3BTLA

Crystal structure of qacr(e58q) bound to malachite green
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 73
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btlA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btlA02
3V6GA 3GZIA 1JJ6C 3QPSA 4YZEA 2XB5A 1LFUP 3BTJA 3S16J 3NXCA 3CCYA 4FTHA 3PO3J 3BHQA 5F0HA 4KWAA 2PZ9A 2NVYJ 5E3MA 3JRFA 2YVEA 3VVYA 3VIBA 4M3EA 3DEWA 2K40A 1IRZA 9ANTA 3BR1A 1TWFJ 3KKDA 2VI6A 3JRDA 1ZR4A 3O8HA 5C3EJ 1FIAA 1OJLA 4CYCA 2R0QC 1A5JA 2M0CA 2ECBA 1ETVA 1MSFC 4D5CA 5FJ8J 1RKWA 2EZIA 2NX4A 2O7TA 3FK6A 5D18A 1H88C 4JP0A 5JLXA 5EDNA 2XB0X 2MSYA 4A93J 2YU9J 5JLWA 1JTYA 3BJBA 2UXUA 3H0GJ 4B1RA 1U78A 4A3DJ 5FMPA 4A3CJ 2GENA 4MXMA 1BJZA 2X48A 1MBKA 2ZOZA 3HOZJ 3S2DJ 3BCGA 3GBGA 1E3OC 2WGBA 4G12A 1MH3A 4JX5A 3BR0A 1HCRA 2CQQA 4BBRJ 1T56A 3B6CA 3K7AJ 2L0KA 5M5YJ 3HOUJ 3OIOA 5F08A 2GFNA 2ZCMA 2NVTJ 3WHBA 1G2HA 2CU7A 1XS9A 4IHVA 1D5YA 2DN0A 3VUQA 4Y7NJ 4A3MJ 2FBQA 1RPWA 3S5RA 4DZJA 3PO2J 4RBOA 4UDSA 3ZQGA 5C44J 2K9QA 1HF0A 4MFDA 1JKPC 5C4XJ 4JYKA 2Y9ZA 2WV1A 2JMWA 2EQRA 5AQCA 3NARA 2L7ZA 5J3LA 1B72B 4V2GA 3BNIA 5J1UA 1LFBA 3JRIA 5IP6A 1LE8A 2HDDA 1ORKA 2QIBA 3QKXA 3C07A 3NI7A 3LSRA 5CXGA 5EG0B 1H8AC 3DCFA 4NN1A 1APLC 2VUMJ 2RHAA 3LJLA 1Q1VA 2DA3A 3G7RA 4ME9A 5HSZA 2DA7A 1HOMA 3WHCA 4W1UA 3BR2A 1TWAJ 2Y31A 4JX6A 3CJDA 4XIDA 1U9OA 2H8RA 1WH5A 3RZOJ 3LSGA 1UI6A 2R7ZJ 1Z77A 3VVZA 4A3JJ 3G1LA 2WB1N 2TRTA 3RKQA 1ENHA 3GTPJ 4M6VA 4M3DA 3FISA 3NAUA 5M5WJ 2O9LA 1MBGA 5CW8A 3HOWJ 5E3OA 5FGLA 3HBLA 4AYBN 5IOZA 2G7SA 1P7JA 4LOCA 5K7FA 1VI0A 1QPIA 1RR7A 2M34A 2TCTA 1VFCA 2R93J 3P9TA 5CXIA 4GCTA 3CWRA 5IP7J 2LKXA 4C3JJ 3A03A 1JKRC 2E2JJ 1BL0A 2REKA 4ICHA 3QPLA 3M4OJ 2CUEA 1MSEC 4M3FA 3S2HJ 1IGNA 1FJLA 3LSJA 5M3MJ 5IYBJ 2HI3A 4D5FA 4DYRA 1PUFA 5GPCA 5EEAA 4C3IJ 4S0HB 2QCOA 5F0CA 2ECCA 5IPAA 3A01B 4A3IJ 5EG0A 1WPKA 1ZKGA 2DMQA 2HOAA 3CDLA 2IU5A 2O7OA 1ZQ3P 2R5YA 3GTOJ 4I76A 1JT0A 2DG7A 1W0TA 1AU7A 3BG5A 3JRGA 3S17J 4NELA 3Q0WA 3VW0A 2E19A 3ZQFA 1WCMJ 2Q24A 3BG3A 2FX0A 2R5ZB 1BA5A 2EZLA 3HDDA 3MKLA 4GFKA 1B8IB 3HTIA 2X9DA 2CJJA 2F07A 4IHYA 1HDPA 5HBUA 1FIPA 3IH3A 3Q0VA 3JRAA 1AHDP 1AKHB 1MNMC 3ON4A 4GFLA 3S1NJ 2YS9A 3BQZA 2ZCXA 5FKLA 1IC8A 2ZB9A 1DU6A 2HYTA 4AF5A 2JJ7A 3BR3A 3AQTA 1GT0C 5D1RA 1GDTA 2RAEA 2DMUA 3HB9A 1QVTA 3CQZJ 3G1MA 2JWTA 2IEKA 1F36A 4V2FA 4C3HJ 1SFOJ 3S1QJ 4A3BJ 3HOVJ 4FE7A 2G7LA 2DA4A 1ETQA 2MGQA 3IV5A 1F43A 2FD5A 2GBYA 3HKZN 2G7GA 1TWGJ 4UUSB 3GTLJ 1UG2A 2MG4A 2H1KA 4HNVA 1X2NA 2L7FP 2JA5J 2O8KA 2D6YA 5EGOA 2UXOA 4M3GA 3BTLA 3A01A 2B63J 1POGA 3BR5A 2MW8A 4IHWA 3GTQJ 2HYJA 2DA2A 1Y1VJ 4C2MJ 5DAJA 1MBFA 4XRSG 2DMPA 3TEDA 4DYCA 3PASA 4JKZA 5FHPA 5M3FJ 3GEUA 3EUPA 1SANA 3TP3A 2FJ1A 2PMZN 2P81A 4HKUA 2DA6A 3S14J 2DTZA 3Q0UA 4A3GJ 3F1BA 5EYRA 4A3KJ 1JUPA 2NP3A 4FISA 5IYDJ 1WI3A 2N8GA 2DA5A 4ABZA 3BTCA 2JN6A 2LVSA 2QKOA 2W53A 2VKEA 5DS9A 5FKNA 1FEXA 2XDNA 2XGEA 5FLMJ 5J1YA 1NK3P 5DTDA 4D7NA 1X2MA 3CMYA 1RKTA 3LHQA 3HGYA 2LK2A 1JJ8C 1JKQC 3VPRA 3HTJA 1YRNB 2LFBA 3VW2A 2L9RA 2JA8J 4X6AJ 1RESA 1I3QJ 3V78A 3K2AA 5C4JJ 2GLOA 4D7MA 5FLVA 5K7HA 3F0CA 4IEJA 2Y9YA 2NVQJ 1OCPA 5IP9J 3HIMA 2Y2ZA 1CQTA 3RD3A 1U8BA 2Y30A 3LOCA 3T6NA 2NVXJ 3H3VK 4CYCB 4B3AA 3JREA 4A69C 2AHQA 4MIMA 4IHXA 3ON2A 2OF7A 4QTRA 1MBEA 2EH3A 3FK7A 5EZHA 4AC6A 4NDLA 2ME6A 5E3NA 3SJMA 3PPBA 4A3FJ 4I6ZA 1HDDC 3RQIA 1TWCJ 2Y0SN 2YUSA 4J19A 2UXHA 3ANGA 1IG7A 1NK2P 3O8GA 2LY9A 3S1RJ 2M8GX 1ETYA 1OCTC 4JNNA 3MN2A 2HXIA 3HM5A 3LNQA 2AO9A 5E3LA 1B72A 1ZK8A 2NS8A 4L5EA 4XRSA 3JRHA 2ZOYA 2LR8A 1Z0XA 3I4NJ 2JA7J 3Q3SA 3JSJA 4RDUA 3BG9A 3D1NI 3ZQIA 4EEFG 3HTHA 3IUVA 2VPRA 1VF9A 1A6IA 1MBHA 1IV6A 2K9SA 4GCKA 1JUMA 2XGCA 4JX4A 2DMTA 3IH4A 2IAIA 4DW6A 2XSDC 3COLA 1T33A 4AUXA 1OFCX 3VVXA 3LSPA 5HAWA 1ZTRA 3PM1A 2GM4A 1GVDA 2WAQN 2L7MP 2QOPA 1NTCA 3HOYJ 2HQ5A 1K83J 3DPJA 1YRNA 1RETA 4XICA 3NRGA 5EFYA 1UHSA 3AQSA 3KNWA 1I6HJ 3GTGJ 1LE8B 2NP5A 1IDZA 1ZGWA 2GUHA 3VOXA 2HXOA 2YVHA 4BBSJ 4JL3A 3SDGA 3ZQCA 1JT6A 3FKIJ 1TC3C 1UMQA 5F27A 3UKGA 1VNDA 2DJNA 3ZOBA 4MK6A 1JUSA 4GFBA 3ZQHA 5HODA 3BT9A 2E2IJ 2UXIA 1ETWA 2K9NA 3TW6A 3GTJJ 4X1EA 2LD5A 3RH2A 4ACIA 2RASA 1JKOC 3LWJA 3HEFA 2E1OA 1H89C 5K7ZA 1JGGA 3ZQLA 1BW5A 3NPIA 2XGDA 2CQXA 3GTKJ 1IJWC 4QIWN 3JR9A 3BQYA 3MVPA 1HLVA 5GPAA 3GTMJ 1EF4A 5IOYA 3E7QA 2FQ4A 2HOTA 5GP9A 4BKXA 2I10A 2ELKA 1ETKA 2HOSA 2G3BA 1QRYA 5M5XJ 1O4XA 2COBA 2XPVA 1R9TJ 3A02A 3JRCA 4L62A 3G56A 1GV2A 4GCLA 1P7IA 3JRBA 1JTXA 3L1PA 3KKCA 4B4CA 3RZDJ 2R5ZA 4AC0A 5IYCJ 3IH2A 4A3EJ 3SFIA 1B8IA 3S15J 2HKUA 1IUFA 3BTIA 4UUTA 3S1MJ 2OERA 3KZ9A 2ME0A 4M3BA 2LP0A 1AKHA 3QBMA 2V57A 3EGQA 2PBXA 3C2BA 2EBIA 1X58A 3HOXJ 1ETOA 2M2EA 5F1JA 1PUFB 1FTTA 3HTAA 3O60A 3B81A 2LLKA 4CGRA 3ANPA 1XC5A 4QSHA 5EZGA 1SGMA 4XRMA 5D19A 1QVUA 2JK3A 2VKVA 1ETXA 1S7EA 2X6OA 3MNLA 2R5YB 2D5VA 2QTQA 4BXXJ 4FCYA 3FRQA 3OSGA 2UXPA 3FIWA 2W48A 2DG8A 3TP0A 5BNGA 5J1RA 3CRJA 2ZCNA 2CUFA 5C4YA 2JA6J 5FKOA 2WUIA 2M9HA 3QQAA 3VP5A 1ITYA 4UUSA 4FE4A 2G0EA 3E7LA 3G1OA 3HGGA 4MFEA 1UI5A 2E2HJ 4A3LJ 2QWTA 1MH4A 3B6AA 2LTPA 3TW7A 3OOUA 5H9TA 1BW6A 4DYQA 4BY7J 3I4MJ 5K58A 1GUUA 1ZR2A 2KT0A 2NS7A 3BRUA 1W0UA 3VOKA 1WH7A 5F04A 2EZKA 3NNRA 2ID6A 4W97A 3OSFA 2XPUA 1MBJA 2XRLA 2ID3A 2KDZA 2XPWA 2QF7A 3M3YJ 1WGXA 1FTZA 1U9NA 2CRGA 3VW1A 4XK4A 2EZHA 5FKKA 4PXIA 1TWHJ 4MO7A 1IDYA 1K61A 2R92J 2DMNA 1DU0A 2DA1A 1XG1A 4DZPA 1Y1WJ 2NOGA 2OPTA 4Y52J 1GV5A 3BR6A 5EF6A 3W6VA 4BY1J 5FKMA 2IBDA 1I50J 2OI8A 4MLOA 5F0FA 3HE0A 5EGOB
chains in the Genus database with same CATH superfamily
3QPSA 3VSLA 2XB5A 4YZEA 4NBQA 2DT7B 4FTHA 3BHQA 4DBRA 4KWAA 5E3MA 1N78A 2YVEA 5ILVA 5HDGA 2TDXA 2ZSIB 1IRZA 4BE1A 4DVYP 1F5TA 3JW4A 1YW9A 4CCJA 2DXIA 4BQOA 4NB5A 1YLFA 2PJRA 2B9SA 3LA7A 3V8KA 2V6EA 1EA3A 3J7ZI 3MAJA 3RI4A 1OR7C 4ON0A 3AAFA 2PMUA 4JOMA 4XLPF 5D18A 1RUOA 2K3PA 3BWGA 2MSYA 2CW8A 2A5WA 1Y6IA 5LHHA 2HNHA 1IN5A 4B1RA 1U78A 4A3DJ 2ZOZA 1MBKA 1ON1A 3I53A 3S2DJ 2ADUA 2ZXJA 3BCGA 1BM9A 2JA2A 3UR3C 4G12A 3HOTA 2EFPA 1BJAA 3CP8A 1HCRA 4OU0A 4BBRJ 1T56A 3K7AJ 3J80K 3F21A 3OIOA 2M45A 2XF6A 2CUJA 3WHBA 3VYRB 2KZGA 3HL2A 3VWBA 3U9GA 3BJOA 4Q47A 3VUQA 1R1TA 2ZKZA 4IX7A 2VT3A 1TTYA 3R0AA 4JK1X 1B9NA 4PJ0C 3PO2J 3RCOA 2J5OA 4PZJA 4B8XA 2K9QA 1HF0A 5C4XJ 1TT5B 1Z7UA 1MMAA 2DQLA 3EUKL 3BZ6A 4LD5A 4NC6A 3GZNB 4JYKA 4NC7A 1OCZH 1U2WA 1YJ9I 4V2GA 3BNIA 1BC8C 1LFBA 3E5XA 3F8BA 4LB5A 3RPUD 3ZN0A 3BCAA 2JRMA 3NI7A 3G3ZA 3QAHA 3L9FA 3LSRA 1SMTA 3JTGA 2IGMA 2K86A 5EG0B 2VKHA 3KP3A 1H8AC 1KU9A 2E1NA 3K4MA 4N9HA 1VQ9I 3I59B 1IXCA 2A6TA 3E0JB 5LRRA 2VUMJ 1FMVA 4CCOA 5TISC 5LLQA 4G6DA 3CJDA 5HOOA 1U9OA 3L2RA 3D0SA 4A12A 2H8RA 1WH5A 2EV0A 3LSGA 3G2BA 1WSUA 2DOEA 4E7IA 1Z21A 1XMAA 3G1LA 4HW0A 3VDXA 2WB1N 3A0HC 3RKQA 3FM3A 2V79A 5LGNA 1J7KA 4M3DA 2R7OA 4IXAA 2WTEA 2VE8A 2Y69H 5FB2A 3E6MA 3F9KA 5L3CA 2LDUA 2C6YA 3LSMA 4LFUA 5FGLA 1U5TC 4NUBA 4U0VA 2HZTA 3WTYC 2QZ8A 2OJED 1W7PA 5H6QA 3GYHX 1QPIA 3ZCOA 1T38A 2QQ9A 3C3WA 4UV8A 4G94A 1J0RA 2LMDA 1HKTA 2LKXA 3A03A 5FD5A 2REKA 3QPLA 4M3FA 3BZKA 4R1HA 1ONVA 2JT1A 2O3FA 5IYBJ 4UVBA 4D5FA 1O3QA 3H5AA 4XLEA 1QA6A 1G3SA 4S0HB 4DJAA 5D5WB 1ZH5A 2QCOA 5F0CA 1K78B 2R7WA 5IPAA 1ZKGA 3CDLA 3HOSA 2DTRA 2VIXA 2M4GA 4GDFA 1XMXA 2CSOA 2PBIA 1W0TA 3M1EA 3ZMZA 1R1VA 4ESBA 1BIAA 3Q0WA 5GAEJ 1P6RA 3ZQFA 5J47A 2PJPA 3IHUA 1GHCA 3HDDA 4EM0B 5HLHA 4I02A 4IHYA 2DODA 1HDPA 1H9GA 5BMZA 3CUQB 3JRAA 4HF1A 1AKHB 4GFLA 4E7SA 3FKJA 3J81Z 2NOJB 1IXRC 4OMYA 1DU6A 2NYXA 3OYAA 4AF5A 2MD5A 4L18B 2Z1DA 2VONA 4MQ9F 2DFHA 3HRUA 1WKMA 1GDTA 3HHGA 2KDOA 2DMUA 2P5KA 3M8JA 1QVTA 2IEKA 1SFOJ 1R7JA 1SAUA 3PUBA 2VL8A 3L2CA 3VW2A 5K1YA 2P4WA 2GBYA 3HKZN 3A4CA 3KP5A 3T0YA 1UG2A 3KEYA 2DPDA 2V1XA 4WXCA 2O6GE 1G3WA 2O8KA 3KYCB 4DGWB 3J7AY 2UXOA 3QWLA 3K1NA 2W85A 1POGA 2MW8A 1X1PA 2DA2A 1QU3A 1Y1VJ 1MDMB 5DAJA 2HR3A 4XN0A 1YOVB 3DQVC 1MZBA 4BHCA 1MBFA 2MH9A 2XUBA 4RGXA 2IXSA 3CJNA 3PASA 1SFEA 2M8EA 4OAZA 4F55A 4E7KA 3ERMA 4JKZA 5M3FJ 2IA2A 2AXLA 2CYYA 4BS9A 4OD5A 1MNDA 2HFHA 2MC4A 3KE2A 1NH3A 1B59A 2P81A 4P96A 5HLTA 3S14J 2DTZA 4A3GJ 2XAGA 1TW3A 3T1BA 2FOKA 3QODA 4EM2A 4CCLA 1DGRM 4C2UA 5LBQA 3FMQA 2DA5A 3BTCA 4EATA 1X19A 5LD2C 2DFIA 2QKOA 2W53A 2VKEA 5DS9A 2XAFA 1CF7A 2STTA 2XDNA 4C2TA 2OCEA 2QWWA 5DTDA 4D7NA 5HDNA 3LL7A 1X2MA 2K4JA 3OY9A 2ISYA 4EJWA 3QYFA 1TW2A 3CUOA 3HGYA 2DYSH 3TDUC 4KIFA 4CYDA 5D6FA 3K4NA 4KITB 2JA8J 3D5SC 3SWHA 1FMWA 3DKXA 3WGHA 5FRMA 1RESA 3C18A 3CDIA 3F0CA 2ICWG 1OCPA 2LG4A 1ERDA 2PFVA 3SEQA 5H2FC 3SEZA 1OISA 5KK1A 4BNCA 1ZG3A 4U7BA 3OOPA 2R7XA 1YX3A 3RYRA 1ZAOA 2BXZA 3Q5FA 2L5QA 1MNEA 1R4NB 4LK0F 4NDLA 3S32A 3M8EA 1QPMA 5E3NA 3OYHA 5DUIA 2BW3A 5DUKA 1HDDC 2QQ8A 1D5VA 3H36A 3OIPA 2OD5A 3ANGA 2KMUA 2ZXWH 2LC2A 2H6BA 3S1RJ 4Y15A 3TGNA 2M8GX 1HW1A 2MLGA 3MN2A 1Z6TA 3HM5A 1B72A 4AVPA 1DPRA 2FMLA 3IRQA 4BDZA 3H0DA 2H8WA 4XRSA 3JRHA 3WU2C 4FX4A 1GXPA 2HYFA 3Q3SA 4L9NA 4RDUA 3D1NI 3ZQIA 4HX7A 3T8TA 2KPMA 3LAPA 1T2KA 1A6IA 2D1HA 2K9SA 3F8MA 4WX9A 3IH4A 4CXFA 4PJNA 3I54A 2ZNZA 2XSDC 1IN4A 1T33A 2Z33A 3WE2A 1N75A 4DBQA 3LSPA 1IN6A 3KP7A 2FU4A 1K83J 3IAS2 1YRNA 1NG6A 4PCQA 3K69A 4PDKA 5GTIC 1KQ0A 2NP5A 2VJJA 3O3KA 1ZGWA 2CFOA 2GUHA 2HXOA 2CQNA 3SDGA 3H9QA 1JT6A 1UMQA 4P9FA 4J00A 4ZDLA 4FETA 4G7ZF 2FA5A 4Z6YA 3LSHA 1S9HA 2VE9A 2E2IJ 2IVMA 3CCUI 2CQ7A 3TQNA 4CA0A 3CC4I 3T8RA 3LWJA 3S3MA 3NPIA 1WI9A 3HTUA 4OOIA 4ZYDA 3JR9A 2IGKA 2F48A 2IS4A 4LK1F 3R6SA 4LLGF 4OWRB 3KP4A 2MYSA 2Q8KA 3KIOA 4NQWB 4P9UA 3A02A 2JSPA 3G56A 3E97A 4GCLA 5GAGJ 2EFQA 1KQ9A 5B3SH 3KKCA 4AC0A 2X1EA 2LYCA 4A5MA 1B8IA 4U0WA 3S3NA 2HKUA 1IUFA 3KZ9A 1Y8RB 1BI0A 1FOYA 4TV7A 2KIQA 4A0XA 3CCRI 2BYVE 4WIBA 1HA8A 2X4HA 2VC0A 3EGQA 1YI2I 3JSOA 3PNYA 2PBXA 3HTAA 5J8FA 4ESJA 2WY7Q 2QSHX 2FJI1 3B81A 2QKMB 3EDPA 2DK8A 2EFWA 2Y48A 2EPFA 4QSHA 5LRSA 3OWTA 1TP4A 1BBYA 3LA3A 5D19A 3DPUA 4E7LA 2VPLA 4I0BA 4HSTA 2CWEA 2X6OA 2BVMA 4L5JA 2QTQA 4B3XA 5J4YA 4R79A 4FCYA 2DJIA 3U2RA 3FRQA 2UXPA 2D1VA 3E6DA 3FIWA 4EV0A 3TP0A 5HS8A 3FBIB 4D1QA 3RYPA 1PDNC 3CRJA 1Y8QB 4ITVA 3HPGA 2WADA 4RS8A 2KISA 2KIUA 2L3DA 2V6CA 2E34A 5GADJ 3VP5A 4UUSA 4FE4A 2O8XA 3HYIA 3G1OA 3H3ZA 3MFKA 2E2HJ 4A3LJ 4RM3A 2QWTA 1XX5A 1ODDA 5DD8A 3HG9A 3TW7A 1BW6A 2EIKH 4BU2A 4DYQA 2OQRA 3LQRA 4EVIA 4ZTFA 1G59A 3KX2A 3EUHC 5K58A 4XQFA 3REOA 4ZZDA 4G7HF 3CO6C 4U88A 2EZKA 2ID6A 4W97A 3S8PA 2R4GA 2KDZA 2XPWA 3HUGA 3U21A 2Q2EA 3K70C 4G7OF 4XK4A 1HQCA 1K61A 2L02A 3MZHA 1DU0A 5CJ9A 2ZMEA 5F1RA 3LSTA 3WGGA 2P6SA 1A6QA 3BZCA 3L2VA 3OV8A 4ZDOA 1LDKB 3BR6A 3G73A 5EF6A 3W6VA 1W1WE 3CLOA 2IBDA 4I09A 5HNFA 4HF2A 2BY0A 2LY2A 1WJFA 3HE0A 5EGOB 3GZIA 1JJ6C 4BE2A 4M9ZA 1S7OA 1LFUP 3NXCA 2RNJA 5GTHC 3S16J 3E5QA 4BGDA 3D5LA 3SYTA 5F0HA 1U0JA 1RUNA 5J40A 3JRFA 2PX9A 2CG4A 2BXYA 4M72A 5E18F 3R61A 4BEHB 1R5HA 2QBYB 2K40A 3IL2A 2O0YA 4B48A 1T39A 9ANTA 4MHGA 1KONA 2DO7A 3O8HA 5L3FA 1FIAA 4RGSA 4G6QA 2R0QC 2MLKA 1MSFC 3QYEA 4XOTA 2W25A 1SAXA 2NNYA 3BOQA 2ZJPF 1J75A 2OTLI 2O7TA 1R1UA 5BOXA 2DAOA 1R23A 1P2FA 3MD2A 2BE5F 2XB0X 5JLXA 3PQJA 5JLWA 1JTYA 2WY8Q 5FLXZ 3GCMA 2ESNA 1KU7A 2X48A 3P9IA 3DBLB 4Y3OA 1REPC 2W7NA 3GBGA 1HXDA 1C0WA 3ESWB 4ESFA 4L9JA 3ASNH 1MKMA 3OS0A 2ISZA 3ZP5A 4EQQA 4BE0A 1S8NA 2L0KA 1QNTA 5F08A 1VQ4I 2XF7A 1G8XA 3RQ4A 1XS9A 4IHVA 1D5YA 2DN0A 1ZLJA 2K3FA 3CF5F 4A3MJ 2FBQA 3DF8A 2ESHA 5IT9Z 5CLSA 1YW7A 2F5VA 5ILSA 2V7FA 2QGUA 1B1BA 4UDSA 3ZQGA 2E36A 3JCUC 1I39A 4MFDA 1R5GA 4XKBA 1IN8A 4U0YA 2Y9ZA 2WV1A 3X2QH 1X3WB 1V5FA 2M1BA 2HDCA 3CTAA 2GXBA 2GIVA 1IXSB 4YG2F 3JRIA 1OMIA 1LE8A 4MQVA 3C07A 4HA8A 3GWZA 1PJRA 4ZZLA 1TNSA 2VQGA 2CV1A 4CZZA 1V5EA 1MJ9A 3OYMA 1APLC 1Z3YA 2RHAA 3LJLA 3DFGA 5FO5A 1O3SA 1XMKA 5CYVA 3TBIA 2UXXA 4IRGA 5BPDA 4ME9A 2H27A 1HOMA 5H20A 1FP2A 1LFPA 4OINF 1TWAJ 1LJ9A 2Y31A 2FOWA 1WHUA 4OD4A 5F6FA 3RZOJ 1OYWA 2F2EA 2PMZA 4LLNA 1R36A 3SZPA 2HVSA 4DNCA 5LEJA 3GTPJ 3A2KA 4I99C 2IA0A 3FISA 3ABLH 3VFZA 3U1DA 1MBGA 2B3WA 3HOWJ 2YVXA 4M6XA 5E3OA 2H1LA 3P9KA 3HBLA 2G7SA 1MMNA 2W00A 4LOCA 2LBFA 3KLOA 4AWXB 2TCTA 2M34A 2R93J 4N9IA 3SHFA 3BDDA 1HKQA 4Y17A 3TO7A 2R7TA 5IP7J 1L0OC 1I1SA 2R7DA 4C3JJ 1X4OA 1BL0A 1A31A 3J7YJ 4ICHA 2R7VA 3K2ZA 4AIJA 1YJWI 3BCBA 3S2HJ 1OYYA 2MH2A 1PP7U 1D3YA 3LSJA 3ABTA 3VEPA 3GLLA 1VQKI 2IW5A 1S6LA 1SMYF 2R7SA 1LUJB 4V19K 2BGCA 4M74A 1HC8A 1JGSA 2ELJA 4HZFA 3MZ8A 1G6NA 4KT6A 2ECCA 5H6RA 3A01B 5EG0A 4RA2A 3JSPA 2IU5A 5D5UB 3GTOJ 4I76A 1JT0A 1LKXA 1AU7A 3D5RC 3OYDA 2V9KA 3ISPA 2JTVA 3ZXSA 1J09A 2OV7A 5D8LB 2FX0A 4LG0B 1TQPA 3CLQA 1FZPB 1WJBA 1ZELA 3MKLA 2DYRH 4KICA 2X0LA 5DCMA 4GFKA 3I9V2 5E8GA 2XRNA 2F07A 2KRHA 2YSRA 3FHZA 1ZLKA 5ICCA 5TRDA 3H92A 1YFHA 1RRJA 4XRFA 1SVMA 5HBUA 1FIPA 1LDDA 3IH3A 3Q0VA 3J81K 3W2WA 1MNMC 3M8FA 4E7ZA 2CW0F 3S1NJ 4BH9A 2X6XA 3CMMA 1LDJA 1KGSA 2ZB9A 1XN7A 5K5RA 5D1RA 3GFLA 3PIPF 1XGSA 1VQ5I 2HQAA 1XTAA 3OIQA 3HB9A 2L2OA 3G1MA 4V2FA 1F36A 4A3BJ 4KUMA 4M9XA 5ICGA 3WGIA 1D1BA 1WFXA 4FE7A 2G7LA 2RQQA 1WQ2A 2DA4A 2KQRA 2MGQA 2FBKA 4U87A 3OS2A 5L3BA 1DQUA 2MC3A 2MG4A 1TQIA 2FEZA 4LLLA 4YFNF 2L7FP 2LRDA 3OYBA 3I55I 3MCZA 2XAJA 4KN4X 5FFZA 2QVOA 4M3GA 1PVEA 1FWZA 3BTLA 2B63J 2F4MB 4HLYA 2JRTA 3AL0B 4IHWA 1F1ZA 2DOFA 2HYJA 3GTQJ 2RREA 2ZXIA 2O5RA 1FOXA 4C2MJ 2DU9A 4RAGA 5ICEA 1ZREA 1AA7A 2HWVA 2CS3A 4FASD 4XKCA 3FXQA 3GEUA 1S72I 3QPTA 3EUPA 1XSVA 3G71I 2RKHA 3AL0C 5BPIA 3QRFF 2DA6A 5FRNA 3KETA 5EYRA 1JUPA 4FISA 3CUQA 5AONA 4RAFA 2AQFA 2V26A 3FMRA 5D4SA 5IYDJ 2ZJ2A 3COAC 3FXRA 2JN6A 1KQ8A 2XGEA 1MGTA 1U5TB 5J1YA 5FLMJ 1NK3P 2DPUA 1XGOA 2FQ3A 2LK2A 1JJ8C 4L5IA 3KLNA 3HTJA 3GZ6A 1XB4A 4L0YB 3HXLA 4B47A 2HQNA 3CC7I 4EJTA 4X6AJ 4UB8C 1RNLA 3K2AA 3KYDB 5C4JJ 4D7MA 2RN7A 2Y9YA 3BJAA 2XKPA 3KCCA 1CQTA 1DPUA 6PAXA 3FXMA 3JREA 3ZQ7A 3K6GA 3VYUB 3OS1A 1VTNC 2L9VA 4M6YA 1WWXA 4HDUA 4UY8I 2XAQA 5EZHA 3SJMA 4I6ZA 1LQ1A 3E5UA 2Y0SN 5CVUA 2UXHA 1IG7A 1NK2P 3O8GA 1OCTC 2HXIA 5KNLA 1S7AA 1D0ZA 2AQEA 2OQGA 4HPQA 3OL4A 3TOBA 4C9YA 1K4TA 2NAZA 3I4PA 2ZOYA 1Z0XA 1JHFA 3DXJF 2G7UA 4XKWA 2BY1A 4EEFG 2CUZA 3CJQB 3MMYB 2ZJRF 3RSNA 4KNYA 4PSWA 1JUMA 4JX4A 2DMTA 3IKVA 2BZTA 3SXYA 2KIMA 4J01A 1SD6A 1OFCX 1VQ8I 1FSHA 2GOXB 2KZVA 3PM1A 5CQEA 2WAQN 3V42A 5E17F 1XCVA 1ZGAA 4EGYA 1NTCA 1VQNI 1Z1DA 2E5ZA 4RB2C 1UG0A 2F4IA 3DPLC 4RGRA 4XICA 1DDNA 2LOOA 1FSEA 2NRAC 3GTGJ 3NWTA 1BC7C 5D5XB 5K5QA 5E1XA 3NQOA 3VOXA 3AG1H 3F3XA 4BBSJ 3ZQCA 2YVHA 4M73A 2Z16A 5JR3A 3UKGA 3ZN1A 2ZO4A 4XNFA 3ZOBA 4L0ZB 1X4PA 2CFXA 2A05A 3GX4X 5J8CA 2UXIA 4BACA 3GTJJ 2EV5A 3RH2A 4ACIA 2RASA 3GUDA 1JKOC 3HEFA 1RIOH 2VJIA 5DD4A 3DLAA 3ZQLA 2BY3A 3R0JA 3DU5A 3VYSB 1W5SA 1HSJA 1YHQI 4I7HA 5GPAA 3ABKH 5IOYA 5ILUA 3ERED 1XGNA 3WU1B 2EA2A 2QQBA 4XSZF 2G3BA 1QRYA 3WE3A 5KAFC 4AIKA 4YRVA 2XPVA 1R9TJ 1IF1A 4XR6A 1JTXA 3CJRB 1X3UA 4HV5A 3L1PA 1S3JA 1W7PB 3RZDJ 2R7UA 2A6HF 2R5ZA 2KIFA 5FGMA 3ZMSA 1YO5C 3IH2A 1B9MA 1P4XA 3WG7H 3SFIA 3S15J 2FRHA 3BTIA 1FYMA 4KYWA 3DEEA 2L54A 4OAYA 3CJTB 3OYEA 2ME0A 4ZYAA 1USTA 2IJLA 4GYGA 1SFKA 1XDUA 2K9MA 2QSGX 1O57A 5GAHJ 4Q5SF 1FTTA 3A1YA 2GXAA 1TZLA 4ZC3A 2M5WA 4RB3C 3BP8A 2LLKA 4CGRA 2I8DA 1XC5A 3OYKA 3KZZA 4E70A 4UVAA 1WJDA 1E3PA 1BIBA 4XRMA 2K02A 1R58A 2K85A 5CVJA 3ABUA 5HLGA 4CDGA 2HVQA 2W48A 1KU3A 4IHSA 2VN2A 4QPOA 4KN7X 2CUFA 1PP8F 2RV8A 5C4YA 1WVRA 3CCQI 4BXUA 1V5GA 2WUIA 3QQAA 1ITYA 3CD6I 1L3LA 3HGGA 2CH0A 4MFEA 1UI5A 5EJCA 2IA1A 1P4WA 1MH4A 3B6AA 1G3TA 3RIRA 4FQGA 3BG6A 2E7XA 4NQWA 3WODF 1U8RA 2QLZA 1WH7A 5F04A 5E1WA 3FXJA 3ZMTA 4IOAF 4MEXF 3NNRA 1XSDA 1T98A 2MFZA 4LIUA 3OSFA 4LMYA 2A5YB 2XRLA 4IQ4A 2WB1A 3M3YJ 4EM1A 1SEUA 1U9NA 3VW1A 2KRCA 4ENMA 2MABA 2OAZA 4PXIA 1TWHJ 4MO7A 2R92J 2DMNA 3SZGA 4IHTA 3IKTA 1IAWA 1XG1A 2XHKA 4DZPA 4S05A 3LFKA 4H0EA 4HSRA 2QEXI 4F52A 2IS1A 2OPTA 2QSFX 2IT0A 2HVRA 4Y52J 4BDYA 1PUFB 4OIRF 1Z67A 5ERIA 2VXZA 5FKMA 1EKEA 3V8JA 1XD7A 3QYBA 2OI8A 1O7LA 3VTIA 1LEAA 4YIRX 1XDSA 3BTJA 3DBRB 1IRGA 1YS7A 2ACJA 5LGTA 3PO3J 2K4BA 2W57A 4BHBA 5DV5A 2NVYJ 3FBNB 4UNOA 2GIZA 2R3SA 2PZ9A 3VVYA 1T6SA 4LGWA 3VIBA 1ZG1A 2XIGA 1FYLA 4XONA 3BR1A 1TWFJ 3KKDA 2E71A 1ZR4A 3S2WA 4AIDA 2P6TA 3EYYA 3PQKA 4CYCA 1A5JA 3ROUA 1SFXA 2M0CA 4AD9A 1ETVA 2EA4A 1E3HA 4D5CA 3RJPA 4MTEA 1RKWA 5FJ8J 4NNJA 2NX4A 2IGOA 3FK6A 2P5LC 3WTUC 3QOPA 4PJLA 5J4VA 4JP0A 1M1EB 3NEUA 4U7DA 3W2AA 5FLXK 1YIJI 2YU9J 3IAM2 3FXLA 3PNVA 5KCMA 3DKYA 2UXUA 3H0GJ 4ENNA 1CF7B 5FMPA 4A3CJ 2GENA 3R60A 2NVUB 3Q9SA 1VQPI 1P9QC 5ED4A 3KP6A 1A36A 3HOZJ 2WGBA 2L7KA 2XKOA 4CGZA 1MH3A 1BI2A 2CMPA 2XC7A 2ZCWA 2DK5A 3BR0A 2CGPA 3CCVI 5FD6A 3HOUJ 3B6CA 5M5YJ 1XGMA 4XLHA 2GFNA 2WV0A 2VQCA 4MGRA 2CU7A 1HSTA 2M4KA 2VQLA 3SZTA 3L7WA 5IT9K 1IZ1A 2PEXA 2EFOA 3DWLE 3R4KA 3F6VA 3S5RA 1F9NA 1A35A 5JVTA 4RBOA 1XSXA 5C44J 4AM3A 3I5UA 5E20A 2XSJC 1YQAA 1U3EM 4XORA 5JVGF 2L9SA 3DEUA 3CCSI 3HKZA 2EQRA 5AQCA 3NARA 4LITA 2F5FA 1D1CA 4A5NA 2E60A 1ZRDA 2L7ZA 4FHTA 5J3LA 1B72B 2GOMA 3V8LA 4BEHA 1QO0D 2KJBA 1ORKA 2QIBA 4NC8A 3QKXA 3ZMUA 2M3AA 3M9AA 5CXGA 3E3VA 2DFFA 1R5ID 1W4MA 1OKRA 2E5NA 1VQ6I 1WRJA 4PK4A 2JVGA 5DM7F 2VBYA 5DCFA 3ZR8X 1Q1VA 1FBUA 1FPQA 1V54H 2YU3A 2R7QA 3G7RA 4GO1A 5HVQC 4D0PA 2DA7A 2Q0OA 4W1UA 1HW5A 2HOEA 3BR2A 2W4SA 4FT8A 2HKOA 4GYIA 3HRSA 3CCEI 3S3OA 3N97A 1UB9A 2OTJI 1IUYA 3O6BB 1T0FA 2Y0MA 3A0BC 4XKVA 4AVZA 1EJ9A 2CW7A 3PJRA 4U9NA 1SD4A 5EEGA 2FMYA 3MKWB 3K8PC 1SVOA 2X6WA 1MMGA 4M6VA 1V3FA 4CUGA 1DUXC 4U9LA 1YE9A 2A2FX 3WG9A 4Y33A 3WTZA 1AWCA 4AYBN 1P7JA 1BR4A 4YFKF 1UZCA 5K7FA 4MTDA 1VI0A 1IRXA 3G6EI 4R8HA 1VFCA 2KFDA 3BJ6A 4KIBA 3P9TA 1OYIA 1MIJA 1FYKA 5CXIA 4GCTA 5JFRA 4YEJA 1MMDA 4KISA 5TJJA 2CUEA 1TT0A 4WXHA 1MSEC 1IGNA 2OA4A 5M3MJ 2OC6A 2HI3A 4HDVA 2I5UA 1X1CA 4IRHA 5KAIC 4DYRA 1OQYA 1PUFA 5EEAA 1VQ7I 3UNGC 4C3IJ 2ZJQF 1QHHD 5IY5H 3TO9A 1NHAA 2DFEA 3BPVA 2HS5A 2OCCH 2DMQA 3N4MA 3V4GA 2O7OA 3EPZA 3HPHA 2R5YA 2EWNA 1RI7A 4E4HA 2LKPA 3ASOH 2L01A 4KDPA 4PUSA 2M7AA 3JRGA 1H9TA 3S17J 4NELA 3VW0A 1WCMJ 1WJAA 2Q24A 3CESA 3MKZA 1BA5A 5D8KB 3BC8A 3K4CA 5E1ZB 1B8IB 3HTIA 5AIQA 2AXTC 2X9DA 2CJJA 4G8XA 2Q1ZB 1V55H 1VQOI 5BS6A 3VODA 2ZFUA 1E0EA 1EV7A 1T8IA 2EILH 2JSCA 3OYLA 1SC7A 2UWMA 3ON4A 3PFIA 1A04A 5KVRA 4I2OA 4N4OB 2A3SA 4K2EA 2ZCXA 3RTRA 2HYTA 1ZARA 3FXUA 3BR3A 3GW2A 3L2QA 2YR2A 1UAAA 4BXFA 1BI3A 3BROA 3S1QJ 1UELB 1UJ8A 4IL6C 3CCMI 2WC2A 3FWEA 2WA0A 2ZNYA 1HBXG 2X1DA 4HX4A 5HLIA 2XV4S 1KYWA 1SD7A 1ETQA 4RB0A 2FD5A 1J2XA 2B7EA 1TWGJ 2X51A 2ELHA 3SFZA 2L4AA 4UUSB 1LPQA 2H1KA 3RPQA 4HNVA 4OIQF 2A61A 4BUPA 1BOBA 2IPQX 3CC2I 2GXGA 2JA5J 3MZYA 2JZYA 3RDIA 2WWYA 2D6YA 1D8KA 1FX7A 4F91B 3A01A 4F3QA 3F8CA 1BI1A 1VQLI 3QU6A 4YIFA 1OR7A 2RGVA 2DBBA 4ZYHA 3ULQB 1SVLA 1Z05A 2DMPA 5FROA 3TEDA 3LSIA 2V1NA 4KFCA 3DPTA 2HPIA 3HUGB 3P5JA 2GWRA 2H6CA 4IJAA 4XLFA 3OYIA 4BJ6C 4WF2A 5D4RA 1CGPA 1SANA 4MEYF 2FJ1A 4KMFA 3Q0UA 2K5CA 2HPMA 1T95A 1ZGJA 2O03A 3VB2A 1RZ4A 1WI3A 4P55A 2Z9OA 3DU6A 3K4BA 2LVSA 5ICFA 4HNTA 2DDAA 5A2QK 3H9GA 1TQMA 2V9PA 4IPAA 2IGNA 4ZYGA 4IQJA 2ZMEC 2H94A 1OCOH 3J7AO 2W84A 1STZA 3LHQA 2P7VB 3VPRA 2WBMA 4ZTJA 2A07F 3DBHB 2L9RA 1I1GA 2VJ4A 2GLOA 2Y75A 5FLVA 5K7HA 3F8FA 4IEJA 3RD3A 2XDVA 4F92B 5IP9J 4YIIA 3VOEA 3OYGA 1U8BA 3T5XA 2F6CA 2NVXJ 3DTEA 2OZUA 4B3AA 4A69C 2AHQA 2HU9A 2W82A 4HG2A 2F5DA 3F72A 4IHXA 2OF7A 4QTRA 3OYJA 1MBEA 2R7FA 1X1AA 4AC6A 1JXSA 2B1EA 3PPBA 3H9JA 4ZYEA 2XVCA 1FOKA 4Q48A 2YUSA 5IT3A 3W6JB 2YPRA 2LY9A 1P92A 1YTYA 3ZGKA 1ETYA 2V9VA 2Z99A 3LNQA 2AO9A 5E3LA 1I5ZA 1ZK8A 2LREA 2P0WA 2NS8A 2ZXHA 3EUAA 3K4JA 4HAMA 4L5EA 2GZWA 3AFHA 2STWA 2LR8A 4O3MA 2FBHA 3I4NJ 4LB6B 2M30A 2NS0A 4Y4RA 3BG9A 2XAHA 3I59A 3M1CA 4B09A 4WWCA 3HTHA 3IUVA 2VPRA 1YX5A 3HRMA 3EYIA 1IV6A 4GCKA 2XGCA 3QU3A 2IAIA 1PUEE 3OMYA 3CP2A 1UHWA 3COLA 2G9WA 2EFNA 2NXNB 3VVXA 3IWFA 2WAFA 1U5TA 4A6DA 2K27A 2GA2A 3FM5A 2BHYA 1KA8A 3IRRA 3I71A 2QOPA 5JI6A 2NNNA 3DPJA 2LNBA 1RETA 3KP2A 3NRGA 1UHSA 1I6HJ 2L9NA 1LE8B 4CHUA 4HRIA 1U6GA 3LAJA 3MWMA 3F8NA 4HV6A 4EJUA 1V4RA 3FKIJ 4YFXF 4II2A 4G6TB 2DJNA 4MK6A 1JUSA 2VASA 5HODA 3CCLI 3BT9A 2K9NA 3TW6A 2Z3YA 3GLXA 4X1EA 2LD5A 5CVIA 2COMA 2VKDA 3FXOA 4HX8A 3NWSA 3V7SA 3KPHA 1USSA 1G3YA 5K7ZA 1JGGA 1BW5A 3W6KB 2HZDA 4E7JA 3GTKJ 1IJWC 4QIWN 3BQYA 3MVPA 1HLVA 1W36D 3CDHA 2A69F 1MW7A 1EH7A 4CCMA 4RM2A 3E7QA 2FQ4A 1K78A 2OU2A 3LFUA 3HSEA 3WTTC 3FZVA 5DYMA 2I10A 3KZIC 2ELKA 5M5XJ 1QGPA 4BYYA 1O4XA 2KP6A 1FOWA 4L62A 1P7IA 1YYVA 2JQ7A 4XBFA 4B4CA 2X1CA 2LBFB 3S93A 4RGUA 3RKXA 4UVCA 1ON2A 4YELA 3TO6A 4UUTA 3S1MJ 2OERA 1LEBA 3I58A 1BR1A 4M3BA 2LP0A 1AKHA 1QZYA 1Z7LA 1ULYA 3C2GA 4S04A 2V57A 3KEQA 5DM6F 3DLLF 1X58A 2BV6A 3M07A 5J6XA 4FX0A 3HSRA 5A2QZ 3IP4B 1YITI 1XCBA 2PN6A 2JPBA 2XAUA 5EZGA 1O3RA 3ANPA 3ECHA 2KHMA 4ASNA 2JK3A 2VKVA 3PSFA 3MNLA 3K9TA 2D5VA 4N4NB 2RDPA 3OSGA 2DQRA 4P1WA 1D8JA 5BNGA 2W24A 1DP7P 2BY2A 4XSXF 2ZCNA 4IRVA 2HTJA 2JA6J 5L3GA 2MD0A 5FKOA 3FF5A 2PJRB 2M9HA 3E6BA 5DCMB 4EJOA 2G0EA 4XLNF 2ZY9A 3M7GA 3K70D 2VJ5A 2XROA 1FY7A 2DCEA 2QA4I 4BY7J 2FE3A 3BPXA 4AU7A 3WTSC 3KYLA 1QQIA 1GUUA 4JBAA 2KT0A 2NS7A 4BHPA 1ZR2A 1W0UA 1N25A 2DT5A 1MDMA 2CQKA 1JHHA 4A6EA 4C2MA 2M0MA 2ZBKA 1W5TA 2ID3A 4RLFA 2QF7A 4F7ZA 1WGXA 2CV0A 5FFXA 3KFWX 4L9TA 2FXAA 2CRGA 2EZHA 3CZ6A 5FKKA 1IDYA 1FP1D 1LNWA 2RC4A 2DA1A 4IRIA 2QUFA 1J5YA 4ENKA 2NOGA 3NS4A 3K1MA 4P5OA 5LGUA 4XMYA 3OR2C 3JAMZ 2HQRA 2V1UA 5DEQA 1T08B 2WAEA 4BY1J 3MKYB 1I50J 2QM3A 5F0FA 3V6GA 1MD0A 1FLIA 3TKYA 1ZRFA 2P8TA 1Y56A 3CCYA 4GCVA 2DW4A 1QZEA 3P9CA 1J59A 4M3EA 3DEWA 1GLNA 1W5CC 3LWFA 2VI6A 4PGGA 3JRDA 1IRFA 5C3EJ 4CCNA 1K7AA 3TMOA 1OJLA 2J5PA 1D0XA 3GMEA 2F5CA 5HNHA 1Y39A 2ECBA 3O2PE 4OIPF 2RVCA 2EZIA 4QWQA 3RKWA 3CMAI 1H88C 4HOBA 5K5OA 5EDNA 4A93J 2HEOA 1I3AA 3I3LA 3LMMA 3ZMDA 4BAYA 1Y0UA 4CSWA 3BJBA 3MEXA 2D45A 4L9VA 1BJZA 2P7CB 4MXMA 4CICA 5LEKA 3WTWC 2EB7A 3ECOA 4E6KG 1E3OC 5B5EC 3IUOA 3VSKA 4JX5A 3CUQC 3I64A 2BHZA 4GGGA 1OPCA 2CQQA 5CKTA 3ABMH 3PFYA 2ZCMA 2NVTJ 1UHMA 3J80Z 3HOXJ 1G2HA 2FF4A 4ZJZA 1P4AA 3B73A 3WTXC 4Y7NJ 2D2WA 1I27A 4RMNA 1RPWA 1R49A 4DZJA 5CPRB 3BY6A 2XF5A 3GVAA 2QKLB 2VXDA 4UHTA 2ZFWA 5HS7A 1Z91A 3PNTA 1JKPC 5F64A 3DTIA 3GFMA 2K9LA 3ONQA 4IZZA 4IOCF 2JMWA 2BOLA 2UXNA 4RAZA 1X1DA 4RAYA 4HYEA 1YS6A 1B6AA 5J1UA 1I6XA 5IP6A 1GXQA 2HDDA 4ENJA 4CCKA 3E1SA 2LY1A 2CO5A 3ZQQA 1WJCA 3DCFA 4NN1A 1KZHA 4Y13A 3PUFA 2LF8A 2KKOA 3GFJA 3GO5A 2DA3A 2OUMA 3H5RA 3WTVC 5HSZA 3WHCA 2PFBA 2HTSA 4JX6A 4AIHA 2A6EF 4XIDA 1R6RA 4IKFA 1FBQA 4UXNA 2R7ZJ 1Z77A 1UI6A 3WU0A 2VOPA 3VVZA 2KJCA 4ETSA 4A3JJ 2TRTA 1ENHA 3CMEI 3OR1C 5D6EA 1BOAA 1R4MB 4UV9A 3NAUA 3QP6A 2O61A 5M5WJ 2O9LA 2X85A 2A68F 2CV2A 4O5VA 5CW8A 1E17A 1Z9CA 1YIOA 1ACIA 2GA1A 2K7LA 3FHNA 1WJEA 5IOZA 1G4DA 4IO9F 1RR7A 4WCGA 5D5VB 3CWRA 3ZPLA 2RNGA 4CH7A 1JKRC 2E2JJ 2MA3A 3M4OJ 4Z2YA 3EETA 1O3TA 1FJLA 4I98B 1QBJA 2VOOA 2RQPA 1B4AA 5GPCA 4HQMA 3HRTA 3TL4X 2VQHA 3RPUA 2ETHA 4WK8F 1YJNI 1GVJA 3U1KA 4A3IJ 1WPKA 2HOAA 2Y0SA 2DI3A 1ZQ3P 4LIVA 2DG7A 1SFUA 3GEZA 3AG3H 3BG5A 2HDWA 2R7RA 2E35A 3DTKA 3EUHA 2E19A 2DT6A 3BG3A 2R5ZB 2EZLA 1JE8A 1TBXA 2E7WA 4GRIA 4EMSA 2FUG2 1N77A 3ZRGA 1D1AA 3AG4H 1AHDP 1ZHFA 2YS9A 3BQZA 2PMHA 4UUVA 5FKLA 1IC8A 4KJZA 1LB2A 1Y0NA 2JVHA 1FBSA 2JJ7A 3AQTA 2WAQA 5B66C 1GT0C 2RAEA 5EEHA 3CQZJ 2JWTA 2LF7A 4C3HJ 3OYFA 3HOVJ 2UV1A 5L3DA 3PL8A 1FC3A 3I56I 1KYZA 3K10A 3BG7A 2XASA 3IV5A 1F43A 2VC1A 2YX4A 4I0AA 1RR8C 2G7GA 3L2WA 2ZSHB 4A0ZA 3GTLJ 3F23A 4KIGA 1X2NA 3C7JA 1WJ5A 3L00A 1VZ0A 1MJBA 5EGOA 1HW2A 4XL9A 2X6YA 2EIMH 3L2UA 2BW3B 3BR5A 3IWZA 3HIFA 4NHJA 3PSIA 3GXOA 4PFOA 5BQTA 4X0GA 2JUGA 2UZKA 4PJMA 3TDZC 3TOAA 4XRSG 4EJVA 1ZN2A 4DYCA 4ANJA 2QBYA 5FHPA 4M9SA 4JQFA 4DQ2A 3K0LA 2FSWA 1DP3A 3OL3A 1W36C 4DOZA 3DKWA 2KLOA 1K6YA 3TP3A 4XOPA 2PMZN 4HKUA 4G9YA 3HC7A 1KU2A 3F1BA 5TGTA 4A3KJ 2NP3A 2N8GA 4ABZA 1K4SA 3SDBA 4WXDA 4MNUA 5FKNA 1FEXA 1FNNA 2L4MA 5JHUA 2B0LA 4M71A 3OYCA 2EV6A 3CMYA 1RKTA 1LVKA 1E2XA 3HHHA 3E6CC 4PFPA 1JKQC 2H09A 1YRNB 2LFBA 1UCRA 1HKSA 1NG7A 3VYTB 3V7RA 1I3QJ 4HNUA 2IS2A 3V78A 2LKSA 3HIMA 2NVQJ 2Y2ZA 4HBLA 4XLAA 1IV8A 3T6NA 2Y30A 1ZYRF 3LOCA 3H3VK 4CYCB 4LG3A 3JTHA 2M87A 5AIPA 4MIMA 3ON2A 1YW8A 4B43A 3V7CA 2EINH 2EH3A 3FK7A 1EH6A 2ME6A 2HYGD 4BQNA 4Q4ZF 4A3FJ 3MQ0A 1EH8A 1MMSA 3RQIA 1TWCJ 4J19A 1TNTA 3CO7C 1TL8A 3H5NA 5LFAA 3HTSB 2OBPA 2IRFG 4JNNA 3Q9VA 2EK5A 1XPXA 2EIJH 2DOAA 4H4KC 3SQNA 4XN3A 3LQQA 1IN7A 2EJRA 3C2HA 2JA7J 4PGHA 2ZC2A 3JSJA 2PG4A 3LA2A 4HLXA 4KMUX 1PYVA 1R71A 3CF2A 1VF9A 3G4SI 1ZG5A 1MBHA 3C1DA 1OLTA 5E79C 4HF0A 4DW6A 3AG2H 4AUXA 3CCJI 3KEOA 1J9IA 1S29A 5HAWA 1ZTRA 2GM4A 3QOEA 3QP5A 1GVDA 4F93B 2L7MP 4QPQA 1QZZA 4ZDPA 2HQ5A 4BQQA 3HOYJ 2G7HA 5EFYA 3AQSA 1Q1HA 2VBXA 4CO8A 3KNWA 2HGCA 2PLYA 1IDZA 3BLYA 3GF2A 4RLQA 4KA4A 4JL3A 2KRFA 1TC3C 4LJZF 5F27A 1VNDA 4A0YA 4GFBA 3H3UA 1SD5A 3ZQHA 1D0YA 1IO2A 1ETWA 2VB6A 2Z2SB 4OIOF 2IP2A 1H0MA 1FT9A 3DV8A 3ELKA 2E1OA 1H89C 4N0BA 2E1MB 1OCCH 5CVRA 1YG2A 2QYOA 2XGDA 2CQXA 5CQGA 2P5VA 4QLCU 3I0TA 3GTMJ 1EF4A 2M7BA 2HOTA 4II3A 2DLLA 4OMZA 5GP9A 1X3ZB 2JUCA 4BKXA 4ZH4F 3FMSA 1Z6RA 3H1CA 1ETKA 2HOSA 4D9JA 4BL0B 2E1MC 1UFMA 3NRVA 2COBA 1AOYA 4BJ5C 1T0FC 4I01A 4O6JA 4XM3A 1GV2A 3JRCA 4BQAA 4UB6C 1R22A 4CZCA 2QENA 4RB1A 3JRBA 1W7PD 1JI8A 2Q2EB 2MBFA 2JPCA 4LG0A 4KT5C 5IYCJ 1DGWY 4A3EJ 3N05A 4IF4A 2ZMEB 2VBZA 3P7NA 1F4KA 2F4OB 3K1PA 3IC7A 2VLAA 3W3CA 3K4LA 3QBMA 5KHDA 1RC9A 3HZJA 1TLHB 2HKXA 2EBIA 3B02A 3C2BA 1ETOA 2M2EA 4HEA2 5HS9A 1X1BA 3FDYA 5F1JA 3AKZA 3O60A 1MJAA 2FNAA 3FX3A 3HJEA 2FNPA 1WZ2A 1SGMA 2OZ6A 1QVUA 2GAUA 1ETXA 3GFIA 1S7EA 3GZ5A 2R5YB 3HSFA 2FBIA 3L09A 3DP7A 5B1AH 4BXXJ 2F5EA 2LSOA 2IS6A 1QHGA 2PQ8A 2DG8A 5J1RA 1BN5A 2VODA 2LH9A 2BBYA 2AS5F 3ML6A 2DDBA 5B1BH 4B44A 3PIOF 1O7FA 3E7LA 4GXOA 3K4KA 2PI0A 4HQEA 2LTPA 4C30A 4A2UA 3OOUA 4XLCA 5H9TA 5HDKA 3I4MJ 5JHFA 2BVLA 3BRUA 4IVNA 3QPHA 3VOKA 2QQAA 4BJTA 5E8IA 2VT2A 2V1DA 3RKYA 1ZRCA 2Z5UA 2XPUA 1VQMI 1MBJA 1OCRH 2BEOA 3OYNA 1Z3XA 5CVVA 3EQLF 2E1CA 1FTZA 4DIQA 1IW7F 2KL4A 3ZMVA 4E7HA 4EGZA 1S5LC 4PJJA 3FXKA 2V4JC 2XGXA 5L3EA 1Y1WJ 3JAMK 2UUZA 2GQQA 3F6OA 3LSKA 2W1OA 2VBWA 4AYBA 1GV5A 1LVAA 3W2VA 4PSXA 1R00A 2YX7A 1K79A 3H35A 5LHIA 3F22A 1BR2A 5DDGA 4MLOA 1K6OA 3KZYA 5LHGA
chains in the Genus database with same CATH topology
3V6GA 3GZIA 1JJ6C 3QPSA 4YZEA 2XB5A 1LFUP 3BTJA 3S16J 3NXCA 3CCYA 4FTHA 3PO3J 3BHQA 5F0HA 4KWAA 2PZ9A 2NVYJ 5E3MA 3JRFA 2YVEA 3VVYA 3VIBA 4M3EA 3DEWA 2K40A 1IRZA 9ANTA 3BR1A 1TWFJ 3KKDA 2VI6A 3JRDA 1ZR4A 3O8HA 5C3EJ 1FIAA 1OJLA 4CYCA 2R0QC 1A5JA 2M0CA 2ECBA 1ETVA 1MSFC 4D5CA 5FJ8J 1RKWA 2EZIA 2NX4A 2O7TA 3FK6A 5D18A 1H88C 4JP0A 5JLXA 5EDNA 2XB0X 2MSYA 4A93J 2YU9J 5JLWA 1JTYA 3BJBA 2UXUA 3H0GJ 4B1RA 1U78A 4A3DJ 5FMPA 4A3CJ 2GENA 4MXMA 1BJZA 2X48A 1MBKA 2ZOZA 3HOZJ 3S2DJ 3BCGA 3GBGA 1E3OC 2WGBA 4G12A 1MH3A 4JX5A 3BR0A 1HCRA 2CQQA 4BBRJ 1T56A 3B6CA 3K7AJ 2L0KA 5M5YJ 3HOUJ 3OIOA 5F08A 2GFNA 2ZCMA 2NVTJ 3WHBA 1G2HA 2CU7A 1XS9A 4IHVA 1D5YA 2DN0A 3VUQA 4Y7NJ 4A3MJ 2FBQA 1RPWA 3S5RA 4DZJA 3PO2J 4RBOA 4UDSA 3ZQGA 5C44J 2K9QA 1HF0A 4MFDA 1JKPC 5C4XJ 4JYKA 2Y9ZA 2WV1A 2JMWA 2EQRA 5AQCA 3NARA 2L7ZA 5J3LA 1B72B 4V2GA 3BNIA 5J1UA 1LFBA 3JRIA 5IP6A 1LE8A 2HDDA 1ORKA 2QIBA 3QKXA 3C07A 3NI7A 3LSRA 5CXGA 5EG0B 1H8AC 3DCFA 4NN1A 1APLC 2VUMJ 2RHAA 3LJLA 1Q1VA 2DA3A 3G7RA 4ME9A 5HSZA 2DA7A 1HOMA 3WHCA 4W1UA 3BR2A 1TWAJ 2Y31A 4JX6A 3CJDA 4XIDA 1U9OA 2H8RA 1WH5A 3RZOJ 3LSGA 1UI6A 2R7ZJ 1Z77A 3VVZA 4A3JJ 3G1LA 2WB1N 2TRTA 3RKQA 1ENHA 3GTPJ 4M6VA 4M3DA 3FISA 3NAUA 5M5WJ 2O9LA 1MBGA 5CW8A 3HOWJ 5E3OA 5FGLA 3HBLA 4AYBN 5IOZA 2G7SA 1P7JA 4LOCA 5K7FA 1VI0A 1QPIA 1RR7A 2M34A 2TCTA 1VFCA 2R93J 3P9TA 5CXIA 4GCTA 3CWRA 5IP7J 2LKXA 4C3JJ 3A03A 1JKRC 2E2JJ 1BL0A 2REKA 4ICHA 3QPLA 3M4OJ 2CUEA 1MSEC 4M3FA 3S2HJ 1IGNA 1FJLA 3LSJA 5M3MJ 5IYBJ 2HI3A 4D5FA 4DYRA 1PUFA 5GPCA 5EEAA 4C3IJ 4S0HB 2QCOA 5F0CA 2ECCA 5IPAA 3A01B 4A3IJ 5EG0A 1WPKA 1ZKGA 2DMQA 2HOAA 3CDLA 2IU5A 2O7OA 1ZQ3P 2R5YA 3GTOJ 4I76A 1JT0A 2DG7A 1W0TA 1AU7A 3BG5A 3JRGA 3S17J 4NELA 3Q0WA 3VW0A 2E19A 3ZQFA 1WCMJ 2Q24A 3BG3A 2FX0A 2R5ZB 1BA5A 2EZLA 3HDDA 3MKLA 4GFKA 1B8IB 3HTIA 2X9DA 2CJJA 2F07A 4IHYA 1HDPA 5HBUA 1FIPA 3IH3A 3Q0VA 3JRAA 1AHDP 1AKHB 1MNMC 3ON4A 4GFLA 3S1NJ 2YS9A 3BQZA 2ZCXA 5FKLA 1IC8A 2ZB9A 1DU6A 2HYTA 4AF5A 2JJ7A 3BR3A 3AQTA 1GT0C 5D1RA 1GDTA 2RAEA 2DMUA 3HB9A 1QVTA 3CQZJ 3G1MA 2JWTA 2IEKA 1F36A 4V2FA 4C3HJ 1SFOJ 3S1QJ 4A3BJ 3HOVJ 4FE7A 2G7LA 2DA4A 1ETQA 2MGQA 3IV5A 1F43A 2FD5A 2GBYA 3HKZN 2G7GA 1TWGJ 4UUSB 3GTLJ 1UG2A 2MG4A 2H1KA 4HNVA 1X2NA 2L7FP 2JA5J 2O8KA 2D6YA 5EGOA 2UXOA 4M3GA 3BTLA 3A01A 2B63J 1POGA 3BR5A 2MW8A 4IHWA 3GTQJ 2HYJA 2DA2A 1Y1VJ 4C2MJ 5DAJA 1MBFA 4XRSG 2DMPA 3TEDA 4DYCA 3PASA 4JKZA 5FHPA 5M3FJ 3GEUA 3EUPA 1SANA 3TP3A 2FJ1A 2PMZN 2P81A 4HKUA 2DA6A 3S14J 2DTZA 3Q0UA 4A3GJ 3F1BA 5EYRA 4A3KJ 1JUPA 2NP3A 4FISA 5IYDJ 1WI3A 2N8GA 2DA5A 4ABZA 3BTCA 2JN6A 2LVSA 2QKOA 2W53A 2VKEA 5DS9A 5FKNA 1FEXA 2XDNA 2XGEA 5FLMJ 5J1YA 1NK3P 5DTDA 4D7NA 1X2MA 3CMYA 1RKTA 3LHQA 3HGYA 2LK2A 1JJ8C 1JKQC 3VPRA 3HTJA 1YRNB 2LFBA 3VW2A 2L9RA 2JA8J 4X6AJ 1RESA 1I3QJ 3V78A 3K2AA 5C4JJ 2GLOA 4D7MA 5FLVA 5K7HA 3F0CA 4IEJA 2Y9YA 2NVQJ 1OCPA 5IP9J 3HIMA 2Y2ZA 1CQTA 3RD3A 1U8BA 2Y30A 3LOCA 3T6NA 2NVXJ 3H3VK 4CYCB 4B3AA 3JREA 4A69C 2AHQA 4MIMA 4IHXA 3ON2A 2OF7A 4QTRA 1MBEA 2EH3A 3FK7A 5EZHA 4AC6A 4NDLA 2ME6A 5E3NA 3SJMA 3PPBA 4A3FJ 4I6ZA 1HDDC 3RQIA 1TWCJ 2Y0SN 2YUSA 4J19A 2UXHA 3ANGA 1IG7A 1NK2P 3O8GA 2LY9A 3S1RJ 2M8GX 1ETYA 1OCTC 4JNNA 3MN2A 2HXIA 3HM5A 3LNQA 2AO9A 5E3LA 1B72A 1ZK8A 2NS8A 4L5EA 4XRSA 3JRHA 2ZOYA 2LR8A 1Z0XA 3I4NJ 2JA7J 3Q3SA 3JSJA 4RDUA 3BG9A 3D1NI 3ZQIA 4EEFG 3HTHA 3IUVA 2VPRA 1VF9A 1A6IA 1MBHA 1IV6A 2K9SA 4GCKA 1JUMA 2XGCA 4JX4A 2DMTA 3IH4A 2IAIA 4DW6A 2XSDC 3COLA 1T33A 4AUXA 1OFCX 3VVXA 3LSPA 5HAWA 1ZTRA 3PM1A 2GM4A 1GVDA 2WAQN 2L7MP 2QOPA 1NTCA 3HOYJ 2HQ5A 1K83J 3DPJA 1YRNA 1RETA 4XICA 3NRGA 5EFYA 1UHSA 3AQSA 3KNWA 1I6HJ 3GTGJ 1LE8B 2NP5A 1IDZA 1ZGWA 2GUHA 3VOXA 2HXOA 2YVHA 4BBSJ 4JL3A 3SDGA 3ZQCA 1JT6A 3FKIJ 1TC3C 1UMQA 5F27A 3UKGA 1VNDA 2DJNA 3ZOBA 4MK6A 1JUSA 4GFBA 3ZQHA 5HODA 3BT9A 2E2IJ 2UXIA 1ETWA 2K9NA 3TW6A 3GTJJ 4X1EA 2LD5A 3RH2A 4ACIA 2RASA 1JKOC 3LWJA 3HEFA 2E1OA 1H89C 5K7ZA 1JGGA 3ZQLA 1BW5A 3NPIA 2XGDA 2CQXA 3GTKJ 1IJWC 4QIWN 3JR9A 3BQYA 3MVPA 1HLVA 5GPAA 3GTMJ 1EF4A 5IOYA 3E7QA 2FQ4A 2HOTA 5GP9A 4BKXA 2I10A 2ELKA 1ETKA 2HOSA 2G3BA 1QRYA 5M5XJ 1O4XA 2COBA 2XPVA 1R9TJ 3A02A 3JRCA 4L62A 3G56A 1GV2A 4GCLA 1P7IA 3JRBA 1JTXA 3L1PA 3KKCA 4B4CA 3RZDJ 2R5ZA 4AC0A 5IYCJ 3IH2A 4A3EJ 3SFIA 1B8IA 3S15J 2HKUA 1IUFA 3BTIA 4UUTA 3S1MJ 2OERA 3KZ9A 2ME0A 4M3BA 2LP0A 1AKHA 3QBMA 2V57A 3EGQA 2PBXA 3C2BA 2EBIA 1X58A 3HOXJ 1ETOA 2M2EA 5F1JA 1PUFB 1FTTA 3HTAA 3O60A 3B81A 2LLKA 4CGRA 3ANPA 1XC5A 4QSHA 5EZGA 1SGMA 4XRMA 5D19A 1QVUA 2JK3A 2VKVA 1ETXA 1S7EA 2X6OA 3MNLA 2R5YB 2D5VA 2QTQA 4BXXJ 4FCYA 3FRQA 3OSGA 2UXPA 3FIWA 2W48A 2DG8A 3TP0A 5BNGA 5J1RA 3CRJA 2ZCNA 2CUFA 5C4YA 2JA6J 5FKOA 2WUIA 2M9HA 3QQAA 3VP5A 1ITYA 4UUSA 4FE4A 2G0EA 3E7LA 3G1OA 3HGGA 4MFEA 1UI5A 2E2HJ 4A3LJ 2QWTA 1MH4A 3B6AA 2LTPA 3TW7A 3OOUA 5H9TA 1BW6A 4DYQA 4BY7J 3I4MJ 5K58A 1GUUA 1ZR2A 2KT0A 2NS7A 3BRUA 1W0UA 3VOKA 1WH7A 5F04A 2EZKA 3NNRA 2ID6A 4W97A 3OSFA 2XPUA 1MBJA 2XRLA 2ID3A 2KDZA 2XPWA 2QF7A 3M3YJ 1WGXA 1FTZA 1U9NA 2CRGA 3VW1A 4XK4A 2EZHA 5FKKA 4PXIA 1TWHJ 4MO7A 1IDYA 1K61A 2R92J 2DMNA 1DU0A 2DA1A 1XG1A 4DZPA 1Y1WJ 2NOGA 2OPTA 4Y52J 1GV5A 3BR6A 5EF6A 3W6VA 4BY1J 5FKMA 2IBDA 1I50J 2OI8A 4MLOA 5F0FA 3HE0A 5EGOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6G A;  3GZI A;  1JJ6 C;  3QPS A;  4YZE A;  2XB5 A;  1LFU P;  3BTJ A;  3S16 J;  3NXC A;  3CCY A;  4FTH A;  3PO3 J;  3BHQ A;  5F0H A;  4KWA A;  2PZ9 A;  2NVY J;  5E3M A;  3JRF A;  2YVE A;  3VVY A;  3VIB A;  4M3E A;  3DEW A;  2K40 A;  1IRZ A;  9ANT A;  3BR1 A;  1TWF J;  3KKD A;  2VI6 A;  3JRD A;  1ZR4 A;  3O8H A;  5C3E J;  1FIA A;  1OJL A;  4CYC A;  2R0Q C;  1A5J A;  2M0C A;  2ECB A;  1ETV A;  1MSF C;  4D5C A;  5FJ8 J;  1RKW A;  2EZI A;  2NX4 A;  2O7T A;  3FK6 A;  5D18 A;  1H88 C;  4JP0 A;  5JLX A;  5EDN A;  2XB0 X;  2MSY A;  4A93 J;  2YU9 J;  5JLW A;  1JTY A;  3BJB A;  2UXU A;  3H0G J;  4B1R A;  1U78 A;  4A3D J;  5FMP A;  4A3C J;  2GEN A;  4MXM A;  1BJZ A;  2X48 A;  1MBK A;  2ZOZ A;  3HOZ J;  3S2D J;  3BCG A;  3GBG A;  1E3O C;  2WGB A;  4G12 A;  1MH3 A;  4JX5 A;  3BR0 A;  1HCR A;  2CQQ A;  4BBR J;  1T56 A;  3B6C A;  3K7A J;  2L0K A;  5M5Y J;  3HOU J;  3OIO A;  5F08 A;  2GFN A;  2ZCM A;  2NVT J;  3WHB A;  1G2H A;  2CU7 A;  1XS9 A;  4IHV A;  1D5Y A;  2DN0 A;  3VUQ A;  4Y7N J;  4A3M J;  2FBQ A;  1RPW A;  3S5R A;  4DZJ A;  3PO2 J;  4RBO A;  4UDS A;  3ZQG A;  5C44 J;  2K9Q A;  1HF0 A;  4MFD A;  1JKP C;  5C4X J;  4JYK A;  2Y9Z A;  2WV1 A;  2JMW A;  2EQR A;  5AQC A;  3NAR A;  2L7Z A;  5J3L A;  1B72 B;  4V2G A;  3BNI A;  5J1U A;  1LFB A;  3JRI A;  5IP6 A;  1LE8 A;  2HDD A;  1ORK A;  2QIB A;  3QKX A;  3C07 A;  3NI7 A;  3LSR A;  5CXG A;  5EG0 B;  1H8A C;  3DCF A;  4NN1 A;  1APL C;  2VUM J;  2RHA A;  3LJL A;  1Q1V A;  2DA3 A;  3G7R A;  4ME9 A;  5HSZ A;  2DA7 A;  1HOM A;  3WHC A;  4W1U A;  3BR2 A;  1TWA J;  2Y31 A;  4JX6 A;  3CJD A;  4XID A;  1U9O A;  2H8R A;  1WH5 A;  3RZO J;  3LSG A;  1UI6 A;  2R7Z J;  1Z77 A;  3VVZ A;  4A3J J;  3G1L A;  2WB1 N;  2TRT A;  3RKQ A;  1ENH A;  3GTP J;  4M6V A;  4M3D A;  3FIS A;  3NAU A;  5M5W J;  2O9L A;  1MBG A;  5CW8 A;  3HOW J;  5E3O A;  5FGL A;  3HBL A;  4AYB N;  5IOZ A;  2G7S A;  1P7J A;  4LOC A;  5K7F A;  1VI0 A;  1QPI A;  1RR7 A;  2M34 A;  2TCT A;  1VFC A;  2R93 J;  3P9T A;  5CXI A;  4GCT A;  3CWR A;  5IP7 J;  2LKX A;  4C3J J;  3A03 A;  1JKR C;  2E2J J;  1BL0 A;  2REK A;  4ICH A;  3QPL A;  3M4O J;  2CUE A;  1MSE C;  4M3F A;  3S2H J;  1IGN A;  1FJL A;  3LSJ A;  5M3M J;  5IYB J;  2HI3 A;  4D5F A;  4DYR A;  1PUF A;  5GPC A;  5EEA A;  4C3I J;  4S0H B;  2QCO A;  5F0C A;  2ECC A;  5IPA A;  3A01 B;  4A3I J;  5EG0 A;  1WPK A;  1ZKG A;  2DMQ A;  2HOA A;  3CDL A;  2IU5 A;  2O7O A;  1ZQ3 P;  2R5Y A;  3GTO J;  4I76 A;  1JT0 A;  2DG7 A;  1W0T A;  1AU7 A;  3BG5 A;  3JRG A;  3S17 J;  4NEL A;  3Q0W A;  3VW0 A;  2E19 A;  3ZQF A;  1WCM J;  2Q24 A;  3BG3 A;  2FX0 A;  2R5Z B;  1BA5 A;  2EZL A;  3HDD A;  3MKL A;  4GFK A;  1B8I B;  3HTI A;  2X9D A;  2CJJ A;  2F07 A;  4IHY A;  1HDP A;  5HBU A;  1FIP A;  3IH3 A;  3Q0V A;  3JRA A;  1AHD P;  1AKH B;  1MNM C;  3ON4 A;  4GFL A;  3S1N J;  2YS9 A;  3BQZ A;  2ZCX A;  5FKL A;  1IC8 A;  2ZB9 A;  1DU6 A;  2HYT A;  4AF5 A;  2JJ7 A;  3BR3 A;  3AQT A;  1GT0 C;  5D1R A;  1GDT A;  2RAE A;  2DMU A;  3HB9 A;  1QVT A;  3CQZ J;  3G1M A;  2JWT A;  2IEK A;  1F36 A;  4V2F A;  4C3H J;  1SFO J;  3S1Q J;  4A3B J;  3HOV J;  4FE7 A;  2G7L A;  2DA4 A;  1ETQ A;  2MGQ A;  3IV5 A;  1F43 A;  2FD5 A;  2GBY A;  3HKZ N;  2G7G A;  1TWG J;  4UUS B;  3GTL J;  1UG2 A;  2MG4 A;  2H1K A;  4HNV A;  1X2N A;  2L7F P;  2JA5 J;  2O8K A;  2D6Y A;  5EGO A;  2UXO A;  4M3G A;  3BTL A;  3A01 A;  2B63 J;  1POG A;  3BR5 A;  2MW8 A;  4IHW A;  3GTQ J;  2HYJ A;  2DA2 A;  1Y1V J;  4C2M J;  5DAJ A;  1MBF A;  4XRS G;  2DMP A;  3TED A;  4DYC A;  3PAS A;  4JKZ A;  5FHP A;  5M3F J;  3GEU A;  3EUP A;  1SAN A;  3TP3 A;  2FJ1 A;  2PMZ N;  2P81 A;  4HKU A;  2DA6 A;  3S14 J;  2DTZ A;  3Q0U A;  4A3G J;  3F1B A;  5EYR A;  4A3K J;  1JUP A;  2NP3 A;  4FIS A;  5IYD J;  1WI3 A;  2N8G A;  2DA5 A;  4ABZ A;  3BTC A;  2JN6 A;  2LVS A;  2QKO A;  2W53 A;  2VKE A;  5DS9 A;  5FKN A;  1FEX A;  2XDN A;  2XGE A;  5FLM J;  5J1Y A;  1NK3 P;  5DTD A;  4D7N A;  1X2M A;  3CMY A;  1RKT A;  3LHQ A;  3HGY A;  2LK2 A;  1JJ8 C;  1JKQ C;  3VPR A;  3HTJ A;  1YRN B;  2LFB A;  3VW2 A;  2L9R A;  2JA8 J;  4X6A J;  1RES A;  1I3Q J;  3V78 A;  3K2A A;  5C4J J;  2GLO A;  4D7M A;  5FLV A;  5K7H A;  3F0C A;  4IEJ A;  2Y9Y A;  2NVQ J;  1OCP A;  5IP9 J;  3HIM A;  2Y2Z A;  1CQT A;  3RD3 A;  1U8B A;  2Y30 A;  3LOC A;  3T6N A;  2NVX J;  3H3V K;  4CYC B;  4B3A A;  3JRE A;  4A69 C;  2AHQ A;  4MIM A;  4IHX A;  3ON2 A;  2OF7 A;  4QTR A;  1MBE A;  2EH3 A;  3FK7 A;  5EZH A;  4AC6 A;  4NDL A;  2ME6 A;  5E3N A;  3SJM A;  3PPB A;  4A3F J;  4I6Z A;  1HDD C;  3RQI A;  1TWC J;  2Y0S N;  2YUS A;  4J19 A;  2UXH A;  3ANG A;  1IG7 A;  1NK2 P;  3O8G A;  2LY9 A;  3S1R J;  2M8G X;  1ETY A;  1OCT C;  4JNN A;  3MN2 A;  2HXI A;  3HM5 A;  3LNQ A;  2AO9 A;  5E3L A;  1B72 A;  1ZK8 A;  2NS8 A;  4L5E A;  4XRS A;  3JRH A;  2ZOY A;  2LR8 A;  1Z0X A;  3I4N J;  2JA7 J;  3Q3S A;  3JSJ A;  4RDU A;  3BG9 A;  3D1N I;  3ZQI A;  4EEF G;  3HTH A;  3IUV A;  2VPR A;  1VF9 A;  1A6I A;  1MBH A;  1IV6 A;  2K9S A;  4GCK A;  1JUM A;  2XGC A;  4JX4 A;  2DMT A;  3IH4 A;  2IAI A;  4DW6 A;  2XSD C;  3COL A;  1T33 A;  4AUX A;  1OFC X;  3VVX A;  3LSP A;  5HAW A;  1ZTR A;  3PM1 A;  2GM4 A;  1GVD A;  2WAQ N;  2L7M P;  2QOP A;  1NTC A;  3HOY J;  2HQ5 A;  1K83 J;  3DPJ A;  1YRN A;  1RET A;  4XIC A;  3NRG A;  5EFY A;  1UHS A;  3AQS A;  3KNW A;  1I6H J;  3GTG J;  1LE8 B;  2NP5 A;  1IDZ A;  1ZGW A;  2GUH A;  3VOX A;  2HXO A;  2YVH A;  4BBS J;  4JL3 A;  3SDG A;  3ZQC A;  1JT6 A;  3FKI J;  1TC3 C;  1UMQ A;  5F27 A;  3UKG A;  1VND A;  2DJN A;  3ZOB A;  4MK6 A;  1JUS A;  4GFB A;  3ZQH A;  5HOD A;  3BT9 A;  2E2I J;  2UXI A;  1ETW A;  2K9N A;  3TW6 A;  3GTJ J;  4X1E A;  2LD5 A;  3RH2 A;  4ACI A;  2RAS A;  1JKO C;  3LWJ A;  3HEF A;  2E1O A;  1H89 C;  5K7Z A;  1JGG A;  3ZQL A;  1BW5 A;  3NPI A;  2XGD A;  2CQX A;  3GTK J;  1IJW C;  4QIW N;  3JR9 A;  3BQY A;  3MVP A;  1HLV A;  5GPA A;  3GTM J;  1EF4 A;  5IOY A;  3E7Q A;  2FQ4 A;  2HOT A;  5GP9 A;  4BKX A;  2I10 A;  2ELK A;  1ETK A;  2HOS A;  2G3B A;  1QRY A;  5M5X J;  1O4X A;  2COB A;  2XPV A;  1R9T J;  3A02 A;  3JRC A;  4L62 A;  3G56 A;  1GV2 A;  4GCL A;  1P7I A;  3JRB A;  1JTX A;  3L1P A;  3KKC A;  4B4C A;  3RZD J;  2R5Z A;  4AC0 A;  5IYC J;  3IH2 A;  4A3E J;  3SFI A;  1B8I A;  3S15 J;  2HKU A;  1IUF A;  3BTI A;  4UUT A;  3S1M J;  2OER A;  3KZ9 A;  2ME0 A;  4M3B A;  2LP0 A;  1AKH A;  3QBM A;  2V57 A;  3EGQ A;  2PBX A;  3C2B A;  2EBI A;  1X58 A;  3HOX J;  1ETO A;  2M2E A;  5F1J A;  1PUF B;  1FTT A;  3HTA A;  3O60 A;  3B81 A;  2LLK A;  4CGR A;  3ANP A;  1XC5 A;  4QSH A;  5EZG A;  1SGM A;  4XRM A;  5D19 A;  1QVU A;  2JK3 A;  2VKV A;  1ETX A;  1S7E A;  2X6O A;  3MNL A;  2R5Y B;  2D5V A;  2QTQ A;  4BXX J;  4FCY A;  3FRQ A;  3OSG A;  2UXP A;  3FIW A;  2W48 A;  2DG8 A;  3TP0 A;  5BNG A;  5J1R A;  3CRJ A;  2ZCN A;  2CUF A;  5C4Y A;  2JA6 J;  5FKO A;  2WUI A;  2M9H A;  3QQA A;  3VP5 A;  1ITY A;  4UUS A;  4FE4 A;  2G0E A;  3E7L A;  3G1O A;  3HGG A;  4MFE A;  1UI5 A;  2E2H J;  4A3L J;  2QWT A;  1MH4 A;  3B6A A;  2LTP A;  3TW7 A;  3OOU A;  5H9T A;  1BW6 A;  4DYQ A;  4BY7 J;  3I4M J;  5K58 A;  1GUU A;  1ZR2 A;  2KT0 A;  2NS7 A;  3BRU A;  1W0U A;  3VOK A;  1WH7 A;  5F04 A;  2EZK A;  3NNR A;  2ID6 A;  4W97 A;  3OSF A;  2XPU A;  1MBJ A;  2XRL A;  2ID3 A;  2KDZ A;  2XPW A;  2QF7 A;  3M3Y J;  1WGX A;  1FTZ A;  1U9N A;  2CRG A;  3VW1 A;  4XK4 A;  2EZH A;  5FKK A;  4PXI A;  1TWH J;  4MO7 A;  1IDY A;  1K61 A;  2R92 J;  2DMN A;  1DU0 A;  2DA1 A;  1XG1 A;  4DZP A;  1Y1W J;  2NOG A;  2OPT A;  4Y52 J;  1GV5 A;  3BR6 A;  5EF6 A;  3W6V A;  4BY1 J;  5FKM A;  2IBD A;  1I50 J;  2OI8 A;  4MLO A;  5F0F A;  3HE0 A;  5EGO B; 
#chains in the Genus database with same CATH topology
 3QPS A;  3VSL A;  2XB5 A;  4YZE A;  4NBQ A;  2DT7 B;  4FTH A;  3BHQ A;  4DBR A;  4KWA A;  5E3M A;  1N78 A;  2YVE A;  5ILV A;  5HDG A;  2TDX A;  2ZSI B;  1IRZ A;  4BE1 A;  4DVY P;  1F5T A;  3JW4 A;  1YW9 A;  4CCJ A;  2DXI A;  4BQO A;  4NB5 A;  1YLF A;  2PJR A;  2B9S A;  3LA7 A;  3V8K A;  2V6E A;  1EA3 A;  3J7Z I;  3MAJ A;  3RI4 A;  1OR7 C;  4ON0 A;  3AAF A;  2PMU A;  4JOM A;  4XLP F;  5D18 A;  1RUO A;  2K3P A;  3BWG A;  2MSY A;  2CW8 A;  2A5W A;  1Y6I A;  5LHH A;  2HNH A;  1IN5 A;  4B1R A;  1U78 A;  4A3D J;  2ZOZ A;  1MBK A;  1ON1 A;  3I53 A;  3S2D J;  2ADU A;  2ZXJ A;  3BCG A;  1BM9 A;  2JA2 A;  3UR3 C;  4G12 A;  3HOT A;  2EFP A;  1BJA A;  3CP8 A;  1HCR A;  4OU0 A;  4BBR J;  1T56 A;  3K7A J;  3J80 K;  3F21 A;  3OIO A;  2M45 A;  2XF6 A;  2CUJ A;  3WHB A;  3VYR B;  2KZG A;  3HL2 A;  3VWB A;  3U9G A;  3BJO A;  4Q47 A;  3VUQ A;  1R1T A;  2ZKZ A;  4IX7 A;  2VT3 A;  1TTY A;  3R0A A;  4JK1 X;  1B9N A;  4PJ0 C;  3PO2 J;  3RCO A;  2J5O A;  4PZJ A;  4B8X A;  2K9Q A;  1HF0 A;  5C4X J;  1TT5 B;  1Z7U A;  1MMA A;  2DQL A;  3EUK L;  3BZ6 A;  4LD5 A;  4NC6 A;  3GZN B;  4JYK A;  4NC7 A;  1OCZ H;  1U2W A;  1YJ9 I;  4V2G A;  3BNI A;  1BC8 C;  1LFB A;  3E5X A;  3F8B A;  4LB5 A;  3RPU D;  3ZN0 A;  3BCA A;  2JRM A;  3NI7 A;  3G3Z A;  3QAH A;  3L9F A;  3LSR A;  1SMT A;  3JTG A;  2IGM A;  2K86 A;  5EG0 B;  2VKH A;  3KP3 A;  1H8A C;  1KU9 A;  2E1N A;  3K4M A;  4N9H A;  1VQ9 I;  3I59 B;  1IXC A;  2A6T A;  3E0J B;  5LRR A;  2VUM J;  1FMV A;  4CCO A;  5TIS C;  5LLQ A;  4G6D A;  3CJD A;  5HOO A;  1U9O A;  3L2R A;  3D0S A;  4A12 A;  2H8R A;  1WH5 A;  2EV0 A;  3LSG A;  3G2B A;  1WSU A;  2DOE A;  4E7I A;  1Z21 A;  1XMA A;  3G1L A;  4HW0 A;  3VDX A;  2WB1 N;  3A0H C;  3RKQ A;  3FM3 A;  2V79 A;  5LGN A;  1J7K A;  4M3D A;  2R7O A;  4IXA A;  2WTE A;  2VE8 A;  2Y69 H;  5FB2 A;  3E6M A;  3F9K A;  5L3C A;  2LDU A;  2C6Y A;  3LSM A;  4LFU A;  5FGL A;  1U5T C;  4NUB A;  4U0V A;  2HZT A;  3WTY C;  2QZ8 A;  2OJE D;  1W7P A;  5H6Q A;  3GYH X;  1QPI A;  3ZCO A;  1T38 A;  2QQ9 A;  3C3W A;  4UV8 A;  4G94 A;  1J0R A;  2LMD A;  1HKT A;  2LKX A;  3A03 A;  5FD5 A;  2REK A;  3QPL A;  4M3F A;  3BZK A;  4R1H A;  1ONV A;  2JT1 A;  2O3F A;  5IYB J;  4UVB A;  4D5F A;  1O3Q A;  3H5A A;  4XLE A;  1QA6 A;  1G3S A;  4S0H B;  4DJA A;  5D5W B;  1ZH5 A;  2QCO A;  5F0C A;  1K78 B;  2R7W A;  5IPA A;  1ZKG A;  3CDL A;  3HOS A;  2DTR A;  2VIX A;  2M4G A;  4GDF A;  1XMX A;  2CSO A;  2PBI A;  1W0T A;  3M1E A;  3ZMZ A;  1R1V A;  4ESB A;  1BIA A;  3Q0W A;  5GAE J;  1P6R A;  3ZQF A;  5J47 A;  2PJP A;  3IHU A;  1GHC A;  3HDD A;  4EM0 B;  5HLH A;  4I02 A;  4IHY A;  2DOD A;  1HDP A;  1H9G A;  5BMZ A;  3CUQ B;  3JRA A;  4HF1 A;  1AKH B;  4GFL A;  4E7S A;  3FKJ A;  3J81 Z;  2NOJ B;  1IXR C;  4OMY A;  1DU6 A;  2NYX A;  3OYA A;  4AF5 A;  2MD5 A;  4L18 B;  2Z1D A;  2VON A;  4MQ9 F;  2DFH A;  3HRU A;  1WKM A;  1GDT A;  3HHG A;  2KDO A;  2DMU A;  2P5K A;  3M8J A;  1QVT A;  2IEK A;  1SFO J;  1R7J A;  1SAU A;  3PUB A;  2VL8 A;  3L2C A;  3VW2 A;  5K1Y A;  2P4W A;  2GBY A;  3HKZ N;  3A4C A;  3KP5 A;  3T0Y A;  1UG2 A;  3KEY A;  2DPD A;  2V1X A;  4WXC A;  2O6G E;  1G3W A;  2O8K A;  3KYC B;  4DGW B;  3J7A Y;  2UXO A;  3QWL A;  3K1N A;  2W85 A;  1POG A;  2MW8 A;  1X1P A;  2DA2 A;  1QU3 A;  1Y1V J;  1MDM B;  5DAJ A;  2HR3 A;  4XN0 A;  1YOV B;  3DQV C;  1MZB A;  4BHC A;  1MBF A;  2MH9 A;  2XUB A;  4RGX A;  2IXS A;  3CJN A;  3PAS A;  1SFE A;  2M8E A;  4OAZ A;  4F55 A;  4E7K A;  3ERM A;  4JKZ A;  5M3F J;  2IA2 A;  2AXL A;  2CYY A;  4BS9 A;  4OD5 A;  1MND A;  2HFH A;  2MC4 A;  3KE2 A;  1NH3 A;  1B59 A;  2P81 A;  4P96 A;  5HLT A;  3S14 J;  2DTZ A;  4A3G J;  2XAG A;  1TW3 A;  3T1B A;  2FOK A;  3QOD A;  4EM2 A;  4CCL A;  1DGR M;  4C2U A;  5LBQ A;  3FMQ A;  2DA5 A;  3BTC A;  4EAT A;  1X19 A;  5LD2 C;  2DFI A;  2QKO A;  2W53 A;  2VKE A;  5DS9 A;  2XAF A;  1CF7 A;  2STT A;  2XDN A;  4C2T A;  2OCE A;  2QWW A;  5DTD A;  4D7N A;  5HDN A;  3LL7 A;  1X2M A;  2K4J A;  3OY9 A;  2ISY A;  4EJW A;  3QYF A;  1TW2 A;  3CUO A;  3HGY A;  2DYS H;  3TDU C;  4KIF A;  4CYD A;  5D6F A;  3K4N A;  4KIT B;  2JA8 J;  3D5S C;  3SWH A;  1FMW A;  3DKX A;  3WGH A;  5FRM A;  1RES A;  3C18 A;  3CDI A;  3F0C A;  2ICW G;  1OCP A;  2LG4 A;  1ERD A;  2PFV A;  3SEQ A;  5H2F C;  3SEZ A;  1OIS A;  5KK1 A;  4BNC A;  1ZG3 A;  4U7B A;  3OOP A;  2R7X A;  1YX3 A;  3RYR A;  1ZAO A;  2BXZ A;  3Q5F A;  2L5Q A;  1MNE A;  1R4N B;  4LK0 F;  4NDL A;  3S32 A;  3M8E A;  1QPM A;  5E3N A;  3OYH A;  5DUI A;  2BW3 A;  5DUK A;  1HDD C;  2QQ8 A;  1D5V A;  3H36 A;  3OIP A;  2OD5 A;  3ANG A;  2KMU A;  2ZXW H;  2LC2 A;  2H6B A;  3S1R J;  4Y15 A;  3TGN A;  2M8G X;  1HW1 A;  2MLG A;  3MN2 A;  1Z6T A;  3HM5 A;  1B72 A;  4AVP A;  1DPR A;  2FML A;  3IRQ A;  4BDZ A;  3H0D A;  2H8W A;  4XRS A;  3JRH A;  3WU2 C;  4FX4 A;  1GXP A;  2HYF A;  3Q3S A;  4L9N A;  4RDU A;  3D1N I;  3ZQI A;  4HX7 A;  3T8T A;  2KPM A;  3LAP A;  1T2K A;  1A6I A;  2D1H A;  2K9S A;  3F8M A;  4WX9 A;  3IH4 A;  4CXF A;  4PJN A;  3I54 A;  2ZNZ A;  2XSD C;  1IN4 A;  1T33 A;  2Z33 A;  3WE2 A;  1N75 A;  4DBQ A;  3LSP A;  1IN6 A;  3KP7 A;  2FU4 A;  1K83 J;  3IAS 2;  1YRN A;  1NG6 A;  4PCQ A;  3K69 A;  4PDK A;  5GTI C;  1KQ0 A;  2NP5 A;  2VJJ A;  3O3K A;  1ZGW A;  2CFO A;  2GUH A;  2HXO A;  2CQN A;  3SDG A;  3H9Q A;  1JT6 A;  1UMQ A;  4P9F A;  4J00 A;  4ZDL A;  4FET A;  4G7Z F;  2FA5 A;  4Z6Y A;  3LSH A;  1S9H A;  2VE9 A;  2E2I J;  2IVM A;  3CCU I;  2CQ7 A;  3TQN A;  4CA0 A;  3CC4 I;  3T8R A;  3LWJ A;  3S3M A;  3NPI A;  1WI9 A;  3HTU A;  4OOI A;  4ZYD A;  3JR9 A;  2IGK A;  2F48 A;  2IS4 A;  4LK1 F;  3R6S A;  4LLG F;  4OWR B;  3KP4 A;  2MYS A;  2Q8K A;  3KIO A;  4NQW B;  4P9U A;  3A02 A;  2JSP A;  3G56 A;  3E97 A;  4GCL A;  5GAG J;  2EFQ A;  1KQ9 A;  5B3S H;  3KKC A;  4AC0 A;  2X1E A;  2LYC A;  4A5M A;  1B8I A;  4U0W A;  3S3N A;  2HKU A;  1IUF A;  3KZ9 A;  1Y8R B;  1BI0 A;  1FOY A;  4TV7 A;  2KIQ A;  4A0X A;  3CCR I;  2BYV E;  4WIB A;  1HA8 A;  2X4H A;  2VC0 A;  3EGQ A;  1YI2 I;  3JSO A;  3PNY A;  2PBX A;  3HTA A;  5J8F A;  4ESJ A;  2WY7 Q;  2QSH X;  2FJI 1;  3B81 A;  2QKM B;  3EDP A;  2DK8 A;  2EFW A;  2Y48 A;  2EPF A;  4QSH A;  5LRS A;  3OWT A;  1TP4 A;  1BBY A;  3LA3 A;  5D19 A;  3DPU A;  4E7L A;  2VPL A;  4I0B A;  4HST A;  2CWE A;  2X6O A;  2BVM A;  4L5J A;  2QTQ A;  4B3X A;  5J4Y A;  4R79 A;  4FCY A;  2DJI A;  3U2R A;  3FRQ A;  2UXP A;  2D1V A;  3E6D A;  3FIW A;  4EV0 A;  3TP0 A;  5HS8 A;  3FBI B;  4D1Q A;  3RYP A;  1PDN C;  3CRJ A;  1Y8Q B;  4ITV A;  3HPG A;  2WAD A;  4RS8 A;  2KIS A;  2KIU A;  2L3D A;  2V6C A;  2E34 A;  5GAD J;  3VP5 A;  4UUS A;  4FE4 A;  2O8X A;  3HYI A;  3G1O A;  3H3Z A;  3MFK A;  2E2H J;  4A3L J;  4RM3 A;  2QWT A;  1XX5 A;  1ODD A;  5DD8 A;  3HG9 A;  3TW7 A;  1BW6 A;  2EIK H;  4BU2 A;  4DYQ A;  2OQR A;  3LQR A;  4EVI A;  4ZTF A;  1G59 A;  3KX2 A;  3EUH C;  5K58 A;  4XQF A;  3REO A;  4ZZD A;  4G7H F;  3CO6 C;  4U88 A;  2EZK A;  2ID6 A;  4W97 A;  3S8P A;  2R4G A;  2KDZ A;  2XPW A;  3HUG A;  3U21 A;  2Q2E A;  3K70 C;  4G7O F;  4XK4 A;  1HQC A;  1K61 A;  2L02 A;  3MZH A;  1DU0 A;  5CJ9 A;  2ZME A;  5F1R A;  3LST A;  3WGG A;  2P6S A;  1A6Q A;  3BZC A;  3L2V A;  3OV8 A;  4ZDO A;  1LDK B;  3BR6 A;  3G73 A;  5EF6 A;  3W6V A;  1W1W E;  3CLO A;  2IBD A;  4I09 A;  5HNF A;  4HF2 A;  2BY0 A;  2LY2 A;  1WJF A;  3HE0 A;  5EGO B;  3GZI A;  1JJ6 C;  4BE2 A;  4M9Z A;  1S7O A;  1LFU P;  3NXC A;  2RNJ A;  5GTH C;  3S16 J;  3E5Q A;  4BGD A;  3D5L A;  3SYT A;  5F0H A;  1U0J A;  1RUN A;  5J40 A;  3JRF A;  2PX9 A;  2CG4 A;  2BXY A;  4M72 A;  5E18 F;  3R61 A;  4BEH B;  1R5H A;  2QBY B;  2K40 A;  3IL2 A;  2O0Y A;  4B48 A;  1T39 A;  9ANT A;  4MHG A;  1KON A;  2DO7 A;  3O8H A;  5L3F A;  1FIA A;  4RGS A;  4G6Q A;  2R0Q C;  2MLK A;  1MSF C;  3QYE A;  4XOT A;  2W25 A;  1SAX A;  2NNY A;  3BOQ A;  2ZJP F;  1J75 A;  2OTL I;  2O7T A;  1R1U A;  5BOX A;  2DAO A;  1R23 A;  1P2F A;  3MD2 A;  2BE5 F;  2XB0 X;  5JLX A;  3PQJ A;  5JLW A;  1JTY A;  2WY8 Q;  5FLX Z;  3GCM A;  2ESN A;  1KU7 A;  2X48 A;  3P9I A;  3DBL B;  4Y3O A;  1REP C;  2W7N A;  3GBG A;  1HXD A;  1C0W A;  3ESW B;  4ESF A;  4L9J A;  3ASN H;  1MKM A;  3OS0 A;  2ISZ A;  3ZP5 A;  4EQQ A;  4BE0 A;  1S8N A;  2L0K A;  1QNT A;  5F08 A;  1VQ4 I;  2XF7 A;  1G8X A;  3RQ4 A;  1XS9 A;  4IHV A;  1D5Y A;  2DN0 A;  1ZLJ A;  2K3F A;  3CF5 F;  4A3M J;  2FBQ A;  3DF8 A;  2ESH A;  5IT9 Z;  5CLS A;  1YW7 A;  2F5V A;  5ILS A;  2V7F A;  2QGU A;  1B1B A;  4UDS A;  3ZQG A;  2E36 A;  3JCU C;  1I39 A;  4MFD A;  1R5G A;  4XKB A;  1IN8 A;  4U0Y A;  2Y9Z A;  2WV1 A;  3X2Q H;  1X3W B;  1V5F A;  2M1B A;  2HDC A;  3CTA A;  2GXB A;  2GIV A;  1IXS B;  4YG2 F;  3JRI A;  1OMI A;  1LE8 A;  4MQV A;  3C07 A;  4HA8 A;  3GWZ A;  1PJR A;  4ZZL A;  1TNS A;  2VQG A;  2CV1 A;  4CZZ A;  1V5E A;  1MJ9 A;  3OYM A;  1APL C;  1Z3Y A;  2RHA A;  3LJL A;  3DFG A;  5FO5 A;  1O3S A;  1XMK A;  5CYV A;  3TBI A;  2UXX A;  4IRG A;  5BPD A;  4ME9 A;  2H27 A;  1HOM A;  5H20 A;  1FP2 A;  1LFP A;  4OIN F;  1TWA J;  1LJ9 A;  2Y31 A;  2FOW A;  1WHU A;  4OD4 A;  5F6F A;  3RZO J;  1OYW A;  2F2E A;  2PMZ A;  4LLN A;  1R36 A;  3SZP A;  2HVS A;  4DNC A;  5LEJ A;  3GTP J;  3A2K A;  4I99 C;  2IA0 A;  3FIS A;  3ABL H;  3VFZ A;  3U1D A;  1MBG A;  2B3W A;  3HOW J;  2YVX A;  4M6X A;  5E3O A;  2H1L A;  3P9K A;  3HBL A;  2G7S A;  1MMN A;  2W00 A;  4LOC A;  2LBF A;  3KLO A;  4AWX B;  2TCT A;  2M34 A;  2R93 J;  4N9I A;  3SHF A;  3BDD A;  1HKQ A;  4Y17 A;  3TO7 A;  2R7T A;  5IP7 J;  1L0O C;  1I1S A;  2R7D A;  4C3J J;  1X4O A;  1BL0 A;  1A31 A;  3J7Y J;  4ICH A;  2R7V A;  3K2Z A;  4AIJ A;  1YJW I;  3BCB A;  3S2H J;  1OYY A;  2MH2 A;  1PP7 U;  1D3Y A;  3LSJ A;  3ABT A;  3VEP A;  3GLL A;  1VQK I;  2IW5 A;  1S6L A;  1SMY F;  2R7S A;  1LUJ B;  4V19 K;  2BGC A;  4M74 A;  1HC8 A;  1JGS A;  2ELJ A;  4HZF A;  3MZ8 A;  1G6N A;  4KT6 A;  2ECC A;  5H6R A;  3A01 B;  5EG0 A;  4RA2 A;  3JSP A;  2IU5 A;  5D5U B;  3GTO J;  4I76 A;  1JT0 A;  1LKX A;  1AU7 A;  3D5R C;  3OYD A;  2V9K A;  3ISP A;  2JTV A;  3ZXS A;  1J09 A;  2OV7 A;  5D8L B;  2FX0 A;  4LG0 B;  1TQP A;  3CLQ A;  1FZP B;  1WJB A;  1ZEL A;  3MKL A;  2DYR H;  4KIC A;  2X0L A;  5DCM A;  4GFK A;  3I9V 2;  5E8G A;  2XRN A;  2F07 A;  2KRH A;  2YSR A;  3FHZ A;  1ZLK A;  5ICC A;  5TRD A;  3H92 A;  1YFH A;  1RRJ A;  4XRF A;  1SVM A;  5HBU A;  1FIP A;  1LDD A;  3IH3 A;  3Q0V A;  3J81 K;  3W2W A;  1MNM C;  3M8F A;  4E7Z A;  2CW0 F;  3S1N J;  4BH9 A;  2X6X A;  3CMM A;  1LDJ A;  1KGS A;  2ZB9 A;  1XN7 A;  5K5R A;  5D1R A;  3GFL A;  3PIP F;  1XGS A;  1VQ5 I;  2HQA A;  1XTA A;  3OIQ A;  3HB9 A;  2L2O A;  3G1M A;  4V2F A;  1F36 A;  4A3B J;  4KUM A;  4M9X A;  5ICG A;  3WGI A;  1D1B A;  1WFX A;  4FE7 A;  2G7L A;  2RQQ A;  1WQ2 A;  2DA4 A;  2KQR A;  2MGQ A;  2FBK A;  4U87 A;  3OS2 A;  5L3B A;  1DQU A;  2MC3 A;  2MG4 A;  1TQI A;  2FEZ A;  4LLL A;  4YFN F;  2L7F P;  2LRD A;  3OYB A;  3I55 I;  3MCZ A;  2XAJ A;  4KN4 X;  5FFZ A;  2QVO A;  4M3G A;  1PVE A;  1FWZ A;  3BTL A;  2B63 J;  2F4M B;  4HLY A;  2JRT A;  3AL0 B;  4IHW A;  1F1Z A;  2DOF A;  2HYJ A;  3GTQ J;  2RRE A;  2ZXI A;  2O5R A;  1FOX A;  4C2M J;  2DU9 A;  4RAG A;  5ICE A;  1ZRE A;  1AA7 A;  2HWV A;  2CS3 A;  4FAS D;  4XKC A;  3FXQ A;  3GEU A;  1S72 I;  3QPT A;  3EUP A;  1XSV A;  3G71 I;  2RKH A;  3AL0 C;  5BPI A;  3QRF F;  2DA6 A;  5FRN A;  3KET A;  5EYR A;  1JUP A;  4FIS A;  3CUQ A;  5AON A;  4RAF A;  2AQF A;  2V26 A;  3FMR A;  5D4S A;  5IYD J;  2ZJ2 A;  3COA C;  3FXR A;  2JN6 A;  1KQ8 A;  2XGE A;  1MGT A;  1U5T B;  5J1Y A;  5FLM J;  1NK3 P;  2DPU A;  1XGO A;  2FQ3 A;  2LK2 A;  1JJ8 C;  4L5I A;  3KLN A;  3HTJ A;  3GZ6 A;  1XB4 A;  4L0Y B;  3HXL A;  4B47 A;  2HQN A;  3CC7 I;  4EJT A;  4X6A J;  4UB8 C;  1RNL A;  3K2A A;  3KYD B;  5C4J J;  4D7M A;  2RN7 A;  2Y9Y A;  3BJA A;  2XKP A;  3KCC A;  1CQT A;  1DPU A;  6PAX A;  3FXM A;  3JRE A;  3ZQ7 A;  3K6G A;  3VYU B;  3OS1 A;  1VTN C;  2L9V A;  4M6Y A;  1WWX A;  4HDU A;  4UY8 I;  2XAQ A;  5EZH A;  3SJM A;  4I6Z A;  1LQ1 A;  3E5U A;  2Y0S N;  5CVU A;  2UXH A;  1IG7 A;  1NK2 P;  3O8G A;  1OCT C;  2HXI A;  5KNL A;  1S7A A;  1D0Z A;  2AQE A;  2OQG A;  4HPQ A;  3OL4 A;  3TOB A;  4C9Y A;  1K4T A;  2NAZ A;  3I4P A;  2ZOY A;  1Z0X A;  1JHF A;  3DXJ F;  2G7U A;  4XKW A;  2BY1 A;  4EEF G;  2CUZ A;  3CJQ B;  3MMY B;  2ZJR F;  3RSN A;  4KNY A;  4PSW A;  1JUM A;  4JX4 A;  2DMT A;  3IKV A;  2BZT A;  3SXY A;  2KIM A;  4J01 A;  1SD6 A;  1OFC X;  1VQ8 I;  1FSH A;  2GOX B;  2KZV A;  3PM1 A;  5CQE A;  2WAQ N;  3V42 A;  5E17 F;  1XCV A;  1ZGA A;  4EGY A;  1NTC A;  1VQN I;  1Z1D A;  2E5Z A;  4RB2 C;  1UG0 A;  2F4I A;  3DPL C;  4RGR A;  4XIC A;  1DDN A;  2LOO A;  1FSE A;  2NRA C;  3GTG J;  3NWT A;  1BC7 C;  5D5X B;  5K5Q A;  5E1X A;  3NQO A;  3VOX A;  3AG1 H;  3F3X A;  4BBS J;  3ZQC A;  2YVH A;  4M73 A;  2Z16 A;  5JR3 A;  3UKG A;  3ZN1 A;  2ZO4 A;  4XNF A;  3ZOB A;  4L0Z B;  1X4P A;  2CFX A;  2A05 A;  3GX4 X;  5J8C A;  2UXI A;  4BAC A;  3GTJ J;  2EV5 A;  3RH2 A;  4ACI A;  2RAS A;  3GUD A;  1JKO C;  3HEF A;  1RIO H;  2VJI A;  5DD4 A;  3DLA A;  3ZQL A;  2BY3 A;  3R0J A;  3DU5 A;  3VYS B;  1W5S A;  1HSJ A;  1YHQ I;  4I7H A;  5GPA A;  3ABK H;  5IOY A;  5ILU A;  3ERE D;  1XGN A;  3WU1 B;  2EA2 A;  2QQB A;  4XSZ F;  2G3B A;  1QRY A;  3WE3 A;  5KAF C;  4AIK A;  4YRV A;  2XPV A;  1R9T J;  1IF1 A;  4XR6 A;  1JTX A;  3CJR B;  1X3U A;  4HV5 A;  3L1P A;  1S3J A;  1W7P B;  3RZD J;  2R7U A;  2A6H F;  2R5Z A;  2KIF A;  5FGM A;  3ZMS A;  1YO5 C;  3IH2 A;  1B9M A;  1P4X A;  3WG7 H;  3SFI A;  3S15 J;  2FRH A;  3BTI A;  1FYM A;  4KYW A;  3DEE A;  2L54 A;  4OAY A;  3CJT B;  3OYE A;  2ME0 A;  4ZYA A;  1UST A;  2IJL A;  4GYG A;  1SFK A;  1XDU A;  2K9M A;  2QSG X;  1O57 A;  5GAH J;  4Q5S F;  1FTT A;  3A1Y A;  2GXA A;  1TZL A;  4ZC3 A;  2M5W A;  4RB3 C;  3BP8 A;  2LLK A;  4CGR A;  2I8D A;  1XC5 A;  3OYK A;  3KZZ A;  4E70 A;  4UVA A;  1WJD A;  1E3P A;  1BIB A;  4XRM A;  2K02 A;  1R58 A;  2K85 A;  5CVJ A;  3ABU A;  5HLG A;  4CDG A;  2HVQ A;  2W48 A;  1KU3 A;  4IHS A;  2VN2 A;  4QPO A;  4KN7 X;  2CUF A;  1PP8 F;  2RV8 A;  5C4Y A;  1WVR A;  3CCQ I;  4BXU A;  1V5G A;  2WUI A;  3QQA A;  1ITY A;  3CD6 I;  1L3L A;  3HGG A;  2CH0 A;  4MFE A;  1UI5 A;  5EJC A;  2IA1 A;  1P4W A;  1MH4 A;  3B6A A;  1G3T A;  3RIR A;  4FQG A;  3BG6 A;  2E7X A;  4NQW A;  3WOD F;  1U8R A;  2QLZ A;  1WH7 A;  5F04 A;  5E1W A;  3FXJ A;  3ZMT A;  4IOA F;  4MEX F;  3NNR A;  1XSD A;  1T98 A;  2MFZ A;  4LIU A;  3OSF A;  4LMY A;  2A5Y B;  2XRL A;  4IQ4 A;  2WB1 A;  3M3Y J;  4EM1 A;  1SEU A;  1U9N A;  3VW1 A;  2KRC A;  4ENM A;  2MAB A;  2OAZ A;  4PXI A;  1TWH J;  4MO7 A;  2R92 J;  2DMN A;  3SZG A;  4IHT A;  3IKT A;  1IAW A;  1XG1 A;  2XHK A;  4DZP A;  4S05 A;  3LFK A;  4H0E A;  4HSR A;  2QEX I;  4F52 A;  2IS1 A;  2OPT A;  2QSF X;  2IT0 A;  2HVR A;  4Y52 J;  4BDY A;  1PUF B;  4OIR F;  1Z67 A;  5ERI A;  2VXZ A;  5FKM A;  1EKE A;  3V8J A;  1XD7 A;  3QYB A;  2OI8 A;  1O7L A;  3VTI A;  1LEA A;  4YIR X;  1XDS A;  3BTJ A;  3DBR B;  1IRG A;  1YS7 A;  2ACJ A;  5LGT A;  3PO3 J;  2K4B A;  2W57 A;  4BHB A;  5DV5 A;  2NVY J;  3FBN B;  4UNO A;  2GIZ A;  2R3S A;  2PZ9 A;  3VVY A;  1T6S A;  4LGW A;  3VIB A;  1ZG1 A;  2XIG A;  1FYL A;  4XON A;  3BR1 A;  1TWF J;  3KKD A;  2E71 A;  1ZR4 A;  3S2W A;  4AID A;  2P6T A;  3EYY A;  3PQK A;  4CYC A;  1A5J A;  3ROU A;  1SFX A;  2M0C A;  4AD9 A;  1ETV A;  2EA4 A;  1E3H A;  4D5C A;  3RJP A;  4MTE A;  1RKW A;  5FJ8 J;  4NNJ A;  2NX4 A;  2IGO A;  3FK6 A;  2P5L C;  3WTU C;  3QOP A;  4PJL A;  5J4V A;  4JP0 A;  1M1E B;  3NEU A;  4U7D A;  3W2A A;  5FLX K;  1YIJ I;  2YU9 J;  3IAM 2;  3FXL A;  3PNV A;  5KCM A;  3DKY A;  2UXU A;  3H0G J;  4ENN A;  1CF7 B;  5FMP A;  4A3C J;  2GEN A;  3R60 A;  2NVU B;  3Q9S A;  1VQP I;  1P9Q C;  5ED4 A;  3KP6 A;  1A36 A;  3HOZ J;  2WGB A;  2L7K A;  2XKO A;  4CGZ A;  1MH3 A;  1BI2 A;  2CMP A;  2XC7 A;  2ZCW A;  2DK5 A;  3BR0 A;  2CGP A;  3CCV I;  5FD6 A;  3HOU J;  3B6C A;  5M5Y J;  1XGM A;  4XLH A;  2GFN A;  2WV0 A;  2VQC A;  4MGR A;  2CU7 A;  1HST A;  2M4K A;  2VQL A;  3SZT A;  3L7W A;  5IT9 K;  1IZ1 A;  2PEX A;  2EFO A;  3DWL E;  3R4K A;  3F6V A;  3S5R A;  1F9N A;  1A35 A;  5JVT A;  4RBO A;  1XSX A;  5C44 J;  4AM3 A;  3I5U A;  5E20 A;  2XSJ C;  1YQA A;  1U3E M;  4XOR A;  5JVG F;  2L9S A;  3DEU A;  3CCS I;  3HKZ A;  2EQR A;  5AQC A;  3NAR A;  4LIT A;  2F5F A;  1D1C A;  4A5N A;  2E60 A;  1ZRD A;  2L7Z A;  4FHT A;  5J3L A;  1B72 B;  2GOM A;  3V8L A;  4BEH A;  1QO0 D;  2KJB A;  1ORK A;  2QIB A;  4NC8 A;  3QKX A;  3ZMU A;  2M3A A;  3M9A A;  5CXG A;  3E3V A;  2DFF A;  1R5I D;  1W4M A;  1OKR A;  2E5N A;  1VQ6 I;  1WRJ A;  4PK4 A;  2JVG A;  5DM7 F;  2VBY A;  5DCF A;  3ZR8 X;  1Q1V A;  1FBU A;  1FPQ A;  1V54 H;  2YU3 A;  2R7Q A;  3G7R A;  4GO1 A;  5HVQ C;  4D0P A;  2DA7 A;  2Q0O A;  4W1U A;  1HW5 A;  2HOE A;  3BR2 A;  2W4S A;  4FT8 A;  2HKO A;  4GYI A;  3HRS A;  3CCE I;  3S3O A;  3N97 A;  1UB9 A;  2OTJ I;  1IUY A;  3O6B B;  1T0F A;  2Y0M A;  3A0B C;  4XKV A;  4AVZ A;  1EJ9 A;  2CW7 A;  3PJR A;  4U9N A;  1SD4 A;  5EEG A;  2FMY A;  3MKW B;  3K8P C;  1SVO A;  2X6W A;  1MMG A;  4M6V A;  1V3F A;  4CUG A;  1DUX C;  4U9L A;  1YE9 A;  2A2F X;  3WG9 A;  4Y33 A;  3WTZ A;  1AWC A;  4AYB N;  1P7J A;  1BR4 A;  4YFK F;  1UZC A;  5K7F A;  4MTD A;  1VI0 A;  1IRX A;  3G6E I;  4R8H A;  1VFC A;  2KFD A;  3BJ6 A;  4KIB A;  3P9T A;  1OYI A;  1MIJ A;  1FYK A;  5CXI A;  4GCT A;  5JFR A;  4YEJ A;  1MMD A;  4KIS A;  5TJJ A;  2CUE A;  1TT0 A;  4WXH A;  1MSE C;  1IGN A;  2OA4 A;  5M3M J;  2OC6 A;  2HI3 A;  4HDV A;  2I5U A;  1X1C A;  4IRH A;  5KAI C;  4DYR A;  1OQY A;  1PUF A;  5EEA A;  1VQ7 I;  3UNG C;  4C3I J;  2ZJQ F;  1QHH D;  5IY5 H;  3TO9 A;  1NHA A;  2DFE A;  3BPV A;  2HS5 A;  2OCC H;  2DMQ A;  3N4M A;  3V4G A;  2O7O A;  3EPZ A;  3HPH A;  2R5Y A;  2EWN A;  1RI7 A;  4E4H A;  2LKP A;  3ASO H;  2L01 A;  4KDP A;  4PUS A;  2M7A A;  3JRG A;  1H9T A;  3S17 J;  4NEL A;  3VW0 A;  1WCM J;  1WJA A;  2Q24 A;  3CES A;  3MKZ A;  1BA5 A;  5D8K B;  3BC8 A;  3K4C A;  5E1Z B;  1B8I B;  3HTI A;  5AIQ A;  2AXT C;  2X9D A;  2CJJ A;  4G8X A;  2Q1Z B;  1V55 H;  1VQO I;  5BS6 A;  3VOD A;  2ZFU A;  1E0E A;  1EV7 A;  1T8I A;  2EIL H;  2JSC A;  3OYL A;  1SC7 A;  2UWM A;  3ON4 A;  3PFI A;  1A04 A;  5KVR A;  4I2O A;  4N4O B;  2A3S A;  4K2E A;  2ZCX A;  3RTR A;  2HYT A;  1ZAR A;  3FXU A;  3BR3 A;  3GW2 A;  3L2Q A;  2YR2 A;  1UAA A;  4BXF A;  1BI3 A;  3BRO A;  3S1Q J;  1UEL B;  1UJ8 A;  4IL6 C;  3CCM I;  2WC2 A;  3FWE A;  2WA0 A;  2ZNY A;  1HBX G;  2X1D A;  4HX4 A;  5HLI A;  2XV4 S;  1KYW A;  1SD7 A;  1ETQ A;  4RB0 A;  2FD5 A;  1J2X A;  2B7E A;  1TWG J;  2X51 A;  2ELH A;  3SFZ A;  2L4A A;  4UUS B;  1LPQ A;  2H1K A;  3RPQ A;  4HNV A;  4OIQ F;  2A61 A;  4BUP A;  1BOB A;  2IPQ X;  3CC2 I;  2GXG A;  2JA5 J;  3MZY A;  2JZY A;  3RDI A;  2WWY A;  2D6Y A;  1D8K A;  1FX7 A;  4F91 B;  3A01 A;  4F3Q A;  3F8C A;  1BI1 A;  1VQL I;  3QU6 A;  4YIF A;  1OR7 A;  2RGV A;  2DBB A;  4ZYH A;  3ULQ B;  1SVL A;  1Z05 A;  2DMP A;  5FRO A;  3TED A;  3LSI A;  2V1N A;  4KFC A;  3DPT A;  2HPI A;  3HUG B;  3P5J A;  2GWR A;  2H6C A;  4IJA A;  4XLF A;  3OYI A;  4BJ6 C;  4WF2 A;  5D4R A;  1CGP A;  1SAN A;  4MEY F;  2FJ1 A;  4KMF A;  3Q0U A;  2K5C A;  2HPM A;  1T95 A;  1ZGJ A;  2O03 A;  3VB2 A;  1RZ4 A;  1WI3 A;  4P55 A;  2Z9O A;  3DU6 A;  3K4B A;  2LVS A;  5ICF A;  4HNT A;  2DDA A;  5A2Q K;  3H9G A;  1TQM A;  2V9P A;  4IPA A;  2IGN A;  4ZYG A;  4IQJ A;  2ZME C;  2H94 A;  1OCO H;  3J7A O;  2W84 A;  1STZ A;  3LHQ A;  2P7V B;  3VPR A;  2WBM A;  4ZTJ A;  2A07 F;  3DBH B;  2L9R A;  1I1G A;  2VJ4 A;  2GLO A;  2Y75 A;  5FLV A;  5K7H A;  3F8F A;  4IEJ A;  3RD3 A;  2XDV A;  4F92 B;  5IP9 J;  4YII A;  3VOE A;  3OYG A;  1U8B A;  3T5X A;  2F6C A;  2NVX J;  3DTE A;  2OZU A;  4B3A A;  4A69 C;  2AHQ A;  2HU9 A;  2W82 A;  4HG2 A;  2F5D A;  3F72 A;  4IHX A;  2OF7 A;  4QTR A;  3OYJ A;  1MBE A;  2R7F A;  1X1A A;  4AC6 A;  1JXS A;  2B1E A;  3PPB A;  3H9J A;  4ZYE A;  2XVC A;  1FOK A;  4Q48 A;  2YUS A;  5IT3 A;  3W6J B;  2YPR A;  2LY9 A;  1P92 A;  1YTY A;  3ZGK A;  1ETY A;  2V9V A;  2Z99 A;  3LNQ A;  2AO9 A;  5E3L A;  1I5Z A;  1ZK8 A;  2LRE A;  2P0W A;  2NS8 A;  2ZXH A;  3EUA A;  3K4J A;  4HAM A;  4L5E A;  2GZW A;  3AFH A;  2STW A;  2LR8 A;  4O3M A;  2FBH A;  3I4N J;  4LB6 B;  2M30 A;  2NS0 A;  4Y4R A;  3BG9 A;  2XAH A;  3I59 A;  3M1C A;  4B09 A;  4WWC A;  3HTH A;  3IUV A;  2VPR A;  1YX5 A;  3HRM A;  3EYI A;  1IV6 A;  4GCK A;  2XGC A;  3QU3 A;  2IAI A;  1PUE E;  3OMY A;  3CP2 A;  1UHW A;  3COL A;  2G9W A;  2EFN A;  2NXN B;  3VVX A;  3IWF A;  2WAF A;  1U5T A;  4A6D A;  2K27 A;  2GA2 A;  3FM5 A;  2BHY A;  1KA8 A;  3IRR A;  3I71 A;  2QOP A;  5JI6 A;  2NNN A;  3DPJ A;  2LNB A;  1RET A;  3KP2 A;  3NRG A;  1UHS A;  1I6H J;  2L9N A;  1LE8 B;  4CHU A;  4HRI A;  1U6G A;  3LAJ A;  3MWM A;  3F8N A;  4HV6 A;  4EJU A;  1V4R A;  3FKI J;  4YFX F;  4II2 A;  4G6T B;  2DJN A;  4MK6 A;  1JUS A;  2VAS A;  5HOD A;  3CCL I;  3BT9 A;  2K9N A;  3TW6 A;  2Z3Y A;  3GLX A;  4X1E A;  2LD5 A;  5CVI A;  2COM A;  2VKD A;  3FXO A;  4HX8 A;  3NWS A;  3V7S A;  3KPH A;  1USS A;  1G3Y A;  5K7Z A;  1JGG A;  1BW5 A;  3W6K B;  2HZD A;  4E7J A;  3GTK J;  1IJW C;  4QIW N;  3BQY A;  3MVP A;  1HLV A;  1W36 D;  3CDH A;  2A69 F;  1MW7 A;  1EH7 A;  4CCM A;  4RM2 A;  3E7Q A;  2FQ4 A;  1K78 A;  2OU2 A;  3LFU A;  3HSE A;  3WTT C;  3FZV A;  5DYM A;  2I10 A;  3KZI C;  2ELK A;  5M5X J;  1QGP A;  4BYY A;  1O4X A;  2KP6 A;  1FOW A;  4L62 A;  1P7I A;  1YYV A;  2JQ7 A;  4XBF A;  4B4C A;  2X1C A;  2LBF B;  3S93 A;  4RGU A;  3RKX A;  4UVC A;  1ON2 A;  4YEL A;  3TO6 A;  4UUT A;  3S1M J;  2OER A;  1LEB A;  3I58 A;  1BR1 A;  4M3B A;  2LP0 A;  1AKH A;  1QZY A;  1Z7L A;  1ULY A;  3C2G A;  4S04 A;  2V57 A;  3KEQ A;  5DM6 F;  3DLL F;  1X58 A;  2BV6 A;  3M07 A;  5J6X A;  4FX0 A;  3HSR A;  5A2Q Z;  3IP4 B;  1YIT I;  1XCB A;  2PN6 A;  2JPB A;  2XAU A;  5EZG A;  1O3R A;  3ANP A;  3ECH A;  2KHM A;  4ASN A;  2JK3 A;  2VKV A;  3PSF A;  3MNL A;  3K9T A;  2D5V A;  4N4N B;  2RDP A;  3OSG A;  2DQR A;  4P1W A;  1D8J A;  5BNG A;  2W24 A;  1DP7 P;  2BY2 A;  4XSX F;  2ZCN A;  4IRV A;  2HTJ A;  2JA6 J;  5L3G A;  2MD0 A;  5FKO A;  3FF5 A;  2PJR B;  2M9H A;  3E6B A;  5DCM B;  4EJO A;  2G0E A;  4XLN F;  2ZY9 A;  3M7G A;  3K70 D;  2VJ5 A;  2XRO A;  1FY7 A;  2DCE A;  2QA4 I;  4BY7 J;  2FE3 A;  3BPX A;  4AU7 A;  3WTS C;  3KYL A;  1QQI A;  1GUU A;  4JBA A;  2KT0 A;  2NS7 A;  4BHP A;  1ZR2 A;  1W0U A;  1N25 A;  2DT5 A;  1MDM A;  2CQK A;  1JHH A;  4A6E A;  4C2M A;  2M0M A;  2ZBK A;  1W5T A;  2ID3 A;  4RLF A;  2QF7 A;  4F7Z A;  1WGX A;  2CV0 A;  5FFX A;  3KFW X;  4L9T A;  2FXA A;  2CRG A;  2EZH A;  3CZ6 A;  5FKK A;  1IDY A;  1FP1 D;  1LNW A;  2RC4 A;  2DA1 A;  4IRI A;  2QUF A;  1J5Y A;  4ENK A;  2NOG A;  3NS4 A;  3K1M A;  4P5O A;  5LGU A;  4XMY A;  3OR2 C;  3JAM Z;  2HQR A;  2V1U A;  5DEQ A;  1T08 B;  2WAE A;  4BY1 J;  3MKY B;  1I50 J;  2QM3 A;  5F0F A;  3V6G A;  1MD0 A;  1FLI A;  3TKY A;  1ZRF A;  2P8T A;  1Y56 A;  3CCY A;  4GCV A;  2DW4 A;  1QZE A;  3P9C A;  1J59 A;  4M3E A;  3DEW A;  1GLN A;  1W5C C;  3LWF A;  2VI6 A;  4PGG A;  3JRD A;  1IRF A;  5C3E J;  4CCN A;  1K7A A;  3TMO A;  1OJL A;  2J5P A;  1D0X A;  3GME A;  2F5C A;  5HNH A;  1Y39 A;  2ECB A;  3O2P E;  4OIP F;  2RVC A;  2EZI A;  4QWQ A;  3RKW A;  3CMA I;  1H88 C;  4HOB A;  5K5O A;  5EDN A;  4A93 J;  2HEO A;  1I3A A;  3I3L A;  3LMM A;  3ZMD A;  4BAY A;  1Y0U A;  4CSW A;  3BJB A;  3MEX A;  2D45 A;  4L9V A;  1BJZ A;  2P7C B;  4MXM A;  4CIC A;  5LEK A;  3WTW C;  2EB7 A;  3ECO A;  4E6K G;  1E3O C;  5B5E C;  3IUO A;  3VSK A;  4JX5 A;  3CUQ C;  3I64 A;  2BHZ A;  4GGG A;  1OPC A;  2CQQ A;  5CKT A;  3ABM H;  3PFY A;  2ZCM A;  2NVT J;  1UHM A;  3J80 Z;  3HOX J;  1G2H A;  2FF4 A;  4ZJZ A;  1P4A A;  3B73 A;  3WTX C;  4Y7N J;  2D2W A;  1I27 A;  4RMN A;  1RPW A;  1R49 A;  4DZJ A;  5CPR B;  3BY6 A;  2XF5 A;  3GVA A;  2QKL B;  2VXD A;  4UHT A;  2ZFW A;  5HS7 A;  1Z91 A;  3PNT A;  1JKP C;  5F64 A;  3DTI A;  3GFM A;  2K9L A;  3ONQ A;  4IZZ A;  4IOC F;  2JMW A;  2BOL A;  2UXN A;  4RAZ A;  1X1D A;  4RAY A;  4HYE A;  1YS6 A;  1B6A A;  5J1U A;  1I6X A;  5IP6 A;  1GXQ A;  2HDD A;  4ENJ A;  4CCK A;  3E1S A;  2LY1 A;  2CO5 A;  3ZQQ A;  1WJC A;  3DCF A;  4NN1 A;  1KZH A;  4Y13 A;  3PUF A;  2LF8 A;  2KKO A;  3GFJ A;  3GO5 A;  2DA3 A;  2OUM A;  3H5R A;  3WTV C;  5HSZ A;  3WHC A;  2PFB A;  2HTS A;  4JX6 A;  4AIH A;  2A6E F;  4XID A;  1R6R A;  4IKF A;  1FBQ A;  4UXN A;  2R7Z J;  1Z77 A;  1UI6 A;  3WU0 A;  2VOP A;  3VVZ A;  2KJC A;  4ETS A;  4A3J J;  2TRT A;  1ENH A;  3CME I;  3OR1 C;  5D6E A;  1BOA A;  1R4M B;  4UV9 A;  3NAU A;  3QP6 A;  2O61 A;  5M5W J;  2O9L A;  2X85 A;  2A68 F;  2CV2 A;  4O5V A;  5CW8 A;  1E17 A;  1Z9C A;  1YIO A;  1ACI A;  2GA1 A;  2K7L A;  3FHN A;  1WJE A;  5IOZ A;  1G4D A;  4IO9 F;  1RR7 A;  4WCG A;  5D5V B;  3CWR A;  3ZPL A;  2RNG A;  4CH7 A;  1JKR C;  2E2J J;  2MA3 A;  3M4O J;  4Z2Y A;  3EET A;  1O3T A;  1FJL A;  4I98 B;  1QBJ A;  2VOO A;  2RQP A;  1B4A A;  5GPC A;  4HQM A;  3HRT A;  3TL4 X;  2VQH A;  3RPU A;  2ETH A;  4WK8 F;  1YJN I;  1GVJ A;  3U1K A;  4A3I J;  1WPK A;  2HOA A;  2Y0S A;  2DI3 A;  1ZQ3 P;  4LIV A;  2DG7 A;  1SFU A;  3GEZ A;  3AG3 H;  3BG5 A;  2HDW A;  2R7R A;  2E35 A;  3DTK A;  3EUH A;  2E19 A;  2DT6 A;  3BG3 A;  2R5Z B;  2EZL A;  1JE8 A;  1TBX A;  2E7W A;  4GRI A;  4EMS A;  2FUG 2;  1N77 A;  3ZRG A;  1D1A A;  3AG4 H;  1AHD P;  1ZHF A;  2YS9 A;  3BQZ A;  2PMH A;  4UUV A;  5FKL A;  1IC8 A;  4KJZ A;  1LB2 A;  1Y0N A;  2JVH A;  1FBS A;  2JJ7 A;  3AQT A;  2WAQ A;  5B66 C;  1GT0 C;  2RAE A;  5EEH A;  3CQZ J;  2JWT A;  2LF7 A;  4C3H J;  3OYF A;  3HOV J;  2UV1 A;  5L3D A;  3PL8 A;  1FC3 A;  3I56 I;  1KYZ A;  3K10 A;  3BG7 A;  2XAS A;  3IV5 A;  1F43 A;  2VC1 A;  2YX4 A;  4I0A A;  1RR8 C;  2G7G A;  3L2W A;  2ZSH B;  4A0Z A;  3GTL J;  3F23 A;  4KIG A;  1X2N A;  3C7J A;  1WJ5 A;  3L00 A;  1VZ0 A;  1MJB A;  5EGO A;  1HW2 A;  4XL9 A;  2X6Y A;  2EIM H;  3L2U A;  2BW3 B;  3BR5 A;  3IWZ A;  3HIF A;  4NHJ A;  3PSI A;  3GXO A;  4PFO A;  5BQT A;  4X0G A;  2JUG A;  2UZK A;  4PJM A;  3TDZ C;  3TOA A;  4XRS G;  4EJV A;  1ZN2 A;  4DYC A;  4ANJ A;  2QBY A;  5FHP A;  4M9S A;  4JQF A;  4DQ2 A;  3K0L A;  2FSW A;  1DP3 A;  3OL3 A;  1W36 C;  4DOZ A;  3DKW A;  2KLO A;  1K6Y A;  3TP3 A;  4XOP A;  2PMZ N;  4HKU A;  4G9Y A;  3HC7 A;  1KU2 A;  3F1B A;  5TGT A;  4A3K J;  2NP3 A;  2N8G A;  4ABZ A;  1K4S A;  3SDB A;  4WXD A;  4MNU A;  5FKN A;  1FEX A;  1FNN A;  2L4M A;  5JHU A;  2B0L A;  4M71 A;  3OYC A;  2EV6 A;  3CMY A;  1RKT A;  1LVK A;  1E2X A;  3HHH A;  3E6C C;  4PFP A;  1JKQ C;  2H09 A;  1YRN B;  2LFB A;  1UCR A;  1HKS A;  1NG7 A;  3VYT B;  3V7R A;  1I3Q J;  4HNU A;  2IS2 A;  3V78 A;  2LKS A;  3HIM A;  2NVQ J;  2Y2Z A;  4HBL A;  4XLA A;  1IV8 A;  3T6N A;  2Y30 A;  1ZYR F;  3LOC A;  3H3V K;  4CYC B;  4LG3 A;  3JTH A;  2M87 A;  5AIP A;  4MIM A;  3ON2 A;  1YW8 A;  4B43 A;  3V7C A;  2EIN H;  2EH3 A;  3FK7 A;  1EH6 A;  2ME6 A;  2HYG D;  4BQN A;  4Q4Z F;  4A3F J;  3MQ0 A;  1EH8 A;  1MMS A;  3RQI A;  1TWC J;  4J19 A;  1TNT A;  3CO7 C;  1TL8 A;  3H5N A;  5LFA A;  3HTS B;  2OBP A;  2IRF G;  4JNN A;  3Q9V A;  2EK5 A;  1XPX A;  2EIJ H;  2DOA A;  4H4K C;  3SQN A;  4XN3 A;  3LQQ A;  1IN7 A;  2EJR A;  3C2H A;  2JA7 J;  4PGH A;  2ZC2 A;  3JSJ A;  2PG4 A;  3LA2 A;  4HLX A;  4KMU X;  1PYV A;  1R71 A;  3CF2 A;  1VF9 A;  3G4S I;  1ZG5 A;  1MBH A;  3C1D A;  1OLT A;  5E79 C;  4HF0 A;  4DW6 A;  3AG2 H;  4AUX A;  3CCJ I;  3KEO A;  1J9I A;  1S29 A;  5HAW A;  1ZTR A;  2GM4 A;  3QOE A;  3QP5 A;  1GVD A;  4F93 B;  2L7M P;  4QPQ A;  1QZZ A;  4ZDP A;  2HQ5 A;  4BQQ A;  3HOY J;  2G7H A;  5EFY A;  3AQS A;  1Q1H A;  2VBX A;  4CO8 A;  3KNW A;  2HGC A;  2PLY A;  1IDZ A;  3BLY A;  3GF2 A;  4RLQ A;  4KA4 A;  4JL3 A;  2KRF A;  1TC3 C;  4LJZ F;  5F27 A;  1VND A;  4A0Y A;  4GFB A;  3H3U A;  1SD5 A;  3ZQH A;  1D0Y A;  1IO2 A;  1ETW A;  2VB6 A;  2Z2S B;  4OIO F;  2IP2 A;  1H0M A;  1FT9 A;  3DV8 A;  3ELK A;  2E1O A;  1H89 C;  4N0B A;  2E1M B;  1OCC H;  5CVR A;  1YG2 A;  2QYO A;  2XGD A;  2CQX A;  5CQG A;  2P5V A;  4QLC U;  3I0T A;  3GTM J;  1EF4 A;  2M7B A;  2HOT A;  4II3 A;  2DLL A;  4OMZ A;  5GP9 A;  1X3Z B;  2JUC A;  4BKX A;  4ZH4 F;  3FMS A;  1Z6R A;  3H1C A;  1ETK A;  2HOS A;  4D9J A;  4BL0 B;  2E1M C;  1UFM A;  3NRV A;  2COB A;  1AOY A;  4BJ5 C;  1T0F C;  4I01 A;  4O6J A;  4XM3 A;  1GV2 A;  3JRC A;  4BQA A;  4UB6 C;  1R22 A;  4CZC A;  2QEN A;  4RB1 A;  3JRB A;  1W7P D;  1JI8 A;  2Q2E B;  2MBF A;  2JPC A;  4LG0 A;  4KT5 C;  5IYC J;  1DGW Y;  4A3E J;  3N05 A;  4IF4 A;  2ZME B;  2VBZ A;  3P7N A;  1F4K A;  2F4O B;  3K1P A;  3IC7 A;  2VLA A;  3W3C A;  3K4L A;  3QBM A;  5KHD A;  1RC9 A;  3HZJ A;  1TLH B;  2HKX A;  2EBI A;  3B02 A;  3C2B A;  1ETO A;  2M2E A;  4HEA 2;  5HS9 A;  1X1B A;  3FDY A;  5F1J A;  3AKZ A;  3O60 A;  1MJA A;  2FNA A;  3FX3 A;  3HJE A;  2FNP A;  1WZ2 A;  1SGM A;  2OZ6 A;  1QVU A;  2GAU A;  1ETX A;  3GFI A;  1S7E A;  3GZ5 A;  2R5Y B;  3HSF A;  2FBI A;  3L09 A;  3DP7 A;  5B1A H;  4BXX J;  2F5E A;  2LSO A;  2IS6 A;  1QHG A;  2PQ8 A;  2DG8 A;  5J1R A;  1BN5 A;  2VOD A;  2LH9 A;  2BBY A;  2AS5 F;  3ML6 A;  2DDB A;  5B1B H;  4B44 A;  3PIO F;  1O7F A;  3E7L A;  4GXO A;  3K4K A;  2PI0 A;  4HQE A;  2LTP A;  4C30 A;  4A2U A;  3OOU A;  4XLC A;  5H9T A;  5HDK A;  3I4M J;  5JHF A;  2BVL A;  3BRU A;  4IVN A;  3QPH A;  3VOK A;  2QQA A;  4BJT A;  5E8I A;  2VT2 A;  2V1D A;  3RKY A;  1ZRC A;  2Z5U A;  2XPU A;  1VQM I;  1MBJ A;  1OCR H;  2BEO A;  3OYN A;  1Z3X A;  5CVV A;  3EQL F;  2E1C A;  1FTZ A;  4DIQ A;  1IW7 F;  2KL4 A;  3ZMV A;  4E7H A;  4EGZ A;  1S5L C;  4PJJ A;  3FXK A;  2V4J C;  2XGX A;  5L3E A;  1Y1W J;  3JAM K;  2UUZ A;  2GQQ A;  3F6O A;  3LSK A;  2W1O A;  2VBW A;  4AYB A;  1GV5 A;  1LVA A;  3W2V A;  4PSX A;  1R00 A;  2YX7 A;  1K79 A;  3H35 A;  5LHI A;  3F22 A;  1BR2 A;  5DDG A;  4MLO A;  1K6O A;  3KZY A;  5LHG A; 
#chains in the Genus database with same CATH homology
 3V6G A;  3GZI A;  1JJ6 C;  3QPS A;  4YZE A;  2XB5 A;  1LFU P;  3BTJ A;  3S16 J;  3NXC A;  3CCY A;  4FTH A;  3PO3 J;  3BHQ A;  5F0H A;  4KWA A;  2PZ9 A;  2NVY J;  5E3M A;  3JRF A;  2YVE A;  3VVY A;  3VIB A;  4M3E A;  3DEW A;  2K40 A;  1IRZ A;  9ANT A;  3BR1 A;  1TWF J;  3KKD A;  2VI6 A;  3JRD A;  1ZR4 A;  3O8H A;  5C3E J;  1FIA A;  1OJL A;  4CYC A;  2R0Q C;  1A5J A;  2M0C A;  2ECB A;  1ETV A;  1MSF C;  4D5C A;  5FJ8 J;  1RKW A;  2EZI A;  2NX4 A;  2O7T A;  3FK6 A;  5D18 A;  1H88 C;  4JP0 A;  5JLX A;  5EDN A;  2XB0 X;  2MSY A;  4A93 J;  2YU9 J;  5JLW A;  1JTY A;  3BJB A;  2UXU A;  3H0G J;  4B1R A;  1U78 A;  4A3D J;  5FMP A;  4A3C J;  2GEN A;  4MXM A;  1BJZ A;  2X48 A;  1MBK A;  2ZOZ A;  3HOZ J;  3S2D J;  3BCG A;  3GBG A;  1E3O C;  2WGB A;  4G12 A;  1MH3 A;  4JX5 A;  3BR0 A;  1HCR A;  2CQQ A;  4BBR J;  1T56 A;  3B6C A;  3K7A J;  2L0K A;  5M5Y J;  3HOU J;  3OIO A;  5F08 A;  2GFN A;  2ZCM A;  2NVT J;  3WHB A;  1G2H A;  2CU7 A;  1XS9 A;  4IHV A;  1D5Y A;  2DN0 A;  3VUQ A;  4Y7N J;  4A3M J;  2FBQ A;  1RPW A;  3S5R A;  4DZJ A;  3PO2 J;  4RBO A;  4UDS A;  3ZQG A;  5C44 J;  2K9Q A;  1HF0 A;  4MFD A;  1JKP C;  5C4X J;  4JYK A;  2Y9Z A;  2WV1 A;  2JMW A;  2EQR A;  5AQC A;  3NAR A;  2L7Z A;  5J3L A;  1B72 B;  4V2G A;  3BNI A;  5J1U A;  1LFB A;  3JRI A;  5IP6 A;  1LE8 A;  2HDD A;  1ORK A;  2QIB A;  3QKX A;  3C07 A;  3NI7 A;  3LSR A;  5CXG A;  5EG0 B;  1H8A C;  3DCF A;  4NN1 A;  1APL C;  2VUM J;  2RHA A;  3LJL A;  1Q1V A;  2DA3 A;  3G7R A;  4ME9 A;  5HSZ A;  2DA7 A;  1HOM A;  3WHC A;  4W1U A;  3BR2 A;  1TWA J;  2Y31 A;  4JX6 A;  3CJD A;  4XID A;  1U9O A;  2H8R A;  1WH5 A;  3RZO J;  3LSG A;  1UI6 A;  2R7Z J;  1Z77 A;  3VVZ A;  4A3J J;  3G1L A;  2WB1 N;  2TRT A;  3RKQ A;  1ENH A;  3GTP J;  4M6V A;  4M3D A;  3FIS A;  3NAU A;  5M5W J;  2O9L A;  1MBG A;  5CW8 A;  3HOW J;  5E3O A;  5FGL A;  3HBL A;  4AYB N;  5IOZ A;  2G7S A;  1P7J A;  4LOC A;  5K7F A;  1VI0 A;  1QPI A;  1RR7 A;  2M34 A;  2TCT A;  1VFC A;  2R93 J;  3P9T A;  5CXI A;  4GCT A;  3CWR A;  5IP7 J;  2LKX A;  4C3J J;  3A03 A;  1JKR C;  2E2J J;  1BL0 A;  2REK A;  4ICH A;  3QPL A;  3M4O J;  2CUE A;  1MSE C;  4M3F A;  3S2H J;  1IGN A;  1FJL A;  3LSJ A;  5M3M J;  5IYB J;  2HI3 A;  4D5F A;  4DYR A;  1PUF A;  5GPC A;  5EEA A;  4C3I J;  4S0H B;  2QCO A;  5F0C A;  2ECC A;  5IPA A;  3A01 B;  4A3I J;  5EG0 A;  1WPK A;  1ZKG A;  2DMQ A;  2HOA A;  3CDL A;  2IU5 A;  2O7O A;  1ZQ3 P;  2R5Y A;  3GTO J;  4I76 A;  1JT0 A;  2DG7 A;  1W0T A;  1AU7 A;  3BG5 A;  3JRG A;  3S17 J;  4NEL A;  3Q0W A;  3VW0 A;  2E19 A;  3ZQF A;  1WCM J;  2Q24 A;  3BG3 A;  2FX0 A;  2R5Z B;  1BA5 A;  2EZL A;  3HDD A;  3MKL A;  4GFK A;  1B8I B;  3HTI A;  2X9D A;  2CJJ A;  2F07 A;  4IHY A;  1HDP A;  5HBU A;  1FIP A;  3IH3 A;  3Q0V A;  3JRA A;  1AHD P;  1AKH B;  1MNM C;  3ON4 A;  4GFL A;  3S1N J;  2YS9 A;  3BQZ A;  2ZCX A;  5FKL A;  1IC8 A;  2ZB9 A;  1DU6 A;  2HYT A;  4AF5 A;  2JJ7 A;  3BR3 A;  3AQT A;  1GT0 C;  5D1R A;  1GDT A;  2RAE A;  2DMU A;  3HB9 A;  1QVT A;  3CQZ J;  3G1M A;  2JWT A;  2IEK A;  1F36 A;  4V2F A;  4C3H J;  1SFO J;  3S1Q J;  4A3B J;  3HOV J;  4FE7 A;  2G7L A;  2DA4 A;  1ETQ A;  2MGQ A;  3IV5 A;  1F43 A;  2FD5 A;  2GBY A;  3HKZ N;  2G7G A;  1TWG J;  4UUS B;  3GTL J;  1UG2 A;  2MG4 A;  2H1K A;  4HNV A;  1X2N A;  2L7F P;  2JA5 J;  2O8K A;  2D6Y A;  5EGO A;  2UXO A;  4M3G A;  3BTL A;  3A01 A;  2B63 J;  1POG A;  3BR5 A;  2MW8 A;  4IHW A;  3GTQ J;  2HYJ A;  2DA2 A;  1Y1V J;  4C2M J;  5DAJ A;  1MBF A;  4XRS G;  2DMP A;  3TED A;  4DYC A;  3PAS A;  4JKZ A;  5FHP A;  5M3F J;  3GEU A;  3EUP A;  1SAN A;  3TP3 A;  2FJ1 A;  2PMZ N;  2P81 A;  4HKU A;  2DA6 A;  3S14 J;  2DTZ A;  3Q0U A;  4A3G J;  3F1B A;  5EYR A;  4A3K J;  1JUP A;  2NP3 A;  4FIS A;  5IYD J;  1WI3 A;  2N8G A;  2DA5 A;  4ABZ A;  3BTC A;  2JN6 A;  2LVS A;  2QKO A;  2W53 A;  2VKE A;  5DS9 A;  5FKN A;  1FEX A;  2XDN A;  2XGE A;  5FLM J;  5J1Y A;  1NK3 P;  5DTD A;  4D7N A;  1X2M A;  3CMY A;  1RKT A;  3LHQ A;  3HGY A;  2LK2 A;  1JJ8 C;  1JKQ C;  3VPR A;  3HTJ A;  1YRN B;  2LFB A;  3VW2 A;  2L9R A;  2JA8 J;  4X6A J;  1RES A;  1I3Q J;  3V78 A;  3K2A A;  5C4J J;  2GLO A;  4D7M A;  5FLV A;  5K7H A;  3F0C A;  4IEJ A;  2Y9Y A;  2NVQ J;  1OCP A;  5IP9 J;  3HIM A;  2Y2Z A;  1CQT A;  3RD3 A;  1U8B A;  2Y30 A;  3LOC A;  3T6N A;  2NVX J;  3H3V K;  4CYC B;  4B3A A;  3JRE A;  4A69 C;  2AHQ A;  4MIM A;  4IHX A;  3ON2 A;  2OF7 A;  4QTR A;  1MBE A;  2EH3 A;  3FK7 A;  5EZH A;  4AC6 A;  4NDL A;  2ME6 A;  5E3N A;  3SJM A;  3PPB A;  4A3F J;  4I6Z A;  1HDD C;  3RQI A;  1TWC J;  2Y0S N;  2YUS A;  4J19 A;  2UXH A;  3ANG A;  1IG7 A;  1NK2 P;  3O8G A;  2LY9 A;  3S1R J;  2M8G X;  1ETY A;  1OCT C;  4JNN A;  3MN2 A;  2HXI A;  3HM5 A;  3LNQ A;  2AO9 A;  5E3L A;  1B72 A;  1ZK8 A;  2NS8 A;  4L5E A;  4XRS A;  3JRH A;  2ZOY A;  2LR8 A;  1Z0X A;  3I4N J;  2JA7 J;  3Q3S A;  3JSJ A;  4RDU A;  3BG9 A;  3D1N I;  3ZQI A;  4EEF G;  3HTH A;  3IUV A;  2VPR A;  1VF9 A;  1A6I A;  1MBH A;  1IV6 A;  2K9S A;  4GCK A;  1JUM A;  2XGC A;  4JX4 A;  2DMT A;  3IH4 A;  2IAI A;  4DW6 A;  2XSD C;  3COL A;  1T33 A;  4AUX A;  1OFC X;  3VVX A;  3LSP A;  5HAW A;  1ZTR A;  3PM1 A;  2GM4 A;  1GVD A;  2WAQ N;  2L7M P;  2QOP A;  1NTC A;  3HOY J;  2HQ5 A;  1K83 J;  3DPJ A;  1YRN A;  1RET A;  4XIC A;  3NRG A;  5EFY A;  1UHS A;  3AQS A;  3KNW A;  1I6H J;  3GTG J;  1LE8 B;  2NP5 A;  1IDZ A;  1ZGW A;  2GUH A;  3VOX A;  2HXO A;  2YVH A;  4BBS J;  4JL3 A;  3SDG A;  3ZQC A;  1JT6 A;  3FKI J;  1TC3 C;  1UMQ A;  5F27 A;  3UKG A;  1VND A;  2DJN A;  3ZOB A;  4MK6 A;  1JUS A;  4GFB A;  3ZQH A;  5HOD A;  3BT9 A;  2E2I J;  2UXI A;  1ETW A;  2K9N A;  3TW6 A;  3GTJ J;  4X1E A;  2LD5 A;  3RH2 A;  4ACI A;  2RAS A;  1JKO C;  3LWJ A;  3HEF A;  2E1O A;  1H89 C;  5K7Z A;  1JGG A;  3ZQL A;  1BW5 A;  3NPI A;  2XGD A;  2CQX A;  3GTK J;  1IJW C;  4QIW N;  3JR9 A;  3BQY A;  3MVP A;  1HLV A;  5GPA A;  3GTM J;  1EF4 A;  5IOY A;  3E7Q A;  2FQ4 A;  2HOT A;  5GP9 A;  4BKX A;  2I10 A;  2ELK A;  1ETK A;  2HOS A;  2G3B A;  1QRY A;  5M5X J;  1O4X A;  2COB A;  2XPV A;  1R9T J;  3A02 A;  3JRC A;  4L62 A;  3G56 A;  1GV2 A;  4GCL A;  1P7I A;  3JRB A;  1JTX A;  3L1P A;  3KKC A;  4B4C A;  3RZD J;  2R5Z A;  4AC0 A;  5IYC J;  3IH2 A;  4A3E J;  3SFI A;  1B8I A;  3S15 J;  2HKU A;  1IUF A;  3BTI A;  4UUT A;  3S1M J;  2OER A;  3KZ9 A;  2ME0 A;  4M3B A;  2LP0 A;  1AKH A;  3QBM A;  2V57 A;  3EGQ A;  2PBX A;  3C2B A;  2EBI A;  1X58 A;  3HOX J;  1ETO A;  2M2E A;  5F1J A;  1PUF B;  1FTT A;  3HTA A;  3O60 A;  3B81 A;  2LLK A;  4CGR A;  3ANP A;  1XC5 A;  4QSH A;  5EZG A;  1SGM A;  4XRM A;  5D19 A;  1QVU A;  2JK3 A;  2VKV A;  1ETX A;  1S7E A;  2X6O A;  3MNL A;  2R5Y B;  2D5V A;  2QTQ A;  4BXX J;  4FCY A;  3FRQ A;  3OSG A;  2UXP A;  3FIW A;  2W48 A;  2DG8 A;  3TP0 A;  5BNG A;  5J1R A;  3CRJ A;  2ZCN A;  2CUF A;  5C4Y A;  2JA6 J;  5FKO A;  2WUI A;  2M9H A;  3QQA A;  3VP5 A;  1ITY A;  4UUS A;  4FE4 A;  2G0E A;  3E7L A;  3G1O A;  3HGG A;  4MFE A;  1UI5 A;  2E2H J;  4A3L J;  2QWT A;  1MH4 A;  3B6A A;  2LTP A;  3TW7 A;  3OOU A;  5H9T A;  1BW6 A;  4DYQ A;  4BY7 J;  3I4M J;  5K58 A;  1GUU A;  1ZR2 A;  2KT0 A;  2NS7 A;  3BRU A;  1W0U A;  3VOK A;  1WH7 A;  5F04 A;  2EZK A;  3NNR A;  2ID6 A;  4W97 A;  3OSF A;  2XPU A;  1MBJ A;  2XRL A;  2ID3 A;  2KDZ A;  2XPW A;  2QF7 A;  3M3Y J;  1WGX A;  1FTZ A;  1U9N A;  2CRG A;  3VW1 A;  4XK4 A;  2EZH A;  5FKK A;  4PXI A;  1TWH J;  4MO7 A;  1IDY A;  1K61 A;  2R92 J;  2DMN A;  1DU0 A;  2DA1 A;  1XG1 A;  4DZP A;  1Y1W J;  2NOG A;  2OPT A;  4Y52 J;  1GV5 A;  3BR6 A;  5EF6 A;  3W6V A;  4BY1 J;  5FKM A;  2IBD A;  1I50 J;  2OI8 A;  4MLO A;  5F0F A;  3HE0 A;  5EGO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...