5K1YA 3IH3A 1RKWA 2VUMJ 1XC5A 5E3MA 2LC2A 3KZZA 4XLAA 3LSPA 2BHYA 2L7FP 4JX6A 4XRMA 1Z67A 3PM1A 2VC1A 3F1BA 5ICEA 3FBNB 2DMUA 1MDMA 3CC7I 3M07A 2KJCA 1Z3XA 1MMAA 2E36A 2JK3A 3EUKL 4KFCA 3B81A 2LNBA 1OMIA 3DKYA 3A2KA 3LL7A 3DXJF 1RESA 1APLC 1RETA 1WVRA 4BBSJ 3L2UA 5E1WA 4L9TA 3OIQA 3RIRA 4H0EA 2STTA 4BDYA 4NDLA 4KIBA 4CSWA 4B47A 3JRIA 1LEBA 2F4OB 1FJLA 3C2HA 2Z33A 3RJPA 3CMAI 1D1CA 4PGHA 2NVQJ 2NP3A 1Z77A 3KLOA 2GZWA 1FBQA 3FK7A 2CFOA 4U9NA 3HIMA 3H3UA 2X6YA 5ED4A 2GXBA 1X3ZB 1WI3A 2XAQA 3HHHA 2K3PA 5M5WJ 1BW5A 3IP4B 1U5TB 2ZBKA 3CCQI 1ZR2A 2CH0A 4JX5A 2HYTA 3TDUC 4IO9F 1K79A 1NG6A 3LA3A 4OIQF 1ZGJA 2PFVA 3DEWA 4EJVA 1ETYA 3KIOA 4OMZA 3I59A 4UV9A 1WQ2A 2EJRA 1IC8A 5DD8A 3CQZJ 3LAPA 1VF9A 2DDAA 1YJNI 4CO8A 2WAQA 2Y2ZA 3E0JB 3BY6A 3BJOA 3FXOA 4I7HA 3IUOA 5J4VA 4A3FJ 1XX5A 4KN4X 5D5VB 2LKSA 2A05A 3G1OA 3GTQJ 1O3SA 4A0ZA 4E70A 2XHKA 1H9GA 1X2NA 2F4MB 2VT3A 3CUQC 1YW9A 2B63J 2H8WA 2X6OA 1VQPI 3F8FA 3D5SC 1K6YA 2YSRA 2UUZA 3I4MJ 3RYRA 3BZCA 2EA2A 3CJNA 5F04A 1F43A 1FX7A 1VQOI 4JX4A 3FXLA 3MKWB 1IUYA 4I09A 5FB2A 4A2UA 1IN5A 4RGRA 4XK4A 1SEUA 3RPUD 1Z6TA 1WSUA 1OCTC 2ELHA 3H9JA 2O8XA 2KQRA 3FXRA 4C3IJ 1KA8A 1XN7A 2W57A 3ABTA 1R4NB 3V8JA 1YI2I 1OQYA 4B8XA 3OYBA 2YVEA 1J2XA 3TO7A 2DQLA 1EH6A 1SD7A 2X48A 4XLHA 1AA7A 3SEZA 1AKHA 2EB7A 1FIAA 2CV0A 1I1SA 1JKPC 1QZEA 3ZMSA 3R0AA 1X1AA 2DA7A 1XG1A 2ELKA 3QU6A 1Y8QB 5CPRB 1FBUA 1HW1A 3ML6A 2JZYA 3SJMA 1Z7UA 3GZIA 3I54A 3HL2A 3CCEI 3COLA 3TEDA 3G1MA 2FJ1A 2E60A 3M1CA 3K4MA 4EJUA 5CQGA 2FBQA 2QUFA 2RN7A 3N4MA 2E2IJ 2QLZA 2NYXA 2RGVA 5DEQA 1YRNB 2IGNA 1I27A 4M3FA 5LRRA 5LGNA 1J9IA 2PBXA 3FWEA 1JXSA 4RAGA 4CCJA 4IF4A 2VBXA 1H89C 3S3NA 1TWCJ 4Y4RA 2TRTA 5BPIA 3TO6A 1R1UA 2CS3A 3WTXC 5LGUA 1AU7A 1BM9A 1BA5A 1Y6IA 2ZXJA 1XSVA 2OQGA 2JRMA 2HNHA 3LSRA 4IRIA 1E2XA 2DA2A 1FP2A 2TDXA 1U5TA 1LQ1A 3WG9A 3R61A 4XKWA 5K7FA 2M0MA 4GCVA 1F4KA 5D5XB 4BQQA 4JP0A 1BIBA 2HPMA 3QOPA 4D7NA 5D4SA 1YITI 1Y39A 5K7ZA 3HGGA 2OF7A 4XLFA 4ZJZA 4F93B 4F91B 4ZTJA 2RQPA 3NPIA 1RNLA 5DCMB 1MKMA 1KQ9A 3T6NA 4XM3A 4HQEA 4Y33A 3FRQA 2UXHA 1BI3A 1DQUA 4XQFA 2FU4A 1PVEA 1U0JA 2Z16A 4PK4A 5GP9A 3HEFA 3A03A 5F27A 1ON2A 3I5UA 5CVJA 1IN8A 1GDTA 2Y9YA 2VKEA 2C6YA 4W1UA 2M45A 3HSEA 4EQQA 4IHWA 3HM5A 1HKSA 1P4WA 4EM2A 4HDUA 2EFQA 3EQLF 2EZLA 3ZMZA 4E7JA 3S93A 2JA6J 3SEQA 2MBFA 1OCOH 1QBJA 3SYTA 2VKVA 4HSTA 2NVTJ 2VJ5A 2H94A 9ANTA 4RAFA 3G73A 1R22A 4MXMA 4CCMA 1O57A 3OSFA 1ZARA 1TWGJ 2DMQA 2P6SA 3HSFA 2QIBA 4J00A 3FZVA 3GTPJ 2R5ZB 2EZHA 4NB5A 4XKBA 3BZ6A 1IZ1A 4G6QA 2HVRA 4ANJA 3S2DJ 4A3CJ 3FKJA 2K9NA 5ILUA 3W6VA 1DUXC 3K9TA 2VE8A 1K61A 3K2ZA 4UVCA 4IJAA 2IJLA 1MNMC 1WGXA 2VXDA 3M7GA 1YRNA 1VQNI 3KCCA 3LWFA 4XOPA 3JREA 1FOXA 1WKMA 1S6LA 4XONA 2VQLA 1Z3YA 3LWJA 4MNUA 5HBUA 2XRNA 1P7IA 2E2JJ 4ZTFA 5CXIA 4DQ2A 2ISYA 2UXOA 4IXAA 4TV7A 3JRBA 2OBPA 4A93J 2I8DA 3L9FA 3JRHA 4PSXA 5TRDA 2ZY9A 1R00A 3EYYA 2ID3A 1HKTA 2Q24A 2Q2EB 4P9FA 1YLFA 2EFOA 4ZH4F 3RYPA 1NH3A 2V57A 1SANA 3O60A 4BU2A 4LG0A 3JSOA 1DP3A 2VJIA 3PNYA 2UXUA 1R1VA 3GMEA 2G3BA 3WTTC 2MABA 2VPLA 2BVLA 5JLWA 1GV2A 2E1MC 2VJ4A 1XGMA 3T8TA 1IRFA 3RSNA 3GTOJ 4M3DA 5IT9K 3CF2A 3HTUA 2DOEA 1VQ5I 3P9CA 2KDOA 3HDDA 1SD4A 1R58A 4B3XA 5DCMA 4F55A 1O3QA 2ZNZA 5DYMA 2UWMA 2EV6A 1I3QJ 1T08B 2BEOA 2L7MP 2M7AA 1K78B 2LVSA 3HUGB 1MW7A 4XR6A 3TP0A 2CSOA 1S5LC 3CO6C 3ON2A 3RD3A 1R1TA 5E8IA 1UCRA 1ZTRA 4IRHA 3ZQ7A 2OCCH 4CA0A 3WTYC 5FLVA 2GLOA 1J0RA 5F0CA 1GUUA 2QCOA 1S72I 2YX7A 3RQ4A 2X9DA 1KU9A 1WHUA 2B3WA 1UJ8A 2QQ9A 3OIOA 3JTGA 3BR6A 2P7VB 3BOQA 1QHHD 2X85A 2JT1A 1L3LA 1CGPA 2NRAC 2XKPA 2UZKA 1HCRA 3OYFA 3VDXA 3ONQA 3CCUI 1STZA 3HJEA 3HBLA 4IRGA 1OJLA 4DBRA 1TQIA 5E20A 2REKA 3G56A 3FM5A 4D9JA 1BR4A 1Y1VJ 3EGQA 4CCOA 3GZNB 4ETSA 1JHFA 3HTSB 4XLPF 1X58A 3LAJA 1QPMA 2LKPA 3DU5A 1XB4A 2HEOA 3IAS2 4HYEA 3HTJA 2OTJI 2CUJA 2EV0A 3Q9SA 2KKOA 3UKGA 5H20A 2R5ZA 1OLTA 4YIIA 1IXSB 3BC8A 2EIMH 2FA5A 5TGTA 4N0BA 2D2WA 3EETA 3TKYA 4RLQA 3DEEA 4L0YB 2JA2A 3I55I 4FX0A 1W1WE 4LIUA 4OD5A 4XKVA 4A3JJ 2DFIA 3MCZA 1FT9A 4IHSA 2GM4A 2LK2A 3HRTA 4ON0A 2D1VA 5HLHA 4EGYA 2XPUA 2QF7A 4PFOA 1OFCX 4B09A 4ZYGA 1E3HA 1RUNA 1ZHFA 3VODA 1FY7A 2AO9A 3ISPA 3VVZA 3CCLI 3CCRI 3ABUA 3CCYA 3L2VA 2NAZA 2Q2EA 4AYBA 4NN1A 3IV5A 4LFUA 1QVUA 3W2VA 1TNSA 1DGWY 1X1CA 3DTIA 3H5AA 3DBHB 2EILH 5AIQA 2FNAA 3H0GJ 1HDPA 2K5CA 5M5YJ 5IYDJ 4HDVA 5M3FJ 1MBKA 3FIWA 3TGNA 3J7YJ 1BR1A 3ZRGA 2WGBA 3TOBA 2LYCA 2K9MA 2CW8A 2E1CA 1LE8B 4JL3A 4UB6C 4X0GA 3HOSA 2VT2A 4N4NB 4A3GJ 3BRUA 3EDPA 3H3ZA 3HTAA 5ICGA 4U87A 3BR1A 3TBIA 1YO5C 2O5RA 5H2FC 5DS9A 2RC4A 2FUG2 1K78A 1U6GA 4WF2A 4KYWA 2W82A 2XKOA 1YFHA 3CCVI 3KFWX 3KZYA 4HX4A 4RS8A 3AKZA 1SGMA 1O4XA 1O3RA 2ZOYA 1LJ9A 3GCMA 4GO1A 3DCFA 2W25A 2DG8A 2M87A 1Z6RA 4A3BJ 1OCCH 4BL0B 4S04A 3IKVA 4JK1X 3U9GA 2CU7A 3CLOA 3S5RA 3PSIA 1QHGA 1V4RA 3LA2A 1HXDA 1IRXA 1R71A 2P5KA 3PPBA 2YS9A 1TQMA 3AL0B 1RKTA 5D8KB 3BWGA 4WK8F 4HF1A 2HPIA 2ID6A 4AC0A 3OS1A 5FKNA 2NVXJ 2A07F 1G4DA 3ANGA 1MH4A 4DBQA 1HSTA 2CV2A 4M72A 4IHTA 2EV5A 3BPVA 4IPAA 5J40A 3HKZN 3I4PA 5FKOA 4OOIA 1MIJA 1BN5A 2XPWA 3O3KA 2HZTA 2PMUA 5M3MJ 1E0EA 1ZG3A 3FDYA 1XGOA 1RR8C 3K2AA 4J01A 3RKWA 2E19A 3F22A 3GF2A 3KEQA 2W7NA 1MD0A 4KT5C 5DUKA 2Z99A 1MNEA 3I3LA 1TLHB 4BQNA 3ASOH 4QTRA 1AWCA 3PO2J 3H92A 5EZGA 4HOBA 5TISC 2JA8J 1E3PA 1C0WA 2G7UA 3SZGA 4RGUA 3ZMVA 3K4KA 2COBA 2H8RA 1ZLJA 5ILSA 3KKDA 2VC0A 1POGA 2B9SA 4BNCA 3ECOA 2KZGA 3C1DA 2BXYA 3C18A 2O61A 2DMPA 1ZLKA 2AQFA 2K9LA 4M3EA 5JLXA 1X2MA 4FQGA 2JTVA 3ABKH 2PLYA 4A3DJ 2IS6A 4B1RA 4XN3A 5E1XA 3NRGA 3VOKA 2RREA 3ZMDA 3S1NJ 2FBKA 1LE8A 2N8GA 1ZRDA 3A1YA 1FOWA 1WZ2A 4KMUX 3AQSA 1MMDA 1ON1A 2IEKA 2V1NA 3L2RA 3WGIA 2M0CA 4ABZA 5FKKA 3G4SI 2G7LA 2O03A 2PN6A 2M1BA 3NI7A 4XIDA 1B72B 4GRIA 4BJ6C 3DKWA 2Q1ZB 1KYWA 2LREA 2ZMEC 4A5MA 3BJ6A 5B5EC 1W4MA 1I3AA 2IGMA 4FE4A 2B7EA 2CUZA 1BOBA 3ZQGA 2R7XA 1IAWA 1UG0A 1XCVA 4B43A 2L2OA 2F5VA 4HLYA 3JTHA 3DF8A 3KP5A 5GAGJ 3P7NA 4G9YA 1MSFC 2V9VA 2Q0OA 3G2BA 3UNGC 5CVUA 5IT9Z 3GWZA 2GXAA 4C3JJ 4MEYF 2G7GA 2LDUA 3HG9A 4LOCA 3TMOA 3BQYA 3K10A 2O0YA 3C07A 3MKYB 3CDHA 4KIFA 2BY3A 4LLLA 5B3SH 3ZQLA 2HTSA 2JQ7A 3M8JA 3MAJA 5B1AH 3OYEA 1BJAA 1UHSA 4YFKF 4XBFA 2EBIA 3M4OJ 1X3UA 2LP0A 3M9AA 1G3TA 4NNJA 1LB2A 2E7XA 1QQIA 4D0PA 2ISZA 2DA5A 4BXXJ 1IRGA 3I58A 5L3CA 2Y30A 2PI0A 2F48A 2ESHA 2DA3A 4ESBA 4UXNA 3QAHA 2Y48A 3HRUA 3A01B 2XGXA 2HU9A 1B9MA 2VB6A 3OYGA 2ZJPF 4FCYA 3WTUC 3D1NI 1R9TJ 1ZREA 1ZGAA 3OR1C 2V1UA 2CUFA 2VQCA 5LEKA 5EGOB 4HEA2 4NC8A 4F3QA 1ITYA 2XF6A 4M3BA 4NC6A 3OMYA 2DPUA 1QA6A 3PO3J 3S1QJ 1BI1A 4BQOA 4RBOA 3T1BA 2GIVA 1TZLA 3MFKA 4EGZA 2WAQN 2HTJA 5D4RA 5HNHA 5F64A 4MHGA 3RPUA 1RZ4A 3F3XA 4R79A 1A35A 1P92A 1VZ0A 1MNDA 3F0CA 2K86A 1ERDA 4O5VA 3DBLB 4XRSG 5KVRA 2I5UA 3LJLA 3FKIJ 2QGUA 4RAZA 4RLFA 2HOAA 3GXOA 4E7IA 3H0DA 1UFMA 4AD9A 3P5JA 2V6CA 2DFEA 3NNRA 3DKXA 1NK2P 3VP5A 3DQVC 1B72A 3KKCA 3TQNA 4KUMA 5KHDA 2OD5A 5JVTA 1GXQA 3DPTA 3VFZA 4DVYP 2NVUB 2MW8A 3KYCB 3DBRB 3G71I 3U2RA 3ELKA 1IO2A 1ETXA 4NC7A 3FMSA 2L01A 4Q48A 1HF0A 1G3WA 2HYGD 3OYKA 3PQKA 2WWYA 2H09A 5D18A 2JA5J 3KNWA 5K5OA 1ZR4A 1H8AC 2NNYA 3J81K 4QIWN 2QKLB 4X1EA 3CJDA 3CC4I 1T33A 1IW7F 1ULYA 2OI8A 2VASA 5K58A 1UHWA 4BUPA 2ZCXA 2HYFA 1QZZA 2FQ4A 1USSA 4L5IA 2FJI1 3G7RA 4GCKA 1B8IB 2QOPA 5DCFA 1JKOC 4P1WA 4D5CA 4M6YA 2RAEA 1J59A 3S15J 1IGNA 2E1OA 2NXNB 5C3EJ 4CZZA 4FTHA 3A0HC 3E5UA 2L54A 3BHQA 4L5JA 5HDGA 4L9VA 2QYOA 1HOMA 3MKLA 3K1MA 2P6TA 6PAXA 2XVCA 3DTEA 1XMKA 1Y8RB 5LHGA 3A01A 2IS2A 1IF1A 3CP8A 4FETA 1A5JA 5KCMA 5JI6A 1Z1DA 3ECHA 4UVBA 2DA1A 2NS0A 3OIPA 3R60A 1N75A 5EGOA 1MBJA 2XPVA 3E5XA 5IP6A 3CMMA 4A0XA 1K7AA 3GVAA 1XS9A 1BL0A 1KQ8A 3L2CA 2ZJ2A 1X1BA 1J09A 3GZ5A 2RKHA 4U7BA 1IXRC 3QODA 1PP8F 3GTLJ 3WHBA 2BE5F 1TWHJ 3BG9A 3PQJA 2NS7A 4UV8A 1HKQA 4K2EA 2JSPA 5CXGA 1P4XA 2ZKZA 4DGWB 2O3FA 5LBQA 4JQFA 3COAC 1KU3A 5AONA 2FD5A 1OCRH 1HSJA 5EFYA 2NOJB 4A3EJ 3CRJA 3BP8A 4WXCA 4DZPA 4CUGA 3WTWC 3BCGA 1T0FA 5FO5A 3GW2A 3SZTA 1F5TA 2ME0A 1OYIA 4E7KA 4BS9A 1U8BA 3K69A 3VW2A 2BBYA 1DU6A 1OR7A 4EATA 3X2QH 2PJPA 4LD5A 3VSLA 2LD5A 1ZAOA 5JHFA 2K85A 3V8KA 4A6EA 3C3WA 4D1QA 4ENMA 4PJNA 2CWEA 2Y31A 2MD0A 3TL4X 3OYIA 3LHQA 3CF5F 2EFNA
chains in the Genus database with same CATH topology
3V78A 2DJNA 5IYBJ 1GV2A 5JLWA 2XSDC 4G12A 5DAJA 5E3NA 3GTOJ 4M3DA 3HGYA 2DA6A 1UMQA 5EDNA 4JKZA 4W97A 3HDDA 4CGRA 4GFLA 3BT9A 3BG3A 3AQTA 1FTZA 1I3QJ 2L7MP 1B8IA 2LVSA 2H1KA 3Q3SA 2O8KA 1CQTA 3TP0A 5J1YA 1IG7A 5E3OA 2XDNA 3ON2A 3RD3A 4M3GA 5FKLA 3LSJA 2L7ZA 4AUXA 1F36A 5CW8A 1ZTRA 2OPTA 3B6CA 5EEAA 5FLVA 3JSJA 2GLOA 5F0CA 1GUUA 2QCOA 3BTLA 2X9DA 1HLVA 4UDSA 2EQRA 3OIOA 3WHCA 1ETOA 3BR6A 3JRFA 5FGLA 2XGCA 1PUFB 4AF5A 4IHXA 3TW6A 5HAWA 5IYCJ 5D19A 1HCRA 2FX0A 3HBLA 1JJ6C 5J1UA 2CRGA 1U9NA 5GPCA 1OJLA 2RASA 3G56A 3HTIA 2REKA 4DYCA 2CUEA 3S17J 2JA7J 1Y1VJ 3B6AA 3EGQA 4I6ZA 2HDDA 2LFBA 2O7OA 4DYQA 1X58A 5IOZA 3TW7A 4A3KJ 3C2BA 2JJ7A 1AKHB 3HTJA 4JYKA 2ZOZA 3RZOJ 2KDZA 3UKGA 2R5ZA 3K7AJ 1JKQC 3BTIA 2WUIA 5M5XJ 3IUVA 2EZIA 2LY9A 3LSGA 2XB0X 4GFKA 2IBDA 2NX4A 4V2FA 3ZQIA 2M2EA 1MBEA 2NS8A 4A3JJ 4B3AA 1W0UA 4JNNA 2GM4A 2LK2A 1GVDA 3JRGA 3S1MJ 2VPRA 2XPUA 2QF7A 1HDDC 5J1RA 2KT0A 3HOXJ 5F08A 2ECBA 1OFCX 3RH2A 1NTCA 2PZ9A 2AO9A 3MN2A 3VVZA 3CCYA 3GTMJ 1MBFA 4NN1A 3IV5A 1Z0XA 4MIMA 1QVUA 3NAUA 1BW6A 1JUPA 4I76A 3H0GJ 1HDPA 5BNGA 3HB9A 5M5YJ 5IYDJ 1IJWC 2R93J 2R5YB 5M3FJ 1MBKA 1P7JA 3FIWA 3GTJJ 2K9QA 2WGBA 3BR3A 5EZHA 3V6GA 1WH7A 3Q0WA 3MVPA 3RKQA 1LE8B 3E7QA 4JL3A 4A3GJ 3BR2A 4ACIA 2D6YA 3BRUA 3G1LA 3HTAA 4IEJA 4B4CA 3BR1A 3P9TA 5DS9A 2D5VA 2VI6A 1T56A 1ZGWA 3HOVJ 4FISA 3GBGA 3VVYA 4EEFG 2I10A 1MSEC 2NP5A 4A3IJ 5C4XJ 1SGMA 2UXIA 1BJZA 1O4XA 2ZOYA 2ECCA 3MNLA 3DCFA 3TP3A 2DG8A 1LFUP 4A3BJ 4BY1J 1SFOJ 1UI5A 2OERA 1W0TA 4KWAA 3FK6A 4AYBN 2CU7A 4Y7NJ 2MG4A 3S5RA 2GBYA 1ZQ3P 2ZCMA 1IV6A 1PUFA 3PPBA 1K83J 3RZDJ 2YS9A 5HSZA 3LNQA 2YUSA 1A6IA 1RKTA 3HOWJ 4HKUA 2ID6A 2JN6A 4AC0A 5F1JA 5FKNA 2R0QC 2NVXJ 1JJ8C 4AC6A 1ETVA 3QQAA 1MH4A 3ANGA 1MH3A 2XRLA 3ANPA 5FHPA 3HKZN 5FKOA 1UI6A 4PXIA 1Q1VA 1UG2A 1ETQA 2XPWA 3BR0A 2GUHA 5M3MJ 2O9LA 1JKRC 4L5EA 2WV1A 3VW0A 4L62A 3K2AA 3VVXA 1GT0C 1WCMJ 1FTTA 2E19A 1QPIA 2MGQA 1ZKGA 2LTPA 3HOYJ 1IDZA 2LLKA 1JT6A 1RPWA 3HTHA 3SDGA 4BBRJ 2M8GX 2P81A 3BTJA 4QTRA 5H9TA 3PO2J 5EZGA 1I6HJ 2JA8J 4IHVA 3VUQA 4V2GA 2IU5A 3IH3A 1RKWA 2VUMJ 2COBA 2H8RA 4D7MA 1XC5A 3E7LA 4UUTA 3KKDA 5E3MA 2UXPA 3LSPA 2HI3A 1POGA 3VPRA 2L7FP 4JX6A 3ZQFA 4XRMA 3I4NJ 2L0KA 1U78A 2DMPA 3PM1A 4M3EA 5JLXA 2R92J 1X2MA 3F1BA 2DMUA 4ME9A 1ENHA 5C4YA 2R5YA 1VI0A 4DZJA 4A3DJ 3JRDA 1MBGA 2WB1N 4B1RA 1S7EA 2JK3A 3IH2A 3NRGA 3VOKA 3S1NJ 3B81A 1LE8A 4MK6A 2N8GA 4UUSB 2HOSA 1RESA 1APLC 1RETA 5EG0B 3H3VK 4BBSJ 3AQSA 2NVYJ 1WH5A 2IEKA 4XICA 1U9OA 5EF6A 4HNVA 2TCTA 4NDLA 2M0CA 4ABZA 5FKKA 5FLMJ 2Y0SN 2G7LA 3JRIA 3NI7A 1FJLA 4XIDA 1B72B 2NVQJ 2JMWA 2NP3A 2CJJA 1Z77A 4S0HB 4ICHA 3FK7A 5DTDA 1Y1WJ 3HIMA 3BTCA 1H88C 3HOZJ 4FE4A 2NOGA 4DW6A 1WI3A 2DMNA 5M5WJ 2CQQA 4MLOA 2MSYA 1BW5A 3ZQGA 4X6AJ 1E3OC 5F0HA 1ZR2A 4JX5A 2HYTA 4CYCB 2G0EA 3Q0VA 3DEWA 4DYRA 3LOCA 4YZEA 1ETYA 1MSFC 1G2HA 1I50J 1IC8A 3CMYA 4C3JJ 3CQZJ 2G7GA 1VF9A 3GTKJ 4LOCA 3BQYA 2Y2ZA 2ZB9A 3C07A 3NXCA 3GEUA 2YVHA 1FIPA 4A3FJ 3ZQLA 4GCTA 3QBMA 3G1OA 3GTQJ 5D1RA 1UHSA 2EBIA 3M4OJ 2LP0A 5IOYA 1X2NA 4BXXJ 2DA5A 2B63J 2X6OA 1VFCA 4C2MJ 1WPKA 2Y30A 1RR7A 5C44J 2DA3A 3Q0UA 3I4MJ 2ZCNA 2R7ZJ 3QKXA 3A01B 1ETWA 5F04A 1F43A 4JX4A 4FCYA 1R9TJ 3D1NI 1FEXA 2CUFA 3BG5A 4XK4A 2F07A 3FISA 5EGOB 3S2HJ 3IH4A 2XGDA 2DG7A 1OCTC 1AHDP 1ITYA 1QRYA 4M3BA 4NELA 2M34A 1JT0A 3PO3J 4C3IJ 4RBOA 3S1QJ 2YVEA 1NK3P 3BQZA 2WAQN 4MFDA 2X48A 1AKHA 1FIAA 4M6VA 2DMTA 1JKPC 4A3MJ 2E2HJ 2DA7A 1XG1A 2ELKA 3F0CA 1MBHA 3KZ9A 1GV5A 2K40A 3SFIA 4XRSG 5IP7J 3SJMA 1EF4A 3LJLA 4UUSA 4IHYA 3GZIA 3COLA 2QKOA 3FKIJ 3TEDA 3G1MA 2FJ1A 5EG0A 2HOAA 1DU0A 1ETKA 3ON4A 2YU9J 3PASA 2FBQA 2JWTA 2E2IJ 2AHQA 1YRNB 2CQXA 4M3FA 3NNRA 1NK2P 2PBXA 1OCPA 3S1RJ 3VP5A 2G7SA 4A69C 3ZQCA 1H89C 1B72A 3KKCA 2HXIA 1TWCJ 2TRTA 2W48A 3VOXA 4BKXA 2MW8A 4FE7A 1AU7A 1BA5A 3JRCA 4A3LJ 5HODA 3LSRA 2DA2A 1ETXA 4XRSA 3L1PA 1HF0A 1QVTA 1TC3C 5D18A 2JA5J 3NARA 3KNWA 5K7FA 2DN0A 4CYCA 1ZR4A 4GFBA 1H8AC 3S14J 3BR5A 4Y52J 4JP0A 2RHAA 5FMPA 4QIWN 4X1EA 4D7NA 3HOUJ 3CJDA 1T33A 3OOUA 5K7ZA 3RQIA 2OI8A 3HGGA 3S16J 5K58A 2OF7A 2M9HA 3ZOBA 4J19A 3QPLA 2ZCXA 3EUPA 2FQ4A 5FKMA 4BY7J 2ME6A 3NPIA 1JUSA 3G7RA 2HQ5A 3O8GA 3CDLA 3FRQA 3T6NA 4GCKA 2UXHA 1B8IB 2QOPA 1JKOC 2EZKA 4D5CA 2QWTA 2RAEA 3S15J 1IGNA 2XGEA 5GP9A 3HEFA 3ZQHA 2E1OA 5C3EJ 3A03A 4FTHA 2L9RA 5F27A 3GTGJ 3BHQA 3CWRA 1HOMA 4GCLA 3VIBA 3MKLA 1GDTA 2GFNA 2Y9YA 2VKEA 2K9SA 1IUFA 2LR8A 4MFEA 4W1UA 5IP9J 3A01A 4IHWA 3HM5A 1TWAJ 1IRZA 1A5JA 2PMZN 2EZLA 3HE0A 2XB5A 2DA1A 2HOTA 2JA6J 1D5YA 5EGOA 1MBJA 2XPVA 1ORKA 5IP6A 2EH3A 2O7TA 2VKVA 1JGGA 1XS9A 2GENA 2NVTJ 3M3YJ 4D5FA 2HXOA 1VNDA 1BL0A 9ANTA 2HKUA 3A02A 5GPAA 4MXMA 3GTLJ 3WHBA 5FJ8J 1TWHJ 3BG9A 3OSFA 1TWGJ 2DMQA 4C3HJ 3JR9A 5E3LA 2NS7A 2QIBA 5CXGA 3GTPJ 5C4JJ 2R5ZB 2EZHA 1LFBA 4RDUA 1JTYA 3S2DJ 2FD5A 4A3CJ 2K9NA 3W6VA 2DTZA 1K61A 5J3LA 5EFYA 5AQCA 4A3EJ 2Y9ZA 3CRJA 1MNMC 1WGXA 4DZPA 1YRNA 5IPAA 3BCGA 3OSGA 3JREA 2LKXA 1JUMA 2ME0A 1U8BA 3O8HA 3BJBA 3LWJA 5HBUA 2IAIA 3VW2A 1P7IA 2E2JJ 5CXIA 1DU6A 2UXOA 3JRBA 4A93J 3JRHA 3QPSA 2DA4A 2W53A 2LD5A 3DPJA 2ID3A 3JRAA 2Q24A 3BNIA 2V57A 5F0FA 1SANA 1TWFJ 2Y31A 5K7HA 2QTQA 3O60A 3VW1A 4QSHA 1JTXA 3LHQA 2UXUA 1ZK8A 1IDYA 4MO7A 2HYJA 2G3BA 5EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V78 A;  2DJN A;  5IYB J;  1GV2 A;  5JLW A;  2XSD C;  4G12 A;  5DAJ A;  5E3N A;  3GTO J;  4M3D A;  3HGY A;  2DA6 A;  1UMQ A;  5EDN A;  4JKZ A;  4W97 A;  3HDD A;  4CGR A;  4GFL A;  3BT9 A;  3BG3 A;  3AQT A;  1FTZ A;  1I3Q J;  2L7M P;  1B8I A;  2LVS A;  2H1K A;  3Q3S A;  2O8K A;  1CQT A;  3TP0 A;  5J1Y A;  1IG7 A;  5E3O A;  2XDN A;  3ON2 A;  3RD3 A;  4M3G A;  5FKL A;  3LSJ A;  2L7Z A;  4AUX A;  1F36 A;  5CW8 A;  1ZTR A;  2OPT A;  3B6C A;  5EEA A;  5FLV A;  3JSJ A;  2GLO A;  5F0C A;  1GUU A;  2QCO A;  3BTL A;  2X9D A;  1HLV A;  4UDS A;  2EQR A;  3OIO A;  3WHC A;  1ETO A;  3BR6 A;  3JRF A;  5FGL A;  2XGC A;  1PUF B;  4AF5 A;  4IHX A;  3TW6 A;  5HAW A;  5IYC J;  5D19 A;  1HCR A;  2FX0 A;  3HBL A;  1JJ6 C;  5J1U A;  2CRG A;  1U9N A;  5GPC A;  1OJL A;  2RAS A;  3G56 A;  3HTI A;  2REK A;  4DYC A;  2CUE A;  3S17 J;  2JA7 J;  1Y1V J;  3B6A A;  3EGQ A;  4I6Z A;  2HDD A;  2LFB A;  2O7O A;  4DYQ A;  1X58 A;  5IOZ A;  3TW7 A;  4A3K J;  3C2B A;  2JJ7 A;  1AKH B;  3HTJ A;  4JYK A;  2ZOZ A;  3RZO J;  2KDZ A;  3UKG A;  2R5Z A;  3K7A J;  1JKQ C;  3BTI A;  2WUI A;  5M5X J;  3IUV A;  2EZI A;  2LY9 A;  3LSG A;  2XB0 X;  4GFK A;  2IBD A;  2NX4 A;  4V2F A;  3ZQI A;  2M2E A;  1MBE A;  2NS8 A;  4A3J J;  4B3A A;  1W0U A;  4JNN A;  2GM4 A;  2LK2 A;  1GVD A;  3JRG A;  3S1M J;  2VPR A;  2XPU A;  2QF7 A;  1HDD C;  5J1R A;  2KT0 A;  3HOX J;  5F08 A;  2ECB A;  1OFC X;  3RH2 A;  1NTC A;  2PZ9 A;  2AO9 A;  3MN2 A;  3VVZ A;  3CCY A;  3GTM J;  1MBF A;  4NN1 A;  3IV5 A;  1Z0X A;  4MIM A;  1QVU A;  3NAU A;  1BW6 A;  1JUP A;  4I76 A;  3H0G J;  1HDP A;  5BNG A;  3HB9 A;  5M5Y J;  5IYD J;  1IJW C;  2R93 J;  2R5Y B;  5M3F J;  1MBK A;  1P7J A;  3FIW A;  3GTJ J;  2K9Q A;  2WGB A;  3BR3 A;  5EZH A;  3V6G A;  1WH7 A;  3Q0W A;  3MVP A;  3RKQ A;  1LE8 B;  3E7Q A;  4JL3 A;  4A3G J;  3BR2 A;  4ACI A;  2D6Y A;  3BRU A;  3G1L A;  3HTA A;  4IEJ A;  4B4C A;  3BR1 A;  3P9T A;  5DS9 A;  2D5V A;  2VI6 A;  1T56 A;  1ZGW A;  3HOV J;  4FIS A;  3GBG A;  3VVY A;  4EEF G;  2I10 A;  1MSE C;  2NP5 A;  4A3I J;  5C4X J;  1SGM A;  2UXI A;  1BJZ A;  1O4X A;  2ZOY A;  2ECC A;  3MNL A;  3DCF A;  3TP3 A;  2DG8 A;  1LFU P;  4A3B J;  4BY1 J;  1SFO J;  1UI5 A;  2OER A;  1W0T A;  4KWA A;  3FK6 A;  4AYB N;  2CU7 A;  4Y7N J;  2MG4 A;  3S5R A;  2GBY A;  1ZQ3 P;  2ZCM A;  1IV6 A;  1PUF A;  3PPB A;  1K83 J;  3RZD J;  2YS9 A;  5HSZ A;  3LNQ A;  2YUS A;  1A6I A;  1RKT A;  3HOW J;  4HKU A;  2ID6 A;  2JN6 A;  4AC0 A;  5F1J A;  5FKN A;  2R0Q C;  2NVX J;  1JJ8 C;  4AC6 A;  1ETV A;  3QQA A;  1MH4 A;  3ANG A;  1MH3 A;  2XRL A;  3ANP A;  5FHP A;  3HKZ N;  5FKO A;  1UI6 A;  4PXI A;  1Q1V A;  1UG2 A;  1ETQ A;  2XPW A;  3BR0 A;  2GUH A;  5M3M J;  2O9L A;  1JKR C;  4L5E A;  2WV1 A;  3VW0 A;  4L62 A;  3K2A A;  3VVX A;  1GT0 C;  1WCM J;  1FTT A;  2E19 A;  1QPI A;  2MGQ A;  1ZKG A;  2LTP A;  3HOY J;  1IDZ A;  2LLK A;  1JT6 A;  1RPW A;  3HTH A;  3SDG A;  4BBR J;  2M8G X;  2P81 A;  3BTJ A;  4QTR A;  5H9T A;  3PO2 J;  5EZG A;  1I6H J;  2JA8 J;  4IHV A;  3VUQ A;  4V2G A;  2IU5 A;  3IH3 A;  1RKW A;  2VUM J;  2COB A;  2H8R A;  4D7M A;  1XC5 A;  3E7L A;  4UUT A;  3KKD A;  5E3M A;  2UXP A;  3LSP A;  2HI3 A;  1POG A;  3VPR A;  2L7F P;  4JX6 A;  3ZQF A;  4XRM A;  3I4N J;  2L0K A;  1U78 A;  2DMP A;  3PM1 A;  4M3E A;  5JLX A;  2R92 J;  1X2M A;  3F1B A;  2DMU A;  4ME9 A;  1ENH A;  5C4Y A;  2R5Y A;  1VI0 A;  4DZJ A;  4A3D J;  3JRD A;  1MBG A;  2WB1 N;  4B1R A;  1S7E A;  2JK3 A;  3IH2 A;  3NRG A;  3VOK A;  3S1N J;  3B81 A;  1LE8 A;  4MK6 A;  2N8G A;  4UUS B;  2HOS A;  1RES A;  1APL C;  1RET A;  5EG0 B;  3H3V K;  4BBS J;  3AQS A;  2NVY J;  1WH5 A;  2IEK A;  4XIC A;  1U9O A;  5EF6 A;  4HNV A;  2TCT A;  4NDL A;  2M0C A;  4ABZ A;  5FKK A;  5FLM J;  2Y0S N;  2G7L A;  3JRI A;  3NI7 A;  1FJL A;  4XID A;  1B72 B;  2NVQ J;  2JMW A;  2NP3 A;  2CJJ A;  1Z77 A;  4S0H B;  4ICH A;  3FK7 A;  5DTD A;  1Y1W J;  3HIM A;  3BTC A;  1H88 C;  3HOZ J;  4FE4 A;  2NOG A;  4DW6 A;  1WI3 A;  2DMN A;  5M5W J;  2CQQ A;  4MLO A;  2MSY A;  1BW5 A;  3ZQG A;  4X6A J;  1E3O C;  5F0H A;  1ZR2 A;  4JX5 A;  2HYT A;  4CYC B;  2G0E A;  3Q0V A;  3DEW A;  4DYR A;  3LOC A;  4YZE A;  1ETY A;  1MSF C;  1G2H A;  1I50 J;  1IC8 A;  3CMY A;  4C3J J;  3CQZ J;  2G7G A;  1VF9 A;  3GTK J;  4LOC A;  3BQY A;  2Y2Z A;  2ZB9 A;  3C07 A;  3NXC A;  3GEU A;  2YVH A;  1FIP A;  4A3F J;  3ZQL A;  4GCT A;  3QBM A;  3G1O A;  3GTQ J;  5D1R A;  1UHS A;  2EBI A;  3M4O J;  2LP0 A;  5IOY A;  1X2N A;  4BXX J;  2DA5 A;  2B63 J;  2X6O A;  1VFC A;  4C2M J;  1WPK A;  2Y30 A;  1RR7 A;  5C44 J;  2DA3 A;  3Q0U A;  3I4M J;  2ZCN A;  2R7Z J;  3QKX A;  3A01 B;  1ETW A;  5F04 A;  1F43 A;  4JX4 A;  4FCY A;  1R9T J;  3D1N I;  1FEX A;  2CUF A;  3BG5 A;  4XK4 A;  2F07 A;  3FIS A;  5EGO B;  3S2H J;  3IH4 A;  2XGD A;  2DG7 A;  1OCT C;  1AHD P;  1ITY A;  1QRY A;  4M3B A;  4NEL A;  2M34 A;  1JT0 A;  3PO3 J;  4C3I J;  4RBO A;  3S1Q J;  2YVE A;  1NK3 P;  3BQZ A;  2WAQ N;  4MFD A;  2X48 A;  1AKH A;  1FIA A;  4M6V A;  2DMT A;  1JKP C;  4A3M J;  2E2H J;  2DA7 A;  1XG1 A;  2ELK A;  3F0C A;  1MBH A;  3KZ9 A;  1GV5 A;  2K40 A;  3SFI A;  4XRS G;  5IP7 J;  3SJM A;  1EF4 A;  3LJL A;  4UUS A;  4IHY A;  3GZI A;  3COL A;  2QKO A;  3FKI J;  3TED A;  3G1M A;  2FJ1 A;  5EG0 A;  2HOA A;  1DU0 A;  1ETK A;  3ON4 A;  2YU9 J;  3PAS A;  2FBQ A;  2JWT A;  2E2I J;  2AHQ A;  1YRN B;  2CQX A;  4M3F A;  3NNR A;  1NK2 P;  2PBX A;  1OCP A;  3S1R J;  3VP5 A;  2G7S A;  4A69 C;  3ZQC A;  1H89 C;  1B72 A;  3KKC A;  2HXI A;  1TWC J;  2TRT A;  2W48 A;  3VOX A;  4BKX A;  2MW8 A;  4FE7 A;  1AU7 A;  1BA5 A;  3JRC A;  4A3L J;  5HOD A;  3LSR A;  2DA2 A;  1ETX A;  4XRS A;  3L1P A;  1HF0 A;  1QVT A;  1TC3 C;  5D18 A;  2JA5 J;  3NAR A;  3KNW A;  5K7F A;  2DN0 A;  4CYC A;  1ZR4 A;  4GFB A;  1H8A C;  3S14 J;  3BR5 A;  4Y52 J;  4JP0 A;  2RHA A;  5FMP A;  4QIW N;  4X1E A;  4D7N A;  3HOU J;  3CJD A;  1T33 A;  3OOU A;  5K7Z A;  3RQI A;  2OI8 A;  3HGG A;  3S16 J;  5K58 A;  2OF7 A;  2M9H A;  3ZOB A;  4J19 A;  3QPL A;  2ZCX A;  3EUP A;  2FQ4 A;  5FKM A;  4BY7 J;  2ME6 A;  3NPI A;  1JUS A;  3G7R A;  2HQ5 A;  3O8G A;  3CDL A;  3FRQ A;  3T6N A;  4GCK A;  2UXH A;  1B8I B;  2QOP A;  1JKO C;  2EZK A;  4D5C A;  2QWT A;  2RAE A;  3S15 J;  1IGN A;  2XGE A;  5GP9 A;  3HEF A;  3ZQH A;  2E1O A;  5C3E J;  3A03 A;  4FTH A;  2L9R A;  5F27 A;  3GTG J;  3BHQ A;  3CWR A;  1HOM A;  4GCL A;  3VIB A;  3MKL A;  1GDT A;  2GFN A;  2Y9Y A;  2VKE A;  2K9S A;  1IUF A;  2LR8 A;  4MFE A;  4W1U A;  5IP9 J;  3A01 A;  4IHW A;  3HM5 A;  1TWA J;  1IRZ A;  1A5J A;  2PMZ N;  2EZL A;  3HE0 A;  2XB5 A;  2DA1 A;  2HOT A;  2JA6 J;  1D5Y A;  5EGO A;  1MBJ A;  2XPV A;  1ORK A;  5IP6 A;  2EH3 A;  2O7T A;  2VKV A;  1JGG A;  1XS9 A;  2GEN A;  2NVT J;  3M3Y J;  4D5F A;  2HXO A;  1VND A;  1BL0 A;  9ANT A;  2HKU A;  3A02 A;  5GPA A;  4MXM A;  3GTL J;  3WHB A;  5FJ8 J;  1TWH J;  3BG9 A;  3OSF A;  1TWG J;  2DMQ A;  4C3H J;  3JR9 A;  5E3L A;  2NS7 A;  2QIB A;  5CXG A;  3GTP J;  5C4J J;  2R5Z B;  2EZH A;  1LFB A;  4RDU A;  1JTY A;  3S2D J;  2FD5 A;  4A3C J;  2K9N A;  3W6V A;  2DTZ A;  1K61 A;  5J3L A;  5EFY A;  5AQC A;  4A3E J;  2Y9Z A;  3CRJ A;  1MNM C;  1WGX A;  4DZP A;  1YRN A;  5IPA A;  3BCG A;  3OSG A;  3JRE A;  2LKX A;  1JUM A;  2ME0 A;  1U8B A;  3O8H A;  3BJB A;  3LWJ A;  5HBU A;  2IAI A;  3VW2 A;  1P7I A;  2E2J J;  5CXI A;  1DU6 A;  2UXO A;  3JRB A;  4A93 J;  3JRH A;  3QPS A;  2DA4 A;  2W53 A;  2LD5 A;  3DPJ A;  2ID3 A;  3JRA A;  2Q24 A;  3BNI A;  2V57 A;  5F0F A;  1SAN A;  1TWF J;  2Y31 A;  5K7H A;  2QTQ A;  3O60 A;  3VW1 A;  4QSH A;  1JTX A;  3LHQ A;  2UXU A;  1ZK8 A;  1IDY A;  4MO7 A;  2HYJ A;  2G3B A;  5EYR A; 
#chains in the Genus database with same CATH topology
 3V78 A;  2DJN A;  2XSD C;  3ZN0 A;  2XAJ A;  4F52 A;  1FMV A;  2OA4 A;  1BC7 C;  2DA6 A;  5EDN A;  2WY7 Q;  3B02 A;  4U0W A;  2HR3 A;  1JGS A;  3CUO A;  1B8I A;  5D6F A;  3D5R C;  2H1K A;  2O8K A;  4PJJ A;  1XDU A;  3FXJ A;  4HNT A;  3K1P A;  5J1Y A;  1MZB A;  2D45 A;  5E3O A;  2L7Z A;  4AUX A;  2OUM A;  2PMH A;  5CW8 A;  1RC9 A;  2DOD A;  1JE8 A;  1YOV B;  3ZMU A;  1D8K A;  2IT0 A;  1ONV A;  2KRF A;  1R6R A;  1HLV A;  4UDS A;  2IXS A;  2R7O A;  2EQR A;  4FT8 A;  5CLS A;  3WHC A;  3KPH A;  2HVQ A;  4UVA A;  2IS4 A;  2XGC A;  1PUF B;  4AF5 A;  3ASN H;  2YR2 A;  3CO7 C;  4YIF A;  5D19 A;  1V54 H;  4AIH A;  2K4J A;  5ERI A;  2X1D A;  2FX0 A;  1XSX A;  1SFU A;  2R7T A;  1U9N A;  3J7Z I;  5GPC A;  1UZC A;  4HZF A;  4U9L A;  2GA1 A;  4YFN F;  4G7O F;  2E1N A;  1FYL A;  2HDD A;  2BY0 A;  2LFB A;  2O7O A;  4KJZ A;  4DYQ A;  4UUV A;  2KIM A;  2XAG A;  3TW7 A;  3ERE D;  3C2B A;  4DJA A;  1Z05 A;  1B4A A;  2ZOZ A;  3RZO J;  1O7F A;  1D1A A;  1U5T C;  2GXG A;  1K4S A;  2MH9 A;  3PFY A;  3I71 A;  3O6B B;  3IUV A;  1BBY A;  1R36 A;  2M8E A;  2IW5 A;  4RB2 C;  2A2F X;  1UST A;  4V2F A;  3GLL A;  2M2E A;  2DFF A;  1MBE A;  2NS8 A;  4G94 A;  4IX7 A;  2M7B A;  4EJT A;  1I39 A;  5FRM A;  2KHM A;  1W0U A;  2DU9 A;  1Z9C A;  1GXP A;  1GVD A;  3CD6 I;  2QBY B;  3AG2 H;  2ZSI B;  5F08 A;  3OYC A;  3R4K A;  1NTC A;  1YJW I;  2PZ9 A;  4GYI A;  1VQ6 I;  2LY1 A;  2RNJ A;  3MMY B;  1P2F A;  5EEG A;  3VYR B;  4BAC A;  4PJ0 C;  1JUP A;  1WRJ A;  3H5R A;  5BNG A;  3PIO F;  1K4T A;  1W36 D;  5FGM A;  2R5Y B;  1YX5 A;  2JPC A;  1MMG A;  2VL8 A;  1YS7 A;  3PFI A;  3JSP A;  3Q0W A;  3V6G A;  2ZO4 A;  3E7Q A;  2KPM A;  2D6Y A;  4HF2 A;  4IEJ A;  3LQQ A;  1J5Y A;  2VBZ A;  2FOK A;  3J80 K;  1T56 A;  4Z6Y A;  4N9H A;  1WJB A;  5HLT A;  1X19 A;  1X4P A;  2DOF A;  2XAF A;  4A0Y A;  2R7V A;  4A12 A;  1RUO A;  2RVC A;  3K70 D;  2ECC A;  3TP3 A;  1LFU P;  4G6T B;  3E3V A;  1SFO J;  4KA4 A;  5HDN A;  3KE2 A;  5GAH J;  1W0T A;  3W3C A;  3FK6 A;  4KWA A;  3E6C C;  2W00 A;  4AYB N;  4ZDO A;  3WTZ A;  2OQR A;  2MG4 A;  3CZ6 A;  5KK1 A;  4PJM A;  1XPX A;  2K27 A;  2XUB A;  2KP6 A;  1PUF A;  1ZQ3 P;  3DLA A;  1K83 J;  4LIV A;  3OL4 A;  3QWL A;  4H4K C;  4ENJ A;  1M1E B;  3LNQ A;  3RI4 A;  4BH9 A;  2A69 F;  3J81 Z;  2JN6 A;  1D0X A;  4GGG A;  5E18 F;  1VQL I;  2E34 A;  3U21 A;  1JJ8 C;  3BRO A;  3F9K A;  3HRS A;  3QQA A;  2BHZ A;  1MH3 A;  2PFB A;  3ANP A;  3CC2 I;  1FOY A;  3NWS A;  3W2A A;  1SD5 A;  1S9H A;  2BOL A;  4JOM A;  2VBW A;  3F6O A;  2J5O A;  3BR0 A;  4M9S A;  2M4G A;  3WTS C;  2WBM A;  1TT0 A;  4LMY A;  2Z5U A;  3VW0 A;  4BAY A;  4KIC A;  3VVX A;  3HRM A;  2DT7 B;  1EKE A;  2ZNY A;  1EJ9 A;  3HOY J;  4MQV A;  1S7O A;  2HGC A;  1JT6 A;  2LLK A;  1RPW A;  4I0B A;  5CVV A;  3VYT B;  2PBI A;  2M8G X;  2ZCW A;  2VON A;  4IOA F;  1I6H J;  2QBY A;  4IHV A;  3K6G A;  3VUQ A;  1HBX G;  3L09 A;  1W5T A;  1EH8 A;  2KIQ A;  3SDB A;  5ICC A;  4BE1 A;  2LMD A;  4UHT A;  2QA4 I;  4DOZ A;  3OWT A;  2UXP A;  2HI3 A;  1FC3 A;  3M8E A;  3VB2 A;  4HW0 A;  4CH7 A;  1LUJ B;  3A4C A;  4ME9 A;  2IPQ X;  1TTY A;  3K4L A;  1OCZ H;  5HS9 A;  1HW2 A;  5DUI A;  1KON A;  2R5Y A;  2MC4 A;  4DZJ A;  2UXN A;  1MBG A;  3OYH A;  3PIP F;  4M9X A;  3IAM 2;  1BOA A;  3BCA A;  3IH2 A;  4MK6 A;  3JCU C;  1NHA A;  3BG7 A;  3AG4 H;  1T38 A;  3EPZ A;  1ZG5 A;  4NUB A;  2CGP A;  4IOC F;  4I01 A;  2KIU A;  4BEH B;  4MTD A;  5EF6 A;  2TCT A;  4BJT A;  2ZFW A;  1ZRC A;  2KIF A;  4ZYE A;  2JUG A;  5GAE J;  2Y0S N;  5FLM J;  2ELJ A;  2AXL A;  2JSC A;  1G3S A;  1YHQ I;  2JMW A;  3S2W A;  2HZD A;  1VQ8 I;  2CJJ A;  4S0H B;  1U2W A;  3IWZ A;  5DTD A;  5F1R A;  3BTC A;  3W2W A;  4GDF A;  2L4M A;  3S3M A;  2KL4 A;  1KYZ A;  2DMN A;  2ZC2 A;  4X6A J;  1E3O C;  1MJA A;  3FXM A;  4PDK A;  5L3F A;  4IL6 C;  2JPB A;  2P4W A;  2X6X A;  3R0J A;  4CYC B;  1SFK A;  1WJE A;  2G0E A;  1I5Z A;  1W5C C;  3DV8 A;  1YX3 A;  3LMM A;  3Q0V A;  3WU1 B;  4DYR A;  3LOC A;  2GOM A;  3R6S A;  4RGS A;  3MZH A;  2ZXH A;  3GFI A;  1G59 A;  1I50 J;  2M5W A;  5LGT A;  2WA0 A;  1R23 A;  2A61 A;  3VOE A;  1D8J A;  4C9Y A;  3GTK J;  3D5L A;  4EM0 B;  5LD2 C;  1B9N A;  3HUG A;  3NXC A;  3GEU A;  3CLQ A;  2YVH A;  3VSK A;  5LHI A;  2A5W A;  1S3J A;  1FIP A;  3BPX A;  1FOK A;  1FWZ A;  3LST A;  4UNO A;  4GCT A;  5BS6 A;  3QBM A;  2X1E A;  4XN0 A;  5IT3 A;  3WU2 C;  5FFZ A;  3FF5 A;  2ZFU A;  3KP7 A;  2Z2S B;  1H9T A;  4BXF A;  1VFC A;  3H5N A;  1LNW A;  2P0W A;  1WPK A;  4EVI A;  1RR7 A;  2EWN A;  4JBA A;  4FAS D;  1GHC A;  1ETW A;  2CQK A;  3SQN A;  4UB8 C;  3I56 I;  2CO5 A;  1SVO A;  4HG2 A;  4HLX A;  2F07 A;  4ZDL A;  4I02 A;  2XGD A;  2DDB A;  5CQE A;  2EFP A;  1T2K A;  2DBB A;  4U88 A;  2XIG A;  3M8F A;  2CV1 A;  2XV4 S;  1JT0 A;  1PUE E;  5DM7 F;  4NEL A;  4HBL A;  3BQZ A;  3HZJ A;  2NNN A;  4M6V A;  1R4M B;  2PJR B;  4A3M J;  3QPH A;  3RCO A;  2R7R A;  2QSG X;  4CCK A;  2QQA A;  2LG4 A;  2DFH A;  2LF8 A;  3MZ8 A;  1MBH A;  4OAY A;  1GV5 A;  2L9N A;  5IP7 J;  3QRF F;  4HX8 A;  4IQ4 A;  1FSE A;  1EF4 A;  5D6E A;  1YW7 A;  1YTY A;  1ETK A;  1XSD A;  4HV6 A;  3PAS A;  1P6R A;  4BEH A;  5GAD J;  5HS8 A;  2BGC A;  5L3D A;  1VQK I;  3LSH A;  4ZYH A;  2Y0S A;  2F5C A;  5FFX A;  2COM A;  3LFU A;  2B1E A;  1OCP A;  3NRV A;  3PSF A;  3ZQC A;  3DTK A;  2R7W A;  2YVX A;  2A5Y B;  2HXI A;  5BOX A;  2IA2 A;  2W48 A;  4N9I A;  1W7P B;  3ZR8 X;  2QKM B;  3OL3 A;  2XRO A;  4A3L J;  5HOD A;  3LQR A;  1LDD A;  3SHF A;  4XRS A;  3ABL H;  3L1P A;  1HA8 A;  2K02 A;  4HX7 A;  3ZXS A;  4HSR A;  1TC3 C;  3GX4 X;  2DN0 A;  4CYC A;  4GFB A;  1LDJ A;  4Q47 A;  3SXY A;  3S14 J;  3BR5 A;  4Y52 J;  3FHZ A;  5FMP A;  3HOU J;  2WC2 A;  4LK0 F;  1FSH A;  2IA1 A;  3RQI A;  3GYH X;  1XTA A;  3FXU A;  3F8N A;  2VN2 A;  3ZOB A;  2H1L A;  4IVN A;  1DGR M;  3MWM A;  4M9Z A;  4BE2 A;  3E97 A;  5FKM A;  2ME6 A;  3IRR A;  1JUS A;  3J80 Z;  1SAX A;  2XDV A;  1WJA A;  3O8G A;  2EIJ H;  3CDL A;  2ICW G;  2EZK A;  1IN7 A;  4HAM A;  1G8X A;  2IP2 A;  1REP C;  4RA2 A;  3QYB A;  3PJR A;  2X6W A;  5DM6 F;  4ESJ A;  3CWR A;  2FF4 A;  4G7H F;  4GCL A;  3TO9 A;  4L9N A;  2P7C B;  2LR8 A;  1YIO A;  5IY5 H;  2VQH A;  2H27 A;  3MKZ A;  2XF5 A;  1IRZ A;  4ENK A;  3LFK A;  1WJC A;  1XD7 A;  1PDN C;  3KP2 A;  4NBQ A;  2PMZ N;  1B6A A;  3EYI A;  2KIS A;  1HC8 A;  1LPQ A;  1D5Y A;  4XLN F;  3P9I A;  2L02 A;  5JVG F;  4E7H A;  1QU3 A;  1YJ9 I;  2DTR A;  3V7S A;  3F21 A;  2GEN A;  2F5E A;  1TNT A;  4D5F A;  2HXO A;  1VND A;  2KJB A;  1O7L A;  2J5P A;  4GXO A;  4RM2 A;  2DPD A;  4WWC A;  4C3H J;  2DYS H;  1LKX A;  2F5F A;  1N25 A;  1WJD A;  5C4J J;  4C2M A;  2HQN A;  3HHG A;  5JFR A;  3AL0 C;  4ZDP A;  5HOO A;  4II3 A;  3FX3 A;  3L2W A;  3N05 A;  4Y15 A;  2P5L C;  5J3L A;  4BHC A;  2ETH A;  1IXC A;  2KRC A;  3I64 A;  3GO5 A;  4AIJ A;  4XMY A;  1PYV A;  1UEL B;  3O8H A;  4BHB A;  2IAI A;  2QQB A;  1T6S A;  1BC8 C;  1S29 A;  1W7P A;  3BJA A;  3QPS A;  2MLG A;  2EA4 A;  3HYI A;  4LGW A;  2W53 A;  2BY2 A;  2Q8K A;  3DPJ A;  2ADU A;  4AIK A;  1UB9 A;  3BNI A;  3NWT A;  5F0F A;  2IRF G;  2QSH X;  3RKX A;  1TWF J;  5K7H A;  2QTQ A;  2WV0 A;  4LLG F;  4QSH A;  5KAI C;  1JTX A;  1ZK8 A;  1IDY A;  4MO7 A;  3CUQ B;  3H35 A;  5EYR A;  4E4H A;  2R7Q A;  2G7H A;  5IYB J;  2GOX B;  2VJJ A;  4WXH A;  2V6E A;  5DAJ A;  4ITV A;  1NG7 A;  3A0B C;  5E3N A;  2OV7 A;  2UV1 A;  2HWV A;  3HGY A;  4EJO A;  1UMQ A;  4JKZ A;  5FLX K;  4U7D A;  3BG3 A;  3V8L A;  2X51 A;  4LLN A;  1U8R A;  3VTI A;  2P8T A;  3Q3S A;  2VKH A;  5B66 C;  2LY2 A;  1OKR A;  3IKT A;  3WOD F;  1YYV A;  4YIR X;  2VBY A;  2XDN A;  1FP1 D;  4M3G A;  5FKL A;  3H1C A;  1J7K A;  1XGN A;  3ZQQ A;  2OPT A;  1R7J A;  2W84 A;  2DLL A;  3RDI A;  5EEA A;  5LEJ A;  1GLN A;  1UHM A;  4L9J A;  3REO A;  3KP4 A;  3CP2 A;  1ETO A;  4PSW A;  5FGL A;  2LOO A;  1U3E M;  4IHX A;  5DDG A;  2PMZ A;  2YU3 A;  2V9P A;  5IYC J;  3JAM K;  1A36 A;  3E6M A;  3T8R A;  3ULQ B;  3CES A;  4U0Y A;  1OPC A;  1JJ6 C;  4HRI A;  2CRG A;  1XCB A;  4EMS A;  2RAS A;  2CUE A;  4Z2Y A;  4B48 A;  4HQM A;  3B6A A;  4I6Z A;  3OS0 A;  5BMZ A;  1D1B A;  3FBI B;  5IOZ A;  4I99 C;  4A3K J;  4CYD A;  5CJ9 A;  1AKH B;  4QLC U;  5KAF C;  4IZZ A;  4WIB A;  1BIA A;  2DCE A;  3K7A J;  1JKQ C;  2VXZ A;  1YS6 A;  2FOW A;  1OYW A;  3BTI A;  3PUB A;  3SZP A;  2WUI A;  2EZI A;  4CIC A;  3LSG A;  1Y56 A;  4GFK A;  2IBD A;  1R49 A;  3KLN A;  3VYU B;  4XL9 A;  3ZQI A;  1YIJ I;  3T0Y A;  4C2U A;  4B3A A;  4JNN A;  5HNF A;  3WGH A;  2VPR A;  1HDD C;  3HOX J;  2R4G A;  1LEA A;  3RH2 A;  2ECB A;  2HQR A;  4YEJ A;  1T95 A;  4ZZD A;  3PL8 A;  2CQN A;  4BGD A;  1MBF A;  4CXF A;  1DDN A;  1RI7 A;  4MIM A;  4PFP A;  1WWX A;  1LDK B;  3T5X A;  2ZXI A;  1A6Q A;  4I76 A;  2VIX A;  3OV8 A;  3F8C A;  3CUQ A;  1IJW C;  2R93 J;  3C7J A;  1P7J A;  3H36 A;  4XLC A;  2M4K A;  3CME I;  3E5Q A;  3GTJ J;  4RB3 C;  2K9Q A;  1L0O C;  1D5V A;  1FPQ A;  1WH7 A;  3RKQ A;  1MMN A;  4RGX A;  1TL8 A;  2DYR H;  2BY1 A;  2X1C A;  4ACI A;  3WE2 A;  3G1L A;  1ZG1 A;  4YFX F;  1V5F A;  4RM3 A;  1W7P D;  3P9T A;  3RPQ A;  1SVL A;  4E6K G;  1BI0 A;  1ZGW A;  1VQ7 I;  3OY9 A;  2D5V A;  5GTI C;  3GFJ A;  2PG4 A;  2EK5 A;  3E6D A;  3VVY A;  4EEF G;  2I10 A;  4LG3 A;  4AVZ A;  1MMS A;  2XF7 A;  3FHN A;  4EM1 A;  1Y0U A;  1FMW A;  3HPH A;  4KIT B;  4BY1 J;  2OER A;  4DIQ A;  4KMF A;  2ZSH B;  1D0Z A;  1B1B A;  3UR3 C;  4CGZ A;  5CKT A;  4Y7N J;  4RAY A;  2H6B A;  4OIP F;  2ZCM A;  1IV6 A;  3QP5 A;  3O2P E;  3CJR B;  1FYK A;  1TT5 B;  2YUS A;  1A6I A;  2ESN A;  3HOW J;  2BW3 B;  1W36 C;  1T0F C;  1X1D A;  3ABM H;  1SC7 A;  3QU3 A;  5F1J A;  2HFH A;  2WY8 Q;  3MZY A;  3K4C A;  4AC6 A;  4XKC A;  1ODD A;  3B73 A;  4M71 A;  3DFG A;  5JR3 A;  1OR7 C;  4Q4Z F;  5ICF A;  2X0L A;  3W6K B;  5LFA A;  3S8P A;  3MQ0 A;  1I6X A;  5A2Q K;  5J4Y A;  3I0T A;  1W5S A;  3K4N A;  4PXI A;  1XMA A;  1Q1V A;  1UG2 A;  1ETQ A;  5D5U B;  1KZH A;  2O9L A;  1JKR C;  4L5E A;  3K70 C;  2CG4 A;  3S3O A;  2GAU A;  2GWR A;  4OIN F;  2WV1 A;  2QEN A;  1ZRF A;  3S32 A;  1PJR A;  2FXA A;  3G3Z A;  4XOR A;  1FTT A;  4HV5 A;  1ZKG A;  2KFD A;  2LTP A;  3OS2 A;  5D8L B;  2FRH A;  4F92 B;  2QZ8 A;  3HTH A;  3SDG A;  5H9T A;  4MGR A;  5E8G A;  2E1M B;  3FM3 A;  2O6G E;  2JVG A;  4I2O A;  1ZN2 A;  4V2G A;  3CCS I;  2ZXW H;  4CZC A;  4QPO A;  1EV7 A;  2DO7 A;  2V7F A;  4UY8 I;  3GEZ A;  3QOE A;  4D7M A;  4UUT A;  3E7L A;  3RKY A;  4HA8 A;  2DK5 A;  1QNT A;  3VYS B;  3VPR A;  3ZQF A;  1SAU A;  4OIR F;  3I4N J;  2L0K A;  2W1O A;  1U78 A;  2HS5 A;  3GUD A;  4A6D A;  4ZYA A;  2BV6 A;  2R92 J;  1ENH A;  5C4Y A;  4LG0 B;  1VI0 A;  5J8C A;  3GLX A;  3IC7 A;  3JRD A;  2WB1 N;  1RIO H;  1S7E A;  2QVO A;  3KEY A;  3VEP A;  4UUS B;  2HOS A;  1KU2 A;  4AVP A;  5EG0 B;  5HS7 A;  1VQ4 I;  3H3V K;  2NVY J;  1WH5 A;  3J7A Y;  1IV8 A;  2CYY A;  3MEX A;  4XIC A;  1U9O A;  3ZN1 A;  1X4O A;  2L4A A;  3KP6 A;  4HNV A;  4Y13 A;  5DV5 A;  2STW A;  2MA3 A;  1S8N A;  4BDZ A;  4O3M A;  2KRH A;  2LF7 A;  4KDP A;  4A5N A;  2P5V A;  2E7W A;  5K5R A;  4ICH A;  4OMY A;  2DT5 A;  3E6B A;  1Y1W J;  4CCL A;  1H88 C;  3HOZ J;  4HPQ A;  2NOG A;  4DW6 A;  1V5E A;  2CQQ A;  4MLO A;  2MSY A;  2CW7 A;  4HF0 A;  5J47 A;  2FQ3 A;  5F0H A;  3ZGK A;  2EIK H;  2UXX A;  3F72 A;  4KIS A;  2BW3 A;  3PNV A;  2MC3 A;  3BZK A;  1TQP A;  2X4H A;  1PP7 U;  4YZE A;  3CCJ I;  3NS4 A;  5D5W B;  1G2H A;  2AQE A;  1BR2 A;  3OOP A;  3AFH A;  2BZT A;  3CMY A;  5FLX Z;  4R8H A;  2LH9 A;  2ZB9 A;  3D0S A;  2MH2 A;  2CFX A;  4BYY A;  2Y0M A;  4DNC A;  3OYJ A;  3ERM A;  2HDC A;  1WJF A;  5D1R A;  1K6O A;  4XOT A;  4BHP A;  2F5D A;  4O6J A;  2LSO A;  5IOY A;  2OU2 A;  3QYE A;  5E79 C;  4M74 A;  4C2M J;  5C44 J;  3M1E A;  2EFW A;  3V4G A;  2VLA A;  1WJ5 A;  3Q0U A;  2ZCN A;  3FMQ A;  2R7Z J;  3QKX A;  1V55 H;  2IS1 A;  3IRQ A;  3J7A O;  5HVQ C;  1FEX A;  1R5G A;  2QQ8 A;  3JAM Z;  5HLG A;  4C2T A;  3BG5 A;  2F6C A;  4OWR B;  5GTH C;  3FIS A;  1FZP B;  2K7L A;  3S2H J;  3IH4 A;  2DG7 A;  1AHD P;  1FLI A;  1OIS A;  1QRY A;  3DLL F;  3SFZ A;  2M34 A;  1TBX A;  1XDS A;  3KET A;  3KP3 A;  5KNL A;  4AM3 A;  1NK3 P;  2HQA A;  4L18 B;  4MFD A;  4RB0 A;  5CYV A;  2IGK A;  2DMT A;  3DEU A;  1I1G A;  1YE9 A;  2WB1 A;  3L00 A;  2E2H J;  4GYG A;  3L7W A;  1ZYR F;  3DPL C;  2QEX I;  1GVJ A;  4BXU A;  1SMY F;  3SFI A;  2K40 A;  1SFX A;  2AS5 F;  2WTE A;  3KZ9 A;  2MFZ A;  1A31 A;  4UUS A;  4IHY A;  2QKO A;  5EG0 A;  2KLO A;  1DU0 A;  3ON4 A;  2YU9 J;  1P9Q C;  4BQA A;  2JWT A;  2DXI A;  3FXQ A;  2AHQ A;  2BXZ A;  2CQX A;  3H9Q A;  5J6X A;  3S1R J;  1P4A A;  2WAD A;  2G7S A;  4A69 C;  4Y3O A;  4FHT A;  4L0Z B;  2KZV A;  3OYL A;  2EIN H;  4M6X A;  2Z9O A;  1KQ0 A;  3VOX A;  4BKX A;  2Y75 A;  4FE7 A;  4Q5S F;  2DOA A;  3DPU A;  3JRC A;  4BE0 A;  2A6T A;  3F8B A;  4OAZ A;  2FML A;  3CJT B;  4G8X A;  4AID A;  5E1Z B;  1QVT A;  4XSZ F;  1JI8 A;  4ZC3 A;  4MEX F;  3NAR A;  4II2 A;  3HPG A;  3IWF A;  2R3S A;  3CJQ B;  1VTN C;  4WXD A;  5HDK A;  2ACJ A;  2RHA A;  3ZP5 A;  1Y0N A;  3OOU A;  5TJJ A;  3AG1 H;  1TW3 A;  3S16 J;  3ESW B;  4Y17 A;  5FRN A;  2V26 A;  2M9H A;  2FMY A;  3QPL A;  4J19 A;  3EUP A;  3F23 A;  4BY7 J;  1HQC A;  2VOD A;  1QZY A;  4CCN A;  3TOA A;  4ENN A;  1Z7L A;  4LJZ F;  3PUF A;  2HQ5 A;  2W4S A;  3JW4 A;  4WX9 A;  4ASN A;  2FE3 A;  1XMX A;  4R1H A;  5B1B H;  2QWT A;  4LB5 A;  1WI9 A;  2XGE A;  3F8M A;  1E17 A;  3ZQH A;  2OC6 A;  2G9W A;  2L9R A;  2RV8 A;  3GTG J;  1AOY A;  3VIB A;  2CW0 F;  1G6N A;  1S7A A;  1XGS A;  2GFN A;  2K9S A;  1IUF A;  3BG6 A;  4IRV A;  5ILV A;  4MFE A;  5IP9 J;  2HDW A;  5K5Q A;  4I98 B;  1D0Y A;  4E7S A;  5E17 F;  5JHU A;  1TWA J;  1ZEL A;  1FNN A;  4LK1 F;  4B44 A;  4WCG A;  5L3G A;  3DU6 A;  1MJ9 A;  3EUH A;  2PQ8 A;  2A3S A;  2A68 F;  3HE0 A;  2XB5 A;  4PZJ A;  4PCQ A;  2HOT A;  2V9K A;  1ORK A;  2EH3 A;  2O7T A;  2YPR A;  1JGG A;  5F6F A;  2LBF B;  3M3Y J;  2FNP A;  4ESF A;  1Z91 A;  4XNF A;  2JUC A;  2HKU A;  3A02 A;  5GPA A;  1ACI A;  1T98 A;  4EJW A;  5FJ8 J;  5A2Q Z;  2CMP A;  3JR9 A;  3Q9V A;  5E3L A;  1HW5 A;  2ZME B;  2GIZ A;  3QP6 A;  5LLQ A;  3V7R A;  3HSR A;  1LFB A;  3K0L A;  4RDU A;  3WTV C;  1JTY A;  1VQ9 I;  2PEX A;  3DWL E;  3EUH C;  2V79 A;  2DTZ A;  2OJE D;  5FD6 A;  4E7Z A;  4M73 A;  2WAF A;  3FMR A;  5AQC A;  2Y9Z A;  1LVA A;  1YG2 A;  5IPA A;  2RNG A;  4PGG A;  3OSG A;  1ZH5 A;  2LKX A;  3ZPL A;  2FSW A;  1FYM A;  1JUM A;  1D3Y A;  2XAH A;  1O3T A;  2GA2 A;  4MQ9 F;  3BJB A;  5LHH A;  1V5G A;  3NQO A;  3K4B A;  5BQT A;  3V42 A;  5FD5 A;  2OAZ A;  5AIP A;  2DA4 A;  4YG2 F;  1Z21 A;  2ZJQ F;  3CCM I;  2XAS A;  3JRA A;  4NHJ A;  2L7K A;  3K1N A;  5L3B A;  2QSF X;  3VW1 A;  1KGS A;  2VQG A;  1MJB A;  2HYJ A;  3E1S A;  3KYL A;  1QO0 D;  3LSM A;  3V7C A;  2MD5 A;  3AAF A;  2D1H A;  3BCB A;  4G12 A;  2Z3Y A;  1X1P A;  4W97 A;  4CGR A;  4GFL A;  3BT9 A;  1CF7 B;  3AQT A;  2GQQ A;  2R7D A;  1FTZ A;  3KZI C;  3LSI A;  2KMU A;  4BJ5 C;  4AU7 A;  2E5Z A;  1CQT A;  3K8P C;  1IG7 A;  5CVR A;  2W24 A;  1Q1H A;  2R7S A;  3LA7 A;  3LSJ A;  4FX4 A;  3BLY A;  1F36 A;  1R5I D;  2OCE A;  2L9S A;  5L3E A;  3B6C A;  3FXK A;  1KU7 A;  3JSJ A;  2RDP A;  3BTL A;  1MGT A;  1LVK A;  3KX2 A;  5H6R A;  3QYF A;  2Z1D A;  3JRF A;  3TDZ C;  4XSX F;  1RRJ A;  2CQ7 A;  2DK8 A;  2IA0 A;  4LIT A;  3TW6 A;  2E71 A;  2XAU A;  3VWB A;  5HAW A;  4C30 A;  3OR2 C;  3ZCO A;  4I0A A;  3NEU A;  2B0L A;  1YW8 A;  5LRS A;  2DJI A;  3KYD B;  5J1U A;  1B59 A;  1SVM A;  2L5Q A;  1UAA A;  2V1X A;  1F9N A;  3U1K A;  2LBF A;  3HTI A;  4DYC A;  1J75 A;  3HXL A;  1LFP A;  3S17 J;  2JA7 J;  1DPU A;  1IN4 A;  2L3D A;  1QGP A;  3PNT A;  1V3F A;  3BDD A;  2HVS A;  1X3W B;  3IL2 A;  2JJ7 A;  2DI3 A;  4NQW B;  4YEL A;  4JYK A;  2MLK A;  1OYY A;  2K4B A;  2ZME A;  1DP7 P;  2KDZ A;  4V19 K;  1JHH A;  3P9K A;  2V1D A;  1DPR A;  2R7F A;  2A6E F;  5M5X J;  3RTR A;  1EH7 A;  2LY9 A;  1T8I A;  2XB0 X;  4RB1 A;  3WE3 A;  2IVM A;  2M3A A;  2NX4 A;  1BI2 A;  2HKO A;  4IKF A;  1H0M A;  4YRV A;  1SMT A;  3MD2 A;  3K4J A;  4E7L A;  2BVM A;  4OD4 A;  2VE9 A;  1WFX A;  4ZZL A;  4P5O A;  4EV0 A;  4MTE A;  4P96 A;  3HOT A;  3JRG A;  3S1M J;  4P55 A;  2R7U A;  5J1R A;  2KT0 A;  2A6H F;  1T39 A;  4XLE A;  3GFL A;  3N97 A;  3MN2 A;  1VQM I;  2HKX A;  5HLI A;  1R5H A;  2V4J C;  3GTM J;  2XC7 A;  1Z0X A;  3ZMT A;  5EJC A;  3G6E I;  4QWQ A;  3NAU A;  4S05 A;  2DAO A;  1BW6 A;  2QWW A;  5EEH A;  5BPD A;  2PJR A;  3HC7 A;  1MDM B;  2WAE A;  3HB9 A;  4PJL A;  2LRD A;  3DP7 A;  4OU0 A;  3H9G A;  2F2E A;  1TP4 A;  3BR3 A;  5EZH A;  3MVP A;  3WGG A;  2IGO A;  2L9V A;  2OTL I;  4KNY A;  2RQQ A;  3BR2 A;  2K3F A;  3C2G A;  4B4C A;  1CF7 A;  4G6D A;  4HNU A;  2VI6 A;  3HOV J;  3GFM A;  3HKZ A;  4FIS A;  3GBG A;  2EPF A;  2H6C A;  2JRT A;  4CDG A;  1A04 A;  2E35 A;  3OYM A;  2FEZ A;  1MSE C;  2NP5 A;  4A3I J;  2MYS A;  5C4X J;  2JVH A;  2UXI A;  1BJZ A;  1TW2 A;  3SWH A;  3MNL A;  3CDI A;  5CVI A;  1N78 A;  4CHU A;  1UI5 A;  2DW4 A;  4N4O B;  3L2Q A;  2BYV E;  4RMN A;  5DD4 A;  2GBY A;  3U1D A;  3CTA A;  3WG7 H;  2YX4 A;  3RZD J;  3LSK A;  3Q5F A;  5HSZ A;  4KN7 X;  3OYA A;  3GZ6 A;  3KEO A;  4HKU A;  3IHU A;  2AXT C;  2W85 A;  4G7Z F;  2F4I A;  4AWX B;  3OYD A;  4LB6 B;  2R0Q C;  1EA3 A;  5FRO A;  2OZU A;  1ETV A;  3I59 B;  2QM3 A;  2XRL A;  2M30 A;  2ZJR F;  3W6J B;  2XSJ C;  5FHP A;  2VOO A;  2E5N A;  3AG3 H;  4P9U A;  1SFE A;  4NQW A;  1UI6 A;  4XRF A;  2FBI A;  1N77 A;  4KT6 A;  4ZYD A;  2GUH A;  2PX9 A;  3I9V 2;  5H6Q A;  2Y69 H;  1F1Z A;  1IN6 A;  2VKD A;  4L62 A;  2FBH A;  1GT0 C;  4OIO F;  5J8F A;  1WCM J;  4U0V A;  2VOP A;  1QPI A;  2MGQ A;  2DT6 A;  3QPT A;  2DQR A;  1G3Y A;  1IDZ A;  1SD6 A;  4F7Z A;  2HOE A;  4KIG A;  3OYN A;  3F6V A;  2OZ6 A;  1YQA A;  4BBR J;  2P81 A;  3BTJ A;  4QPQ A;  1FBS A;  3ROU A;  3HIF A;  4PUS A;  4IQJ A;  3I53 A;  2IU5 A;  3WU0 A;  3EUA A;  5K1Y A;  3IH3 A;  1RKW A;  2VUM J;  1XC5 A;  5E3M A;  2LC2 A;  3KZZ A;  4XLA A;  3LSP A;  2BHY A;  2L7F P;  4JX6 A;  4XRM A;  1Z67 A;  3PM1 A;  2VC1 A;  3F1B A;  5ICE A;  3FBN B;  2DMU A;  1MDM A;  3CC7 I;  3M07 A;  2KJC A;  1Z3X A;  1MMA A;  2E36 A;  2JK3 A;  3EUK L;  4KFC A;  3B81 A;  2LNB A;  1OMI A;  3DKY A;  3A2K A;  3LL7 A;  3DXJ F;  1RES A;  1APL C;  1RET A;  1WVR A;  4BBS J;  3L2U A;  5E1W A;  4L9T A;  3OIQ A;  3RIR A;  4H0E A;  2STT A;  4BDY A;  4NDL A;  4KIB A;  4CSW A;  4B47 A;  3JRI A;  1LEB A;  2F4O B;  1FJL A;  3C2H A;  2Z33 A;  3RJP A;  3CMA I;  1D1C A;  4PGH A;  2NVQ J;  2NP3 A;  1Z77 A;  3KLO A;  2GZW A;  1FBQ A;  3FK7 A;  2CFO A;  4U9N A;  3HIM A;  3H3U A;  2X6Y A;  5ED4 A;  2GXB A;  1X3Z B;  1WI3 A;  2XAQ A;  3HHH A;  2K3P A;  5M5W J;  1BW5 A;  3IP4 B;  1U5T B;  2ZBK A;  3CCQ I;  1ZR2 A;  2CH0 A;  4JX5 A;  2HYT A;  3TDU C;  4IO9 F;  1K79 A;  1NG6 A;  3LA3 A;  4OIQ F;  1ZGJ A;  2PFV A;  3DEW A;  4EJV A;  1ETY A;  3KIO A;  4OMZ A;  3I59 A;  4UV9 A;  1WQ2 A;  2EJR A;  1IC8 A;  5DD8 A;  3CQZ J;  3LAP A;  1VF9 A;  2DDA A;  1YJN I;  4CO8 A;  2WAQ A;  2Y2Z A;  3E0J B;  3BY6 A;  3BJO A;  3FXO A;  4I7H A;  3IUO A;  5J4V A;  4A3F J;  1XX5 A;  4KN4 X;  5D5V B;  2LKS A;  2A05 A;  3G1O A;  3GTQ J;  1O3S A;  4A0Z A;  4E70 A;  2XHK A;  1H9G A;  1X2N A;  2F4M B;  2VT3 A;  3CUQ C;  1YW9 A;  2B63 J;  2H8W A;  2X6O A;  1VQP I;  3F8F A;  3D5S C;  1K6Y A;  2YSR A;  2UUZ A;  3I4M J;  3RYR A;  3BZC A;  2EA2 A;  3CJN A;  5F04 A;  1F43 A;  1FX7 A;  1VQO I;  4JX4 A;  3FXL A;  3MKW B;  1IUY A;  4I09 A;  5FB2 A;  4A2U A;  1IN5 A;  4RGR A;  4XK4 A;  1SEU A;  3RPU D;  1Z6T A;  1WSU A;  1OCT C;  2ELH A;  3H9J A;  2O8X A;  2KQR A;  3FXR A;  4C3I J;  1KA8 A;  1XN7 A;  2W57 A;  3ABT A;  1R4N B;  3V8J A;  1YI2 I;  1OQY A;  4B8X A;  3OYB A;  2YVE A;  1J2X A;  3TO7 A;  2DQL A;  1EH6 A;  1SD7 A;  2X48 A;  4XLH A;  1AA7 A;  3SEZ A;  1AKH A;  2EB7 A;  1FIA A;  2CV0 A;  1I1S A;  1JKP C;  1QZE A;  3ZMS A;  3R0A A;  1X1A A;  2DA7 A;  1XG1 A;  2ELK A;  3QU6 A;  1Y8Q B;  5CPR B;  1FBU A;  1HW1 A;  3ML6 A;  2JZY A;  3SJM A;  1Z7U A;  3GZI A;  3I54 A;  3HL2 A;  3CCE I;  3COL A;  3TED A;  3G1M A;  2FJ1 A;  2E60 A;  3M1C A;  3K4M A;  4EJU A;  5CQG A;  2FBQ A;  2QUF A;  2RN7 A;  3N4M A;  2E2I J;  2QLZ A;  2NYX A;  2RGV A;  5DEQ A;  1YRN B;  2IGN A;  1I27 A;  4M3F A;  5LRR A;  5LGN A;  1J9I A;  2PBX A;  3FWE A;  1JXS A;  4RAG A;  4CCJ A;  4IF4 A;  2VBX A;  1H89 C;  3S3N A;  1TWC J;  4Y4R A;  2TRT A;  5BPI A;  3TO6 A;  1R1U A;  2CS3 A;  3WTX C;  5LGU A;  1AU7 A;  1BM9 A;  1BA5 A;  1Y6I A;  2ZXJ A;  1XSV A;  2OQG A;  2JRM A;  2HNH A;  3LSR A;  4IRI A;  1E2X A;  2DA2 A;  1FP2 A;  2TDX A;  1U5T A;  1LQ1 A;  3WG9 A;  3R61 A;  4XKW A;  5K7F A;  2M0M A;  4GCV A;  1F4K A;  5D5X B;  4BQQ A;  4JP0 A;  1BIB A;  2HPM A;  3QOP A;  4D7N A;  5D4S A;  1YIT I;  1Y39 A;  5K7Z A;  3HGG A;  2OF7 A;  4XLF A;  4ZJZ A;  4F93 B;  4F91 B;  4ZTJ A;  2RQP A;  3NPI A;  1RNL A;  5DCM B;  1MKM A;  1KQ9 A;  3T6N A;  4XM3 A;  4HQE A;  4Y33 A;  3FRQ A;  2UXH A;  1BI3 A;  1DQU A;  4XQF A;  2FU4 A;  1PVE A;  1U0J A;  2Z16 A;  4PK4 A;  5GP9 A;  3HEF A;  3A03 A;  5F27 A;  1ON2 A;  3I5U A;  5CVJ A;  1IN8 A;  1GDT A;  2Y9Y A;  2VKE A;  2C6Y A;  4W1U A;  2M45 A;  3HSE A;  4EQQ A;  4IHW A;  3HM5 A;  1HKS A;  1P4W A;  4EM2 A;  4HDU A;  2EFQ A;  3EQL F;  2EZL A;  3ZMZ A;  4E7J A;  3S93 A;  2JA6 J;  3SEQ A;  2MBF A;  1OCO H;  1QBJ A;  3SYT A;  2VKV A;  4HST A;  2NVT J;  2VJ5 A;  2H94 A;  9ANT A;  4RAF A;  3G73 A;  1R22 A;  4MXM A;  4CCM A;  1O57 A;  3OSF A;  1ZAR A;  1TWG J;  2DMQ A;  2P6S A;  3HSF A;  2QIB A;  4J00 A;  3FZV A;  3GTP J;  2R5Z B;  2EZH A;  4NB5 A;  4XKB A;  3BZ6 A;  1IZ1 A;  4G6Q A;  2HVR A;  4ANJ A;  3S2D J;  4A3C J;  3FKJ A;  2K9N A;  5ILU A;  3W6V A;  1DUX C;  3K9T A;  2VE8 A;  1K61 A;  3K2Z A;  4UVC A;  4IJA A;  2IJL A;  1MNM C;  1WGX A;  2VXD A;  3M7G A;  1YRN A;  1VQN I;  3KCC A;  3LWF A;  4XOP A;  3JRE A;  1FOX A;  1WKM A;  1S6L A;  4XON A;  2VQL A;  1Z3Y A;  3LWJ A;  4MNU A;  5HBU A;  2XRN A;  1P7I A;  2E2J J;  4ZTF A;  5CXI A;  4DQ2 A;  2ISY A;  2UXO A;  4IXA A;  4TV7 A;  3JRB A;  2OBP A;  4A93 J;  2I8D A;  3L9F A;  3JRH A;  4PSX A;  5TRD A;  2ZY9 A;  1R00 A;  3EYY A;  2ID3 A;  1HKT A;  2Q24 A;  2Q2E B;  4P9F A;  1YLF A;  2EFO A;  4ZH4 F;  3RYP A;  1NH3 A;  2V57 A;  1SAN A;  3O60 A;  4BU2 A;  4LG0 A;  3JSO A;  1DP3 A;  2VJI A;  3PNY A;  2UXU A;  1R1V A;  3GME A;  2G3B A;  3WTT C;  2MAB A;  2VPL A;  2BVL A;  5JLW A;  1GV2 A;  2E1M C;  2VJ4 A;  1XGM A;  3T8T A;  1IRF A;  3RSN A;  3GTO J;  4M3D A;  5IT9 K;  3CF2 A;  3HTU A;  2DOE A;  1VQ5 I;  3P9C A;  2KDO A;  3HDD A;  1SD4 A;  1R58 A;  4B3X A;  5DCM A;  4F55 A;  1O3Q A;  2ZNZ A;  5DYM A;  2UWM A;  2EV6 A;  1I3Q J;  1T08 B;  2BEO A;  2L7M P;  2M7A A;  1K78 B;  2LVS A;  3HUG B;  1MW7 A;  4XR6 A;  3TP0 A;  2CSO A;  1S5L C;  3CO6 C;  3ON2 A;  3RD3 A;  1R1T A;  5E8I A;  1UCR A;  1ZTR A;  4IRH A;  3ZQ7 A;  2OCC H;  4CA0 A;  3WTY C;  5FLV A;  2GLO A;  1J0R A;  5F0C A;  1GUU A;  2QCO A;  1S72 I;  2YX7 A;  3RQ4 A;  2X9D A;  1KU9 A;  1WHU A;  2B3W A;  1UJ8 A;  2QQ9 A;  3OIO A;  3JTG A;  3BR6 A;  2P7V B;  3BOQ A;  1QHH D;  2X85 A;  2JT1 A;  1L3L A;  1CGP A;  2NRA C;  2XKP A;  2UZK A;  1HCR A;  3OYF A;  3VDX A;  3ONQ A;  3CCU I;  1STZ A;  3HJE A;  3HBL A;  4IRG A;  1OJL A;  4DBR A;  1TQI A;  5E20 A;  2REK A;  3G56 A;  3FM5 A;  4D9J A;  1BR4 A;  1Y1V J;  3EGQ A;  4CCO A;  3GZN B;  4ETS A;  1JHF A;  3HTS B;  4XLP F;  1X58 A;  3LAJ A;  1QPM A;  2LKP A;  3DU5 A;  1XB4 A;  2HEO A;  3IAS 2;  4HYE A;  3HTJ A;  2OTJ I;  2CUJ A;  2EV0 A;  3Q9S A;  2KKO A;  3UKG A;  5H20 A;  2R5Z A;  1OLT A;  4YII A;  1IXS B;  3BC8 A;  2EIM H;  2FA5 A;  5TGT A;  4N0B A;  2D2W A;  3EET A;  3TKY A;  4RLQ A;  3DEE A;  4L0Y B;  2JA2 A;  3I55 I;  4FX0 A;  1W1W E;  4LIU A;  4OD5 A;  4XKV A;  4A3J J;  2DFI A;  3MCZ A;  1FT9 A;  4IHS A;  2GM4 A;  2LK2 A;  3HRT A;  4ON0 A;  2D1V A;  5HLH A;  4EGY A;  2XPU A;  2QF7 A;  4PFO A;  1OFC X;  4B09 A;  4ZYG A;  1E3H A;  1RUN A;  1ZHF A;  3VOD A;  1FY7 A;  2AO9 A;  3ISP A;  3VVZ A;  3CCL I;  3CCR I;  3ABU A;  3CCY A;  3L2V A;  2NAZ A;  2Q2E A;  4AYB A;  4NN1 A;  3IV5 A;  4LFU A;  1QVU A;  3W2V A;  1TNS A;  1DGW Y;  1X1C A;  3DTI A;  3H5A A;  3DBH B;  2EIL H;  5AIQ A;  2FNA A;  3H0G J;  1HDP A;  2K5C A;  5M5Y J;  5IYD J;  4HDV A;  5M3F J;  1MBK A;  3FIW A;  3TGN A;  3J7Y J;  1BR1 A;  3ZRG A;  2WGB A;  3TOB A;  2LYC A;  2K9M A;  2CW8 A;  2E1C A;  1LE8 B;  4JL3 A;  4UB6 C;  4X0G A;  3HOS A;  2VT2 A;  4N4N B;  4A3G J;  3BRU A;  3EDP A;  3H3Z A;  3HTA A;  5ICG A;  4U87 A;  3BR1 A;  3TBI A;  1YO5 C;  2O5R A;  5H2F C;  5DS9 A;  2RC4 A;  2FUG 2;  1K78 A;  1U6G A;  4WF2 A;  4KYW A;  2W82 A;  2XKO A;  1YFH A;  3CCV I;  3KFW X;  3KZY A;  4HX4 A;  4RS8 A;  3AKZ A;  1SGM A;  1O4X A;  1O3R A;  2ZOY A;  1LJ9 A;  3GCM A;  4GO1 A;  3DCF A;  2W25 A;  2DG8 A;  2M87 A;  1Z6R A;  4A3B J;  1OCC H;  4BL0 B;  4S04 A;  3IKV A;  4JK1 X;  3U9G A;  2CU7 A;  3CLO A;  3S5R A;  3PSI A;  1QHG A;  1V4R A;  3LA2 A;  1HXD A;  1IRX A;  1R71 A;  2P5K A;  3PPB A;  2YS9 A;  1TQM A;  3AL0 B;  1RKT A;  5D8K B;  3BWG A;  4WK8 F;  4HF1 A;  2HPI A;  2ID6 A;  4AC0 A;  3OS1 A;  5FKN A;  2NVX J;  2A07 F;  1G4D A;  3ANG A;  1MH4 A;  4DBQ A;  1HST A;  2CV2 A;  4M72 A;  4IHT A;  2EV5 A;  3BPV A;  4IPA A;  5J40 A;  3HKZ N;  3I4P A;  5FKO A;  4OOI A;  1MIJ A;  1BN5 A;  2XPW A;  3O3K A;  2HZT A;  2PMU A;  5M3M J;  1E0E A;  1ZG3 A;  3FDY A;  1XGO A;  1RR8 C;  3K2A A;  4J01 A;  3RKW A;  2E19 A;  3F22 A;  3GF2 A;  3KEQ A;  2W7N A;  1MD0 A;  4KT5 C;  5DUK A;  2Z99 A;  1MNE A;  3I3L A;  1TLH B;  4BQN A;  3ASO H;  4QTR A;  1AWC A;  3PO2 J;  3H92 A;  5EZG A;  4HOB A;  5TIS C;  2JA8 J;  1E3P A;  1C0W A;  2G7U A;  3SZG A;  4RGU A;  3ZMV A;  3K4K A;  2COB A;  2H8R A;  1ZLJ A;  5ILS A;  3KKD A;  2VC0 A;  1POG A;  2B9S A;  4BNC A;  3ECO A;  2KZG A;  3C1D A;  2BXY A;  3C18 A;  2O61 A;  2DMP A;  1ZLK A;  2AQF A;  2K9L A;  4M3E A;  5JLX A;  1X2M A;  4FQG A;  2JTV A;  3ABK H;  2PLY A;  4A3D J;  2IS6 A;  4B1R A;  4XN3 A;  5E1X A;  3NRG A;  3VOK A;  2RRE A;  3ZMD A;  3S1N J;  2FBK A;  1LE8 A;  2N8G A;  1ZRD A;  3A1Y A;  1FOW A;  1WZ2 A;  4KMU X;  3AQS A;  1MMD A;  1ON1 A;  2IEK A;  2V1N A;  3L2R A;  3WGI A;  2M0C A;  4ABZ A;  5FKK A;  3G4S I;  2G7L A;  2O03 A;  2PN6 A;  2M1B A;  3NI7 A;  4XID A;  1B72 B;  4GRI A;  4BJ6 C;  3DKW A;  2Q1Z B;  1KYW A;  2LRE A;  2ZME C;  4A5M A;  3BJ6 A;  5B5E C;  1W4M A;  1I3A A;  2IGM A;  4FE4 A;  2B7E A;  2CUZ A;  1BOB A;  3ZQG A;  2R7X A;  1IAW A;  1UG0 A;  1XCV A;  4B43 A;  2L2O A;  2F5V A;  4HLY A;  3JTH A;  3DF8 A;  3KP5 A;  5GAG J;  3P7N A;  4G9Y A;  1MSF C;  2V9V A;  2Q0O A;  3G2B A;  3UNG C;  5CVU A;  5IT9 Z;  3GWZ A;  2GXA A;  4C3J J;  4MEY F;  2G7G A;  2LDU A;  3HG9 A;  4LOC A;  3TMO A;  3BQY A;  3K10 A;  2O0Y A;  3C07 A;  3MKY B;  3CDH A;  4KIF A;  2BY3 A;  4LLL A;  5B3S H;  3ZQL A;  2HTS A;  2JQ7 A;  3M8J A;  3MAJ A;  5B1A H;  3OYE A;  1BJA A;  1UHS A;  4YFK F;  4XBF A;  2EBI A;  3M4O J;  1X3U A;  2LP0 A;  3M9A A;  1G3T A;  4NNJ A;  1LB2 A;  2E7X A;  1QQI A;  4D0P A;  2ISZ A;  2DA5 A;  4BXX J;  1IRG A;  3I58 A;  5L3C A;  2Y30 A;  2PI0 A;  2F48 A;  2ESH A;  2DA3 A;  4ESB A;  4UXN A;  3QAH A;  2Y48 A;  3HRU A;  3A01 B;  2XGX A;  2HU9 A;  1B9M A;  2VB6 A;  3OYG A;  2ZJP F;  4FCY A;  3WTU C;  3D1N I;  1R9T J;  1ZRE A;  1ZGA A;  3OR1 C;  2V1U A;  2CUF A;  2VQC A;  5LEK A;  5EGO B;  4HEA 2;  4NC8 A;  4F3Q A;  1ITY A;  2XF6 A;  4M3B A;  4NC6 A;  3OMY A;  2DPU A;  1QA6 A;  3PO3 J;  3S1Q J;  1BI1 A;  4BQO A;  4RBO A;  3T1B A;  2GIV A;  1TZL A;  3MFK A;  4EGZ A;  2WAQ N;  2HTJ A;  5D4R A;  5HNH A;  5F64 A;  4MHG A;  3RPU A;  1RZ4 A;  3F3X A;  4R79 A;  1A35 A;  1P92 A;  1VZ0 A;  1MND A;  3F0C A;  2K86 A;  1ERD A;  4O5V A;  3DBL B;  4XRS G;  5KVR A;  2I5U A;  3LJL A;  3FKI J;  2QGU A;  4RAZ A;  4RLF A;  2HOA A;  3GXO A;  4E7I A;  3H0D A;  1UFM A;  4AD9 A;  3P5J A;  2V6C A;  2DFE A;  3NNR A;  3DKX A;  1NK2 P;  3VP5 A;  3DQV C;  1B72 A;  3KKC A;  3TQN A;  4KUM A;  5KHD A;  2OD5 A;  5JVT A;  1GXQ A;  3DPT A;  3VFZ A;  4DVY P;  2NVU B;  2MW8 A;  3KYC B;  3DBR B;  3G71 I;  3U2R A;  3ELK A;  1IO2 A;  1ETX A;  4NC7 A;  3FMS A;  2L01 A;  4Q48 A;  1HF0 A;  1G3W A;  2HYG D;  3OYK A;  3PQK A;  2WWY A;  2H09 A;  5D18 A;  2JA5 J;  3KNW A;  5K5O A;  1ZR4 A;  1H8A C;  2NNY A;  3J81 K;  4QIW N;  2QKL B;  4X1E A;  3CJD A;  3CC4 I;  1T33 A;  1IW7 F;  1ULY A;  2OI8 A;  2VAS A;  5K58 A;  1UHW A;  4BUP A;  2ZCX A;  2HYF A;  1QZZ A;  2FQ4 A;  1USS A;  4L5I A;  2FJI 1;  3G7R A;  4GCK A;  1B8I B;  2QOP A;  5DCF A;  1JKO C;  4P1W A;  4D5C A;  4M6Y A;  2RAE A;  1J59 A;  3S15 J;  1IGN A;  2E1O A;  2NXN B;  5C3E J;  4CZZ A;  4FTH A;  3A0H C;  3E5U A;  2L54 A;  3BHQ A;  4L5J A;  5HDG A;  4L9V A;  2QYO A;  1HOM A;  3MKL A;  3K1M A;  2P6T A;  6PAX A;  2XVC A;  3DTE A;  1XMK A;  1Y8R B;  5LHG A;  3A01 A;  2IS2 A;  1IF1 A;  3CP8 A;  4FET A;  1A5J A;  5KCM A;  5JI6 A;  1Z1D A;  3ECH A;  4UVB A;  2DA1 A;  2NS0 A;  3OIP A;  3R60 A;  1N75 A;  5EGO A;  1MBJ A;  2XPV A;  3E5X A;  5IP6 A;  3CMM A;  4A0X A;  1K7A A;  3GVA A;  1XS9 A;  1BL0 A;  1KQ8 A;  3L2C A;  2ZJ2 A;  1X1B A;  1J09 A;  3GZ5 A;  2RKH A;  4U7B A;  1IXR C;  3QOD A;  1PP8 F;  3GTL J;  3WHB A;  2BE5 F;  1TWH J;  3BG9 A;  3PQJ A;  2NS7 A;  4UV8 A;  1HKQ A;  4K2E A;  2JSP A;  5CXG A;  1P4X A;  2ZKZ A;  4DGW B;  2O3F A;  5LBQ A;  4JQF A;  3COA C;  1KU3 A;  5AON A;  2FD5 A;  1OCR H;  1HSJ A;  5EFY A;  2NOJ B;  4A3E J;  3CRJ A;  3BP8 A;  4WXC A;  4DZP A;  4CUG A;  3WTW C;  3BCG A;  1T0F A;  5FO5 A;  3GW2 A;  3SZT A;  1F5T A;  2ME0 A;  1OYI A;  4E7K A;  4BS9 A;  1U8B A;  3K69 A;  3VW2 A;  2BBY A;  1DU6 A;  1OR7 A;  4EAT A;  3X2Q H;  2PJP A;  4LD5 A;  3VSL A;  2LD5 A;  1ZAO A;  5JHF A;  2K85 A;  3V8K A;  4A6E A;  3C3W A;  4D1Q A;  4ENM A;  4PJN A;  2CWE A;  2Y31 A;  2MD0 A;  3TL4 X;  3OYI A;  3LHQ A;  3CF5 F;  2EFN A; 
#chains in the Genus database with same CATH homology
 3V78 A;  2DJN A;  5IYB J;  1GV2 A;  5JLW A;  2XSD C;  4G12 A;  5DAJ A;  5E3N A;  3GTO J;  4M3D A;  3HGY A;  2DA6 A;  1UMQ A;  5EDN A;  4JKZ A;  4W97 A;  3HDD A;  4CGR A;  4GFL A;  3BT9 A;  3BG3 A;  3AQT A;  1FTZ A;  1I3Q J;  2L7M P;  1B8I A;  2LVS A;  2H1K A;  3Q3S A;  2O8K A;  1CQT A;  3TP0 A;  5J1Y A;  1IG7 A;  5E3O A;  2XDN A;  3ON2 A;  3RD3 A;  4M3G A;  5FKL A;  3LSJ A;  2L7Z A;  4AUX A;  1F36 A;  5CW8 A;  1ZTR A;  2OPT A;  3B6C A;  5EEA A;  5FLV A;  3JSJ A;  2GLO A;  5F0C A;  1GUU A;  2QCO A;  3BTL A;  2X9D A;  1HLV A;  4UDS A;  2EQR A;  3OIO A;  3WHC A;  1ETO A;  3BR6 A;  3JRF A;  5FGL A;  2XGC A;  1PUF B;  4AF5 A;  4IHX A;  3TW6 A;  5HAW A;  5IYC J;  5D19 A;  1HCR A;  2FX0 A;  3HBL A;  1JJ6 C;  5J1U A;  2CRG A;  1U9N A;  5GPC A;  1OJL A;  2RAS A;  3G56 A;  3HTI A;  2REK A;  4DYC A;  2CUE A;  3S17 J;  2JA7 J;  1Y1V J;  3B6A A;  3EGQ A;  4I6Z A;  2HDD A;  2LFB A;  2O7O A;  4DYQ A;  1X58 A;  5IOZ A;  3TW7 A;  4A3K J;  3C2B A;  2JJ7 A;  1AKH B;  3HTJ A;  4JYK A;  2ZOZ A;  3RZO J;  2KDZ A;  3UKG A;  2R5Z A;  3K7A J;  1JKQ C;  3BTI A;  2WUI A;  5M5X J;  3IUV A;  2EZI A;  2LY9 A;  3LSG A;  2XB0 X;  4GFK A;  2IBD A;  2NX4 A;  4V2F A;  3ZQI A;  2M2E A;  1MBE A;  2NS8 A;  4A3J J;  4B3A A;  1W0U A;  4JNN A;  2GM4 A;  2LK2 A;  1GVD A;  3JRG A;  3S1M J;  2VPR A;  2XPU A;  2QF7 A;  1HDD C;  5J1R A;  2KT0 A;  3HOX J;  5F08 A;  2ECB A;  1OFC X;  3RH2 A;  1NTC A;  2PZ9 A;  2AO9 A;  3MN2 A;  3VVZ A;  3CCY A;  3GTM J;  1MBF A;  4NN1 A;  3IV5 A;  1Z0X A;  4MIM A;  1QVU A;  3NAU A;  1BW6 A;  1JUP A;  4I76 A;  3H0G J;  1HDP A;  5BNG A;  3HB9 A;  5M5Y J;  5IYD J;  1IJW C;  2R93 J;  2R5Y B;  5M3F J;  1MBK A;  1P7J A;  3FIW A;  3GTJ J;  2K9Q A;  2WGB A;  3BR3 A;  5EZH A;  3V6G A;  1WH7 A;  3Q0W A;  3MVP A;  3RKQ A;  1LE8 B;  3E7Q A;  4JL3 A;  4A3G J;  3BR2 A;  4ACI A;  2D6Y A;  3BRU A;  3G1L A;  3HTA A;  4IEJ A;  4B4C A;  3BR1 A;  3P9T A;  5DS9 A;  2D5V A;  2VI6 A;  1T56 A;  1ZGW A;  3HOV J;  4FIS A;  3GBG A;  3VVY A;  4EEF G;  2I10 A;  1MSE C;  2NP5 A;  4A3I J;  5C4X J;  1SGM A;  2UXI A;  1BJZ A;  1O4X A;  2ZOY A;  2ECC A;  3MNL A;  3DCF A;  3TP3 A;  2DG8 A;  1LFU P;  4A3B J;  4BY1 J;  1SFO J;  1UI5 A;  2OER A;  1W0T A;  4KWA A;  3FK6 A;  4AYB N;  2CU7 A;  4Y7N J;  2MG4 A;  3S5R A;  2GBY A;  1ZQ3 P;  2ZCM A;  1IV6 A;  1PUF A;  3PPB A;  1K83 J;  3RZD J;  2YS9 A;  5HSZ A;  3LNQ A;  2YUS A;  1A6I A;  1RKT A;  3HOW J;  4HKU A;  2ID6 A;  2JN6 A;  4AC0 A;  5F1J A;  5FKN A;  2R0Q C;  2NVX J;  1JJ8 C;  4AC6 A;  1ETV A;  3QQA A;  1MH4 A;  3ANG A;  1MH3 A;  2XRL A;  3ANP A;  5FHP A;  3HKZ N;  5FKO A;  1UI6 A;  4PXI A;  1Q1V A;  1UG2 A;  1ETQ A;  2XPW A;  3BR0 A;  2GUH A;  5M3M J;  2O9L A;  1JKR C;  4L5E A;  2WV1 A;  3VW0 A;  4L62 A;  3K2A A;  3VVX A;  1GT0 C;  1WCM J;  1FTT A;  2E19 A;  1QPI A;  2MGQ A;  1ZKG A;  2LTP A;  3HOY J;  1IDZ A;  2LLK A;  1JT6 A;  1RPW A;  3HTH A;  3SDG A;  4BBR J;  2M8G X;  2P81 A;  3BTJ A;  4QTR A;  5H9T A;  3PO2 J;  5EZG A;  1I6H J;  2JA8 J;  4IHV A;  3VUQ A;  4V2G A;  2IU5 A;  3IH3 A;  1RKW A;  2VUM J;  2COB A;  2H8R A;  4D7M A;  1XC5 A;  3E7L A;  4UUT A;  3KKD A;  5E3M A;  2UXP A;  3LSP A;  2HI3 A;  1POG A;  3VPR A;  2L7F P;  4JX6 A;  3ZQF A;  4XRM A;  3I4N J;  2L0K A;  1U78 A;  2DMP A;  3PM1 A;  4M3E A;  5JLX A;  2R92 J;  1X2M A;  3F1B A;  2DMU A;  4ME9 A;  1ENH A;  5C4Y A;  2R5Y A;  1VI0 A;  4DZJ A;  4A3D J;  3JRD A;  1MBG A;  2WB1 N;  4B1R A;  1S7E A;  2JK3 A;  3IH2 A;  3NRG A;  3VOK A;  3S1N J;  3B81 A;  1LE8 A;  4MK6 A;  2N8G A;  4UUS B;  2HOS A;  1RES A;  1APL C;  1RET A;  5EG0 B;  3H3V K;  4BBS J;  3AQS A;  2NVY J;  1WH5 A;  2IEK A;  4XIC A;  1U9O A;  5EF6 A;  4HNV A;  2TCT A;  4NDL A;  2M0C A;  4ABZ A;  5FKK A;  5FLM J;  2Y0S N;  2G7L A;  3JRI A;  3NI7 A;  1FJL A;  4XID A;  1B72 B;  2NVQ J;  2JMW A;  2NP3 A;  2CJJ A;  1Z77 A;  4S0H B;  4ICH A;  3FK7 A;  5DTD A;  1Y1W J;  3HIM A;  3BTC A;  1H88 C;  3HOZ J;  4FE4 A;  2NOG A;  4DW6 A;  1WI3 A;  2DMN A;  5M5W J;  2CQQ A;  4MLO A;  2MSY A;  1BW5 A;  3ZQG A;  4X6A J;  1E3O C;  5F0H A;  1ZR2 A;  4JX5 A;  2HYT A;  4CYC B;  2G0E A;  3Q0V A;  3DEW A;  4DYR A;  3LOC A;  4YZE A;  1ETY A;  1MSF C;  1G2H A;  1I50 J;  1IC8 A;  3CMY A;  4C3J J;  3CQZ J;  2G7G A;  1VF9 A;  3GTK J;  4LOC A;  3BQY A;  2Y2Z A;  2ZB9 A;  3C07 A;  3NXC A;  3GEU A;  2YVH A;  1FIP A;  4A3F J;  3ZQL A;  4GCT A;  3QBM A;  3G1O A;  3GTQ J;  5D1R A;  1UHS A;  2EBI A;  3M4O J;  2LP0 A;  5IOY A;  1X2N A;  4BXX J;  2DA5 A;  2B63 J;  2X6O A;  1VFC A;  4C2M J;  1WPK A;  2Y30 A;  1RR7 A;  5C44 J;  2DA3 A;  3Q0U A;  3I4M J;  2ZCN A;  2R7Z J;  3QKX A;  3A01 B;  1ETW A;  5F04 A;  1F43 A;  4JX4 A;  4FCY A;  1R9T J;  3D1N I;  1FEX A;  2CUF A;  3BG5 A;  4XK4 A;  2F07 A;  3FIS A;  5EGO B;  3S2H J;  3IH4 A;  2XGD A;  2DG7 A;  1OCT C;  1AHD P;  1ITY A;  1QRY A;  4M3B A;  4NEL A;  2M34 A;  1JT0 A;  3PO3 J;  4C3I J;  4RBO A;  3S1Q J;  2YVE A;  1NK3 P;  3BQZ A;  2WAQ N;  4MFD A;  2X48 A;  1AKH A;  1FIA A;  4M6V A;  2DMT A;  1JKP C;  4A3M J;  2E2H J;  2DA7 A;  1XG1 A;  2ELK A;  3F0C A;  1MBH A;  3KZ9 A;  1GV5 A;  2K40 A;  3SFI A;  4XRS G;  5IP7 J;  3SJM A;  1EF4 A;  3LJL A;  4UUS A;  4IHY A;  3GZI A;  3COL A;  2QKO A;  3FKI J;  3TED A;  3G1M A;  2FJ1 A;  5EG0 A;  2HOA A;  1DU0 A;  1ETK A;  3ON4 A;  2YU9 J;  3PAS A;  2FBQ A;  2JWT A;  2E2I J;  2AHQ A;  1YRN B;  2CQX A;  4M3F A;  3NNR A;  1NK2 P;  2PBX A;  1OCP A;  3S1R J;  3VP5 A;  2G7S A;  4A69 C;  3ZQC A;  1H89 C;  1B72 A;  3KKC A;  2HXI A;  1TWC J;  2TRT A;  2W48 A;  3VOX A;  4BKX A;  2MW8 A;  4FE7 A;  1AU7 A;  1BA5 A;  3JRC A;  4A3L J;  5HOD A;  3LSR A;  2DA2 A;  1ETX A;  4XRS A;  3L1P A;  1HF0 A;  1QVT A;  1TC3 C;  5D18 A;  2JA5 J;  3NAR A;  3KNW A;  5K7F A;  2DN0 A;  4CYC A;  1ZR4 A;  4GFB A;  1H8A C;  3S14 J;  3BR5 A;  4Y52 J;  4JP0 A;  2RHA A;  5FMP A;  4QIW N;  4X1E A;  4D7N A;  3HOU J;  3CJD A;  1T33 A;  3OOU A;  5K7Z A;  3RQI A;  2OI8 A;  3HGG A;  3S16 J;  5K58 A;  2OF7 A;  2M9H A;  3ZOB A;  4J19 A;  3QPL A;  2ZCX A;  3EUP A;  2FQ4 A;  5FKM A;  4BY7 J;  2ME6 A;  3NPI A;  1JUS A;  3G7R A;  2HQ5 A;  3O8G A;  3CDL A;  3FRQ A;  3T6N A;  4GCK A;  2UXH A;  1B8I B;  2QOP A;  1JKO C;  2EZK A;  4D5C A;  2QWT A;  2RAE A;  3S15 J;  1IGN A;  2XGE A;  5GP9 A;  3HEF A;  3ZQH A;  2E1O A;  5C3E J;  3A03 A;  4FTH A;  2L9R A;  5F27 A;  3GTG J;  3BHQ A;  3CWR A;  1HOM A;  4GCL A;  3VIB A;  3MKL A;  1GDT A;  2GFN A;  2Y9Y A;  2VKE A;  2K9S A;  1IUF A;  2LR8 A;  4MFE A;  4W1U A;  5IP9 J;  3A01 A;  4IHW A;  3HM5 A;  1TWA J;  1IRZ A;  1A5J A;  2PMZ N;  2EZL A;  3HE0 A;  2XB5 A;  2DA1 A;  2HOT A;  2JA6 J;  1D5Y A;  5EGO A;  1MBJ A;  2XPV A;  1ORK A;  5IP6 A;  2EH3 A;  2O7T A;  2VKV A;  1JGG A;  1XS9 A;  2GEN A;  2NVT J;  3M3Y J;  4D5F A;  2HXO A;  1VND A;  1BL0 A;  9ANT A;  2HKU A;  3A02 A;  5GPA A;  4MXM A;  3GTL J;  3WHB A;  5FJ8 J;  1TWH J;  3BG9 A;  3OSF A;  1TWG J;  2DMQ A;  4C3H J;  3JR9 A;  5E3L A;  2NS7 A;  2QIB A;  5CXG A;  3GTP J;  5C4J J;  2R5Z B;  2EZH A;  1LFB A;  4RDU A;  1JTY A;  3S2D J;  2FD5 A;  4A3C J;  2K9N A;  3W6V A;  2DTZ A;  1K61 A;  5J3L A;  5EFY A;  5AQC A;  4A3E J;  2Y9Z A;  3CRJ A;  1MNM C;  1WGX A;  4DZP A;  1YRN A;  5IPA A;  3BCG A;  3OSG A;  3JRE A;  2LKX A;  1JUM A;  2ME0 A;  1U8B A;  3O8H A;  3BJB A;  3LWJ A;  5HBU A;  2IAI A;  3VW2 A;  1P7I A;  2E2J J;  5CXI A;  1DU6 A;  2UXO A;  3JRB A;  4A93 J;  3JRH A;  3QPS A;  2DA4 A;  2W53 A;  2LD5 A;  3DPJ A;  2ID3 A;  3JRA A;  2Q24 A;  3BNI A;  2V57 A;  5F0F A;  1SAN A;  1TWF J;  2Y31 A;  5K7H A;  2QTQ A;  3O60 A;  3VW1 A;  4QSH A;  1JTX A;  3LHQ A;  2UXU A;  1ZK8 A;  1IDY A;  4MO7 A;  2HYJ A;  2G3B A;  5EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...