3BTLA

Crystal structure of qacr(e58q) bound to malachite green
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 73
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btlA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btlA02
3E7QA 5CXIA 2UXPA 4V2GA 3QKXA 3Q0VA 4A3BJ 2FD5A 4CYCA 2AHQA 2YU9J 3GTPJ 2DG7A 4GCKA 3B81A 3O8HA 4A3IJ 1ORKA 1X58A 3BG3A 1HLVA 3LSJA 2W53A 3GTMJ 1Q1VA 2YVHA 2P81A 3BR0A 2DMPA 2DA6A 4JX5A 2X48A 1JUMA 3S2HJ 2YVEA 1XC5A 2DA2A 2JN6A 1U9NA 2X6OA 2MW8A 3K7AJ 2G7GA 3AQTA 3NXCA 4MXMA 3IH3A 3E7LA 2JMWA 4CYCB 1ZR2A 1OCTC 4NDLA 2VKVA 9ANTA 2NS7A 3A01B 2OI8A 2XB0X 3VOXA 5HSZA 5HAWA 4IEJA 2Y30A 5IP9J 4BY1J 1S7EA 4DZPA 1MNMC 3M3YJ 3S1QJ 3JSJA 1TWGJ 2WB1N 3QQAA 1IG7A 1IC8A 4GFLA 1JTXA 3MNLA 1VF9A 3HOWJ 4JX6A 3NAUA 5F04A 1H89C 5IYBJ 3CJDA 1T33A 2R5ZB 2NX4A 5EFYA 2EQRA 3VP5A 3PO3J 1SANA 1Y1WJ 1TC3C 3VVXA 2R0QC 3FIWA 3H3VK 3S5RA 1VFCA 4W97A 2OF7A 4AC0A 3G1OA 2L9RA 5EZGA 2EZKA 2K40A 3A01A 2D5VA 2ID6A 2L0KA 2YS9A 4B1RA 4QIWN 1AHDP 1MBHA 1HDPA 2CU7A 5EGOB 2XDNA 4GCTA 3ZQFA 4A3LJ 3FRQA 4IHXA 1GUUA 3S14J 2LD5A 4M3DA 5GPAA 3JR9A 5EEAA 3ZOBA 2DJNA 3BTJA 3P9TA 4X1EA 3HGGA 3CCYA 1DU0A 1VI0A 4AC6A 4M3BA 2ZOZA 1B8IB 3BG9A 5IP7J 2QWTA 3JRHA 1FTZA 1PUFA 2CRGA 2LLKA 1HF0A 2G3BA 2H1KA 2K9QA 1JJ8C 2EZIA 3HDDA 5IOYA 2O8KA 2IAIA 4BBSJ 4A93J 1WI3A 2REKA 3FK6A 5FMPA 3IH2A 5E3NA 2QIBA 3Q0WA 4FE7A 3S15J 4HNVA 2W48A 5EG0A 4XICA 3UKGA 5IPAA 1B72A 2UXHA 1ETWA 3IUVA 3HBLA 4I76A 5M3MJ 4UUSB 2HOTA 2QTQA 3B6CA 1IJWC 5FGLA 1LFUP 3FKIJ 5F1JA 3ON2A 4UUTA 4D7MA 3BJBA 3HE0A 2NP5A 3CDLA 3PM1A 1ZR4A 5K7ZA 1RESA 3G1MA 3BQZA 4UDSA 3DEWA 5DAJA 2XGCA 1IV6A 4A3EJ 2HYTA 3GTKJ 1HOMA 3I4NJ 1JT6A 3BRUA 2HDDA 2L7FP 1FIPA 4QSHA 3LSPA 2OERA 2UXUA 3BT9A 1EF4A 1MSEC 5EF6A 1IUFA 1FTTA 2JA7J 4C3JJ 4XIDA 2KT0A 3HOYJ 3V6GA 2N8GA 5DTDA 1GV2A 2LFBA 4BY7J 4L5EA 3SFIA 3LSGA 3ZQIA 3BHQA 1RR7A 5IYCJ 3TW7A 5M3FJ 3HTIA 4XRSA 1WH7A 3HB9A 2R5YA 1LFBA 3QPLA 2LVSA 1QVUA 1W0UA 2O7OA 4MFDA 1GDTA 3JRDA 1BA5A 2XGDA 2XSDC 4FCYA 5D19A 3HOZJ 1Y1VJ 2LKXA 2HKUA 3HGYA 4XRSG 4DYQA 1X2MA 3W6VA 2M0CA 3COLA 4MFEA 1ETKA 1E3OC 2QF7A 2FBQA 2V57A 1JT0A 2HI3A 1MBEA 1A5JA 5HODA 1APLC 3ANPA 5C4JJ 2ZOYA 4MK6A 1ZK8A 2DA5A 3JRFA 1I6HJ 3PO2J 2X9DA 5EZHA 1BW5A 3VW1A 3NRGA 2XB5A 1DU6A 3VOKA 2QOPA 4GFKA 2H8RA 3RQIA 2K9NA 1RKTA 2EZHA 1JTYA 1QVTA 2Y2ZA 4AYBN 2IBDA 4C3IJ 2FX0A 4Y52J 1QRYA 5DS9A 4ME9A 3VW0A 5M5YJ 1ZTRA 4JX4A 1JKRC 4X6AJ 1JKQC 2KDZA 3O60A 3JRIA 3T6NA 1BW6A 2E1OA 5FLVA 4JKZA 1WPKA 5IOZA 2EZLA 2E2HJ 2HYJA 3HOVJ 4M3EA 3BG5A 5FKNA 1ETYA 3SDGA 2M2EA 3JRAA 4FE4A 4KWAA 4EEFG 1JUPA 1U8BA 1MSFC 1OFCX 2D6YA 1JKOC 3NPIA 3BR3A 4JYKA 3D1NI 4BBRJ 5FKOA 1OJLA 2FQ4A 2L7ZA 3GZIA 3S2DJ 2HQ5A 2JWTA 3A02A 1TWCJ 1I3QJ 2PMZN 3IV5A 1F43A 2G0EA 2G7SA 1FIAA 3TP3A 1VNDA 3ON4A 3S1RJ 2JA8J 3ANGA 5E3MA 2UXIA 3KZ9A 1RETA 3VPRA 1ETVA 3S17J 2ZCMA 2E2IJ 2JA5J 4AUXA 2MSYA 1MH4A 2TRTA 1R9TJ 3MKLA 3EGQA 2WAQN 2DA4A 2GUHA 2RHAA 1O4XA 2WV1A 4G12A 5FKKA 5K7HA 2G7LA 5JLWA 2JJ7A 2R92J 1WGXA 2ZB9A 1B72B 1TWFJ 2NVTJ 3S1NJ 2Y0SN 4A3JJ 5C4YA 5H9TA 3OIOA 1D5YA 1WCMJ 3NARA 2DMUA 1ZKGA 3I4MJ 1F36A 4NELA 3RH2A 4B3AA 4I6ZA 2MG4A 1ETQA 2HOSA 2I10A 3OSGA 3LHQA 3ZQGA 1NTCA 4DYRA 3CRJA 1ETOA 3F0CA 4YZEA 1QPIA 3HTAA 3JREA 3LOCA 3V78A 4GCLA 1K61A 3A03A 2VUMJ 2NP3A 3CQZJ 3OSFA 5EYRA 4L62A 1X2NA 2B63J 2QCOA 2IEKA 3JRCA 2CJJA 1GVDA 3ZQHA 1WH5A 5J3LA 3S16J 3NI7A 5GPCA 3HOUJ 2ECBA 3S1MJ 1P7IA 4LOCA 5F27A 4ICHA 2R7ZJ 1ETXA 2Y31A 2TCTA 2ECCA 2L7MP 2LY9A 2VKEA 3WHBA 4JP0A 4DW6A 1K83J 5F0HA 5K7FA 1TWAJ 4ABZA 3BNIA 2RASA 3HIMA 2XGEA 4XK4A 2XPUA 2DMQA 2CQXA 1JJ6C 3HKZN 1B8IA 3BTIA 3ZQCA 2JA6J 2VI6A 2LK2A 3GTGJ 2GBYA 4IHVA 1IGNA 3GTLJ 2ME0A 3HM5A 2YUSA 4IHYA 1MBKA 2Y9YA 4MLOA 3F1BA 5FKLA 2R93J 1PUFB 1AKHB 4IHWA 3G7RA 3FK7A 2EH3A 3HEFA 5FKMA 4A3GJ 4A3FJ 3G56A 4UUSA 4A3KJ 2DA1A 5C3EJ 4BXXJ 5IP6A 1IRZA 3WHCA 1TWHJ 3G1LA 4CGRA 2M8GX 2XRLA 2GLOA 5J1RA 5E3OA 1AKHA 2DMTA 4XRMA 4D5CA 3QPSA 3JRBA 3BCGA 1Z77A 3PPBA 4ACIA 2QKOA 5C4XJ 2CQQA 5C44J 1MBGA 2E2JJ 2LR8A 2XPVA 3BR1A 3LSRA 2DG8A 3DCFA 3VW2A 2NVQJ 2PBXA 3LNQA 4JL3A 2DA7A 1ZGWA 4A3DJ 3IH4A 5BNGA 2R5ZA 3L1PA 1P7JA 3VIBA 5F0FA 4HKUA 3VUQA 1HDDC 2F07A 2DTZA 5M5XJ 3CMYA 2Y9ZA 2GENA 4GFBA 4A3MJ 5AQCA 1UHSA 2FJ1A 2HOAA 3GEUA 3TP0A 2LP0A 2LTPA 5K58A 1POGA 4A69C 3Q3SA 3KNWA 4MO7A 1GV5A 1FJLA 1W0TA 3PASA 5FHPA 5IYDJ 2MGQA 4DZJA 2XPWA 5EGOA 2R5YB 2E19A 3TW6A 1UI6A 3O8GA 1H8AC 2DN0A 3BTLA 1JGGA 4MIMA 5FJ8J 2DMNA 1I50J 2IU5A 4NN1A 3BR5A 3ZQLA 1UG2A 4RDUA 3CWRA 3HTJA 3KKDA 2HXIA 4Y7NJ 3EUPA 3C07A 5CW8A 4V2FA 2WGBA 3KKCA 2HXOA 1ENHA 2M34A 4BKXA 3M4OJ 4PXIA 3JRGA 3B6AA 5F0CA 5JLXA 2VPRA 5D18A 1U9OA 1YRNB 3QBMA 1XG1A 1G2HA 4D7NA 1JUSA 4S0HB 4JNNA 3RZOJ 3BQYA 3NNRA 3VVZA 4C3HJ 3RKQA 2PZ9A 2DA3A 3SJMA 2OPTA 1HCRA 3H0GJ 2CUEA 1SGMA 3FISA 5F08A 2UXOA 3BR6A 3C2BA 4RBOA 1BL0A 4W1UA 2ZCNA 1T56A 3Q0UA 3K2AA 2M9HA 3MN2A 4DYCA 1IDZA 3MVPA 5EDNA 2GM4A 4FTHA 3GTQJ 1BJZA 2JK3A 5CXGA 2CUFA 3LWJA 1JKPC 1RKWA 1YRNA 1ZQ3P 1LE8B 2O9LA 1Z0XA 4J19A 2RAEA 4QTRA 5FLMJ 5M5WJ 1CQTA 1UI5A 3HTHA 3TEDA 4M3FA 2O7TA 2ELKA 2GFNA 2Q24A 2WUIA 3AQSA 2ZCXA 3DPJA 1MH3A 2NOGA 1UMQA 2K9SA 4D5FA 3RZDJ 4A3CJ 2ID3A 3VVYA 1MBJA 2COBA 2AO9A 1IDYA 3GTOJ 5J1UA 1RPWA 2NS8A 4C2MJ 1H88C 4AF5A 2EBIA 5J1YA 1MBFA 1LE8A 3RD3A 3OOUA 5HBUA 2NVYJ 3BTCA 4B4CA 1AU7A 2NVXJ 1OCPA 3GTJJ 1NK3P 1XS9A 2ME6A 1U78A 3BR2A 1NK2P 4FISA 3GBGA 3HOXJ 5GP9A 1GT0C 5E3LA 4M3GA 5EG0B 1A6IA 1FEXA 5D1RA 4M6VA 1SFOJ 3LJLA 1ITYA
chains in the Genus database with same CATH superfamily
3I54A 1I27A 4OMZA 2UXPA 2KFDA 2ZBKA 4D9JA 1WWXA 4V2GA 1D5VA 4RAGA 3Q0VA 2LY2A 4CYCA 2F4OB 4ENNA 2QKMB 1ERDA 3B81A 4A3IJ 1ORKA 1X58A 2HNHA 2KZVA 4MQ9F 3PQKA 4XL9A 3GTMJ 2W53A 4IRVA 2JUGA 3BR0A 1HSTA 4JX5A 2LNBA 4ESFA 3ASNH 3H9QA 3ECHA 4OAYA 1XC5A 1Z6RA 4XOPA 4ENKA 3K8PC 5DCMB 2VOOA 1Y8QB 3DTIA 2VKVA 4XLCA 3A0BC 3BCBA 3OYBA 3A01B 2PJRA 2JRTA 2XB0X 4KFCA 3OS0A 3F21A 4PGGA 4BDZA 3DBRB 1XGNA 3M3YJ 3S1QJ 2RNJA 3AL0B 1XX5A 3CCMI 4ZZLA 3MNLA 4KIBA 4Y3OA 3KYCB 3HOWJ 3GEZA 4CH7A 3OL3A 2QSGX 4RAYA 3F8FA 4G6QA 3VWBA 2OCEA 4BAYA 4F7ZA 4HSTA 1TC3C 4MHGA 3GF2A 5K1YA 3CCUI 4M73A 2KJBA 3L7WA 3U21A 1SFEA 2K40A 4LK1F 3CCQI 3RDIA 2ID6A 3DEEA 5CYVA 4B1RA 2QKLB 3IKVA 5HNHA 1ODDA 1DDNA 2CU7A 4A3LJ 3QAHA 3TDZC 4BYYA 4IHXA 4FASD 1GHCA 1D1AA 3P9CA 2H09A 1OYYA 2H6BA 1DPRA 3K0LA 3O3KA 3BTJA 4X1EA 5K5RA 4HDVA 5AIPA 3M8EA 1VI0A 3K1MA 2NNYA 3BOQA 4NQWB 5IP7J 5K5QA 2QWTA 1P4AA 3JRHA 1FTZA 1AWCA 2LLKA 3HIFA 3BDDA 3HSFA 2V9KA 1JJ8C 3FXOA 4U9NA 2EZIA 2F48A 3HDDA 4BBSJ 4YFXF 4I0AA 4HNUA 2CW0F 2REKA 2QIBA 2ZJ2A 3H5NA 4HNVA 1ZRFA 2W48A 5EG0A 3PIOF 3UKGA 1ETWA 3IUVA 2M7BA 3E5XA 3KLOA 5DD8A 2QTQA 2E1NA 4A2UA 3P5JA 1V5FA 3PFYA 3GLLA 4F92B 3R4KA 1YX3A 4EM2A 4DGWB 3CDLA 3ZMVA 2WC2A 1ZR4A 1F5TA 3VYTB 2FBIA 3LSHA 1FZPB 2E1MC 1OMIA 1YG2A 1IV6A 2ZXWH 4BHBA 4A3EJ 2K3PA 2HYTA 2CO5A 3GTKJ 4BEHB 3I4NJ 4E7IA 2FOKA 1SVMA 3RJPA 3LSIA 1FIPA 1MMGA 2MBFA 2VE8A 1YO5C 2OERA 1EF4A 3EUKL 2JA7J 2JTVA 4XLPF 2L2OA 2QSHX 2JPCA 1GV2A 3KZYA 3MQ0A 3OYJA 4OU0A 5L3GA 1XMAA 2RKHA 3CO6C 2FUG2 3TW7A 3HTIA 3DLAA 1WH7A 2ZJQF 2B7EA 3B02A 2F4IA 2LVSA 1GDTA 1S8NA 1ZGAA 2CQ7A 3OYCA 5D19A 1G3YA 2W1OA 1VQNI 2HKUA 1JHFA 2XUBA 4KN7X 2GXAA 3LFUA 2XHKA 4XRSG 1OR7C 2MC3A 4LG0B 2V9PA 3CC2I 4XLHA 4L5IA 1APLC 1TT0A 2M4GA 4OIQF 3OIQA 3K69A 1IXRC 1T8IA 3K4JA 1J0RA 2DPDA 4CSWA 1I6HJ 3PO2J 4LLGF 1TNTA 1D1CA 4Y4RA 3L2CA 3VW1A 2XB5A 1BC8C 2R7OA 3CCEI 1O7LA 3BZ6A 1VQLI 1HW5A 2KIQA 5TJJA 4HF2A 1TW2A 1S3JA 4KITB 1OCOH 2KP6A 4UV8A 5ICGA 3GFMA 6PAXA 3M1CA 1USSA 4MTEA 3GFIA 3QPTA 5J40A 1WZ2A 2DK8A 3EDPA 1IO2A 3LFKA 4ZJZA 2R7QA 5F64A 1VQ7I 1XGSA 3U1DA 1JKQC 1S7AA 3JRIA 2E1OA 4G7HF 5BQTA 5FLVA 3HRMA 1M1EB 4DIQA 2LG4A 4O6JA 1ETYA 3HRSA 2VT3A 2M2EA 2VODA 3JRAA 1DQUA 4OD5A 3NPIA 4CYDA 2MABA 2K7LA 4XM3A 4MQVA 3IRRA 2DI3A 4BJ6C 3LWFA 4BBRJ 1WKMA 5FKOA 1T39A 2ZJPF 1S6LA 3S32A 3S2DJ 2HQ5A 3HKZA 4BU2A 1TWCJ 1XB4A 1F43A 2COMA 4AD9A 3TGNA 5LHGA 3ANGA 4HEA2 3D5LA 4Q47A 1RETA 1LVKA 2K86A 5ED4A 4ZYDA 1I6XA 3PFIA 3K1PA 1R9TJ 1T0FA 2FSWA 2Z5UA 4WWCA 4IZZA 1BIBA 3R0JA 2JJ7A 2VL8A 1YJ9I 2ZY9A 2ZB9A 3DU6A 1IW7F 2CFXA 2XRNA 2Y0SN 5C4YA 2QQBA 3DBHB 5H9TA 2QVOA 1TLHB 5HDNA 3C7JA 1WCMJ 2P8TA 3ZMZA 3P9IA 1ZKGA 1R1TA 3GLXA 3HSEA 4NC8A 4PGHA 1S72I 4NELA 2PMZA 2HGCA 2LC2A 4R8HA 4AIDA 5E1WA 5ICFA 3WTVC 3ZQGA 3F8BA 2IS6A 3MZHA 3F0CA 5ICCA 4YIRX 2UV1A 4C2MA 4M6YA 3WE2A 3HTAA 3MWMA 3JREA 4RGSA 1SC7A 1XCVA 3DKWA 2Y69H 4KMFA 1SD6A 4AIJA 1I39A 1QZZA 2B63J 2D1HA 2IEKA 2A07F 3ESWB 3QU6A 1AA7A 1T08B 5J4VA 4KJZA 2ECBA 2HQNA 3KZZA 3P9KA 1IN6A 2Y31A 4IRHA 3F22A 2R7ZJ 4WIBA 3I5UA 2LY9A 2KRCA 3CMAI 2I8DA 2VKEA 2G7HA 4AVPA 2PJPA 1O3QA 5F0HA 1OQYA 3H0DA 3TO7A 4ABZA 3W6JB 3BNIA 3HIMA 2XGEA 2PMHA 2EB7A 1T38A 4XOTA 2XPUA 4S04A 2CQXA 3HKZN 2KRHA 2DOEA 2VI6A 4U88A 2V1NA 4UHTA 3CP8A 4BEHA 2GBYA 2XF6A 4UVAA 1ONVA 2ZNYA 3PNTA 3T8RA 4IHVA 3GTLJ 2W82A 2DDBA 3JTHA 3AKZA 1MBKA 4FX4A 4IHYA 2HPMA 3F1BA 2QYOA 4XKWA 2M87A 2UUZA 3FK7A 5ERIA 2XAJA 1YW9A 3HEFA 1SMYF 4Y17A 3FZVA 2WWYA 4A3FJ 3WTSC 3HTSB 1ACIA 2AXTC 2X85A 1RNLA 2IA2A 2G9WA 1XMKA 3G1LA 3WU1B 1FSEA 3M9AA 2Z99A 2D1VA 1B9MA 4L9NA 3EUHA 2YU3A 5J1RA 2DMTA 1Z3YA 2EFOA 2RVCA 3QPSA 4D5CA 3JRBA 4ACIA 4WXHA 1BR2A 4QWQA 4B3XA 4JL3A 4IL6C 1MDMA 3DLLF 2GXBA 3BROA 4HV5A 1ZGWA 4PJNA 5JHUA 2W4SA 2QEXI 3FHNA 4AU7A 4LIVA 2VN2A 3L1PA 2R5ZA 1P7JA 1WJCA 1ZREA 1IN4A 1HDDC 2R7WA 4PZJA 4Y33A 2F07A 3TO9A 5M5XJ 2Y9ZA 3DQVC 3Q5FA 4EJWA 2WAQA 3G2BA 2BVMA 1FNNA 1Z1DA 1R6RA 5K58A 2GQQA 4NB5A 5TGTA 3K10A 4MO7A 1FJLA 5FHPA 2MGQA 1B9NA 2E19A 5E8IA 3CJNA 2MFZA 1NG6A 4Y13A 4EJTA 2HQRA 2PQ8A 2NOJB 1HQCA 1GLNA 1UI6A 4RGXA 4UUVA 2EV0A 2MA3A 2VIXA 3VODA 1IN5A 3BTLA 3V7SA 2V7FA 1W5TA 4HBLA 3BR5A 1FYMA 2VJJA 3CWRA 1J5YA 2EA2A 3KKDA 4CZCA 4GCVA 2R7TA 3QYBA 2KJCA 1W36D 5CW8A 1ENHA 1OLTA 5F0CA 2VPRA 1TQMA 2DFIA 2HKXA 4IPAA 4D7NA 1ZH5A 2HWVA 5CQGA 3NNRA 4M9ZA 4ZZDA 5HDGA 4BQQA 3L2UA 2V26A 5D5VB 4BQAA 3FISA 1LUJB 1WFXA 2VQHA 4XKBA 1FYKA 3C2BA 4RBOA 1BL0A 2UXOA 3Q0UA 1VQ8I 3K2AA 2E1MB 1R58A 5EDNA 3SDBA 2ZFWA 2JK3A 4HSRA 1V55H 4G6TB 1ZGJA 3LWJA 2CQKA 2UXNA 1JKPC 3ZQ7A 2LKPA 1HA8A 5D4SA 1LDKB 2DYRH 4DBRA 3HHGA 5FLMJ 3TEDA 2WUIA 3AQSA 1F1ZA 1MH3A 4KT6A 4A3CJ 3I56I 4GO1A 2COBA 4XONA 2AO9A 3DPLC 3RCOA 3D5RC 2QBYA 3J81Z 5J1YA 1MBFA 2E5ZA 1YOVB 1DPUA 3T8TA 2XC7A 2Q2EA 3SWHA 5E17F 4JBAA 5AONA 2EIMH 4UNOA 2EFQA 2ZXIA 1VQOI 2RDPA 3GTJJ 1NK3P 1XS9A 1U78A 1NK2P 5GP9A 2DAOA 3I59A 1IRFA 2GA1A 1IXSB 5EG0B 1A6IA 3T5XA 1LKXA 1SFOJ 4LB6B 4PJLA 2FU4A 1WRJA 2GZWA 4OIRF 5L3FA 1ITYA 4KIFA 2DW4A 1X4OA 3VYSB 1FX7A 2RN7A 3QKXA 4EQQA 2YU9J 2AHQA 2OA4A 3GTPJ 2DG7A 3QOPA 2L9SA 2P6SA 1X1DA 3VYUB 5J6XA 4S05A 2IJLA 3WU2C 4LK0F 1UHWA 1VQ4I 2X48A 4Y15A 1JUMA 1T95A 3S2HJ 1LJ9A 2HTSA 2DA2A 1UG0A 3K7AJ 2G7GA 4II3A 3IH3A 4CYCB 1KQ0A 1OCTC 4XSZF 3BJAA 9ANTA 1D0YA 2VE9A 2OI8A 3HPHA 2A6EF 3K4CA 3MD2A 4CUGA 1QA6A 1R1UA 2RNGA 4BY1J 2O61A 5HSZA 3S8PA 4ZYGA 3JSJA 4CCOA 1TWGJ 2VBZA 3EETA 4GFLA 3DBLB 5F6FA 2YX4A 3WODF 3NAUA 1H89C 5IYBJ 5L3CA 2YVXA 3M8FA 3CJDA 1T98A 2A6TA 4RB1A 2R7SA 2OJED 3VVXA 1N77A 3GO5A 1OCCH 3HZJA 1VFCA 4P55A 1FYLA 2CGPA 1LDJA 2H94A 1Z6TA 3A01A 2PJRB 1QQIA 2IRFG 2L0KA 3ZR8X 2VJIA 2HZDA 1HDPA 4LD5A 4OWRB 5EGOB 1VQ6I 1AOYA 4G8XA 2FMLA 1GUUA 2W85A 4RAFA 3LQQA 5CLSA 5FLXK 1U6GA 4NHJA 3L2QA 4A0XA 2B0LA 2DJNA 5FRMA 4L5JA 1BN5A 3VTIA 3CCYA 3S2WA 1DU0A 4M3BA 4K2EA 3S3OA 4BXUA 3WTXC 3A2KA 3ZN1A 5DEQA 1W7PD 3HC7A 1R71A 2FEZA 2VLAA 2H1KA 3IRQA 4U0VA 5IOYA 2IAIA 3FK6A 2BGCA 3IH2A 3R0AA 1A6QA 4Z6YA 1BC7C 4XICA 1LFPA 1B72A 4ITVA 3HYIA 1B59A 1YQAA 1XSVA 1WQ2A 5M3MJ 3WU0A 4D1QA 3B6CA 3MKYB 3P7NA 5FGLA 1OKRA 2V6CA 1DP3A 4ESJA 3KIOA 2F5DA 4D7MA 3TQNA 3HE0A 1V3FA 1RESA 2IA1A 2Q1ZB 3CF5F 3BQZA 3U9GA 1MJAA 3DEWA 3V7CA 1T6SA 1KYWA 4CHUA 2DU9A 2HDDA 2L7FP 4RS8A 4CCLA 4EJVA 2RQPA 3AG4H 2RGVA 1MMSA 3LSPA 4RLQA 1RC9A 2UXUA 3BT9A 1MSEC 5TRDA 5A2QK 4P1WA 1YI2I 5EF6A 1IUFA 1FTTA 3ERMA 4LITA 1BOBA 4XIDA 3GMEA 4LJZF 5DTDA 1BBYA 3DKXA 3M7GA 2LFBA 4BY7J 4UV9A 3CC7I 5CKTA 5B66C 3FXLA 5KK1A 4L5EA 3S3NA 1SAUA 2IPQX 1QNTA 1LFBA 1I3AA 1BA5A 1QVUA 4N0BA 2O7OA 3KP3A 1RR8C 2XGDA 3OYAA 2E34A 2KDOA 2K9MA 5DDGA 3HOZJ 2VKDA 3GUDA 3HGYA 3WTYC 5HLIA 2ZMEA 3ISPA 1W36C 3WG9A 4DYQA 3I4PA 2OAZA 1X2MA 2FXAA 1Y8RB 4MFEA 4A5MA 3I71A 2E35A 1A5JA 2XKPA 2ZXJA 2V79A 4JQFA 4JOMA 5HODA 5DV5A 2JPBA 2ZOYA 4CCKA 5LRRA 2DA5A 3CD6I 3KX2A 4RB2C 1E17A 5EZHA 2DFFA 1KQ8A 1DU6A 2QLZA 3RKWA 2VPLA 3FMQA 3VOKA 1S5LC 3RQIA 3E6BA 2K9NA 4AWXB 1RKTA 2DFEA 3RQ4A 2Y2ZA 3JSPA 4F52A 4F93B 2OCCH 2IBDA 2FX0A 4Y52J 2PN6A 3T0YA 5FD6A 4MEXF 5M5YJ 5DD4A 2OC6A 3KFWX 2EFWA 4YELA 4WXCA 2HVRA 4NBQA 2QQAA 4BDYA 3K70D 2KDZA 3DP7A 2HS5A 3T6NA 1BW6A 2P6TA 4JKZA 3CLQA 2V1UA 5IOZA 2MLKA 3FBNB 3N05A 2NRAC 3IP4B 1HSJA 4IRIA 3RTRA 2KIFA 4FE4A 2PI0A 1E0EA 4KWAA 1JUPA 2RQQA 3E6MA 5LHHA 2DQLA 2A69F 1MSFC 2VC1A 4ZDLA 5JI6A 3SEZA 4JYKA 3SQNA 3D1NI 1PYVA 3JTGA 2HEOA 4XN3A 2HVSA 3ZP5A 4HLYA 4GDFA 2F5FA 1W5SA 4BUPA 4HLXA 1OJLA 2L7ZA 4XSXF 2JWTA 2MYSA 3NRVA 1K4SA 4UVBA 2G0EA 3TP3A 1ZLJA 3K2ZA 3TOAA 2JA8J 3MKZA 5E3MA 1LQ1A 3E6CC 2VBYA 1Q1HA 2TDXA 2IS4A 2UXIA 1HW2A 3S17J 2ACJA 3KZ9A 2CQNA 3GZ5A 4CCNA 1Z67A 3KYLA 1N78A 1MH4A 4KICA 2F5VA 1K6OA 3EGQA 2WAQN 4FQGA 3ZCOA 2MH9A 4AIHA 4HNTA 1J2XA 2FJI1 4G12A 1HBXG 5FKKA 4B48A 2VBXA 3V42A 4KMUX 2X6XA 1RUNA 2NVTJ 3S1NJ 5B5EC 1D5YA 1UHMA 2E71A 3HJEA 3G4SI 3D0SA 2EFPA 3BCAA 2QWWA 3HOTA 5KCMA 2R7RA 2BEOA 2DOAA 4TV7A 3RH2A 4B3AA 2FOWA 3OIPA 5DUIA 1ETQA 4E7SA 5EEHA 2I10A 4FX0A 4F91B 3LHQA 1KU2A 2LMDA 1KU9A 1NTCA 3FKJA 3KP2A 4DYRA 1ETOA 1YHQI 3CRJA 1J59A 1QPIA 1YS6A 4YZEA 1V4RA 4RMNA 3DKYA 3JCUC 2KKOA 3RKXA 1Y0NA 3BZCA 3V8LA 1QZYA 4IX7A 3QU3A 5KAFC 4L62A 2M30A 3OYMA 2E5NA 3JRCA 4A0ZA 2BYVE 2WA0A 4P9UA 1WH5A 5J3LA 2JSPA 3JAMK 3AAFA 4M6XA 3NI7A 4ZYEA 4I09A 3ZN0A 3S1MJ 1R36A 5F27A 4MNUA 1TL8A 2L7MP 3RPQA 2HDWA 1OCZH 1LNWA 4DVYP 1W5CC 4JP0A 3K9TA 4DW6A 3DTKA 2UXXA 1TWAJ 4FHTA 2RASA 2QSFX 1XMXA 4XK4A 2XAUA 3OYGA 2ZCWA 4BHCA 1B8IA 4U7DA 3MAJA 4XR6A 3AL0C 2JA6J 1R00A 3GTGJ 2VB6A 2FMYA 3IWZA 3FXJA 3HM5A 3L2WA 4MLOA 2Y9YA 3BWGA 2LY1A 2R93J 4BE2A 1QBJA 1DUXC 1H9GA 3ZMDA 1AKHB 2UWMA 1FOYA 4CXFA 2EH3A 1LB2A 4CDGA 5H6QA 5ILUA 3OYLA 2D2WA 2DT7B 4LB5A 4G6DA 4A3GJ 3ABMH 2HKOA 1VZ0A 4CGRA 3MZYA 2DLLA 3WTWC 5FROA 1XCBA 2PMUA 3C1DA 4XQFA 2Q0OA 5DYMA 2XGXA 2NVUB 5E3OA 1XSDA 3OYHA 1BOAA 1MBGA 2HZTA 2ESNA 2XPVA 4BACA 1OYWA 4N9HA 3VW2A 3FXRA 3I3LA 5HNFA 3B73A 3ABTA 4RLFA 2EV6A 5LHIA 4A3DJ 5BNGA 2W25A 2F2EA 3WGIA 1B1BA 3DU5A 3GX4X 5F0FA 1J9IA 2FF4A 3QRFF 5GAEJ 5CQEA 3CMYA 4HQEA 5AQCA 1Z7UA 2IW5A 4C2TA 3ERED 4JK1X 2LTPA 4RM3A 4HZFA 2FNPA 1BI1A 5D5XB 1POGA 4A69C 3CCSI 5IT9Z 3E97A 4P96A 2KIMA 4HQMA 4HX4A 1W0TA 2ELHA 3PJRA 5KNLA 5JFRA 3VSKA 2XPWA 5EGOA 4O3MA 3ROUA 5LD2C 2P5VA 3OYFA 3KETA 1FP2A 3RSNA 3KP6A 1JGGA 3K4NA 5FJ8J 2DMNA 4DOZA 4U0WA 2IU5A 3CCVI 4AM3A 4UB6C 3LMMA 4WCGA 4RDUA 3HL2A 2QGUA 4F55A 4ESBA 2P7VB 2OTLI 4IHTA 1HKSA 4Y7NJ 2PLYA 4V2FA 3OYIA 3PIPF 2WGBA 2M34A 4N4NB 4CA0A 3M4OJ 1X19A 3JRGA 4PXIA 3ABLH 5JLXA 2P5LC 4R79A 3L09A 3H3UA 2E36A 1MJBA 1P2FA 4C30A 3QBMA 1G2HA 3RPUA 3ONQA 4PFPA 4JNNA 5K5OA 3BQYA 3VVZA 3SHFA 3DTEA 2PZ9A 2CUEA 1R23A 1STZA 3PL8A 2OQRA 5GTIC 3IC7A 1YW7A 3SZGA 4W1UA 3UNGC 2ADUA 1X3WB 1T56A 1X4PA 2LSOA 5DUKA 2M5WA 3MMYB 4PFOA 4FTHA 2GM4A 2WTEA 1S7OA 2WY7Q 3F23A 2KRFA 1RKWA 4RA2A 1YRNA 1ZQ3P 1UZCA 1LE8B 2BY3A 2RAEA 2GOMA 4QTRA 5M5WJ 2OZUA 1UI5A 2O7TA 2ISZA 2GFNA 3RZDJ 2K9SA 1FOWA 1X1AA 2ID3A 4OOIA 3F3XA 4BGDA 2JRMA 1SD7A 4AVZA 2CV2A 5D5UB 3SXYA 4AF5A 1UFMA 2CW8A 3QPHA 5L3EA 2XVCA 4PSWA 5FFXA 3OYNA 4E70A 2EBIA 1FMVA 1WVRA 2K85A 3KEOA 1SVOA 5HBUA 4PDKA 2NVYJ 1D3YA 3BTCA 1AU7A 2NVXJ 3MCZA 2JA2A 2L7KA 4BHPA 2FBKA 1SFXA 2IGKA 2IT0A 4FISA 3GBGA 5E20A 1TBXA 2XDVA 1MMDA 3TL4X 2E60A 3I55I 1TQPA 1ZG1A 1FEXA 2V6EA 2QA4I 3KYDB 2DT5A 2ZSIB 2XF7A 2LRDA 2L01A 5HOOA 1O3TA 3E7QA 5BMZA 5JVGF 5D8KB 3NWSA 3TBIA 2FD5A 3M1EA 2HR3A 3O8HA 1O3RA 3N97A 3O6BB 3BG3A 2HYFA 3LSJA 5DM7F 4Q48A 5BS6A 3QWLA 2YVHA 2DMPA 4WXDA 5AIQA 3ZMUA 4EGYA 2EJRA 1D8KA 3I59B 4LFUA 2C6YA 2YVEA 2QENA 2JN6A 4E7KA 5CVUA 2MW8A 3AQTA 4MXMA 2JVHA 3E7LA 4LGWA 1P4XA 2YR2A 4D0PA 5IY5H 2K5CA 3AG3H 4I01A 4NC6A 5HAWA 3HRTA 5IP9J 3Q9SA 4DZPA 1MNMC 3R60A 3KEYA 1IG7A 3QQAA 2M0MA 1W7PB 1IC8A 1JTXA 1ULYA 1T33A 2NX4A 5EFYA 2GIZA 4HV6A 2IGNA 3PO3J 2Z16A 3HUGA 3VEPA 1BR1A 3OR1C 2R0QC 2BE5F 2OUMA 4L9VA 2OF7A 3CCRI 4AC0A 2CV1A 2L9RA 3MFKA 1W4MA 5D5WB 2VKHA 2D5VA 3F72A 2YS9A 4V19K 3BJOA 3OMYA 4YG2F 5ILVA 4NQWA 3FM5A 3CMMA 3CESA 3DPTA 1KZHA 3QP6A 1L3LA 3ZQFA 2LH9A 1MKMA 3OYKA 3S14J 5GPAA 3JR9A 4N4OB 2ZNZA 2IGMA 2WAFA 3WGGA 3DPUA 3KLNA 5EEAA 1SFUA 1GXPA 1HKTA 3P9TA 4N9IA 5KHDA 1P4WA 5FB2A 1MDMB 2QQ9A 1B8IB 3BG9A 2MC4A 2BHZA 1WI9A 1HF0A 2G3BA 2K9QA 3OWTA 3VOEA 2O8KA 4BS9A 4A93J 1U3EM 1ZRCA 2MD5A 5E3NA 4BE1A 3Q0WA 4FE7A 5IPAA 3HG9A 1DGRM 4I76A 4UUSB 2OTJI 1LFUP 1KU3A 2EV5A 2M3AA 1CGPA 4UUTA 3BJBA 3HXLA 3PM1A 2O6GE 3J7AO 5K7ZA 3G1MA 1J75A 1GXQA 1PJRA 5DAJA 2K3FA 2XGCA 4M71A 1D1BA 1A31A 2V1XA 1HOMA 4A6DA 4IO9F 1JT6A 2K9LA 4EM0B 1G3WA 2LF8A 4G9YA 1B6AA 5HS9A 4QSHA 2LBFA 3T1BA 2W84A 3H3ZA 1VQ9I 4BH9A 2JT1A 4C3JJ 2KT0A 3V6GA 2N8GA 4CGZA 3HSRA 1QZEA 1IF1A 3SFIA 1SEUA 3LSGA 3ZQIA 1RR7A 3TDUC 5M3FJ 3RI4A 1R49A 3ELKA 3HB9A 3K4KA 2RV8A 4ANJA 3LSKA 3QPLA 3ABKH 4HAMA 3GYHX 1Y39A 4L18B 3JRDA 2Z1DA 1U5TB 4E4HA 5GTHC 3W3CA 4PSXA 2XSDC 1SD4A 3CJTB 2B1EA 4OAZA 1XN7A 3MEXA 1YS7A 1VQPI 4ZDOA 3FHZA 3W6VA 5ICEA 4HW0A 2A05A 3BG6A 4GRIA 4DQ2A 3COLA 4PK4A 2QF7A 4A0YA 2FBQA 3GCMA 1MBEA 1LVAA 1TZLA 2VXDA 5C4JJ 4MK6A 2L9VA 4J00A 1ZK8A 1W1WE 5H6RA 3DWLE 2OQGA 1O3SA 4PUSA 2X9DA 2X1DA 2XASA 3MZ8A 5DM6F 1BW5A 3NRGA 4QPOA 1RZ4A 2EK5A 2P5KA 2H8RA 1TW3A 2EILH 2VJ4A 4P9FA 2EZHA 2YX7A 1XGOA 1JTYA 1QVTA 1X1CA 3C2HA 2MH2A 2QZ8A 3M07A 2OBPA 3F6OA 3KCCA 4C3IJ 3K4MA 1QRYA 5DS9A 4B47A 2WAEA 4PJMA 2H8WA 1JKRC 4L0YB 2WB1A 2EPFA 4X6AJ 1LEAA 5HVQC 1K78B 3J80Z 4MTDA 3DEUA 5E1XA 2F5CA 5GADJ 4M9SA 2LDUA 2E2HJ 3CJQB 3KPHA 2HYJA 3K70C 4M3EA 4RGRA 5JR3A 3L9FA 1D0XA 3ZMSA 1BI3A 4ETSA 4EEFG 1SFKA 4BXFA 1U8BA 2D6YA 1JKOC 2GXGA 4IQJA 1FOKA 1ZN2A 1K79A 3K6GA 4CCMA 5FFZA 3ZMTA 2FQ4A 3FBIB 1JHHA 2X6YA 5E8GA 4ZTJA 4RGUA 2DXIA 1I3QJ 3IV5A 5FLXZ 4C2UA 4FETA 1FIAA 2HOEA 2G7SA 3ABUA 3S1RJ 2P0WA 2M7AA 1UAAA 4OMYA 1V5GA 4J01A 2JA5J 2R4GA 3N4MA 1U0JA 1PVEA 1FT9A 3OS1A 2TRTA 2QBYB 1S29A 2GUHA 1O4XA 5HS7A 2O8XA 5GAHJ 1G3SA 4IQ4A 2BY0A 4EM1A 5K7HA 2G7LA 3BG7A 1EKEA 4EATA 5JLWA 2XAHA 2CH0A 1WGXA 4WX9A 2R7VA 1TWFJ 4GYGA 4A3JJ 1YJWI 4XBFA 5J8FA 3RKYA 2DMUA 1Z3XA 5HLHA 4A5NA 1KU7A 3I4MJ 1F36A 2F5EA 2A2FX 3C18A 4WK8F 2NXNB 2HOSA 3PQJA 3LL7A 3W2WA 4X0GA 1WSUA 4MEYF 3GXOA 3QYEA 1PUEE 2XV4S 5IT3A 4LMYA 2CG4A 2CS3A 3LOCA 3V78A 1J7KA 1K61A 4GCLA 4H4KC 1OYIA 1BR4A 5J8CA 4BE0A 3GVAA 3COAC 3CQZJ 2JVGA 3OSFA 2B3WA 3H9JA 1EV7A 2CJJA 3ZQHA 2YSRA 4LIUA 5GPCA 3W2VA 2DJIA 5BPIA 1P7IA 2NAZA 4LOCA 1YITI 1ETXA 2PFBA 2ECCA 4EMSA 1KGSA 1Y6IA 2IS1A 4U7BA 3A1YA 4WF2A 1ZLKA 1WJBA 1SD5A 1N25A 1K83J 2DYSH 3RYRA 4A6EA 4AYBA 3CLOA 5LBQA 1IN7A 2KL4A 2DMQA 3I58A 1Y56A 1N75A 3CCLI 3BTIA 3ZQCA 5J47A 3L00A 3FX3A 2LK2A 3H1CA 3H5AA 2FNAA 3VFZA 4EV0A 2ETHA 2A61A 3WTZA 3E5QA 3ZQQA 1PUFB 1RIOH 4HF1A 3LAJA 1FPQA 3G7RA 3FF5A 4DJAA 3X2QH 1GVJA 5FKMA 1SMTA 2DOFA 5H2FC 4UUSA 1G6NA 1LDDA 3FWEA 4BJTA 2DA1A 2EIJH 5C3EJ 2CV0A 4BXXJ 4MGRA 3PNYA 4EVIA 1IRZA 2DPUA 1TWHJ 2R7DA 3WG7H 3O2PE 2DQRA 2R7FA 4I7HA 2BV6A 1IRGA 2LREA 2P7CB 5LFAA 2Y48A 2VT2A 2HYGD 4HRIA 4XRMA 3PPBA 3BCGA 1Z77A 1U5TA 2QKOA 3F8NA 5C4XJ 5C44J 1G3TA 3HOSA 1NG7A 3IWFA 1XGMA 2E2JJ 1I5ZA 1P9QC 2VQGA 1IZ1A 3LSRA 5CVRA 2NVQJ 2PBXA 3LNQA 2DA7A 3E3VA 5GAGJ 3IH4A 1XD7A 4KISA 2L5QA 2LBFB 3VIBA 2AQEA 2X6WA 1FBQA 2ZC2A 1SAXA 4NC7A 2PX9A 1KQ9A 2FA5A 2DTZA 2UZKA 3FMSA 4GFBA 4A3MJ 3K1NA 2HTJA 1DP7P 1KONA 1FSHA 3CMEI 2M8EA 3Q3SA 1GV5A 3CUQA 4XKCA 5HDKA 1JXSA 3PASA 5A2QZ 4DZJA 4Z2YA 4E7HA 3AG2H 3TW6A 3OY9A 1PP7U 2CWEA 3O8GA 4U9LA 1I1GA 2BY1A 1HXDA 4XKVA 1VQMI 1E3HA 2IA0A 2NNNA 3ZRGA 3WTUC 2HPIA 5H20A 3EYIA 1OISA 1TQIA 3MKWB 3IAM2 4YEJA 3KP7A 3EUPA 4G94A 1H0MA 3LSMA 3KKCA 2HXOA 5FGMA 5LGNA 3EYYA 3B6AA 2JUCA 5D18A 3ECOA 1QHGA 2AQFA 1U9OA 2KLOA 2AS5F 3BZKA 1XG1A 2DK5A 1JUSA 3SZTA 1FWZA 2HU9A 4S0HB 3RZOJ 4C3HJ 4ZYHA 2DCEA 2X1EA 3DFGA 2DA3A 2OU2A 1Z7LA 3DXJF 2OPTA 3SJMA 3H0GJ 2EINH 3WE3A 1SGMA 1V5EA 3BR6A 3F6VA 2XAFA 2PFVA 2RC4A 3DF8A 1FY7A 3V7RA 4HDUA 2ZCNA 3TMOA 1C0WA 1IDZA 3MVPA 1S9HA 1E3PA 3IAS2 4BNCA 4Q4ZF 3J7ZI 3A0HC 3UR3C 1HKQA 2A68F 2CYYA 4UVCA 2H1LA 2O9LA 1K78A 1CQTA 3HTHA 4BQOA 2ZSHB 2ELKA 3EQLF 2MD0A 3ULQB 5LEJA 1D8JA 2ZCXA 5CVVA 2AXLA 2CW7A 2LF7A 2W00A 3V8KA 1MBJA 3GW2A 1OCRH 1IDYA 3GTOJ 2O5RA 5E1ZB 2NS8A 2KQRA 1H88C 1T0FC 4I99C 3CDIA 2XKOA 2EA4A 1UB9A 3ZPLA 3F8MA 3LQRA 4XRFA 1MW7A 1W7PA 4B4CA 1OCPA 2STTA 2HVQA 3BR2A 1H9TA 2BOLA 1GT0C 1JE8A 3BJ6A 5E3LA 1REPC 4M3GA 2ZMEC 2ZMEB 1WJ5A 4M6VA 3OYDA 3LJLA 5DCFA 1BJAA 2VQCA 5CXIA 2IS2A 4XLEA 1J09A 1IUYA 4GGGA 4KDPA 4KA4A 4A3BJ 1P6RA 5DCMA 2E7WA 2KHMA 4GCKA 5JVTA 4IJAA 3JW4A 1HLVA 2STWA 3SYTA 1Q1VA 2P81A 4P5OA 2I5UA 2DA6A 3V8JA 1XPXA 3NS4A 3IUOA 1U9NA 2X6OA 2Z3YA 3OYEA 3NXCA 4CO8A 2EWNA 2KMUA 4L9JA 2JMWA 1ZR2A 4OIOF 4NDLA 3U1KA 3BPVA 4EGZA 2NS7A 2KZGA 3VOXA 3FDYA 4IEJA 2Y30A 2JSCA 2O3FA 1S7EA 4GYIA 2DFHA 2WB1N 1T2KA 2PEXA 3H9GA 3NWTA 4II2A 2VXZA 1VF9A 4LLLA 4JX6A 5F04A 3L2RA 4H0EA 2A5WA 3H36A 2R5ZB 1NH3A 3TO6A 2JQ7A 2EQRA 3VP5A 5LGUA 3RYPA 1SANA 5CJ9A 4O5VA 3G71I 1Y1WJ 2HQAA 3CC4I 1QO0D 3FIWA 2GAUA 3H3VK 3S5RA 4PJ0C 4W97A 1WJFA 3OV8A 3L2VA 3G1OA 1VQKI 4I02A 5EZGA 3J7AY 2ZFUA 2QQ8A 2EZKA 4E7ZA 3H92A 1ZHFA 4RB0A 4QIWN 1AHDP 1YE9A 1MBHA 1YYVA 2A3SA 3OR2C 1YJNI 3JAMZ 2XDNA 4GCTA 3FRQA 2NYXA 2XSJC 3QYFA 3SEQA 5KVRA 2LD5A 4M3DA 2L3DA 4XLFA 1MD0A 2VOPA 3ZOBA 1XTAA 5TISC 3HGGA 1ZARA 3VB2A 4RAZA 4AC6A 2W24A 1R1VA 2ZOZA 1EH7A 3CZ6A 2K27A 2L4AA 3J80K 3REOA 1YW8A 2ZXHA 3CO7C 2X51A 2CRGA 1PUFA 1X1BA 1Y0UA 2EIKH 4BL0B 5HS8A 5FRNA 5E18F 2F6CA 4HPQA 3R6SA 2WV0A 2KPMA 1XSXA 3GWZA 1WI3A 3GFLA 5FMPA 1R5GA 2Z33A 5D6EA 1IN8A 1UJ8A 3VDXA 3S15J 2FRHA 1P92A 5E79C 3H35A 2UXHA 1YLFA 4G7OF 4I2OA 4KNYA 3HBLA 4FT8A 1IRXA 1MNEA 2HOTA 4Q5SF 1IJWC 5KAIC 2A5YB 2ZJRF 2DTRA 1FBSA 3FKIJ 5F1JA 3ON2A 4HA8A 2PBIA 3RIRA 1YIJI 2ZO4A 2M1BA 2NP5A 1R22A 2OZ6A 4UDSA 2WY8Q 1K7AA 2OV7A 2WADA 3CUOA 1HC8A 2BW3B 2DT6A 3SFZA 3BRUA 4HYEA 2X1CA 4QLCU 1WJDA 3VYRB 4KIGA 3GFJA 3OL4A 1IXCA 5BPDA 3G73A 4KN4X 3HHHA 1R5ID 2GOXB 4ZTFA 3HOYJ 4U0YA 3E1SA 4E6KG 1WJAA 2QUFA 2L54A 5L3DA 4LG0A 4ENMA 3BHQA 5J4YA 5IYCJ 4ZYAA 4XRSA 2R5YA 1R4MB 1W0UA 1O7FA 4MFDA 3PNVA 4FCYA 1B4AA 1EA3A 5LLQA 1Y1VJ 1QHHD 2LKXA 4IF4A 2KISA 2RREA 5FO5A 4PCQA 1OPCA 2M0CA 2XF5A 4IHSA 5HLGA 1ETKA 3RPUD 1E3OC 2ICWG 3KP4A 1MMNA 2V57A 5LEKA 1JT0A 2HI3A 2CUZA 3G6EI 3ZXSA 4KT5C 2J5OA 5IT9K 3ANPA 2XROA 5EEGA 3LAPA 1RI7A 3JRFA 3E0JB 4XMYA 3S3MA 1MJ9A 1I1SA 4DBQA 4OINF 4CZZA 5CPRB 2IGOA 3PSIA 3FXQA 2QOPA 2NS0A 4GFKA 2EFNA 1R4NB 2CSOA 4YFNF 4ON0A 2GIVA 4AYBN 5JHFA 1RUOA 3C2GA 1RRJA 4EJUA 4IOCF 3FXUA 5LRSA 3KE2A 4ME9A 2VASA 1ZTRA 4JX4A 3VW0A 4BQNA 2XIGA 1YTYA 3AG1H 3O60A 1YIOA 2ZKZA 3I0TA 1WPKA 4G7ZF 2V9VA 4NNJA 2K02A 2EZLA 3W2AA 5LGTA 3HOVJ 3BG5A 4E7JA 2DODA 5FKNA 3SDGA 3QOEA 4L9TA 1KYZA 3OS2A 3TOBA 5B3SH 3CUQB 2FE3A 2MLGA 3LA7A 2IXSA 5BOXA 1A35A 4UY8I 2GWRA 1OFCX 4M72A 4PJJA 1TTYA 3BR3A 2BVLA 3NQOA 3CDHA 2BXYA 3WTTC 2OD5A 1MNDA 2ELJA 1Z05A 4C9YA 3GZIA 2IVMA 4AIKA 3A02A 2Z2SB 2DBBA 2PMZN 3ON4A 3OOPA 4IXAA 1VNDA 3SZPA 2GA2A 2R7XA 1SVLA 3E5UA 3VPRA 1ETVA 2ZCMA 4A12A 2E2IJ 4AUXA 2MSYA 1DGWY 2O03A 4I98B 4XLAA 2Z9OA 1FP1D 3ML6A 3MKLA 5D4RA 2DA4A 1Z91A 3EUAA 4ASNA 4KYWA 1BI0A 2WV1A 2RHAA 1V54H 3CUQC 2Q2EB 2O0YA 5CVJA 2ISYA 1EH8A 4XORA 1YX5A 5ILSA 1WHUA 2R92J 1B72B 2CUJA 5F1RA 1ZELA 3OIOA 3AFHA 1OR7A 1LEBA 3NARA 2H27A 5B1BH 1F4KA 3GZNB 4CCJA 1LPQA 4I6ZA 2MG4A 1G8XA 3LA2A 1K6YA 3R61A 1R5HA 4U87A 3OSGA 4GXOA 2VJ5A 2F4MB 2W7NA 4B43A 4IKFA 2V4JC 3HPGA 3K4BA 2CFOA 3FMRA 3G3ZA 1IAWA 4RB3C 1U5TC 4YRVA 3A03A 3C3WA 2VUMJ 2Q8KA 3EUHC 2NP3A 5EYRA 1X2NA 3VSLA 2QCOA 4BJ5C 1R7JA 3DV8A 1QU3A 1GVDA 3S16J 3HOUJ 1JI8A 3V4GA 1G59A 4ICHA 3IHUA 2TCTA 2K4JA 1ON1A 1USTA 1KA8A 2L9NA 2HFHA 1EJ9A 4E7LA 3WHBA 3E6DA 5K7FA 2VONA 1UCRA 1QGPA 3JSOA 2M4KA 2X4HA 3CTAA 4ZH4F 1JJ6C 2XAGA 1BM9A 3CP2A 3J7YJ 2Y0MA 2BBYA 1Z9CA 2BW3A 4M9XA 1ON2A 2Y0SA 1MMAA 1F9NA 2L4MA 4RM2A 4YIFA 1IGNA 1TT5B 2ME0A 3LA3A 1MIJA 2YUSA 4YIIA 4ZC3A 5FKLA 1TP4A 3LSTA 1HW1A 5B1AH 3F9KA 4IHWA 2R7UA 1JGSA 2BZTA 1QPMA 4M74A 2J5PA 4UB8C 3G56A 4HX8A 4A3KJ 2A6HF 3A4CA 4KUMA 3BY6A 4B8XA 5D6FA 5IP6A 3WHCA 1CF7A 1TNSA 1ZG3A 4ZDPA 4IVNA 1UELB 2M8GX 2XRLA 3FM3A 1VQ5I 4IOAF 2W57A 1FLIA 3KP5A 2GLOA 3FXMA 2H6CA 1AKHA 3F8CA 1EH6A 1Z21A 2CQQA 3QODA 5L3BA 3IKTA 2BHYA 3I53A 2LR8A 2M45A 3BR1A 3PSFA 3TKYA 3HRUA 3WGHA 2DG8A 2BY2A 3DCFA 3HTUA 3U2RA 1FOXA 4CICA 3BP8A 2R3SA 2HDCA 4HG2A 4XLNF 1E2XA 1D0ZA 1X3ZB 4F3QA 4HKUA 3VUQA 5HLTA 3CJRB 1ZRDA 1PP8F 4UXNA 2GENA 2LOOA 3IL2A 1UHSA 2FJ1A 2HOAA 1FMWA 3GEUA 3TP0A 2LP0A 1NHAA 1G4DA 3KNWA 1ZAOA 3KEQA 4HOBA 2PG4A 1VTNC 5IYDJ 2R5YB 1U2WA 2Y75A 1O57A 2DO7A 4ENJA 2VQLA 4XNFA 1H8AC 2DN0A 3I9V2 2D45A 4MIMA 1CF7B 2KIUA 1I50J 4I0BA 4NN1A 3ZQLA 1UG2A 4LG3A 1ZYRF 3HTJA 2G7UA 1BI2A 2P4WA 2VBWA 1IV8A 2HXIA 3BC8A 3J81K 3C07A 2XAQA 4BKXA 2IP2A 2X0LA 2QM3A 1K4TA 5EJCA 1YFHA 1YRNB 2V1DA 4OIPF 2LKSA 3CF2A 3QP5A 3EPZA 3D5SC 2L02A 2FQ3A 4OD4A 3RKQA 3ZGKA 4R1HA 1A36A 4XN0A 2DDAA 3ASOH 1HCRA 3S93A 4HF0A 4DNCA 5F08A 3HUGB 2ESHA 4HX7A 4DYCA 2M9HA 3MN2A 1FBUA 3BPXA 1XDSA 5CVIA 3GTQJ 1BJZA 5CXGA 1U8RA 2CUFA 1XDUA 1MGTA 1X3UA 3BLYA 3PUFA 1X1PA 3I64A 3W6KB 1Z0XA 4J19A 3Q9VA 4M3FA 4B09A 2Q24A 3DPJA 2NOGA 1MZBA 1UMQA 4D5FA 4LLNA 3VVYA 1A04A 3FXKA 4L0ZB 2BXZA 1FC3A 2E7XA 5FD5A 5J1UA 1RPWA 2VC0A 4C2MJ 4B44A 3GZ6A 1LE8A 4YFKF 3RD3A 1PDNC 3KZIC 1BIAA 2CMPA 4QPQA 4NUBA 3OOUA 4IRGA 5D8LB 3M8JA 3PUBA 3CCJI 2ME6A 1WJEA 2B9SA 3HOXJ 3K4LA 1ZG5A 2YPRA 3NEUA 2LYCA 2E1CA 1L0OC 4EJOA 3H5RA 2FBHA 5D1RA 2WBMA 2K4BA 2JZYA
chains in the Genus database with same CATH topology
3E7QA 5CXIA 2UXPA 4V2GA 3QKXA 3Q0VA 4A3BJ 2FD5A 4CYCA 2AHQA 2YU9J 3GTPJ 2DG7A 4GCKA 3B81A 3O8HA 4A3IJ 1ORKA 1X58A 3BG3A 1HLVA 3LSJA 2W53A 3GTMJ 1Q1VA 2YVHA 2P81A 3BR0A 2DMPA 2DA6A 4JX5A 2X48A 1JUMA 3S2HJ 2YVEA 1XC5A 2DA2A 2JN6A 1U9NA 2X6OA 2MW8A 3K7AJ 2G7GA 3AQTA 3NXCA 4MXMA 3IH3A 3E7LA 2JMWA 4CYCB 1ZR2A 1OCTC 4NDLA 2VKVA 9ANTA 2NS7A 3A01B 2OI8A 2XB0X 3VOXA 5HSZA 5HAWA 4IEJA 2Y30A 5IP9J 4BY1J 1S7EA 4DZPA 1MNMC 3M3YJ 3S1QJ 3JSJA 1TWGJ 2WB1N 3QQAA 1IG7A 1IC8A 4GFLA 1JTXA 3MNLA 1VF9A 3HOWJ 4JX6A 3NAUA 5F04A 1H89C 5IYBJ 3CJDA 1T33A 2R5ZB 2NX4A 5EFYA 2EQRA 3VP5A 3PO3J 1SANA 1Y1WJ 1TC3C 3VVXA 2R0QC 3FIWA 3H3VK 3S5RA 1VFCA 4W97A 2OF7A 4AC0A 3G1OA 2L9RA 5EZGA 2EZKA 2K40A 3A01A 2D5VA 2ID6A 2L0KA 2YS9A 4B1RA 4QIWN 1AHDP 1MBHA 1HDPA 2CU7A 5EGOB 2XDNA 4GCTA 3ZQFA 4A3LJ 3FRQA 4IHXA 1GUUA 3S14J 2LD5A 4M3DA 5GPAA 3JR9A 5EEAA 3ZOBA 2DJNA 3BTJA 3P9TA 4X1EA 3HGGA 3CCYA 1DU0A 1VI0A 4AC6A 4M3BA 2ZOZA 1B8IB 3BG9A 5IP7J 2QWTA 3JRHA 1FTZA 1PUFA 2CRGA 2LLKA 1HF0A 2G3BA 2H1KA 2K9QA 1JJ8C 2EZIA 3HDDA 5IOYA 2O8KA 2IAIA 4BBSJ 4A93J 1WI3A 2REKA 3FK6A 5FMPA 3IH2A 5E3NA 2QIBA 3Q0WA 4FE7A 3S15J 4HNVA 2W48A 5EG0A 4XICA 3UKGA 5IPAA 1B72A 2UXHA 1ETWA 3IUVA 3HBLA 4I76A 5M3MJ 4UUSB 2HOTA 2QTQA 3B6CA 1IJWC 5FGLA 1LFUP 3FKIJ 5F1JA 3ON2A 4UUTA 4D7MA 3BJBA 3HE0A 2NP5A 3CDLA 3PM1A 1ZR4A 5K7ZA 1RESA 3G1MA 3BQZA 4UDSA 3DEWA 5DAJA 2XGCA 1IV6A 4A3EJ 2HYTA 3GTKJ 1HOMA 3I4NJ 1JT6A 3BRUA 2HDDA 2L7FP 1FIPA 4QSHA 3LSPA 2OERA 2UXUA 3BT9A 1EF4A 1MSEC 5EF6A 1IUFA 1FTTA 2JA7J 4C3JJ 4XIDA 2KT0A 3HOYJ 3V6GA 2N8GA 5DTDA 1GV2A 2LFBA 4BY7J 4L5EA 3SFIA 3LSGA 3ZQIA 3BHQA 1RR7A 5IYCJ 3TW7A 5M3FJ 3HTIA 4XRSA 1WH7A 3HB9A 2R5YA 1LFBA 3QPLA 2LVSA 1QVUA 1W0UA 2O7OA 4MFDA 1GDTA 3JRDA 1BA5A 2XGDA 2XSDC 4FCYA 5D19A 3HOZJ 1Y1VJ 2LKXA 2HKUA 3HGYA 4XRSG 4DYQA 1X2MA 3W6VA 2M0CA 3COLA 4MFEA 1ETKA 1E3OC 2QF7A 2FBQA 2V57A 1JT0A 2HI3A 1MBEA 1A5JA 5HODA 1APLC 3ANPA 5C4JJ 2ZOYA 4MK6A 1ZK8A 2DA5A 3JRFA 1I6HJ 3PO2J 2X9DA 5EZHA 1BW5A 3VW1A 3NRGA 2XB5A 1DU6A 3VOKA 2QOPA 4GFKA 2H8RA 3RQIA 2K9NA 1RKTA 2EZHA 1JTYA 1QVTA 2Y2ZA 4AYBN 2IBDA 4C3IJ 2FX0A 4Y52J 1QRYA 5DS9A 4ME9A 3VW0A 5M5YJ 1ZTRA 4JX4A 1JKRC 4X6AJ 1JKQC 2KDZA 3O60A 3JRIA 3T6NA 1BW6A 2E1OA 5FLVA 4JKZA 1WPKA 5IOZA 2EZLA 2E2HJ 2HYJA 3HOVJ 4M3EA 3BG5A 5FKNA 1ETYA 3SDGA 2M2EA 3JRAA 4FE4A 4KWAA 4EEFG 1JUPA 1U8BA 1MSFC 1OFCX 2D6YA 1JKOC 3NPIA 3BR3A 4JYKA 3D1NI 4BBRJ 5FKOA 1OJLA 2FQ4A 2L7ZA 3GZIA 3S2DJ 2HQ5A 2JWTA 3A02A 1TWCJ 1I3QJ 2PMZN 3IV5A 1F43A 2G0EA 2G7SA 1FIAA 3TP3A 1VNDA 3ON4A 3S1RJ 2JA8J 3ANGA 5E3MA 2UXIA 3KZ9A 1RETA 3VPRA 1ETVA 3S17J 2ZCMA 2E2IJ 2JA5J 4AUXA 2MSYA 1MH4A 2TRTA 1R9TJ 3MKLA 3EGQA 2WAQN 2DA4A 2GUHA 2RHAA 1O4XA 2WV1A 4G12A 5FKKA 5K7HA 2G7LA 5JLWA 2JJ7A 2R92J 1WGXA 2ZB9A 1B72B 1TWFJ 2NVTJ 3S1NJ 2Y0SN 4A3JJ 5C4YA 5H9TA 3OIOA 1D5YA 1WCMJ 3NARA 2DMUA 1ZKGA 3I4MJ 1F36A 4NELA 3RH2A 4B3AA 4I6ZA 2MG4A 1ETQA 2HOSA 2I10A 3OSGA 3LHQA 3ZQGA 1NTCA 4DYRA 3CRJA 1ETOA 3F0CA 4YZEA 1QPIA 3HTAA 3JREA 3LOCA 3V78A 4GCLA 1K61A 3A03A 2VUMJ 2NP3A 3CQZJ 3OSFA 5EYRA 4L62A 1X2NA 2B63J 2QCOA 2IEKA 3JRCA 2CJJA 1GVDA 3ZQHA 1WH5A 5J3LA 3S16J 3NI7A 5GPCA 3HOUJ 2ECBA 3S1MJ 1P7IA 4LOCA 5F27A 4ICHA 2R7ZJ 1ETXA 2Y31A 2TCTA 2ECCA 2L7MP 2LY9A 2VKEA 3WHBA 4JP0A 4DW6A 1K83J 5F0HA 5K7FA 1TWAJ 4ABZA 3BNIA 2RASA 3HIMA 2XGEA 4XK4A 2XPUA 2DMQA 2CQXA 1JJ6C 3HKZN 1B8IA 3BTIA 3ZQCA 2JA6J 2VI6A 2LK2A 3GTGJ 2GBYA 4IHVA 1IGNA 3GTLJ 2ME0A 3HM5A 2YUSA 4IHYA 1MBKA 2Y9YA 4MLOA 3F1BA 5FKLA 2R93J 1PUFB 1AKHB 4IHWA 3G7RA 3FK7A 2EH3A 3HEFA 5FKMA 4A3GJ 4A3FJ 3G56A 4UUSA 4A3KJ 2DA1A 5C3EJ 4BXXJ 5IP6A 1IRZA 3WHCA 1TWHJ 3G1LA 4CGRA 2M8GX 2XRLA 2GLOA 5J1RA 5E3OA 1AKHA 2DMTA 4XRMA 4D5CA 3QPSA 3JRBA 3BCGA 1Z77A 3PPBA 4ACIA 2QKOA 5C4XJ 2CQQA 5C44J 1MBGA 2E2JJ 2LR8A 2XPVA 3BR1A 3LSRA 2DG8A 3DCFA 3VW2A 2NVQJ 2PBXA 3LNQA 4JL3A 2DA7A 1ZGWA 4A3DJ 3IH4A 5BNGA 2R5ZA 3L1PA 1P7JA 3VIBA 5F0FA 4HKUA 3VUQA 1HDDC 2F07A 2DTZA 5M5XJ 3CMYA 2Y9ZA 2GENA 4GFBA 4A3MJ 5AQCA 1UHSA 2FJ1A 2HOAA 3GEUA 3TP0A 2LP0A 2LTPA 5K58A 1POGA 4A69C 3Q3SA 3KNWA 4MO7A 1GV5A 1FJLA 1W0TA 3PASA 5FHPA 5IYDJ 2MGQA 4DZJA 2XPWA 5EGOA 2R5YB 2E19A 3TW6A 1UI6A 3O8GA 1H8AC 2DN0A 3BTLA 1JGGA 4MIMA 5FJ8J 2DMNA 1I50J 2IU5A 4NN1A 3BR5A 3ZQLA 1UG2A 4RDUA 3CWRA 3HTJA 3KKDA 2HXIA 4Y7NJ 3EUPA 3C07A 5CW8A 4V2FA 2WGBA 3KKCA 2HXOA 1ENHA 2M34A 4BKXA 3M4OJ 4PXIA 3JRGA 3B6AA 5F0CA 5JLXA 2VPRA 5D18A 1U9OA 1YRNB 3QBMA 1XG1A 1G2HA 4D7NA 1JUSA 4S0HB 4JNNA 3RZOJ 3BQYA 3NNRA 3VVZA 4C3HJ 3RKQA 2PZ9A 2DA3A 3SJMA 2OPTA 1HCRA 3H0GJ 2CUEA 1SGMA 3FISA 5F08A 2UXOA 3BR6A 3C2BA 4RBOA 1BL0A 4W1UA 2ZCNA 1T56A 3Q0UA 3K2AA 2M9HA 3MN2A 4DYCA 1IDZA 3MVPA 5EDNA 2GM4A 4FTHA 3GTQJ 1BJZA 2JK3A 5CXGA 2CUFA 3LWJA 1JKPC 1RKWA 1YRNA 1ZQ3P 1LE8B 2O9LA 1Z0XA 4J19A 2RAEA 4QTRA 5FLMJ 5M5WJ 1CQTA 1UI5A 3HTHA 3TEDA 4M3FA 2O7TA 2ELKA 2GFNA 2Q24A 2WUIA 3AQSA 2ZCXA 3DPJA 1MH3A 2NOGA 1UMQA 2K9SA 4D5FA 3RZDJ 4A3CJ 2ID3A 3VVYA 1MBJA 2COBA 2AO9A 1IDYA 3GTOJ 5J1UA 1RPWA 2NS8A 4C2MJ 1H88C 4AF5A 2EBIA 5J1YA 1MBFA 1LE8A 3RD3A 3OOUA 5HBUA 2NVYJ 3BTCA 4B4CA 1AU7A 2NVXJ 1OCPA 3GTJJ 1NK3P 1XS9A 2ME6A 1U78A 3BR2A 1NK2P 4FISA 3GBGA 3HOXJ 5GP9A 1GT0C 5E3LA 4M3GA 5EG0B 1A6IA 1FEXA 5D1RA 4M6VA 1SFOJ 3LJLA 1ITYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E7Q A;  5CXI A;  2UXP A;  4V2G A;  3QKX A;  3Q0V A;  4A3B J;  2FD5 A;  4CYC A;  2AHQ A;  2YU9 J;  3GTP J;  2DG7 A;  4GCK A;  3B81 A;  3O8H A;  4A3I J;  1ORK A;  1X58 A;  3BG3 A;  1HLV A;  3LSJ A;  2W53 A;  3GTM J;  1Q1V A;  2YVH A;  2P81 A;  3BR0 A;  2DMP A;  2DA6 A;  4JX5 A;  2X48 A;  1JUM A;  3S2H J;  2YVE A;  1XC5 A;  2DA2 A;  2JN6 A;  1U9N A;  2X6O A;  2MW8 A;  3K7A J;  2G7G A;  3AQT A;  3NXC A;  4MXM A;  3IH3 A;  3E7L A;  2JMW A;  4CYC B;  1ZR2 A;  1OCT C;  4NDL A;  2VKV A;  9ANT A;  2NS7 A;  3A01 B;  2OI8 A;  2XB0 X;  3VOX A;  5HSZ A;  5HAW A;  4IEJ A;  2Y30 A;  5IP9 J;  4BY1 J;  1S7E A;  4DZP A;  1MNM C;  3M3Y J;  3S1Q J;  3JSJ A;  1TWG J;  2WB1 N;  3QQA A;  1IG7 A;  1IC8 A;  4GFL A;  1JTX A;  3MNL A;  1VF9 A;  3HOW J;  4JX6 A;  3NAU A;  5F04 A;  1H89 C;  5IYB J;  3CJD A;  1T33 A;  2R5Z B;  2NX4 A;  5EFY A;  2EQR A;  3VP5 A;  3PO3 J;  1SAN A;  1Y1W J;  1TC3 C;  3VVX A;  2R0Q C;  3FIW A;  3H3V K;  3S5R A;  1VFC A;  4W97 A;  2OF7 A;  4AC0 A;  3G1O A;  2L9R A;  5EZG A;  2EZK A;  2K40 A;  3A01 A;  2D5V A;  2ID6 A;  2L0K A;  2YS9 A;  4B1R A;  4QIW N;  1AHD P;  1MBH A;  1HDP A;  2CU7 A;  5EGO B;  2XDN A;  4GCT A;  3ZQF A;  4A3L J;  3FRQ A;  4IHX A;  1GUU A;  3S14 J;  2LD5 A;  4M3D A;  5GPA A;  3JR9 A;  5EEA A;  3ZOB A;  2DJN A;  3BTJ A;  3P9T A;  4X1E A;  3HGG A;  3CCY A;  1DU0 A;  1VI0 A;  4AC6 A;  4M3B A;  2ZOZ A;  1B8I B;  3BG9 A;  5IP7 J;  2QWT A;  3JRH A;  1FTZ A;  1PUF A;  2CRG A;  2LLK A;  1HF0 A;  2G3B A;  2H1K A;  2K9Q A;  1JJ8 C;  2EZI A;  3HDD A;  5IOY A;  2O8K A;  2IAI A;  4BBS J;  4A93 J;  1WI3 A;  2REK A;  3FK6 A;  5FMP A;  3IH2 A;  5E3N A;  2QIB A;  3Q0W A;  4FE7 A;  3S15 J;  4HNV A;  2W48 A;  5EG0 A;  4XIC A;  3UKG A;  5IPA A;  1B72 A;  2UXH A;  1ETW A;  3IUV A;  3HBL A;  4I76 A;  5M3M J;  4UUS B;  2HOT A;  2QTQ A;  3B6C A;  1IJW C;  5FGL A;  1LFU P;  3FKI J;  5F1J A;  3ON2 A;  4UUT A;  4D7M A;  3BJB A;  3HE0 A;  2NP5 A;  3CDL A;  3PM1 A;  1ZR4 A;  5K7Z A;  1RES A;  3G1M A;  3BQZ A;  4UDS A;  3DEW A;  5DAJ A;  2XGC A;  1IV6 A;  4A3E J;  2HYT A;  3GTK J;  1HOM A;  3I4N J;  1JT6 A;  3BRU A;  2HDD A;  2L7F P;  1FIP A;  4QSH A;  3LSP A;  2OER A;  2UXU A;  3BT9 A;  1EF4 A;  1MSE C;  5EF6 A;  1IUF A;  1FTT A;  2JA7 J;  4C3J J;  4XID A;  2KT0 A;  3HOY J;  3V6G A;  2N8G A;  5DTD A;  1GV2 A;  2LFB A;  4BY7 J;  4L5E A;  3SFI A;  3LSG A;  3ZQI A;  3BHQ A;  1RR7 A;  5IYC J;  3TW7 A;  5M3F J;  3HTI A;  4XRS A;  1WH7 A;  3HB9 A;  2R5Y A;  1LFB A;  3QPL A;  2LVS A;  1QVU A;  1W0U A;  2O7O A;  4MFD A;  1GDT A;  3JRD A;  1BA5 A;  2XGD A;  2XSD C;  4FCY A;  5D19 A;  3HOZ J;  1Y1V J;  2LKX A;  2HKU A;  3HGY A;  4XRS G;  4DYQ A;  1X2M A;  3W6V A;  2M0C A;  3COL A;  4MFE A;  1ETK A;  1E3O C;  2QF7 A;  2FBQ A;  2V57 A;  1JT0 A;  2HI3 A;  1MBE A;  1A5J A;  5HOD A;  1APL C;  3ANP A;  5C4J J;  2ZOY A;  4MK6 A;  1ZK8 A;  2DA5 A;  3JRF A;  1I6H J;  3PO2 J;  2X9D A;  5EZH A;  1BW5 A;  3VW1 A;  3NRG A;  2XB5 A;  1DU6 A;  3VOK A;  2QOP A;  4GFK A;  2H8R A;  3RQI A;  2K9N A;  1RKT A;  2EZH A;  1JTY A;  1QVT A;  2Y2Z A;  4AYB N;  2IBD A;  4C3I J;  2FX0 A;  4Y52 J;  1QRY A;  5DS9 A;  4ME9 A;  3VW0 A;  5M5Y J;  1ZTR A;  4JX4 A;  1JKR C;  4X6A J;  1JKQ C;  2KDZ A;  3O60 A;  3JRI A;  3T6N A;  1BW6 A;  2E1O A;  5FLV A;  4JKZ A;  1WPK A;  5IOZ A;  2EZL A;  2E2H J;  2HYJ A;  3HOV J;  4M3E A;  3BG5 A;  5FKN A;  1ETY A;  3SDG A;  2M2E A;  3JRA A;  4FE4 A;  4KWA A;  4EEF G;  1JUP A;  1U8B A;  1MSF C;  1OFC X;  2D6Y A;  1JKO C;  3NPI A;  3BR3 A;  4JYK A;  3D1N I;  4BBR J;  5FKO A;  1OJL A;  2FQ4 A;  2L7Z A;  3GZI A;  3S2D J;  2HQ5 A;  2JWT A;  3A02 A;  1TWC J;  1I3Q J;  2PMZ N;  3IV5 A;  1F43 A;  2G0E A;  2G7S A;  1FIA A;  3TP3 A;  1VND A;  3ON4 A;  3S1R J;  2JA8 J;  3ANG A;  5E3M A;  2UXI A;  3KZ9 A;  1RET A;  3VPR A;  1ETV A;  3S17 J;  2ZCM A;  2E2I J;  2JA5 J;  4AUX A;  2MSY A;  1MH4 A;  2TRT A;  1R9T J;  3MKL A;  3EGQ A;  2WAQ N;  2DA4 A;  2GUH A;  2RHA A;  1O4X A;  2WV1 A;  4G12 A;  5FKK A;  5K7H A;  2G7L A;  5JLW A;  2JJ7 A;  2R92 J;  1WGX A;  2ZB9 A;  1B72 B;  1TWF J;  2NVT J;  3S1N J;  2Y0S N;  4A3J J;  5C4Y A;  5H9T A;  3OIO A;  1D5Y A;  1WCM J;  3NAR A;  2DMU A;  1ZKG A;  3I4M J;  1F36 A;  4NEL A;  3RH2 A;  4B3A A;  4I6Z A;  2MG4 A;  1ETQ A;  2HOS A;  2I10 A;  3OSG A;  3LHQ A;  3ZQG A;  1NTC A;  4DYR A;  3CRJ A;  1ETO A;  3F0C A;  4YZE A;  1QPI A;  3HTA A;  3JRE A;  3LOC A;  3V78 A;  4GCL A;  1K61 A;  3A03 A;  2VUM J;  2NP3 A;  3CQZ J;  3OSF A;  5EYR A;  4L62 A;  1X2N A;  2B63 J;  2QCO A;  2IEK A;  3JRC A;  2CJJ A;  1GVD A;  3ZQH A;  1WH5 A;  5J3L A;  3S16 J;  3NI7 A;  5GPC A;  3HOU J;  2ECB A;  3S1M J;  1P7I A;  4LOC A;  5F27 A;  4ICH A;  2R7Z J;  1ETX A;  2Y31 A;  2TCT A;  2ECC A;  2L7M P;  2LY9 A;  2VKE A;  3WHB A;  4JP0 A;  4DW6 A;  1K83 J;  5F0H A;  5K7F A;  1TWA J;  4ABZ A;  3BNI A;  2RAS A;  3HIM A;  2XGE A;  4XK4 A;  2XPU A;  2DMQ A;  2CQX A;  1JJ6 C;  3HKZ N;  1B8I A;  3BTI A;  3ZQC A;  2JA6 J;  2VI6 A;  2LK2 A;  3GTG J;  2GBY A;  4IHV A;  1IGN A;  3GTL J;  2ME0 A;  3HM5 A;  2YUS A;  4IHY A;  1MBK A;  2Y9Y A;  4MLO A;  3F1B A;  5FKL A;  2R93 J;  1PUF B;  1AKH B;  4IHW A;  3G7R A;  3FK7 A;  2EH3 A;  3HEF A;  5FKM A;  4A3G J;  4A3F J;  3G56 A;  4UUS A;  4A3K J;  2DA1 A;  5C3E J;  4BXX J;  5IP6 A;  1IRZ A;  3WHC A;  1TWH J;  3G1L A;  4CGR A;  2M8G X;  2XRL A;  2GLO A;  5J1R A;  5E3O A;  1AKH A;  2DMT A;  4XRM A;  4D5C A;  3QPS A;  3JRB A;  3BCG A;  1Z77 A;  3PPB A;  4ACI A;  2QKO A;  5C4X J;  2CQQ A;  5C44 J;  1MBG A;  2E2J J;  2LR8 A;  2XPV A;  3BR1 A;  3LSR A;  2DG8 A;  3DCF A;  3VW2 A;  2NVQ J;  2PBX A;  3LNQ A;  4JL3 A;  2DA7 A;  1ZGW A;  4A3D J;  3IH4 A;  5BNG A;  2R5Z A;  3L1P A;  1P7J A;  3VIB A;  5F0F A;  4HKU A;  3VUQ A;  1HDD C;  2F07 A;  2DTZ A;  5M5X J;  3CMY A;  2Y9Z A;  2GEN A;  4GFB A;  4A3M J;  5AQC A;  1UHS A;  2FJ1 A;  2HOA A;  3GEU A;  3TP0 A;  2LP0 A;  2LTP A;  5K58 A;  1POG A;  4A69 C;  3Q3S A;  3KNW A;  4MO7 A;  1GV5 A;  1FJL A;  1W0T A;  3PAS A;  5FHP A;  5IYD J;  2MGQ A;  4DZJ A;  2XPW A;  5EGO A;  2R5Y B;  2E19 A;  3TW6 A;  1UI6 A;  3O8G A;  1H8A C;  2DN0 A;  3BTL A;  1JGG A;  4MIM A;  5FJ8 J;  2DMN A;  1I50 J;  2IU5 A;  4NN1 A;  3BR5 A;  3ZQL A;  1UG2 A;  4RDU A;  3CWR A;  3HTJ A;  3KKD A;  2HXI A;  4Y7N J;  3EUP A;  3C07 A;  5CW8 A;  4V2F A;  2WGB A;  3KKC A;  2HXO A;  1ENH A;  2M34 A;  4BKX A;  3M4O J;  4PXI A;  3JRG A;  3B6A A;  5F0C A;  5JLX A;  2VPR A;  5D18 A;  1U9O A;  1YRN B;  3QBM A;  1XG1 A;  1G2H A;  4D7N A;  1JUS A;  4S0H B;  4JNN A;  3RZO J;  3BQY A;  3NNR A;  3VVZ A;  4C3H J;  3RKQ A;  2PZ9 A;  2DA3 A;  3SJM A;  2OPT A;  1HCR A;  3H0G J;  2CUE A;  1SGM A;  3FIS A;  5F08 A;  2UXO A;  3BR6 A;  3C2B A;  4RBO A;  1BL0 A;  4W1U A;  2ZCN A;  1T56 A;  3Q0U A;  3K2A A;  2M9H A;  3MN2 A;  4DYC A;  1IDZ A;  3MVP A;  5EDN A;  2GM4 A;  4FTH A;  3GTQ J;  1BJZ A;  2JK3 A;  5CXG A;  2CUF A;  3LWJ A;  1JKP C;  1RKW A;  1YRN A;  1ZQ3 P;  1LE8 B;  2O9L A;  1Z0X A;  4J19 A;  2RAE A;  4QTR A;  5FLM J;  5M5W J;  1CQT A;  1UI5 A;  3HTH A;  3TED A;  4M3F A;  2O7T A;  2ELK A;  2GFN A;  2Q24 A;  2WUI A;  3AQS A;  2ZCX A;  3DPJ A;  1MH3 A;  2NOG A;  1UMQ A;  2K9S A;  4D5F A;  3RZD J;  4A3C J;  2ID3 A;  3VVY A;  1MBJ A;  2COB A;  2AO9 A;  1IDY A;  3GTO J;  5J1U A;  1RPW A;  2NS8 A;  4C2M J;  1H88 C;  4AF5 A;  2EBI A;  5J1Y A;  1MBF A;  1LE8 A;  3RD3 A;  3OOU A;  5HBU A;  2NVY J;  3BTC A;  4B4C A;  1AU7 A;  2NVX J;  1OCP A;  3GTJ J;  1NK3 P;  1XS9 A;  2ME6 A;  1U78 A;  3BR2 A;  1NK2 P;  4FIS A;  3GBG A;  3HOX J;  5GP9 A;  1GT0 C;  5E3L A;  4M3G A;  5EG0 B;  1A6I A;  1FEX A;  5D1R A;  4M6V A;  1SFO J;  3LJL A;  1ITY A; 
#chains in the Genus database with same CATH topology
 3I54 A;  1I27 A;  4OMZ A;  2UXP A;  2KFD A;  2ZBK A;  4D9J A;  1WWX A;  4V2G A;  1D5V A;  4RAG A;  3Q0V A;  2LY2 A;  4CYC A;  2F4O B;  4ENN A;  2QKM B;  1ERD A;  3B81 A;  4A3I J;  1ORK A;  1X58 A;  2HNH A;  2KZV A;  4MQ9 F;  3PQK A;  4XL9 A;  3GTM J;  2W53 A;  4IRV A;  2JUG A;  3BR0 A;  1HST A;  4JX5 A;  2LNB A;  4ESF A;  3ASN H;  3H9Q A;  3ECH A;  4OAY A;  1XC5 A;  1Z6R A;  4XOP A;  4ENK A;  3K8P C;  5DCM B;  2VOO A;  1Y8Q B;  3DTI A;  2VKV A;  4XLC A;  3A0B C;  3BCB A;  3OYB A;  3A01 B;  2PJR A;  2JRT A;  2XB0 X;  4KFC A;  3OS0 A;  3F21 A;  4PGG A;  4BDZ A;  3DBR B;  1XGN A;  3M3Y J;  3S1Q J;  2RNJ A;  3AL0 B;  1XX5 A;  3CCM I;  4ZZL A;  3MNL A;  4KIB A;  4Y3O A;  3KYC B;  3HOW J;  3GEZ A;  4CH7 A;  3OL3 A;  2QSG X;  4RAY A;  3F8F A;  4G6Q A;  3VWB A;  2OCE A;  4BAY A;  4F7Z A;  4HST A;  1TC3 C;  4MHG A;  3GF2 A;  5K1Y A;  3CCU I;  4M73 A;  2KJB A;  3L7W A;  3U21 A;  1SFE A;  2K40 A;  4LK1 F;  3CCQ I;  3RDI A;  2ID6 A;  3DEE A;  5CYV A;  4B1R A;  2QKL B;  3IKV A;  5HNH A;  1ODD A;  1DDN A;  2CU7 A;  4A3L J;  3QAH A;  3TDZ C;  4BYY A;  4IHX A;  4FAS D;  1GHC A;  1D1A A;  3P9C A;  2H09 A;  1OYY A;  2H6B A;  1DPR A;  3K0L A;  3O3K A;  3BTJ A;  4X1E A;  5K5R A;  4HDV A;  5AIP A;  3M8E A;  1VI0 A;  3K1M A;  2NNY A;  3BOQ A;  4NQW B;  5IP7 J;  5K5Q A;  2QWT A;  1P4A A;  3JRH A;  1FTZ A;  1AWC A;  2LLK A;  3HIF A;  3BDD A;  3HSF A;  2V9K A;  1JJ8 C;  3FXO A;  4U9N A;  2EZI A;  2F48 A;  3HDD A;  4BBS J;  4YFX F;  4I0A A;  4HNU A;  2CW0 F;  2REK A;  2QIB A;  2ZJ2 A;  3H5N A;  4HNV A;  1ZRF A;  2W48 A;  5EG0 A;  3PIO F;  3UKG A;  1ETW A;  3IUV A;  2M7B A;  3E5X A;  3KLO A;  5DD8 A;  2QTQ A;  2E1N A;  4A2U A;  3P5J A;  1V5F A;  3PFY A;  3GLL A;  4F92 B;  3R4K A;  1YX3 A;  4EM2 A;  4DGW B;  3CDL A;  3ZMV A;  2WC2 A;  1ZR4 A;  1F5T A;  3VYT B;  2FBI A;  3LSH A;  1FZP B;  2E1M C;  1OMI A;  1YG2 A;  1IV6 A;  2ZXW H;  4BHB A;  4A3E J;  2K3P A;  2HYT A;  2CO5 A;  3GTK J;  4BEH B;  3I4N J;  4E7I A;  2FOK A;  1SVM A;  3RJP A;  3LSI A;  1FIP A;  1MMG A;  2MBF A;  2VE8 A;  1YO5 C;  2OER A;  1EF4 A;  3EUK L;  2JA7 J;  2JTV A;  4XLP F;  2L2O A;  2QSH X;  2JPC A;  1GV2 A;  3KZY A;  3MQ0 A;  3OYJ A;  4OU0 A;  5L3G A;  1XMA A;  2RKH A;  3CO6 C;  2FUG 2;  3TW7 A;  3HTI A;  3DLA A;  1WH7 A;  2ZJQ F;  2B7E A;  3B02 A;  2F4I A;  2LVS A;  1GDT A;  1S8N A;  1ZGA A;  2CQ7 A;  3OYC A;  5D19 A;  1G3Y A;  2W1O A;  1VQN I;  2HKU A;  1JHF A;  2XUB A;  4KN7 X;  2GXA A;  3LFU A;  2XHK A;  4XRS G;  1OR7 C;  2MC3 A;  4LG0 B;  2V9P A;  3CC2 I;  4XLH A;  4L5I A;  1APL C;  1TT0 A;  2M4G A;  4OIQ F;  3OIQ A;  3K69 A;  1IXR C;  1T8I A;  3K4J A;  1J0R A;  2DPD A;  4CSW A;  1I6H J;  3PO2 J;  4LLG F;  1TNT A;  1D1C A;  4Y4R A;  3L2C A;  3VW1 A;  2XB5 A;  1BC8 C;  2R7O A;  3CCE I;  1O7L A;  3BZ6 A;  1VQL I;  1HW5 A;  2KIQ A;  5TJJ A;  4HF2 A;  1TW2 A;  1S3J A;  4KIT B;  1OCO H;  2KP6 A;  4UV8 A;  5ICG A;  3GFM A;  6PAX A;  3M1C A;  1USS A;  4MTE A;  3GFI A;  3QPT A;  5J40 A;  1WZ2 A;  2DK8 A;  3EDP A;  1IO2 A;  3LFK A;  4ZJZ A;  2R7Q A;  5F64 A;  1VQ7 I;  1XGS A;  3U1D A;  1JKQ C;  1S7A A;  3JRI A;  2E1O A;  4G7H F;  5BQT A;  5FLV A;  3HRM A;  1M1E B;  4DIQ A;  2LG4 A;  4O6J A;  1ETY A;  3HRS A;  2VT3 A;  2M2E A;  2VOD A;  3JRA A;  1DQU A;  4OD5 A;  3NPI A;  4CYD A;  2MAB A;  2K7L A;  4XM3 A;  4MQV A;  3IRR A;  2DI3 A;  4BJ6 C;  3LWF A;  4BBR J;  1WKM A;  5FKO A;  1T39 A;  2ZJP F;  1S6L A;  3S32 A;  3S2D J;  2HQ5 A;  3HKZ A;  4BU2 A;  1TWC J;  1XB4 A;  1F43 A;  2COM A;  4AD9 A;  3TGN A;  5LHG A;  3ANG A;  4HEA 2;  3D5L A;  4Q47 A;  1RET A;  1LVK A;  2K86 A;  5ED4 A;  4ZYD A;  1I6X A;  3PFI A;  3K1P A;  1R9T J;  1T0F A;  2FSW A;  2Z5U A;  4WWC A;  4IZZ A;  1BIB A;  3R0J A;  2JJ7 A;  2VL8 A;  1YJ9 I;  2ZY9 A;  2ZB9 A;  3DU6 A;  1IW7 F;  2CFX A;  2XRN A;  2Y0S N;  5C4Y A;  2QQB A;  3DBH B;  5H9T A;  2QVO A;  1TLH B;  5HDN A;  3C7J A;  1WCM J;  2P8T A;  3ZMZ A;  3P9I A;  1ZKG A;  1R1T A;  3GLX A;  3HSE A;  4NC8 A;  4PGH A;  1S72 I;  4NEL A;  2PMZ A;  2HGC A;  2LC2 A;  4R8H A;  4AID A;  5E1W A;  5ICF A;  3WTV C;  3ZQG A;  3F8B A;  2IS6 A;  3MZH A;  3F0C A;  5ICC A;  4YIR X;  2UV1 A;  4C2M A;  4M6Y A;  3WE2 A;  3HTA A;  3MWM A;  3JRE A;  4RGS A;  1SC7 A;  1XCV A;  3DKW A;  2Y69 H;  4KMF A;  1SD6 A;  4AIJ A;  1I39 A;  1QZZ A;  2B63 J;  2D1H A;  2IEK A;  2A07 F;  3ESW B;  3QU6 A;  1AA7 A;  1T08 B;  5J4V A;  4KJZ A;  2ECB A;  2HQN A;  3KZZ A;  3P9K A;  1IN6 A;  2Y31 A;  4IRH A;  3F22 A;  2R7Z J;  4WIB A;  3I5U A;  2LY9 A;  2KRC A;  3CMA I;  2I8D A;  2VKE A;  2G7H A;  4AVP A;  2PJP A;  1O3Q A;  5F0H A;  1OQY A;  3H0D A;  3TO7 A;  4ABZ A;  3W6J B;  3BNI A;  3HIM A;  2XGE A;  2PMH A;  2EB7 A;  1T38 A;  4XOT A;  2XPU A;  4S04 A;  2CQX A;  3HKZ N;  2KRH A;  2DOE A;  2VI6 A;  4U88 A;  2V1N A;  4UHT A;  3CP8 A;  4BEH A;  2GBY A;  2XF6 A;  4UVA A;  1ONV A;  2ZNY A;  3PNT A;  3T8R A;  4IHV A;  3GTL J;  2W82 A;  2DDB A;  3JTH A;  3AKZ A;  1MBK A;  4FX4 A;  4IHY A;  2HPM A;  3F1B A;  2QYO A;  4XKW A;  2M87 A;  2UUZ A;  3FK7 A;  5ERI A;  2XAJ A;  1YW9 A;  3HEF A;  1SMY F;  4Y17 A;  3FZV A;  2WWY A;  4A3F J;  3WTS C;  3HTS B;  1ACI A;  2AXT C;  2X85 A;  1RNL A;  2IA2 A;  2G9W A;  1XMK A;  3G1L A;  3WU1 B;  1FSE A;  3M9A A;  2Z99 A;  2D1V A;  1B9M A;  4L9N A;  3EUH A;  2YU3 A;  5J1R A;  2DMT A;  1Z3Y A;  2EFO A;  2RVC A;  3QPS A;  4D5C A;  3JRB A;  4ACI A;  4WXH A;  1BR2 A;  4QWQ A;  4B3X A;  4JL3 A;  4IL6 C;  1MDM A;  3DLL F;  2GXB A;  3BRO A;  4HV5 A;  1ZGW A;  4PJN A;  5JHU A;  2W4S A;  2QEX I;  3FHN A;  4AU7 A;  4LIV A;  2VN2 A;  3L1P A;  2R5Z A;  1P7J A;  1WJC A;  1ZRE A;  1IN4 A;  1HDD C;  2R7W A;  4PZJ A;  4Y33 A;  2F07 A;  3TO9 A;  5M5X J;  2Y9Z A;  3DQV C;  3Q5F A;  4EJW A;  2WAQ A;  3G2B A;  2BVM A;  1FNN A;  1Z1D A;  1R6R A;  5K58 A;  2GQQ A;  4NB5 A;  5TGT A;  3K10 A;  4MO7 A;  1FJL A;  5FHP A;  2MGQ A;  1B9N A;  2E19 A;  5E8I A;  3CJN A;  2MFZ A;  1NG6 A;  4Y13 A;  4EJT A;  2HQR A;  2PQ8 A;  2NOJ B;  1HQC A;  1GLN A;  1UI6 A;  4RGX A;  4UUV A;  2EV0 A;  2MA3 A;  2VIX A;  3VOD A;  1IN5 A;  3BTL A;  3V7S A;  2V7F A;  1W5T A;  4HBL A;  3BR5 A;  1FYM A;  2VJJ A;  3CWR A;  1J5Y A;  2EA2 A;  3KKD A;  4CZC A;  4GCV A;  2R7T A;  3QYB A;  2KJC A;  1W36 D;  5CW8 A;  1ENH A;  1OLT A;  5F0C A;  2VPR A;  1TQM A;  2DFI A;  2HKX A;  4IPA A;  4D7N A;  1ZH5 A;  2HWV A;  5CQG A;  3NNR A;  4M9Z A;  4ZZD A;  5HDG A;  4BQQ A;  3L2U A;  2V26 A;  5D5V B;  4BQA A;  3FIS A;  1LUJ B;  1WFX A;  2VQH A;  4XKB A;  1FYK A;  3C2B A;  4RBO A;  1BL0 A;  2UXO A;  3Q0U A;  1VQ8 I;  3K2A A;  2E1M B;  1R58 A;  5EDN A;  3SDB A;  2ZFW A;  2JK3 A;  4HSR A;  1V55 H;  4G6T B;  1ZGJ A;  3LWJ A;  2CQK A;  2UXN A;  1JKP C;  3ZQ7 A;  2LKP A;  1HA8 A;  5D4S A;  1LDK B;  2DYR H;  4DBR A;  3HHG A;  5FLM J;  3TED A;  2WUI A;  3AQS A;  1F1Z A;  1MH3 A;  4KT6 A;  4A3C J;  3I56 I;  4GO1 A;  2COB A;  4XON A;  2AO9 A;  3DPL C;  3RCO A;  3D5R C;  2QBY A;  3J81 Z;  5J1Y A;  1MBF A;  2E5Z A;  1YOV B;  1DPU A;  3T8T A;  2XC7 A;  2Q2E A;  3SWH A;  5E17 F;  4JBA A;  5AON A;  2EIM H;  4UNO A;  2EFQ A;  2ZXI A;  1VQO I;  2RDP A;  3GTJ J;  1NK3 P;  1XS9 A;  1U78 A;  1NK2 P;  5GP9 A;  2DAO A;  3I59 A;  1IRF A;  2GA1 A;  1IXS B;  5EG0 B;  1A6I A;  3T5X A;  1LKX A;  1SFO J;  4LB6 B;  4PJL A;  2FU4 A;  1WRJ A;  2GZW A;  4OIR F;  5L3F A;  1ITY A;  4KIF A;  2DW4 A;  1X4O A;  3VYS B;  1FX7 A;  2RN7 A;  3QKX A;  4EQQ A;  2YU9 J;  2AHQ A;  2OA4 A;  3GTP J;  2DG7 A;  3QOP A;  2L9S A;  2P6S A;  1X1D A;  3VYU B;  5J6X A;  4S05 A;  2IJL A;  3WU2 C;  4LK0 F;  1UHW A;  1VQ4 I;  2X48 A;  4Y15 A;  1JUM A;  1T95 A;  3S2H J;  1LJ9 A;  2HTS A;  2DA2 A;  1UG0 A;  3K7A J;  2G7G A;  4II3 A;  3IH3 A;  4CYC B;  1KQ0 A;  1OCT C;  4XSZ F;  3BJA A;  9ANT A;  1D0Y A;  2VE9 A;  2OI8 A;  3HPH A;  2A6E F;  3K4C A;  3MD2 A;  4CUG A;  1QA6 A;  1R1U A;  2RNG A;  4BY1 J;  2O61 A;  5HSZ A;  3S8P A;  4ZYG A;  3JSJ A;  4CCO A;  1TWG J;  2VBZ A;  3EET A;  4GFL A;  3DBL B;  5F6F A;  2YX4 A;  3WOD F;  3NAU A;  1H89 C;  5IYB J;  5L3C A;  2YVX A;  3M8F A;  3CJD A;  1T98 A;  2A6T A;  4RB1 A;  2R7S A;  2OJE D;  3VVX A;  1N77 A;  3GO5 A;  1OCC H;  3HZJ A;  1VFC A;  4P55 A;  1FYL A;  2CGP A;  1LDJ A;  2H94 A;  1Z6T A;  3A01 A;  2PJR B;  1QQI A;  2IRF G;  2L0K A;  3ZR8 X;  2VJI A;  2HZD A;  1HDP A;  4LD5 A;  4OWR B;  5EGO B;  1VQ6 I;  1AOY A;  4G8X A;  2FML A;  1GUU A;  2W85 A;  4RAF A;  3LQQ A;  5CLS A;  5FLX K;  1U6G A;  4NHJ A;  3L2Q A;  4A0X A;  2B0L A;  2DJN A;  5FRM A;  4L5J A;  1BN5 A;  3VTI A;  3CCY A;  3S2W A;  1DU0 A;  4M3B A;  4K2E A;  3S3O A;  4BXU A;  3WTX C;  3A2K A;  3ZN1 A;  5DEQ A;  1W7P D;  3HC7 A;  1R71 A;  2FEZ A;  2VLA A;  2H1K A;  3IRQ A;  4U0V A;  5IOY A;  2IAI A;  3FK6 A;  2BGC A;  3IH2 A;  3R0A A;  1A6Q A;  4Z6Y A;  1BC7 C;  4XIC A;  1LFP A;  1B72 A;  4ITV A;  3HYI A;  1B59 A;  1YQA A;  1XSV A;  1WQ2 A;  5M3M J;  3WU0 A;  4D1Q A;  3B6C A;  3MKY B;  3P7N A;  5FGL A;  1OKR A;  2V6C A;  1DP3 A;  4ESJ A;  3KIO A;  2F5D A;  4D7M A;  3TQN A;  3HE0 A;  1V3F A;  1RES A;  2IA1 A;  2Q1Z B;  3CF5 F;  3BQZ A;  3U9G A;  1MJA A;  3DEW A;  3V7C A;  1T6S A;  1KYW A;  4CHU A;  2DU9 A;  2HDD A;  2L7F P;  4RS8 A;  4CCL A;  4EJV A;  2RQP A;  3AG4 H;  2RGV A;  1MMS A;  3LSP A;  4RLQ A;  1RC9 A;  2UXU A;  3BT9 A;  1MSE C;  5TRD A;  5A2Q K;  4P1W A;  1YI2 I;  5EF6 A;  1IUF A;  1FTT A;  3ERM A;  4LIT A;  1BOB A;  4XID A;  3GME A;  4LJZ F;  5DTD A;  1BBY A;  3DKX A;  3M7G A;  2LFB A;  4BY7 J;  4UV9 A;  3CC7 I;  5CKT A;  5B66 C;  3FXL A;  5KK1 A;  4L5E A;  3S3N A;  1SAU A;  2IPQ X;  1QNT A;  1LFB A;  1I3A A;  1BA5 A;  1QVU A;  4N0B A;  2O7O A;  3KP3 A;  1RR8 C;  2XGD A;  3OYA A;  2E34 A;  2KDO A;  2K9M A;  5DDG A;  3HOZ J;  2VKD A;  3GUD A;  3HGY A;  3WTY C;  5HLI A;  2ZME A;  3ISP A;  1W36 C;  3WG9 A;  4DYQ A;  3I4P A;  2OAZ A;  1X2M A;  2FXA A;  1Y8R B;  4MFE A;  4A5M A;  3I71 A;  2E35 A;  1A5J A;  2XKP A;  2ZXJ A;  2V79 A;  4JQF A;  4JOM A;  5HOD A;  5DV5 A;  2JPB A;  2ZOY A;  4CCK A;  5LRR A;  2DA5 A;  3CD6 I;  3KX2 A;  4RB2 C;  1E17 A;  5EZH A;  2DFF A;  1KQ8 A;  1DU6 A;  2QLZ A;  3RKW A;  2VPL A;  3FMQ A;  3VOK A;  1S5L C;  3RQI A;  3E6B A;  2K9N A;  4AWX B;  1RKT A;  2DFE A;  3RQ4 A;  2Y2Z A;  3JSP A;  4F52 A;  4F93 B;  2OCC H;  2IBD A;  2FX0 A;  4Y52 J;  2PN6 A;  3T0Y A;  5FD6 A;  4MEX F;  5M5Y J;  5DD4 A;  2OC6 A;  3KFW X;  2EFW A;  4YEL A;  4WXC A;  2HVR A;  4NBQ A;  2QQA A;  4BDY A;  3K70 D;  2KDZ A;  3DP7 A;  2HS5 A;  3T6N A;  1BW6 A;  2P6T A;  4JKZ A;  3CLQ A;  2V1U A;  5IOZ A;  2MLK A;  3FBN B;  3N05 A;  2NRA C;  3IP4 B;  1HSJ A;  4IRI A;  3RTR A;  2KIF A;  4FE4 A;  2PI0 A;  1E0E A;  4KWA A;  1JUP A;  2RQQ A;  3E6M A;  5LHH A;  2DQL A;  2A69 F;  1MSF C;  2VC1 A;  4ZDL A;  5JI6 A;  3SEZ A;  4JYK A;  3SQN A;  3D1N I;  1PYV A;  3JTG A;  2HEO A;  4XN3 A;  2HVS A;  3ZP5 A;  4HLY A;  4GDF A;  2F5F A;  1W5S A;  4BUP A;  4HLX A;  1OJL A;  2L7Z A;  4XSX F;  2JWT A;  2MYS A;  3NRV A;  1K4S A;  4UVB A;  2G0E A;  3TP3 A;  1ZLJ A;  3K2Z A;  3TOA A;  2JA8 J;  3MKZ A;  5E3M A;  1LQ1 A;  3E6C C;  2VBY A;  1Q1H A;  2TDX A;  2IS4 A;  2UXI A;  1HW2 A;  3S17 J;  2ACJ A;  3KZ9 A;  2CQN A;  3GZ5 A;  4CCN A;  1Z67 A;  3KYL A;  1N78 A;  1MH4 A;  4KIC A;  2F5V A;  1K6O A;  3EGQ A;  2WAQ N;  4FQG A;  3ZCO A;  2MH9 A;  4AIH A;  4HNT A;  1J2X A;  2FJI 1;  4G12 A;  1HBX G;  5FKK A;  4B48 A;  2VBX A;  3V42 A;  4KMU X;  2X6X A;  1RUN A;  2NVT J;  3S1N J;  5B5E C;  1D5Y A;  1UHM A;  2E71 A;  3HJE A;  3G4S I;  3D0S A;  2EFP A;  3BCA A;  2QWW A;  3HOT A;  5KCM A;  2R7R A;  2BEO A;  2DOA A;  4TV7 A;  3RH2 A;  4B3A A;  2FOW A;  3OIP A;  5DUI A;  1ETQ A;  4E7S A;  5EEH A;  2I10 A;  4FX0 A;  4F91 B;  3LHQ A;  1KU2 A;  2LMD A;  1KU9 A;  1NTC A;  3FKJ A;  3KP2 A;  4DYR A;  1ETO A;  1YHQ I;  3CRJ A;  1J59 A;  1QPI A;  1YS6 A;  4YZE A;  1V4R A;  4RMN A;  3DKY A;  3JCU C;  2KKO A;  3RKX A;  1Y0N A;  3BZC A;  3V8L A;  1QZY A;  4IX7 A;  3QU3 A;  5KAF C;  4L62 A;  2M30 A;  3OYM A;  2E5N A;  3JRC A;  4A0Z A;  2BYV E;  2WA0 A;  4P9U A;  1WH5 A;  5J3L A;  2JSP A;  3JAM K;  3AAF A;  4M6X A;  3NI7 A;  4ZYE A;  4I09 A;  3ZN0 A;  3S1M J;  1R36 A;  5F27 A;  4MNU A;  1TL8 A;  2L7M P;  3RPQ A;  2HDW A;  1OCZ H;  1LNW A;  4DVY P;  1W5C C;  4JP0 A;  3K9T A;  4DW6 A;  3DTK A;  2UXX A;  1TWA J;  4FHT A;  2RAS A;  2QSF X;  1XMX A;  4XK4 A;  2XAU A;  3OYG A;  2ZCW A;  4BHC A;  1B8I A;  4U7D A;  3MAJ A;  4XR6 A;  3AL0 C;  2JA6 J;  1R00 A;  3GTG J;  2VB6 A;  2FMY A;  3IWZ A;  3FXJ A;  3HM5 A;  3L2W A;  4MLO A;  2Y9Y A;  3BWG A;  2LY1 A;  2R93 J;  4BE2 A;  1QBJ A;  1DUX C;  1H9G A;  3ZMD A;  1AKH B;  2UWM A;  1FOY A;  4CXF A;  2EH3 A;  1LB2 A;  4CDG A;  5H6Q A;  5ILU A;  3OYL A;  2D2W A;  2DT7 B;  4LB5 A;  4G6D A;  4A3G J;  3ABM H;  2HKO A;  1VZ0 A;  4CGR A;  3MZY A;  2DLL A;  3WTW C;  5FRO A;  1XCB A;  2PMU A;  3C1D A;  4XQF A;  2Q0O A;  5DYM A;  2XGX A;  2NVU B;  5E3O A;  1XSD A;  3OYH A;  1BOA A;  1MBG A;  2HZT A;  2ESN A;  2XPV A;  4BAC A;  1OYW A;  4N9H A;  3VW2 A;  3FXR A;  3I3L A;  5HNF A;  3B73 A;  3ABT A;  4RLF A;  2EV6 A;  5LHI A;  4A3D J;  5BNG A;  2W25 A;  2F2E A;  3WGI A;  1B1B A;  3DU5 A;  3GX4 X;  5F0F A;  1J9I A;  2FF4 A;  3QRF F;  5GAE J;  5CQE A;  3CMY A;  4HQE A;  5AQC A;  1Z7U A;  2IW5 A;  4C2T A;  3ERE D;  4JK1 X;  2LTP A;  4RM3 A;  4HZF A;  2FNP A;  1BI1 A;  5D5X B;  1POG A;  4A69 C;  3CCS I;  5IT9 Z;  3E97 A;  4P96 A;  2KIM A;  4HQM A;  4HX4 A;  1W0T A;  2ELH A;  3PJR A;  5KNL A;  5JFR A;  3VSK A;  2XPW A;  5EGO A;  4O3M A;  3ROU A;  5LD2 C;  2P5V A;  3OYF A;  3KET A;  1FP2 A;  3RSN A;  3KP6 A;  1JGG A;  3K4N A;  5FJ8 J;  2DMN A;  4DOZ A;  4U0W A;  2IU5 A;  3CCV I;  4AM3 A;  4UB6 C;  3LMM A;  4WCG A;  4RDU A;  3HL2 A;  2QGU A;  4F55 A;  4ESB A;  2P7V B;  2OTL I;  4IHT A;  1HKS A;  4Y7N J;  2PLY A;  4V2F A;  3OYI A;  3PIP F;  2WGB A;  2M34 A;  4N4N B;  4CA0 A;  3M4O J;  1X19 A;  3JRG A;  4PXI A;  3ABL H;  5JLX A;  2P5L C;  4R79 A;  3L09 A;  3H3U A;  2E36 A;  1MJB A;  1P2F A;  4C30 A;  3QBM A;  1G2H A;  3RPU A;  3ONQ A;  4PFP A;  4JNN A;  5K5O A;  3BQY A;  3VVZ A;  3SHF A;  3DTE A;  2PZ9 A;  2CUE A;  1R23 A;  1STZ A;  3PL8 A;  2OQR A;  5GTI C;  3IC7 A;  1YW7 A;  3SZG A;  4W1U A;  3UNG C;  2ADU A;  1X3W B;  1T56 A;  1X4P A;  2LSO A;  5DUK A;  2M5W A;  3MMY B;  4PFO A;  4FTH A;  2GM4 A;  2WTE A;  1S7O A;  2WY7 Q;  3F23 A;  2KRF A;  1RKW A;  4RA2 A;  1YRN A;  1ZQ3 P;  1UZC A;  1LE8 B;  2BY3 A;  2RAE A;  2GOM A;  4QTR A;  5M5W J;  2OZU A;  1UI5 A;  2O7T A;  2ISZ A;  2GFN A;  3RZD J;  2K9S A;  1FOW A;  1X1A A;  2ID3 A;  4OOI A;  3F3X A;  4BGD A;  2JRM A;  1SD7 A;  4AVZ A;  2CV2 A;  5D5U B;  3SXY A;  4AF5 A;  1UFM A;  2CW8 A;  3QPH A;  5L3E A;  2XVC A;  4PSW A;  5FFX A;  3OYN A;  4E70 A;  2EBI A;  1FMV A;  1WVR A;  2K85 A;  3KEO A;  1SVO A;  5HBU A;  4PDK A;  2NVY J;  1D3Y A;  3BTC A;  1AU7 A;  2NVX J;  3MCZ A;  2JA2 A;  2L7K A;  4BHP A;  2FBK A;  1SFX A;  2IGK A;  2IT0 A;  4FIS A;  3GBG A;  5E20 A;  1TBX A;  2XDV A;  1MMD A;  3TL4 X;  2E60 A;  3I55 I;  1TQP A;  1ZG1 A;  1FEX A;  2V6E A;  2QA4 I;  3KYD B;  2DT5 A;  2ZSI B;  2XF7 A;  2LRD A;  2L01 A;  5HOO A;  1O3T A;  3E7Q A;  5BMZ A;  5JVG F;  5D8K B;  3NWS A;  3TBI A;  2FD5 A;  3M1E A;  2HR3 A;  3O8H A;  1O3R A;  3N97 A;  3O6B B;  3BG3 A;  2HYF A;  3LSJ A;  5DM7 F;  4Q48 A;  5BS6 A;  3QWL A;  2YVH A;  2DMP A;  4WXD A;  5AIQ A;  3ZMU A;  4EGY A;  2EJR A;  1D8K A;  3I59 B;  4LFU A;  2C6Y A;  2YVE A;  2QEN A;  2JN6 A;  4E7K A;  5CVU A;  2MW8 A;  3AQT A;  4MXM A;  2JVH A;  3E7L A;  4LGW A;  1P4X A;  2YR2 A;  4D0P A;  5IY5 H;  2K5C A;  3AG3 H;  4I01 A;  4NC6 A;  5HAW A;  3HRT A;  5IP9 J;  3Q9S A;  4DZP A;  1MNM C;  3R60 A;  3KEY A;  1IG7 A;  3QQA A;  2M0M A;  1W7P B;  1IC8 A;  1JTX A;  1ULY A;  1T33 A;  2NX4 A;  5EFY A;  2GIZ A;  4HV6 A;  2IGN A;  3PO3 J;  2Z16 A;  3HUG A;  3VEP A;  1BR1 A;  3OR1 C;  2R0Q C;  2BE5 F;  2OUM A;  4L9V A;  2OF7 A;  3CCR I;  4AC0 A;  2CV1 A;  2L9R A;  3MFK A;  1W4M A;  5D5W B;  2VKH A;  2D5V A;  3F72 A;  2YS9 A;  4V19 K;  3BJO A;  3OMY A;  4YG2 F;  5ILV A;  4NQW A;  3FM5 A;  3CMM A;  3CES A;  3DPT A;  1KZH A;  3QP6 A;  1L3L A;  3ZQF A;  2LH9 A;  1MKM A;  3OYK A;  3S14 J;  5GPA A;  3JR9 A;  4N4O B;  2ZNZ A;  2IGM A;  2WAF A;  3WGG A;  3DPU A;  3KLN A;  5EEA A;  1SFU A;  1GXP A;  1HKT A;  3P9T A;  4N9I A;  5KHD A;  1P4W A;  5FB2 A;  1MDM B;  2QQ9 A;  1B8I B;  3BG9 A;  2MC4 A;  2BHZ A;  1WI9 A;  1HF0 A;  2G3B A;  2K9Q A;  3OWT A;  3VOE A;  2O8K A;  4BS9 A;  4A93 J;  1U3E M;  1ZRC A;  2MD5 A;  5E3N A;  4BE1 A;  3Q0W A;  4FE7 A;  5IPA A;  3HG9 A;  1DGR M;  4I76 A;  4UUS B;  2OTJ I;  1LFU P;  1KU3 A;  2EV5 A;  2M3A A;  1CGP A;  4UUT A;  3BJB A;  3HXL A;  3PM1 A;  2O6G E;  3J7A O;  5K7Z A;  3G1M A;  1J75 A;  1GXQ A;  1PJR A;  5DAJ A;  2K3F A;  2XGC A;  4M71 A;  1D1B A;  1A31 A;  2V1X A;  1HOM A;  4A6D A;  4IO9 F;  1JT6 A;  2K9L A;  4EM0 B;  1G3W A;  2LF8 A;  4G9Y A;  1B6A A;  5HS9 A;  4QSH A;  2LBF A;  3T1B A;  2W84 A;  3H3Z A;  1VQ9 I;  4BH9 A;  2JT1 A;  4C3J J;  2KT0 A;  3V6G A;  2N8G A;  4CGZ A;  3HSR A;  1QZE A;  1IF1 A;  3SFI A;  1SEU A;  3LSG A;  3ZQI A;  1RR7 A;  3TDU C;  5M3F J;  3RI4 A;  1R49 A;  3ELK A;  3HB9 A;  3K4K A;  2RV8 A;  4ANJ A;  3LSK A;  3QPL A;  3ABK H;  4HAM A;  3GYH X;  1Y39 A;  4L18 B;  3JRD A;  2Z1D A;  1U5T B;  4E4H A;  5GTH C;  3W3C A;  4PSX A;  2XSD C;  1SD4 A;  3CJT B;  2B1E A;  4OAZ A;  1XN7 A;  3MEX A;  1YS7 A;  1VQP I;  4ZDO A;  3FHZ A;  3W6V A;  5ICE A;  4HW0 A;  2A05 A;  3BG6 A;  4GRI A;  4DQ2 A;  3COL A;  4PK4 A;  2QF7 A;  4A0Y A;  2FBQ A;  3GCM A;  1MBE A;  1LVA A;  1TZL A;  2VXD A;  5C4J J;  4MK6 A;  2L9V A;  4J00 A;  1ZK8 A;  1W1W E;  5H6R A;  3DWL E;  2OQG A;  1O3S A;  4PUS A;  2X9D A;  2X1D A;  2XAS A;  3MZ8 A;  5DM6 F;  1BW5 A;  3NRG A;  4QPO A;  1RZ4 A;  2EK5 A;  2P5K A;  2H8R A;  1TW3 A;  2EIL H;  2VJ4 A;  4P9F A;  2EZH A;  2YX7 A;  1XGO A;  1JTY A;  1QVT A;  1X1C A;  3C2H A;  2MH2 A;  2QZ8 A;  3M07 A;  2OBP A;  3F6O A;  3KCC A;  4C3I J;  3K4M A;  1QRY A;  5DS9 A;  4B47 A;  2WAE A;  4PJM A;  2H8W A;  1JKR C;  4L0Y B;  2WB1 A;  2EPF A;  4X6A J;  1LEA A;  5HVQ C;  1K78 B;  3J80 Z;  4MTD A;  3DEU A;  5E1X A;  2F5C A;  5GAD J;  4M9S A;  2LDU A;  2E2H J;  3CJQ B;  3KPH A;  2HYJ A;  3K70 C;  4M3E A;  4RGR A;  5JR3 A;  3L9F A;  1D0X A;  3ZMS A;  1BI3 A;  4ETS A;  4EEF G;  1SFK A;  4BXF A;  1U8B A;  2D6Y A;  1JKO C;  2GXG A;  4IQJ A;  1FOK A;  1ZN2 A;  1K79 A;  3K6G A;  4CCM A;  5FFZ A;  3ZMT A;  2FQ4 A;  3FBI B;  1JHH A;  2X6Y A;  5E8G A;  4ZTJ A;  4RGU A;  2DXI A;  1I3Q J;  3IV5 A;  5FLX Z;  4C2U A;  4FET A;  1FIA A;  2HOE A;  2G7S A;  3ABU A;  3S1R J;  2P0W A;  2M7A A;  1UAA A;  4OMY A;  1V5G A;  4J01 A;  2JA5 J;  2R4G A;  3N4M A;  1U0J A;  1PVE A;  1FT9 A;  3OS1 A;  2TRT A;  2QBY B;  1S29 A;  2GUH A;  1O4X A;  5HS7 A;  2O8X A;  5GAH J;  1G3S A;  4IQ4 A;  2BY0 A;  4EM1 A;  5K7H A;  2G7L A;  3BG7 A;  1EKE A;  4EAT A;  5JLW A;  2XAH A;  2CH0 A;  1WGX A;  4WX9 A;  2R7V A;  1TWF J;  4GYG A;  4A3J J;  1YJW I;  4XBF A;  5J8F A;  3RKY A;  2DMU A;  1Z3X A;  5HLH A;  4A5N A;  1KU7 A;  3I4M J;  1F36 A;  2F5E A;  2A2F X;  3C18 A;  4WK8 F;  2NXN B;  2HOS A;  3PQJ A;  3LL7 A;  3W2W A;  4X0G A;  1WSU A;  4MEY F;  3GXO A;  3QYE A;  1PUE E;  2XV4 S;  5IT3 A;  4LMY A;  2CG4 A;  2CS3 A;  3LOC A;  3V78 A;  1J7K A;  1K61 A;  4GCL A;  4H4K C;  1OYI A;  1BR4 A;  5J8C A;  4BE0 A;  3GVA A;  3COA C;  3CQZ J;  2JVG A;  3OSF A;  2B3W A;  3H9J A;  1EV7 A;  2CJJ A;  3ZQH A;  2YSR A;  4LIU A;  5GPC A;  3W2V A;  2DJI A;  5BPI A;  1P7I A;  2NAZ A;  4LOC A;  1YIT I;  1ETX A;  2PFB A;  2ECC A;  4EMS A;  1KGS A;  1Y6I A;  2IS1 A;  4U7B A;  3A1Y A;  4WF2 A;  1ZLK A;  1WJB A;  1SD5 A;  1N25 A;  1K83 J;  2DYS H;  3RYR A;  4A6E A;  4AYB A;  3CLO A;  5LBQ A;  1IN7 A;  2KL4 A;  2DMQ A;  3I58 A;  1Y56 A;  1N75 A;  3CCL I;  3BTI A;  3ZQC A;  5J47 A;  3L00 A;  3FX3 A;  2LK2 A;  3H1C A;  3H5A A;  2FNA A;  3VFZ A;  4EV0 A;  2ETH A;  2A61 A;  3WTZ A;  3E5Q A;  3ZQQ A;  1PUF B;  1RIO H;  4HF1 A;  3LAJ A;  1FPQ A;  3G7R A;  3FF5 A;  4DJA A;  3X2Q H;  1GVJ A;  5FKM A;  1SMT A;  2DOF A;  5H2F C;  4UUS A;  1G6N A;  1LDD A;  3FWE A;  4BJT A;  2DA1 A;  2EIJ H;  5C3E J;  2CV0 A;  4BXX J;  4MGR A;  3PNY A;  4EVI A;  1IRZ A;  2DPU A;  1TWH J;  2R7D A;  3WG7 H;  3O2P E;  2DQR A;  2R7F A;  4I7H A;  2BV6 A;  1IRG A;  2LRE A;  2P7C B;  5LFA A;  2Y48 A;  2VT2 A;  2HYG D;  4HRI A;  4XRM A;  3PPB A;  3BCG A;  1Z77 A;  1U5T A;  2QKO A;  3F8N A;  5C4X J;  5C44 J;  1G3T A;  3HOS A;  1NG7 A;  3IWF A;  1XGM A;  2E2J J;  1I5Z A;  1P9Q C;  2VQG A;  1IZ1 A;  3LSR A;  5CVR A;  2NVQ J;  2PBX A;  3LNQ A;  2DA7 A;  3E3V A;  5GAG J;  3IH4 A;  1XD7 A;  4KIS A;  2L5Q A;  2LBF B;  3VIB A;  2AQE A;  2X6W A;  1FBQ A;  2ZC2 A;  1SAX A;  4NC7 A;  2PX9 A;  1KQ9 A;  2FA5 A;  2DTZ A;  2UZK A;  3FMS A;  4GFB A;  4A3M J;  3K1N A;  2HTJ A;  1DP7 P;  1KON A;  1FSH A;  3CME I;  2M8E A;  3Q3S A;  1GV5 A;  3CUQ A;  4XKC A;  5HDK A;  1JXS A;  3PAS A;  5A2Q Z;  4DZJ A;  4Z2Y A;  4E7H A;  3AG2 H;  3TW6 A;  3OY9 A;  1PP7 U;  2CWE A;  3O8G A;  4U9L A;  1I1G A;  2BY1 A;  1HXD A;  4XKV A;  1VQM I;  1E3H A;  2IA0 A;  2NNN A;  3ZRG A;  3WTU C;  2HPI A;  5H20 A;  3EYI A;  1OIS A;  1TQI A;  3MKW B;  3IAM 2;  4YEJ A;  3KP7 A;  3EUP A;  4G94 A;  1H0M A;  3LSM A;  3KKC A;  2HXO A;  5FGM A;  5LGN A;  3EYY A;  3B6A A;  2JUC A;  5D18 A;  3ECO A;  1QHG A;  2AQF A;  1U9O A;  2KLO A;  2AS5 F;  3BZK A;  1XG1 A;  2DK5 A;  1JUS A;  3SZT A;  1FWZ A;  2HU9 A;  4S0H B;  3RZO J;  4C3H J;  4ZYH A;  2DCE A;  2X1E A;  3DFG A;  2DA3 A;  2OU2 A;  1Z7L A;  3DXJ F;  2OPT A;  3SJM A;  3H0G J;  2EIN H;  3WE3 A;  1SGM A;  1V5E A;  3BR6 A;  3F6V A;  2XAF A;  2PFV A;  2RC4 A;  3DF8 A;  1FY7 A;  3V7R A;  4HDU A;  2ZCN A;  3TMO A;  1C0W A;  1IDZ A;  3MVP A;  1S9H A;  1E3P A;  3IAS 2;  4BNC A;  4Q4Z F;  3J7Z I;  3A0H C;  3UR3 C;  1HKQ A;  2A68 F;  2CYY A;  4UVC A;  2H1L A;  2O9L A;  1K78 A;  1CQT A;  3HTH A;  4BQO A;  2ZSH B;  2ELK A;  3EQL F;  2MD0 A;  3ULQ B;  5LEJ A;  1D8J A;  2ZCX A;  5CVV A;  2AXL A;  2CW7 A;  2LF7 A;  2W00 A;  3V8K A;  1MBJ A;  3GW2 A;  1OCR H;  1IDY A;  3GTO J;  2O5R A;  5E1Z B;  2NS8 A;  2KQR A;  1H88 C;  1T0F C;  4I99 C;  3CDI A;  2XKO A;  2EA4 A;  1UB9 A;  3ZPL A;  3F8M A;  3LQR A;  4XRF A;  1MW7 A;  1W7P A;  4B4C A;  1OCP A;  2STT A;  2HVQ A;  3BR2 A;  1H9T A;  2BOL A;  1GT0 C;  1JE8 A;  3BJ6 A;  5E3L A;  1REP C;  4M3G A;  2ZME C;  2ZME B;  1WJ5 A;  4M6V A;  3OYD A;  3LJL A;  5DCF A;  1BJA A;  2VQC A;  5CXI A;  2IS2 A;  4XLE A;  1J09 A;  1IUY A;  4GGG A;  4KDP A;  4KA4 A;  4A3B J;  1P6R A;  5DCM A;  2E7W A;  2KHM A;  4GCK A;  5JVT A;  4IJA A;  3JW4 A;  1HLV A;  2STW A;  3SYT A;  1Q1V A;  2P81 A;  4P5O A;  2I5U A;  2DA6 A;  3V8J A;  1XPX A;  3NS4 A;  3IUO A;  1U9N A;  2X6O A;  2Z3Y A;  3OYE A;  3NXC A;  4CO8 A;  2EWN A;  2KMU A;  4L9J A;  2JMW A;  1ZR2 A;  4OIO F;  4NDL A;  3U1K A;  3BPV A;  4EGZ A;  2NS7 A;  2KZG A;  3VOX A;  3FDY A;  4IEJ A;  2Y30 A;  2JSC A;  2O3F A;  1S7E A;  4GYI A;  2DFH A;  2WB1 N;  1T2K A;  2PEX A;  3H9G A;  3NWT A;  4II2 A;  2VXZ A;  1VF9 A;  4LLL A;  4JX6 A;  5F04 A;  3L2R A;  4H0E A;  2A5W A;  3H36 A;  2R5Z B;  1NH3 A;  3TO6 A;  2JQ7 A;  2EQR A;  3VP5 A;  5LGU A;  3RYP A;  1SAN A;  5CJ9 A;  4O5V A;  3G71 I;  1Y1W J;  2HQA A;  3CC4 I;  1QO0 D;  3FIW A;  2GAU A;  3H3V K;  3S5R A;  4PJ0 C;  4W97 A;  1WJF A;  3OV8 A;  3L2V A;  3G1O A;  1VQK I;  4I02 A;  5EZG A;  3J7A Y;  2ZFU A;  2QQ8 A;  2EZK A;  4E7Z A;  3H92 A;  1ZHF A;  4RB0 A;  4QIW N;  1AHD P;  1YE9 A;  1MBH A;  1YYV A;  2A3S A;  3OR2 C;  1YJN I;  3JAM Z;  2XDN A;  4GCT A;  3FRQ A;  2NYX A;  2XSJ C;  3QYF A;  3SEQ A;  5KVR A;  2LD5 A;  4M3D A;  2L3D A;  4XLF A;  1MD0 A;  2VOP A;  3ZOB A;  1XTA A;  5TIS C;  3HGG A;  1ZAR A;  3VB2 A;  4RAZ A;  4AC6 A;  2W24 A;  1R1V A;  2ZOZ A;  1EH7 A;  3CZ6 A;  2K27 A;  2L4A A;  3J80 K;  3REO A;  1YW8 A;  2ZXH A;  3CO7 C;  2X51 A;  2CRG A;  1PUF A;  1X1B A;  1Y0U A;  2EIK H;  4BL0 B;  5HS8 A;  5FRN A;  5E18 F;  2F6C A;  4HPQ A;  3R6S A;  2WV0 A;  2KPM A;  1XSX A;  3GWZ A;  1WI3 A;  3GFL A;  5FMP A;  1R5G A;  2Z33 A;  5D6E A;  1IN8 A;  1UJ8 A;  3VDX A;  3S15 J;  2FRH A;  1P92 A;  5E79 C;  3H35 A;  2UXH A;  1YLF A;  4G7O F;  4I2O A;  4KNY A;  3HBL A;  4FT8 A;  1IRX A;  1MNE A;  2HOT A;  4Q5S F;  1IJW C;  5KAI C;  2A5Y B;  2ZJR F;  2DTR A;  1FBS A;  3FKI J;  5F1J A;  3ON2 A;  4HA8 A;  2PBI A;  3RIR A;  1YIJ I;  2ZO4 A;  2M1B A;  2NP5 A;  1R22 A;  2OZ6 A;  4UDS A;  2WY8 Q;  1K7A A;  2OV7 A;  2WAD A;  3CUO A;  1HC8 A;  2BW3 B;  2DT6 A;  3SFZ A;  3BRU A;  4HYE A;  2X1C A;  4QLC U;  1WJD A;  3VYR B;  4KIG A;  3GFJ A;  3OL4 A;  1IXC A;  5BPD A;  3G73 A;  4KN4 X;  3HHH A;  1R5I D;  2GOX B;  4ZTF A;  3HOY J;  4U0Y A;  3E1S A;  4E6K G;  1WJA A;  2QUF A;  2L54 A;  5L3D A;  4LG0 A;  4ENM A;  3BHQ A;  5J4Y A;  5IYC J;  4ZYA A;  4XRS A;  2R5Y A;  1R4M B;  1W0U A;  1O7F A;  4MFD A;  3PNV A;  4FCY A;  1B4A A;  1EA3 A;  5LLQ A;  1Y1V J;  1QHH D;  2LKX A;  4IF4 A;  2KIS A;  2RRE A;  5FO5 A;  4PCQ A;  1OPC A;  2M0C A;  2XF5 A;  4IHS A;  5HLG A;  1ETK A;  3RPU D;  1E3O C;  2ICW G;  3KP4 A;  1MMN A;  2V57 A;  5LEK A;  1JT0 A;  2HI3 A;  2CUZ A;  3G6E I;  3ZXS A;  4KT5 C;  2J5O A;  5IT9 K;  3ANP A;  2XRO A;  5EEG A;  3LAP A;  1RI7 A;  3JRF A;  3E0J B;  4XMY A;  3S3M A;  1MJ9 A;  1I1S A;  4DBQ A;  4OIN F;  4CZZ A;  5CPR B;  2IGO A;  3PSI A;  3FXQ A;  2QOP A;  2NS0 A;  4GFK A;  2EFN A;  1R4N B;  2CSO A;  4YFN F;  4ON0 A;  2GIV A;  4AYB N;  5JHF A;  1RUO A;  3C2G A;  1RRJ A;  4EJU A;  4IOC F;  3FXU A;  5LRS A;  3KE2 A;  4ME9 A;  2VAS A;  1ZTR A;  4JX4 A;  3VW0 A;  4BQN A;  2XIG A;  1YTY A;  3AG1 H;  3O60 A;  1YIO A;  2ZKZ A;  3I0T A;  1WPK A;  4G7Z F;  2V9V A;  4NNJ A;  2K02 A;  2EZL A;  3W2A A;  5LGT A;  3HOV J;  3BG5 A;  4E7J A;  2DOD A;  5FKN A;  3SDG A;  3QOE A;  4L9T A;  1KYZ A;  3OS2 A;  3TOB A;  5B3S H;  3CUQ B;  2FE3 A;  2MLG A;  3LA7 A;  2IXS A;  5BOX A;  1A35 A;  4UY8 I;  2GWR A;  1OFC X;  4M72 A;  4PJJ A;  1TTY A;  3BR3 A;  2BVL A;  3NQO A;  3CDH A;  2BXY A;  3WTT C;  2OD5 A;  1MND A;  2ELJ A;  1Z05 A;  4C9Y A;  3GZI A;  2IVM A;  4AIK A;  3A02 A;  2Z2S B;  2DBB A;  2PMZ N;  3ON4 A;  3OOP A;  4IXA A;  1VND A;  3SZP A;  2GA2 A;  2R7X A;  1SVL A;  3E5U A;  3VPR A;  1ETV A;  2ZCM A;  4A12 A;  2E2I J;  4AUX A;  2MSY A;  1DGW Y;  2O03 A;  4I98 B;  4XLA A;  2Z9O A;  1FP1 D;  3ML6 A;  3MKL A;  5D4R A;  2DA4 A;  1Z91 A;  3EUA A;  4ASN A;  4KYW A;  1BI0 A;  2WV1 A;  2RHA A;  1V54 H;  3CUQ C;  2Q2E B;  2O0Y A;  5CVJ A;  2ISY A;  1EH8 A;  4XOR A;  1YX5 A;  5ILS A;  1WHU A;  2R92 J;  1B72 B;  2CUJ A;  5F1R A;  1ZEL A;  3OIO A;  3AFH A;  1OR7 A;  1LEB A;  3NAR A;  2H27 A;  5B1B H;  1F4K A;  3GZN B;  4CCJ A;  1LPQ A;  4I6Z A;  2MG4 A;  1G8X A;  3LA2 A;  1K6Y A;  3R61 A;  1R5H A;  4U87 A;  3OSG A;  4GXO A;  2VJ5 A;  2F4M B;  2W7N A;  4B43 A;  4IKF A;  2V4J C;  3HPG A;  3K4B A;  2CFO A;  3FMR A;  3G3Z A;  1IAW A;  4RB3 C;  1U5T C;  4YRV A;  3A03 A;  3C3W A;  2VUM J;  2Q8K A;  3EUH C;  2NP3 A;  5EYR A;  1X2N A;  3VSL A;  2QCO A;  4BJ5 C;  1R7J A;  3DV8 A;  1QU3 A;  1GVD A;  3S16 J;  3HOU J;  1JI8 A;  3V4G A;  1G59 A;  4ICH A;  3IHU A;  2TCT A;  2K4J A;  1ON1 A;  1UST A;  1KA8 A;  2L9N A;  2HFH A;  1EJ9 A;  4E7L A;  3WHB A;  3E6D A;  5K7F A;  2VON A;  1UCR A;  1QGP A;  3JSO A;  2M4K A;  2X4H A;  3CTA A;  4ZH4 F;  1JJ6 C;  2XAG A;  1BM9 A;  3CP2 A;  3J7Y J;  2Y0M A;  2BBY A;  1Z9C A;  2BW3 A;  4M9X A;  1ON2 A;  2Y0S A;  1MMA A;  1F9N A;  2L4M A;  4RM2 A;  4YIF A;  1IGN A;  1TT5 B;  2ME0 A;  3LA3 A;  1MIJ A;  2YUS A;  4YII A;  4ZC3 A;  5FKL A;  1TP4 A;  3LST A;  1HW1 A;  5B1A H;  3F9K A;  4IHW A;  2R7U A;  1JGS A;  2BZT A;  1QPM A;  4M74 A;  2J5P A;  4UB8 C;  3G56 A;  4HX8 A;  4A3K J;  2A6H F;  3A4C A;  4KUM A;  3BY6 A;  4B8X A;  5D6F A;  5IP6 A;  3WHC A;  1CF7 A;  1TNS A;  1ZG3 A;  4ZDP A;  4IVN A;  1UEL B;  2M8G X;  2XRL A;  3FM3 A;  1VQ5 I;  4IOA F;  2W57 A;  1FLI A;  3KP5 A;  2GLO A;  3FXM A;  2H6C A;  1AKH A;  3F8C A;  1EH6 A;  1Z21 A;  2CQQ A;  3QOD A;  5L3B A;  3IKT A;  2BHY A;  3I53 A;  2LR8 A;  2M45 A;  3BR1 A;  3PSF A;  3TKY A;  3HRU A;  3WGH A;  2DG8 A;  2BY2 A;  3DCF A;  3HTU A;  3U2R A;  1FOX A;  4CIC A;  3BP8 A;  2R3S A;  2HDC A;  4HG2 A;  4XLN F;  1E2X A;  1D0Z A;  1X3Z B;  4F3Q A;  4HKU A;  3VUQ A;  5HLT A;  3CJR B;  1ZRD A;  1PP8 F;  4UXN A;  2GEN A;  2LOO A;  3IL2 A;  1UHS A;  2FJ1 A;  2HOA A;  1FMW A;  3GEU A;  3TP0 A;  2LP0 A;  1NHA A;  1G4D A;  3KNW A;  1ZAO A;  3KEQ A;  4HOB A;  2PG4 A;  1VTN C;  5IYD J;  2R5Y B;  1U2W A;  2Y75 A;  1O57 A;  2DO7 A;  4ENJ A;  2VQL A;  4XNF A;  1H8A C;  2DN0 A;  3I9V 2;  2D45 A;  4MIM A;  1CF7 B;  2KIU A;  1I50 J;  4I0B A;  4NN1 A;  3ZQL A;  1UG2 A;  4LG3 A;  1ZYR F;  3HTJ A;  2G7U A;  1BI2 A;  2P4W A;  2VBW A;  1IV8 A;  2HXI A;  3BC8 A;  3J81 K;  3C07 A;  2XAQ A;  4BKX A;  2IP2 A;  2X0L A;  2QM3 A;  1K4T A;  5EJC A;  1YFH A;  1YRN B;  2V1D A;  4OIP F;  2LKS A;  3CF2 A;  3QP5 A;  3EPZ A;  3D5S C;  2L02 A;  2FQ3 A;  4OD4 A;  3RKQ A;  3ZGK A;  4R1H A;  1A36 A;  4XN0 A;  2DDA A;  3ASO H;  1HCR A;  3S93 A;  4HF0 A;  4DNC A;  5F08 A;  3HUG B;  2ESH A;  4HX7 A;  4DYC A;  2M9H A;  3MN2 A;  1FBU A;  3BPX A;  1XDS A;  5CVI A;  3GTQ J;  1BJZ A;  5CXG A;  1U8R A;  2CUF A;  1XDU A;  1MGT A;  1X3U A;  3BLY A;  3PUF A;  1X1P A;  3I64 A;  3W6K B;  1Z0X A;  4J19 A;  3Q9V A;  4M3F A;  4B09 A;  2Q24 A;  3DPJ A;  2NOG A;  1MZB A;  1UMQ A;  4D5F A;  4LLN A;  3VVY A;  1A04 A;  3FXK A;  4L0Z B;  2BXZ A;  1FC3 A;  2E7X A;  5FD5 A;  5J1U A;  1RPW A;  2VC0 A;  4C2M J;  4B44 A;  3GZ6 A;  1LE8 A;  4YFK F;  3RD3 A;  1PDN C;  3KZI C;  1BIA A;  2CMP A;  4QPQ A;  4NUB A;  3OOU A;  4IRG A;  5D8L B;  3M8J A;  3PUB A;  3CCJ I;  2ME6 A;  1WJE A;  2B9S A;  3HOX J;  3K4L A;  1ZG5 A;  2YPR A;  3NEU A;  2LYC A;  2E1C A;  1L0O C;  4EJO A;  3H5R A;  2FBH A;  5D1R A;  2WBM A;  2K4B A;  2JZY A; 
#chains in the Genus database with same CATH homology
 3E7Q A;  5CXI A;  2UXP A;  4V2G A;  3QKX A;  3Q0V A;  4A3B J;  2FD5 A;  4CYC A;  2AHQ A;  2YU9 J;  3GTP J;  2DG7 A;  4GCK A;  3B81 A;  3O8H A;  4A3I J;  1ORK A;  1X58 A;  3BG3 A;  1HLV A;  3LSJ A;  2W53 A;  3GTM J;  1Q1V A;  2YVH A;  2P81 A;  3BR0 A;  2DMP A;  2DA6 A;  4JX5 A;  2X48 A;  1JUM A;  3S2H J;  2YVE A;  1XC5 A;  2DA2 A;  2JN6 A;  1U9N A;  2X6O A;  2MW8 A;  3K7A J;  2G7G A;  3AQT A;  3NXC A;  4MXM A;  3IH3 A;  3E7L A;  2JMW A;  4CYC B;  1ZR2 A;  1OCT C;  4NDL A;  2VKV A;  9ANT A;  2NS7 A;  3A01 B;  2OI8 A;  2XB0 X;  3VOX A;  5HSZ A;  5HAW A;  4IEJ A;  2Y30 A;  5IP9 J;  4BY1 J;  1S7E A;  4DZP A;  1MNM C;  3M3Y J;  3S1Q J;  3JSJ A;  1TWG J;  2WB1 N;  3QQA A;  1IG7 A;  1IC8 A;  4GFL A;  1JTX A;  3MNL A;  1VF9 A;  3HOW J;  4JX6 A;  3NAU A;  5F04 A;  1H89 C;  5IYB J;  3CJD A;  1T33 A;  2R5Z B;  2NX4 A;  5EFY A;  2EQR A;  3VP5 A;  3PO3 J;  1SAN A;  1Y1W J;  1TC3 C;  3VVX A;  2R0Q C;  3FIW A;  3H3V K;  3S5R A;  1VFC A;  4W97 A;  2OF7 A;  4AC0 A;  3G1O A;  2L9R A;  5EZG A;  2EZK A;  2K40 A;  3A01 A;  2D5V A;  2ID6 A;  2L0K A;  2YS9 A;  4B1R A;  4QIW N;  1AHD P;  1MBH A;  1HDP A;  2CU7 A;  5EGO B;  2XDN A;  4GCT A;  3ZQF A;  4A3L J;  3FRQ A;  4IHX A;  1GUU A;  3S14 J;  2LD5 A;  4M3D A;  5GPA A;  3JR9 A;  5EEA A;  3ZOB A;  2DJN A;  3BTJ A;  3P9T A;  4X1E A;  3HGG A;  3CCY A;  1DU0 A;  1VI0 A;  4AC6 A;  4M3B A;  2ZOZ A;  1B8I B;  3BG9 A;  5IP7 J;  2QWT A;  3JRH A;  1FTZ A;  1PUF A;  2CRG A;  2LLK A;  1HF0 A;  2G3B A;  2H1K A;  2K9Q A;  1JJ8 C;  2EZI A;  3HDD A;  5IOY A;  2O8K A;  2IAI A;  4BBS J;  4A93 J;  1WI3 A;  2REK A;  3FK6 A;  5FMP A;  3IH2 A;  5E3N A;  2QIB A;  3Q0W A;  4FE7 A;  3S15 J;  4HNV A;  2W48 A;  5EG0 A;  4XIC A;  3UKG A;  5IPA A;  1B72 A;  2UXH A;  1ETW A;  3IUV A;  3HBL A;  4I76 A;  5M3M J;  4UUS B;  2HOT A;  2QTQ A;  3B6C A;  1IJW C;  5FGL A;  1LFU P;  3FKI J;  5F1J A;  3ON2 A;  4UUT A;  4D7M A;  3BJB A;  3HE0 A;  2NP5 A;  3CDL A;  3PM1 A;  1ZR4 A;  5K7Z A;  1RES A;  3G1M A;  3BQZ A;  4UDS A;  3DEW A;  5DAJ A;  2XGC A;  1IV6 A;  4A3E J;  2HYT A;  3GTK J;  1HOM A;  3I4N J;  1JT6 A;  3BRU A;  2HDD A;  2L7F P;  1FIP A;  4QSH A;  3LSP A;  2OER A;  2UXU A;  3BT9 A;  1EF4 A;  1MSE C;  5EF6 A;  1IUF A;  1FTT A;  2JA7 J;  4C3J J;  4XID A;  2KT0 A;  3HOY J;  3V6G A;  2N8G A;  5DTD A;  1GV2 A;  2LFB A;  4BY7 J;  4L5E A;  3SFI A;  3LSG A;  3ZQI A;  3BHQ A;  1RR7 A;  5IYC J;  3TW7 A;  5M3F J;  3HTI A;  4XRS A;  1WH7 A;  3HB9 A;  2R5Y A;  1LFB A;  3QPL A;  2LVS A;  1QVU A;  1W0U A;  2O7O A;  4MFD A;  1GDT A;  3JRD A;  1BA5 A;  2XGD A;  2XSD C;  4FCY A;  5D19 A;  3HOZ J;  1Y1V J;  2LKX A;  2HKU A;  3HGY A;  4XRS G;  4DYQ A;  1X2M A;  3W6V A;  2M0C A;  3COL A;  4MFE A;  1ETK A;  1E3O C;  2QF7 A;  2FBQ A;  2V57 A;  1JT0 A;  2HI3 A;  1MBE A;  1A5J A;  5HOD A;  1APL C;  3ANP A;  5C4J J;  2ZOY A;  4MK6 A;  1ZK8 A;  2DA5 A;  3JRF A;  1I6H J;  3PO2 J;  2X9D A;  5EZH A;  1BW5 A;  3VW1 A;  3NRG A;  2XB5 A;  1DU6 A;  3VOK A;  2QOP A;  4GFK A;  2H8R A;  3RQI A;  2K9N A;  1RKT A;  2EZH A;  1JTY A;  1QVT A;  2Y2Z A;  4AYB N;  2IBD A;  4C3I J;  2FX0 A;  4Y52 J;  1QRY A;  5DS9 A;  4ME9 A;  3VW0 A;  5M5Y J;  1ZTR A;  4JX4 A;  1JKR C;  4X6A J;  1JKQ C;  2KDZ A;  3O60 A;  3JRI A;  3T6N A;  1BW6 A;  2E1O A;  5FLV A;  4JKZ A;  1WPK A;  5IOZ A;  2EZL A;  2E2H J;  2HYJ A;  3HOV J;  4M3E A;  3BG5 A;  5FKN A;  1ETY A;  3SDG A;  2M2E A;  3JRA A;  4FE4 A;  4KWA A;  4EEF G;  1JUP A;  1U8B A;  1MSF C;  1OFC X;  2D6Y A;  1JKO C;  3NPI A;  3BR3 A;  4JYK A;  3D1N I;  4BBR J;  5FKO A;  1OJL A;  2FQ4 A;  2L7Z A;  3GZI A;  3S2D J;  2HQ5 A;  2JWT A;  3A02 A;  1TWC J;  1I3Q J;  2PMZ N;  3IV5 A;  1F43 A;  2G0E A;  2G7S A;  1FIA A;  3TP3 A;  1VND A;  3ON4 A;  3S1R J;  2JA8 J;  3ANG A;  5E3M A;  2UXI A;  3KZ9 A;  1RET A;  3VPR A;  1ETV A;  3S17 J;  2ZCM A;  2E2I J;  2JA5 J;  4AUX A;  2MSY A;  1MH4 A;  2TRT A;  1R9T J;  3MKL A;  3EGQ A;  2WAQ N;  2DA4 A;  2GUH A;  2RHA A;  1O4X A;  2WV1 A;  4G12 A;  5FKK A;  5K7H A;  2G7L A;  5JLW A;  2JJ7 A;  2R92 J;  1WGX A;  2ZB9 A;  1B72 B;  1TWF J;  2NVT J;  3S1N J;  2Y0S N;  4A3J J;  5C4Y A;  5H9T A;  3OIO A;  1D5Y A;  1WCM J;  3NAR A;  2DMU A;  1ZKG A;  3I4M J;  1F36 A;  4NEL A;  3RH2 A;  4B3A A;  4I6Z A;  2MG4 A;  1ETQ A;  2HOS A;  2I10 A;  3OSG A;  3LHQ A;  3ZQG A;  1NTC A;  4DYR A;  3CRJ A;  1ETO A;  3F0C A;  4YZE A;  1QPI A;  3HTA A;  3JRE A;  3LOC A;  3V78 A;  4GCL A;  1K61 A;  3A03 A;  2VUM J;  2NP3 A;  3CQZ J;  3OSF A;  5EYR A;  4L62 A;  1X2N A;  2B63 J;  2QCO A;  2IEK A;  3JRC A;  2CJJ A;  1GVD A;  3ZQH A;  1WH5 A;  5J3L A;  3S16 J;  3NI7 A;  5GPC A;  3HOU J;  2ECB A;  3S1M J;  1P7I A;  4LOC A;  5F27 A;  4ICH A;  2R7Z J;  1ETX A;  2Y31 A;  2TCT A;  2ECC A;  2L7M P;  2LY9 A;  2VKE A;  3WHB A;  4JP0 A;  4DW6 A;  1K83 J;  5F0H A;  5K7F A;  1TWA J;  4ABZ A;  3BNI A;  2RAS A;  3HIM A;  2XGE A;  4XK4 A;  2XPU A;  2DMQ A;  2CQX A;  1JJ6 C;  3HKZ N;  1B8I A;  3BTI A;  3ZQC A;  2JA6 J;  2VI6 A;  2LK2 A;  3GTG J;  2GBY A;  4IHV A;  1IGN A;  3GTL J;  2ME0 A;  3HM5 A;  2YUS A;  4IHY A;  1MBK A;  2Y9Y A;  4MLO A;  3F1B A;  5FKL A;  2R93 J;  1PUF B;  1AKH B;  4IHW A;  3G7R A;  3FK7 A;  2EH3 A;  3HEF A;  5FKM A;  4A3G J;  4A3F J;  3G56 A;  4UUS A;  4A3K J;  2DA1 A;  5C3E J;  4BXX J;  5IP6 A;  1IRZ A;  3WHC A;  1TWH J;  3G1L A;  4CGR A;  2M8G X;  2XRL A;  2GLO A;  5J1R A;  5E3O A;  1AKH A;  2DMT A;  4XRM A;  4D5C A;  3QPS A;  3JRB A;  3BCG A;  1Z77 A;  3PPB A;  4ACI A;  2QKO A;  5C4X J;  2CQQ A;  5C44 J;  1MBG A;  2E2J J;  2LR8 A;  2XPV A;  3BR1 A;  3LSR A;  2DG8 A;  3DCF A;  3VW2 A;  2NVQ J;  2PBX A;  3LNQ A;  4JL3 A;  2DA7 A;  1ZGW A;  4A3D J;  3IH4 A;  5BNG A;  2R5Z A;  3L1P A;  1P7J A;  3VIB A;  5F0F A;  4HKU A;  3VUQ A;  1HDD C;  2F07 A;  2DTZ A;  5M5X J;  3CMY A;  2Y9Z A;  2GEN A;  4GFB A;  4A3M J;  5AQC A;  1UHS A;  2FJ1 A;  2HOA A;  3GEU A;  3TP0 A;  2LP0 A;  2LTP A;  5K58 A;  1POG A;  4A69 C;  3Q3S A;  3KNW A;  4MO7 A;  1GV5 A;  1FJL A;  1W0T A;  3PAS A;  5FHP A;  5IYD J;  2MGQ A;  4DZJ A;  2XPW A;  5EGO A;  2R5Y B;  2E19 A;  3TW6 A;  1UI6 A;  3O8G A;  1H8A C;  2DN0 A;  3BTL A;  1JGG A;  4MIM A;  5FJ8 J;  2DMN A;  1I50 J;  2IU5 A;  4NN1 A;  3BR5 A;  3ZQL A;  1UG2 A;  4RDU A;  3CWR A;  3HTJ A;  3KKD A;  2HXI A;  4Y7N J;  3EUP A;  3C07 A;  5CW8 A;  4V2F A;  2WGB A;  3KKC A;  2HXO A;  1ENH A;  2M34 A;  4BKX A;  3M4O J;  4PXI A;  3JRG A;  3B6A A;  5F0C A;  5JLX A;  2VPR A;  5D18 A;  1U9O A;  1YRN B;  3QBM A;  1XG1 A;  1G2H A;  4D7N A;  1JUS A;  4S0H B;  4JNN A;  3RZO J;  3BQY A;  3NNR A;  3VVZ A;  4C3H J;  3RKQ A;  2PZ9 A;  2DA3 A;  3SJM A;  2OPT A;  1HCR A;  3H0G J;  2CUE A;  1SGM A;  3FIS A;  5F08 A;  2UXO A;  3BR6 A;  3C2B A;  4RBO A;  1BL0 A;  4W1U A;  2ZCN A;  1T56 A;  3Q0U A;  3K2A A;  2M9H A;  3MN2 A;  4DYC A;  1IDZ A;  3MVP A;  5EDN A;  2GM4 A;  4FTH A;  3GTQ J;  1BJZ A;  2JK3 A;  5CXG A;  2CUF A;  3LWJ A;  1JKP C;  1RKW A;  1YRN A;  1ZQ3 P;  1LE8 B;  2O9L A;  1Z0X A;  4J19 A;  2RAE A;  4QTR A;  5FLM J;  5M5W J;  1CQT A;  1UI5 A;  3HTH A;  3TED A;  4M3F A;  2O7T A;  2ELK A;  2GFN A;  2Q24 A;  2WUI A;  3AQS A;  2ZCX A;  3DPJ A;  1MH3 A;  2NOG A;  1UMQ A;  2K9S A;  4D5F A;  3RZD J;  4A3C J;  2ID3 A;  3VVY A;  1MBJ A;  2COB A;  2AO9 A;  1IDY A;  3GTO J;  5J1U A;  1RPW A;  2NS8 A;  4C2M J;  1H88 C;  4AF5 A;  2EBI A;  5J1Y A;  1MBF A;  1LE8 A;  3RD3 A;  3OOU A;  5HBU A;  2NVY J;  3BTC A;  4B4C A;  1AU7 A;  2NVX J;  1OCP A;  3GTJ J;  1NK3 P;  1XS9 A;  2ME6 A;  1U78 A;  3BR2 A;  1NK2 P;  4FIS A;  3GBG A;  3HOX J;  5GP9 A;  1GT0 C;  5E3L A;  4M3G A;  5EG0 B;  1A6I A;  1FEX A;  5D1R A;  4M6V A;  1SFO J;  3LJL A;  1ITY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...