2HQ5A

Crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Multidrug-Binding Transcription Factor QacR Binds the Bivalent Aromatic Diamidines DB75 and DB359 in Multiple Positions
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hq5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hq5A02
1Y1WJ 4MXMA 1HDPA 4JX4A 2HYTA 3KKCA 1K83J 3HOZJ 2F07A 4JYKA 4MO7A 1SFOJ 4DYCA 1RESA 2EZHA 2ECCA 2DMUA 1IRZA 3GBGA 3LJLA 5GP9A 2DA6A 3NI7A 4QSHA 2CUFA 2XGEA 5H9TA 3OSFA 1S7EA 3MNLA 4GCLA 2MGQA 3H3VK 3G1OA 1U9NA 5CXGA 1IC8A 3VVYA 4I76A 3G56A 1JUSA 3HOXJ 3HM5A 3IH3A 4A3JJ 2FX0A 1VI0A 2FBQA 5EYRA 1ZR4A 3TW6A 3F1BA 5JLWA 2NVQJ 3IUVA 1RETA 1VF9A 5FLVA 4A3IJ 5GPAA 2CQXA 1JGGA 3WHBA 2UXHA 4ACIA 5C3EJ 1WH7A 3CQZJ 5E3NA 3W6VA 1NK2P 4YZEA 2X48A 1NTCA 4D5CA 5K7FA 3JRBA 2EZIA 4M3EA 5EFYA 2E2IJ 1CQTA 1R9TJ 3VW2A 3NARA 3SDGA 2AO9A 3NPIA 1Z77A 4V2GA 2L0KA 5HODA 2D5VA 2LVSA 3FK6A 1FTZA 1XC5A 1ETWA 3DEWA 3BCGA 4A69C 4AC0A 4DZJA 5E3OA 5EGOB 2R92J 3HTHA 2X6OA 3KNWA 4JX6A 3LNQA 5FJ8J 3JRFA 2VPRA 3BTIA 1FJLA 1GV5A 2WGBA 2ZCMA 2JA6J 3IH4A 4W97A 3BR2A 1PUFB 1HCRA 2DG8A 1ETOA 3HKZN 2GUHA 2O7OA 3RZDJ 1A5JA 3GTOJ 4B3AA 2DA5A 2TCTA 5F0HA 4A3LJ 2G7GA 1RPWA 2Y31A 1T56A 1AU7A 3M3YJ 3ON4A 1EF4A 5F0FA 1LFUP 1TC3C 1JUMA 3JRGA 3S1RJ 1MSFC 2B63J 3B6AA 2XB5A 1B8IB 1Q1VA 5FKLA 3TP3A 2R5ZB 3O8GA 5DS9A 1I50J 2LY9A 4AF5A 2DTZA 3QPSA 2M0CA 3JRAA 3O60A 3A02A 2VUMJ 3HBLA 4JNNA 4Y7NJ 4BBSJ 1MBGA 2O7TA 3LWJA 3DCFA 2X9DA 3BR6A 3BRUA 2EQRA 3GEUA 3VOKA 1G2HA 1BW5A 3CCYA 1OJLA 1XG1A 1TWHJ 1E3OC 2Y2ZA 2E19A 1PUFA 5FGLA 3GZIA 4D5FA 3K2AA 4JL3A 1JKPC 1DU6A 2L7ZA 3JSJA 2DA3A 2DG7A 1TWFJ 2HYJA 4ME9A 1JT6A 2RASA 1NK3P 3H0GJ 5C4JJ 4FCYA 5HAWA 3SJMA 1HOMA 2ID6A 4M3BA 3S5RA 4MIMA 1O4XA 1SANA 3KZ9A 1ORKA 4AC6A 3ANPA 3BNIA 1I3QJ 4JKZA 5IP6A 4B4CA 2R5ZA 1ZGWA 2XPUA 1WH5A 2G7SA 5GPCA 2XRLA 2DA4A 4V2FA 2KT0A 2DA2A 2HXOA 4L5EA 3LSPA 1K61A 3EGQA 4MK6A 4MFDA 4IHYA 9ANTA 2DMNA 5EF6A 2HDDA 3HGGA 3P9TA 1H8AC 3GTMJ 2Q24A 2EZKA 2HXIA 3E7LA 3BTLA 5BNGA 2VKEA 3D1NI 2E2JJ 2ELKA 2QWTA 2ZCNA 3QBMA 5E3LA 3OSGA 3C07A 4A3BJ 2V57A 4UDSA 2LP0A 4PXIA 3BG5A 1QVTA 3LSGA 1RKWA 5E3MA 4CYCB 1MBHA 2LK2A 2HOAA 3UKGA 2FJ1A 2PZ9A 1A6IA 2FD5A 1ITYA 2XPVA 3WHCA 2DMQA 2K40A 2QKOA 4KWAA 3BT9A 3L1PA 1WGXA 3HTIA 2NP5A 2EZLA 4UUSB 2PBXA 1MH3A 1OCPA 2M9HA 1VNDA 2OPTA 3VW1A 3S1QJ 3BQZA 2JN6A 5D1RA 2Y9YA 4M3GA 1W0UA 2DMTA 2WUIA 3RD3A 4Y52J 1X2NA 3G1MA 2D6YA 2KDZA 2L7MP 3HTJA 5K7HA 3Q0VA 3MN2A 2L7FP 3PO3J 5C4YA 1ETKA 3QPLA 1RR7A 3I4MJ 2JWTA 3BR1A 2YVHA 3TEDA 1JKOC 1YRNA 1MBEA 3RKQA 1U78A 1GV2A 3AQTA 4W1UA 4IHWA 3Q3SA 1MBFA 1X58A 1ETQA 3ZQCA 3PPBA 2HOSA 1POGA 5FHPA 2CJJA 2DA7A 2IAIA 3S1MJ 4XK4A 4HNVA 5D18A 2IEKA 3FIWA 3HGYA 2CU7A 4XIDA 4XRSA 1JTXA 1ETYA 3A01B 3JRHA 2UXIA 2XGDA 3BQYA 1WPKA 3G7RA 4M6VA 4UUSA 2YU9J 3GTGJ 3S16J 3ZOBA 2QCOA 2H8RA 1P7IA 2P81A 3PM1A 1B72B 5EDNA 5D19A 3G1LA 3K7AJ 3JR9A 5M5WJ 2XSDC 5IP7J 3HB9A 1RKTA 3HE0A 4EEFG 1QRYA 3ZQFA 4L62A 5EZHA 2LLKA 1QVUA 2QTQA 2PMZN 5F08A 3QQAA 4A3KJ 4D7MA 4DYRA 4DYQA 1IV6A 2W53A 1UHSA 2Y9ZA 1ZQ3P 2O8KA 3Q0UA 4ABZA 1JUPA 1WCMJ 4A3GJ 1BW6A 2G0EA 1JTYA 5F0CA 3ZQGA 3VOXA 1H88C 3NXCA 4BY1J 5EG0B 3HOVJ 1DU0A 3A01A 3S2HJ 2QIBA 2JJ7A 5EGOA 1X2MA 2YS9A 3JRDA 3BG3A 1BL0A 2M8GX 1GVDA 5J1RA 2ZOYA 3TW7A 2COBA 2JA5J 4CGRA 3MVPA 2CRGA 4IHXA 4MLOA 3BJBA 4NELA 5HSZA 1LFBA 2W48A 5CXIA 4QIWN 4IEJA 1MBJA 2DA1A 2XB0X 1AKHB 4HKUA 4AUXA 2LTPA 3V6GA 1FIPA 3BHQA 2UXPA 1GUUA 3FRQA 4A3DJ 2NS7A 3VVXA 4M3DA 3KKDA 3CDLA 3RQIA 4IHVA 5IOZA 5JLXA 3S14J 1GDTA 5K7ZA 1B8IA 5DAJA 3BR3A 2MW8A 1ZK8A 1F43A 3HIMA 2G7LA 5IP9J 3LOCA 4NDLA 2QOPA 2HI3A 5EG0A 1IDYA 2WB1N 4C3IJ 2ME6A 1UG2A 2YUSA 4BBRJ 5FKMA 2I10A 3LSJA 3A03A 2K9NA 3NRGA 2LR8A 4FISA 2XDNA 3EUPA 2O9LA 2VI6A 3VIBA 3OIOA 2IU5A 1W0TA 3Q0WA 1ZTRA 3O8HA 1WI3A 2TRTA 5IYBJ 2ZB9A 4X1EA 4RBOA 3GTQJ 2REKA 3NNRA 3GTJJ 5F1JA 1FEXA 3CJDA 3I4NJ 5K58A 3FISA 4UUTA 4C3JJ 4FE4A 3E7QA 2Y0SN 3CMYA 2ZCXA 2ECBA 4GFLA 1ZKGA 2LFBA 3GTLJ 3PASA 2OI8A 2OF7A 2G3BA 2DN0A 2H1KA 3IV5A 5HBUA 4BY7J 1HDDC 2NOGA 3MKLA 1FIAA 2LKXA 3COLA 1UI6A 2JK3A 1SGMA 4ICHA 5EZGA 2GFNA 3BR5A 5FKOA 3CRJA 2RHAA 3C2BA 5M5XJ 1BJZA 3HDDA 2NS8A 2XPWA 4JX5A 5FLMJ 2ID3A 1LE8B 1U8BA 4QTRA 2HOTA 1TWAJ 4B1RA 3BR0A 3RZOJ 4CYCA 3QKXA 3BTCA 2K9QA 1APLC 3HEFA 2M34A 1IG7A 1ETXA 3B6CA 2NVYJ 3AQSA 1GT0C 4D7NA 2JA8J 3B81A 1Z0XA 2GM4A 2ME0A 2R0QC 2N8GA 2YVEA 2MSYA 4FTHA 1MSEC 4GFBA 5C4XJ 5EEAA 2AHQA 3VP5A 3NAUA 5M5YJ 2UXUA 2ZOZA 1HF0A 3GTPJ 1UI5A 1ENHA 3JRIA 3JREA 3HTAA 4S0HB 1JKRC 1TWCJ 2R5YB 2JMWA 1UMQA 3ON2A 1JT0A 1IDZA 2GBYA 3S15J 2LD5A 3LSRA 2E1OA 1MNMC 1MBKA 1P7JA 1IGNA 5FMPA 4NN1A 1LE8A 1TWGJ 2HQ5A 5C44J 1Y1VJ 2WV1A 5J1UA 1T33A 1QPIA 4M3FA 3ANGA 3VW0A 1VFCA 1XS9A 4JP0A 4LOCA 4XICA 4AYBN 5IYDJ 1MH4A 3S2DJ 2RAEA 1F36A 4C3HJ 1D5YA 1FTTA 2CQQA 4DW6A 3T6NA 3FK7A 5DTDA 4A93J 4J19A 4XRMA 4MFEA 2UXOA 2IBDA 3V78A 3DPJA 2NVTJ 3LHQA 1B72A 4FE7A 3SFIA 2MG4A 4GFKA 2OERA 2CUEA 5IPAA 3TP0A 4A3FJ 2XGCA 2L9RA 4XRSG 2GLOA 4A3MJ 3IH2A 1ZR2A 3GTKJ 2R5YA 4DZPA 3FKIJ 5J3LA 4RDUA 2NX4A 1IUFA 2EBIA 5M3FJ 3HOYJ 3VVZA 3OOUA 2M2EA 3PO2J 1OCTC 2R7ZJ 4X6AJ 1IJWC 2R93J 5F27A 2E2HJ 1OFCX 1JJ8C 3S17J 4BKXA 5F04A 2NVXJ 2QF7A 2K9SA 3F0CA 2Y30A 4GCKA 3ZQIA 3JRCA 3HOUJ 1JJ6C 1AHDP 1H89C 2DJNA 4GCTA 1I6HJ 2DMPA 3VUQA 4I6ZA 1ETVA 4C2MJ 5M3MJ 3M4OJ 3VPRA 3BTJA 2VKVA 4A3CJ 5IOYA 2HKUA 1AKHA 2EH3A 2WAQN 1JKQC 1U9OA 2FQ4A 1BA5A 4A3EJ 4BXXJ 2GENA 3RH2A 1HLVA 3HOWJ 3CWRA 3ZQLA 3ZQHA 1YRNB 5IYCJ 3S1NJ 5CW8A 3BG9A 5FKNA 5FKKA 5J1YA 4G12A 2JA7J 2NP3A 5AQCA
chains in the Genus database with same CATH superfamily
2KL4A 2E60A 3AFHA 1MJAA 2EA2A 2E35A 2ZJPF 2A2FX 3QYFA 4MO7A 4CCOA 5D4SA 3OV8A 4F52A 1SFOJ 1RESA 2EZHA 2ECCA 2DMUA 2YX4A 5KVRA 4QPQA 4QSHA 2VT2A 1YS7A 1K7AA 2XAQA 4XM3A 3MNLA 3E1SA 5F64A 3H3VK 3PUBA 3DKWA 3VVYA 2FNPA 2GA2A 4I76A 2PQ8A 4MTEA 4AVZA 3PL8A 2EA4A 1WQ2A 3PSIA 2FX0A 1VI0A 1KU2A 3KPHA 1J0RA 3ESWB 3IUVA 3V42A 3FXKA 2UXHA 1XPXA 5C3EJ 1O57A 3W6VA 2P5KA 1WI9A 2HKOA 5L3EA 4DQ2A 2M0MA 3WU2C 5EFYA 5HS7A 1Z05A 4M72A 3VW2A 3SDGA 1AOYA 4CCJA 4OD5A 2COMA 2L0KA 2D5VA 1WJFA 2DAOA 3RPUD 1FTZA 3DEWA 3IWFA 2QM3A 3S8PA 4IOAF 5EGOB 4CSWA 1O3RA 3HTHA 1PYVA 4UHTA 4RLQA 3JRFA 3SQNA 1E3HA 2O6GE 4NHJA 2ZCMA 4PCQA 4W97A 4KDPA 3NS4A 1ETOA 1SFEA 3DFGA 2FBHA 3HKZN 3EPZA 1SFUA 2VODA 4A6DA 1XSDA 1FMVA 1HC8A 2ZMEC 4B3AA 2F5FA 5FD5A 2DA5A 2DO7A 3CZ6A 5F0HA 1AA7A 4LG0B 1T56A 3QRFF 4PGHA 1MDMB 2DXIA 3M3YJ 5F0FA 4ESJA 1LFUP 2PMUA 2F4OB 3CJRB 4EM1A 3JRGA 3S1RJ 2B63J 3B6AA 4G6TB 2XB5A 1B8IB 5FKLA 4U0VA 4ZYDA 3GZ5A 2DTZA 1I27A 2M0CA 4MNUA 4BH9A 2KKOA 5FLXK 2MLKA 3RYRA 2ZO4A 4Y7NJ 3GMEA 3DU5A 4LK0F 2O7TA 2CW8A 3KP7A 3BRUA 2LBFA 2EQRA 3I71A 3D5SC 3Q5FA 1OJLA 1XG1A 3BY6A 2K85A 1Z9CA 3VOEA 3F8NA 3IUOA 2VB6A 3PFIA 2V1XA 2ADUA 5DD8A 4C2MA 2IW5A 3KZYA 3OIPA 4ENMA 2DK5A 3GZNB 4RB0A 3SZGA 3JSJA 3ONQA 5L3GA 1TWFJ 4Y3OA 1ZG1A 1JT6A 1ZGAA 2RASA 2BOLA 1YQAA 4H4KC 3S3MA 1HOMA 3ABKH 1R00A 2KLOA 1SANA 4E7LA 2K86A 1ORKA 3E6CC 3ANPA 5DCMB 5IP6A 1X1CA 4B4CA 3VWBA 2F5EA 1ZGWA 2XPUA 3M8JA 4EJVA 1P4XA 2KT0A 1K61A 1BOAA 4CCKA 2H8WA 1G3TA 4HLXA 4F93B 4PFOA 4Y15A 2ZXWH 2M4GA 1ODDA 2HDDA 2OTJI 3QOPA 2XAGA 5GTHC 2R4GA 3P9TA 3E7LA 2ZCNA 2W82A 1D3YA 3QBMA 2DTRA 2W25A 3FX3A 4ENNA 3OSGA 3C07A 3VSKA 2FXAA 1QVTA 3ABLH 1BJAA 5E3MA 3DP7A 2E1MB 3OYDA 2HOAA 3H9JA 2E7WA 3UNGC 2PZ9A 2BYVE 2VXZA 1VTNC 1ITYA 2XPVA 5CPRB 4F92B 2IT0A 3OMYA 2VQCA 3BT9A 4XOTA 2ESNA 1VQ6I 3V8KA 3I59B 2NP5A 3DQVC 4IHSA 2L01A 4LD5A 2RV8A 4L9NA 1W7PB 5A2QK 4OIQF 1OCPA 3IAM2 5KAIC 5B1AH 5BMZA 2TDXA 2JN6A 5D5VB 1A35A 1IXSB 5LRRA 4Y52J 2GXBA 2KDZA 2F5VA 4EGZA 4MQ9F 2HDWA 1ZLJA 4HNTA 1ZRCA 2L7FP 3PO3J 1ETKA 2KIFA 1RR7A 3GFMA 2JWTA 2FNAA 3BR1A 3KYLA 2AXLA 1MBEA 4CCLA 2VQHA 2QLZA 3KETA 3GZ6A 3BG7A 1GV2A 1LNWA 2WADA 3AQTA 4W1UA 1KYZA 1X58A 2XVCA 5D5UB 1ETQA 1PVEA 2R7RA 3ZQCA 3ZMTA 3PIOF 2QBYA 4BEHB 4NB5A 4BYYA 3WTWC 3FDYA 2L4AA 4HNVA 5D18A 2IEKA 1Y6IA 2CU7A 3A01B 4OMYA 1ETYA 2QQ8A 2P7VB 3V7CA 2X6YA 2XF5A 4M6VA 3VYSB 4HA8A 1JE8A 3HG9A 3GCMA 2H8RA 1P7IA 3PM1A 2HR3A 1FT9A 2L54A 2O3FA 5IY5H 1BBYA 4IQ4A 3JR9A 2XSDC 1OLTA 4E6KG 1P6RA 1S8NA 2BHZA 4LITA 4HRIA 4OAZA 3JTGA 3JCUC 3ZQFA 4L62A 5EZHA 5GAGJ 2W53A 4DYRA 3CCUI 1ZQ3P 4HPQA 3RKWA 2ZSHB 2HDCA 3Q0UA 3ZQGA 3NEUA 2BV6A 1QBJA 2BHYA 4DNCA 5JI6A 3BZ6A 5HNFA 3NXCA 5EG0B 3CCMI 1XSXA 2DT7B 4UB8C 1QU3A 3BCBA 4BE1A 3S2HJ 4M9SA 3BDDA 1BL0A 1GVDA 1LDKB 1B9MA 2COBA 5ILSA 4LLNA 3HHHA 4MLOA 5D8LB 1GLNA 3CCLI 3CP2A 3PIPF 1ON1A 2W48A 4N9HA 4RAZA 2IGOA 3DKXA 4CCNA 3GXOA 3OS2A 4HG2A 1XSVA 4HQMA 5FROA 2O5RA 2UXPA 1GUUA 4BJ5C 2LH9A 2VE9A 3E97A 3RQIA 5JLXA 1IXCA 2LMDA 1XDSA 2QA4I 2R7WA 3PQKA 1UHMA 2G7LA 1WJAA 3KP4A 5IP9J 4L0ZB 2ETHA 4NDLA 2PMHA 1IDYA 2ME6A 1UG2A 4N4NB 5FKMA 2L3DA 3I64A 1TP4A 2MC4A 1EH6A 1UG0A 2L9SA 2WV0A 4ESFA 4UNOA 3OIOA 4G94A 4KFCA 3HUGB 1S3JA 2LNBA 4DBQA 1YTYA 3O8HA 4ZH4F 2W85A 5IYBJ 4LB6B 2JRTA 4RBOA 2L5QA 3CJDA 5J8CA 4NQWA 2FOKA 3L09A 3FISA 4FE4A 5LBQA 2HEOA 2ZCXA 4GYIA 2CQNA 1ZAOA 1ZKGA 3SEZA 1FOXA 1FSEA 1ZRDA 4IRVA 4XORA 4U7BA 4OIRF 4XR6A 3I3LA 1LUJB 3I4PA 1DPRA 5D8KB 3E0JB 1DPUA 3IKVA 5DDGA 1UI6A 2NS0A 2IGNA 1SEUA 4AIKA 1QA6A 4I2OA 3BR5A 1T38A 1OR7A 5FKOA 2X85A 3J7ZI 2E5ZA 2G7UA 1YW8A 3S3NA 3HDDA 1HKQA 4NBQA 2YR2A 2A68F 3CMAI 2RQPA 5FLMJ 2JA2A 3V7RA 3C1DA 1LE8B 4AWXB 1YIJI 1T0FC 5JVGF 5E1WA 3RZOJ 4CYCA 3QKXA 1APLC 4XLHA 2RVCA 1D0XA 4UVAA 2K3PA 1P2FA 1M1EB 2K27A 1N75A 1QHHD 4D7NA 4HX8A 3KE2A 2EIKH 2GAUA 3V7SA 2R0QC 1LPQA 5EJCA 2XF7A 4M9XA 2MSYA 1XMXA 2VKDA 1FZPB 4GFBA 1IAWA 3ZMDA 3FXUA 2UXUA 3Q9SA 3K1NA 2F48A 1UI5A 2VJIA 2F5DA 3JRIA 3M7GA 1HW5A 2QZ8A 3AKZA 3BCAA 2DI3A 3HTAA 1JKRC 1R4MB 4G7ZF 3UR3C 4ETSA 4I02A 2GBYA 2LD5A 1Q1HA 2E1OA 4HNUA 5IT3A 3TQNA 2QSFX 3BZKA 3LSHA 2BY3A 3CTAA 4DBRA 1QPIA 4GGGA 1OQYA 4M3FA 3MWMA 1DDNA 4JP0A 3RPQA 2M45A 3OYNA 1XGNA 3E6BA 4C3HJ 2GIZA 1QNTA 4A93J 1I1SA 2EILH 4J19A 4XRMA 3G71I 4MFEA 4CDGA 3P7NA 3CD6I 1FSHA 4ZYHA 1SD4A 3V78A 2NVTJ 1B72A 3GEZA 1QQIA 3HTUA 5JR3A 4BDZA 1JXSA 5BPDA 2OERA 2DT6A 5IPAA 1XCVA 2ZC2A 3TP0A 4HBLA 3I0TA 1MGTA 1L0OC 1Z67A 2K3FA 2R5YA 4DZPA 1KQ0A 5ERIA 1VQ9I 2D2WA 4HF2A 3F23A 1F5TA 2EBIA 2NRAC 1YFHA 5TGTA 3ZMVA 1KYWA 3DEEA 4LFUA 1HBXG 3OOUA 3BWGA 4RB2C 2Y69H 5KK1A 2M2EA 1Z7UA 4X0GA 4Y13A 5F27A 3BJAA 3ZPLA 2GWRA 3KP6A 2E2HJ 1G8XA 3AG2H 2HGCA 5D5XB 4ESBA 1U5TA 1WJEA 4R1HA 1D1BA 2QF7A 1YI2I 2Y30A 5ICGA 2DFEA 3NWTA 2JPCA 5E1ZB 1IN7A 3K70C 1JJ6C 1AHDP 3A2KA 4BJ6C 5KHDA 1H89C 2DJNA 4GCTA 2FU4A 2JVGA 4BHCA 2PEXA 3OYIA 2A69F 1UB9A 3EUAA 1MMSA 3IC7A 4XKVA 4HX7A 1KU3A 1NG7A 3ZXSA 2EPFA 1U0JA 1AKHA 1VQ8I 1JKQC 1U9OA 2FQ4A 4OIPF 1XGMA 5E1XA 4BXXJ 4PJLA 3RH2A 2GOMA 1HLVA 5TISC 2LOOA 1R36A 3ZQLA 4IX7A 3DTEA 2F4MB 5HNHA 5FKKA 2LY1A 5J1YA 5HAWA 1OYWA 2NP3A 1O3QA 1DP3A 2Y75A 3VTIA 3HXLA 3G2BA 3F8FA 1G3WA 2QBYB 5B5EC 2JZYA 3GBGA 1A6QA 4PJJA 3TO6A 5GP9A 2DA6A 1Z1DA 2XGEA 3ZN1A 4WXHA 3ROUA 1W5CC 3GUDA 2MGQA 1U9NA 3V8LA 3OYGA 1QZZA 1VQPI 4L18B 5B3SH 3G56A 3HOXJ 3IH3A 3B02A 3S32A 2IA0A 2PN6A 4PSXA 4CA0A 1RZ4A 3AG4H 4KT6A 3F1BA 4KNYA 1F9NA 1SVOA 4RM2A 3QYBA 2NVQJ 3KEQA 1VF9A 4HAMA 2DFHA 2CV0A 2ZJRF 4ENKA 2CQXA 1X1DA 1J7KA 1D0ZA 4ACIA 1T95A 1QHGA 1WH7A 4XKWA 4BE0A 1ZH5A 3TBIA 5K5OA 3CC7I 1G6NA 5K7FA 4CZZA 2E1NA 2E2IJ 1OYIA 4XSXF 1H0MA 3NARA 4ON0A 3NPIA 5GADJ 1HKTA 4YRVA 2HTJA 1K6OA 2ZFWA 5KCMA 2NNNA 3FXQA 3OL4A 2IRFG 4BXUA 1IN6A 1H9GA 4E7JA 4EQQA 4YIRX 4JX6A 2M8EA 3BTIA 1FBUA 1R22A 3FXMA 2W7NA 1HCRA 4AM3A 3QU6A 2GUHA 2Q2EA 2H94A 1IN4A 3EETA 1RNLA 2G7GA 1RPWA 2Y31A 2HKXA 2R7QA 3ON4A 2JUCA 1TC3C 3HRTA 5ICEA 4FHTA 1MSFC 1S7AA 3ZRGA 4KMUX 4IF4A 4RAYA 4XLPF 3U2RA 3HBLA 2W24A 4BBSJ 4ZYEA 3LWJA 3SWHA 2QUFA 3DCFA 3F22A 4S05A 5H20A 2M1BA 1VQLI 2DPUA 2Y2ZA 1TT0A 3H0DA 2E19A 3I54A 2ICWG 3MEXA 1PUFA 2X51A 3O6BB 3N97A 3K2AA 4D0PA 4UXNA 4PUSA 4HDVA 4NQWB 1TL8A 4WK8F 4HEA2 3U1KA 2HYJA 1KU9A 4YFNF 3LA2A 4ME9A 5HLTA 2M5WA 4AYBA 5C4JJ 4YELA 4M3BA 1R1VA 2DDBA 4MIMA 3S5RA 1WJCA 3KZ9A 1YITI 1BC7C 2Z1DA 4AC6A 4JKZA 1ON2A 4M71A 2QQBA 2R5ZA 3CCVI 1V5FA 1WH5A 3D0SA 2QWWA 2FE3A 2DA2A 1P4WA 3LSPA 3EGQA 4IXAA 1YJNI 1U3EM 5FFXA 6PAXA 3RSNA 1L3LA 5FD6A 3HGGA 4S04A 3GTMJ 2Q24A 2EZKA 3D1NI 2VKEA 3CMEI 4A3BJ 2V57A 1TQMA 4PXIA 5HLHA 3BG5A 5B66C 4CYCB 2FBIA 3UKGA 5FRMA 2Y48A 5E8GA 1K4SA 2R7UA 3WHCA 3L2VA 3HIFA 4LIVA 4KWAA 1IRFA 5LGTA 1R1UA 3LQRA 3HTIA 2HQAA 3CMMA 3E5UA 1SVMA 5CVIA 3L2QA 3KZZA 2EZLA 4UUSB 4RGSA 1CF7B 1MH3A 2BY2A 2BW3A 2PLYA 1VNDA 2OPTA 5L3FA 1AWCA 3BQZA 4L0YB 2Y9YA 3R0JA 4HV6A 3RD3A 3QPTA 3G1MA 5HDKA 2D6YA 5D5WB 3HTJA 3MN2A 3M1CA 3ULQB 3CF2A 2DW4A 2WAQA 4K2EA 3WODF 3DPTA 3RKQA 4PJ0C 3RI4A 2A5YB 3G73A 3RPUA 3PPBA 4JQFA 4BJTA 2HOSA 2CO5A 2CJJA 2DA7A 2IAIA 1D1CA 2V9PA 3H9QA 2VBZA 1J75A 1R5ID 2A07F 3S1MJ 4KN7X 1HA8A 3ERMA 3VYTB 2MABA 4XL9A 4A5NA 4BL0B 3BP8A 2A6EF 3HGYA 4XRSA 1JTXA 2J5PA 4FETA 3ZR8X 1BI2A 1ERDA 1SFKA 1D8KA 1T6SA 1FOYA 1B72B 5D19A 3J7YJ 5M5WJ 2JT1A 2GA1A 4HV5A 1HQCA 3DPUA 3PQJA 2HQRA 5IP7J 2EINH 3SFZA 1R71A 3HB9A 3RKXA 1RI7A 2DODA 4YFKF 3CUQA 1V5EA 4EATA 4CXFA 2VIXA 2PMZN 3CLOA 3QQAA 4D7MA 1UHSA 4BHPA 2Y9ZA 5GAHJ 2HZTA 4KIBA 2EV6A 2BEOA 1B6AA 2PJRA 5EEHA 2G0EA 5F0CA 3VOXA 4U9LA 2KISA 2Z16A 1DU0A 2YVXA 2DOEA 2STWA 3RYPA 2QIBA 2VOPA 1KA8A 4V19K 2WY8Q 2YS9A 2A6TA 3JRDA 3TW7A 4KA4A 2JA5J 3CCEI 1FYMA 4IHXA 3H5NA 5AONA 3L2CA 3FHZA 2UZKA 1OISA 2PI0A 1S9HA 4KUMA 4Y33A 5DM7F 4ZTFA 1FYLA 2IS4A 4QIWN 2EV0A 1MBJA 2DQLA 3WU1B 3HKZA 1AKHB 2IS6A 2HYFA 4AUXA 2LTPA 3V6GA 1FIPA 3BHQA 4Q48A 2FRHA 5LHHA 4RS8A 4EGYA 3VVXA 3KKDA 3CDLA 4OAYA 1D1AA 2K02A 3S14J 1GDTA 3BR3A 2MC3A 1ZK8A 3RTRA 4DVYP 3K4NA 2QOPA 1H9TA 2X6WA 3OR1C 3W2AA 4C3IJ 2DPDA 1BM9A 4UY8I 4A12A 4C2UA 1ZG5A 1ZGJA 3FXJA 2ZMEA 2KRHA 1FYKA 2LR8A 2YSRA 4FISA 4PK4A 1VQMI 2KP6A 3K4LA 4BHBA 2IS1A 4NC6A 2VONA 4PSWA 2VI6A 2Z99A 4N0BA 4O3MA 1WI3A 3E6MA 2M3AA 3GTQJ 2REKA 1YX5A 3SDBA 1R49A 3R60A 4CICA 1VQ7I 3I4NJ 4C3JJ 3E7QA 2Y0SN 3LWFA 1BC8C 2ECBA 3EUHA 2KPMA 3GTLJ 3PASA 4KITB 2OF7A 4RA2A 2DN0A 2H1KA 2DBBA 3L2WA 1R6RA 5HS9A 3M9AA 3SXYA 4KJZA 1HW2A 5K5RA 5ILUA 1FIAA 1XX5A 4DGWB 1V4RA 4HLYA 4CZCA 5EZGA 2GFNA 2XGXA 2F2EA 1BIAA 5LD2C 2RHAA 2ZNZA 3D5RC 5M5XJ 5FGMA 5BQTA 2NS8A 2MH2A 2XPWA 4JX5A 5TJJA 4EJOA 2KMUA 2W84A 1RR8C 3BR0A 3GLXA 1W36C 1V55H 2OBPA 2P8TA 5J4VA 1OMIA 2P4WA 1VQOI 1K78A 2UWMA 2NVYJ 1F4KA 3AQSA 2IPQX 4BAYA 4Z6YA 2JA8J 3B81A 2V7FA 3DTIA 4E7IA 2GM4A 2Q2EB 4I0BA 1IF1A 1KGSA 1O3SA 1SAXA 2N8GA 4FTHA 4ASNA 1MSEC 5C4XJ 5EEAA 1VQ5I 2AHQA 2O61A 3NAUA 3VP5A 2V9KA 5DCFA 1MMDA 4G7OF 2ZOZA 2HVRA 1ENHA 2LRDA 2UXXA 2ESHA 1T8IA 5H6QA 3C18A 2JMWA 1ZYRF 5J8FA 3S15J 5L3CA 2FUG2 2K5CA 4Q47A 5DM6F 1MNMC 3FXOA 2IGMA 1FP1D 1IGNA 2X0LA 2JRMA 4WCGA 5FMPA 3TMOA 1U2WA 1USTA 2HU9A 1R4NB 2WV1A 3HSEA 5J1UA 1K79A 1VFCA 1XS9A 1MZBA 2V1UA 2NNYA 4LOCA 1REPC 5IYDJ 1IXRC 3S2DJ 2RAEA 3WG9A 2MLGA 1D5YA 2VL8A 4DW6A 3T6NA 2MD5A 3OYLA 3SYTA 2UXOA 2IBDA 3EUKL 3L9FA 3DPJA 4HOBA 1A31A 2W4SA 1V3FA 1GVJA 3GFLA 2HZDA 2VASA 3FWEA 2CS3A 4KIFA 4A3FJ 4PDKA 4XRSG 3KEOA 3U1DA 3SZPA 3WTTC 1BN5A 3FZVA 3VFZA 3FKIJ 3BZCA 4RDUA 2NX4A 1IUFA 3BJOA 3CLQA 5BS6A 4BU2A 3Q9VA 3WTYC 3VVZA 4R79A 5JHFA 1YYVA 5GAEJ 3JSOA 1ZHFA 2RGVA 3PO2J 2R7ZJ 4OOIA 2QQAA 2R93J 1OR7C 2WY7Q 4XSZF 5JVTA 2JTVA 3W2VA 1MMNA 4ZZDA 3S17J 4BKXA 4A0YA 5F04A 2F5CA 3FBIB 3F6VA 2EV5A 3ZQIA 4B09A 2XAJA 3M07A 2LKPA 2CH0A 3OS0A 3WTVC 5H2FC 3B73A 2BW3B 4I6ZA 3MZHA 4YIFA 3M4OJ 3V8JA 3WU0A 2OC6A 1UAAA 4XN3A 2K4BA 5CVRA 1USSA 2EH3A 1XN7A 2KZGA 1DUXC 5CLSA 1RRJA 4A3EJ 1HXDA 3ASOH 4I98B 5HLGA 3CWRA 4MHGA 1YG2A 2A5WA 3ZQHA 5CW8A 3KP5A 3G4SI 5DEQA 4AIJA 2JA7J 2RREA 3QP6A 4B3XA 4A0ZA 4XQFA 4J00A 1Y1WJ 4XBFA 2GZWA 2VPLA 1DP7P 4JX4A 2HYTA 1E3PA 2CW7A 3KKCA 1K83J 2OUMA 4L9TA 4YG2F 2YX7A 4JYKA 3HC7A 3HPGA 2VC0A 3KP2A 4Z2YA 3P9IA 3LAPA 5LEJA 3NI7A 5H9TA 3OSFA 1S7EA 3TDZC 2LG4A 4GCLA 5CXGA 1VQKI 1IUYA 3QWLA 3LAJA 4O6JA 1FOWA 3HM5A 2XAFA 4A3JJ 2UUZA 1ACIA 5EEGA 2P5LC 1ZR4A 3LSTA 5F6FA 1RETA 2Q8KA 3CUQB 4RMNA 1E17A 2EFQA 2AQFA 3CQZJ 3FBNB 2M4KA 3VEPA 3K4JA 5L3BA 5E3NA 3OS1A 5E18F 4YZEA 3GW2A 1SD5A 4D1QA 1NTCA 1IV8A 4D5CA 3JAMZ 4EJWA 1OYYA 3V4GA 2KFDA 2P5VA 3L2RA 3L00A 1R9TJ 2AO9A 3H5AA 2PJRB 1Z77A 4V2GA 2RNJA 1LFPA 4KT5C 4YIIA 3RDIA 5HODA 3E5QA 2VXDA 3FK6A 4N9IA 3LSKA 2XF6A 1EH7A 3BCGA 4AC0A 5E3OA 2LBFB 2R92J 5JHUA 3KNWA 2X6OA 2GXAA 2OTLI 2JSCA 5FJ8J 2VN2A 4U87A 3OR2C 2MBFA 3FXRA 2H6BA 3S2WA 2JUGA 1J59A 2JA6J 3ERED 3R61A 3ZN0A 2O7OA 1U5TC 2MFZA 2XUBA 1UJ8A 3S3OA 2BXYA 2JVHA 3HRSA 4A3LJ 3T1BA 4ITVA 3SZTA 4XLCA 4GYGA 5DUIA 4XONA 4LB5A 1U6GA 2CG4A 3EDPA 3OYAA 1MNEA 4P9UA 1EF4A 1DGRM 1JUMA 3TOBA 2KRFA 1Q1VA 2CWEA 3O8GA 1T0FA 5DS9A 2VJ4A 3JRAA 3O60A 2DQRA 3A02A 3HOTA 3OIQA 4E7HA 2VUMJ 1BR1A 1S5LC 3HSFA 4YEJA 1SAUA 1MBGA 4P9FA 3I58A 4A5MA 2X9DA 3GEUA 3VOKA 1BW5A 3KP3A 3CCYA 1R58A 2HTSA 1UFMA 1XDUA 2ZBKA 4DOZA 5DUKA 2CSOA 2VBXA 3KLNA 2XRNA 3GZIA 3MAJA 3K4MA 1TQIA 4D5FA 4JL3A 1YOVB 1JKPC 1DU6A 1FMWA 2L7ZA 1I5ZA 3KEYA 2DG7A 5AIQA 3I5UA 3FMRA 3LSIA 3W6JB 4BQOA 3H0GJ 4FCYA 3K6GA 4U7DA 2ID6A 2V79A 1ZELA 2KQRA 3BNIA 2V4JC 1ZARA 2VKHA 2Y0MA 4F7ZA 4ZJZA 1EA3A 1TZLA 2G7SA 5GPCA 4NC8A 2OCEA 3WG7H 2AS5F 4G8XA 3IHUA 4PFPA 4MFDA 1MMAA 4IHYA 1SC7A 2DMNA 4CYDA 5EF6A 3DU6A 2QEXI 4BE2A 2PFVA 1X1PA 3M8FA 1H8AC 3S93A 3G6EI 2HXIA 2CFXA 2E2JJ 1LEAA 2ELKA 5H6RA 4XKBA 4UDSA 4NC7A 2LP0A 2VOOA 4BS9A 2CQKA 2Q0OA 4BDYA 2GXGA 1Z91A 2FJ1A 1A6IA 2FD5A 2X6XA 3G3ZA 2DMQA 1XGSA 2ISYA 1PP7U 2OZUA 1WGXA 3MKYB 5CYVA 2XHKA 4XNFA 3DEUA 4JBAA 4I09A 2PBXA 1YLFA 5DCMA 2LY2A 2ACJA 3S1QJ 1R1TA 5D1RA 2LDUA 3BPXA 1ZN2A 2L9NA 3KLOA 2NAZA 4JOMA 4OWRB 1W0UA 4B8XA 1X2NA 2WUIA 2L7MP 2ZNYA 5K7HA 2XKPA 4BQQA 2R7DA 3QPLA 2IJLA 5B1BH 5K1YA 2PBIA 1JHHA 2HWVA 3I4MJ 2YVHA 1YRNA 3T8RA 3K8PC 2BZTA 3L7WA 1U78A 4YFXF 1T98A 4Q4ZF 1MBFA 1EKEA 3RQ4A 4FQGA 2K7LA 1POGA 2LSOA 3K70D 4AU7A 1P9QC 4XK4A 3RKYA 3C3WA 4XOPA 2QYOA 2B9SA 2LYCA 4XIDA 2CV1A 4GDFA 3JRHA 2UXIA 1LJ9A 3DBRB 3J80Z 2YU9J 3GTGJ 4HW0A 2ZJ2A 3ZOBA 4E70A 1LKXA 5E17F 1LDJA 2QCOA 4GXOA 4BXFA 1W7PD 3G1LA 3K7AJ 4IPAA 2FJI1 1IZ1A 2EFOA 3EYYA 1MMGA 4II2A 2HFHA 1RUOA 3CJQB 4D9JA 3HE0A 5LGUA 1T2KA 4EEFG 2RQQA 4XLEA 2A6HF 2LLKA 2QTQA 3AL0B 4HF1A 4DYQA 2RNGA 1IV6A 2KJBA 2PG4A 1X1BA 1Y56A 1WJBA 3I55I 2NVUB 1TNSA 3H3UA 3LSMA 2ISZA 1JUPA 3A1YA 1TT5B 4WXDA 4M6YA 4BEHA 1JTYA 3SEQA 2IVMA 1TBXA 3JSPA 1H88C 2FA5A 3LA3A 2XROA 1LEBA 3HOVJ 3K0LA 3R4KA 5CQGA 1D8JA 3A01A 3BG3A 4I01A 4BQAA 2M8GX 5J1RA 2ZOYA 2XV4S 3T5XA 4IOCF 1TTYA 3DBHB 2HPMA 4CGRA 2CRGA 2OJED 4P55A 5HSZA 4NELA 4UB6C 2Z3YA 1GXQA 4C2TA 1YJ9I 3BG6A 4RGRA 1FLIA 2DA1A 2DFFA 1U8RA 3X2QH 1X3ZB 3FRQA 2NS7A 5ICFA 3OYBA 1K4TA 4M3DA 2F6CA 2L2OA 5IOZA 5K7ZA 1HKSA 3MCZA 4LLGF 4N4OB 3P9KA 2MW8A 2WAEA 3HSRA 3HIMA 4L5IA 3IRQA 2HI3A 5EG0A 4CUGA 2EIMH 2H1LA 2L4MA 4L5JA 5DV5A 4BBRJ 2DYRH 3CO6C 3OY9A 3FM3A 4I0AA 3A03A 2K9NA 4OU0A 3T0YA 3WGIA 3NRGA 5IT9K 2XDNA 1QPMA 2O9LA 3CF5F 3KYDB 3VIBA 3MD2A 2Z9OA 3FKJA 1W0TA 3K4CA 4LG3A 3PNTA 3GF2A 4GRIA 1FP2A 4X1EA 3LFKA 3LA7A 5E79C 2F4IA 5K58A 1E0EA 4KN4X 2JQ7A 1KQ8A 4JK1X 4RGXA 2P0WA 3GVAA 2CUJA 3HZJA 4P5OA 5LLQA 3K1PA 1X3UA 3GO5A 3KZIC 1ONVA 1T39A 4ZDOA 1CGPA 2DLLA 2NOGA 4UVCA 3MKLA 4LLLA 3ELKA 3GFJA 3RIRA 2JK3A 4ENJA 4ICHA 4IHTA 1G4DA 3C2HA 4AD9A 2D45A 1NH3A 4KISA 2JSPA 3CUQC 3HL2A 1WWXA 3CRJA 1Y8QB 2VJJA 4QPOA 1EJ9A 1S7OA 4WWCA 2KJCA 2IA1A 1P4AA 4IQJA 3ABTA 1B4AA 2ID3A 1ZREA 5CKTA 4E7SA 3HUGA 2HOTA 4RB3C 5CJ9A 4IO9F 3BTCA 3FMSA 3HEFA 2M34A 2A3SA 3TO9A 1TLHB 3WTZA 1IG7A 1R23A 1ETXA 3B6CA 1BIBA 1XB4A 3WE2A 1S6LA 2ZKZA 3TOAA 2DYSH 3TL4X 5KAFC 4ZTJA 3CJTB 2YVEA 3IL2A 3QOEA 1Z6RA 3F8MA 3ECHA 3VYUB 5ED4A 3GFIA 4OD4A 2O8XA 3LMMA 2QKLB 3CC2I 1WJ5A 2GIVA 1HF0A 1RUNA 2CV2A 3HTSB 3JW4A 3REOA 1WRJA 1SD7A 3DF8A 3JREA 1VZ0A 4S0HB 1TWCJ 2R5YB 3ON2A 1UMQA 3T8TA 3QAHA 1JT0A 3TO7A 1IDZA 3MKZA 2V9VA 4EJUA 3WGHA 3HHGA 2ZJQF 1OCRH 1MBKA 1K6YA 1P7JA 2KZVA 3OYEA 2M87A 1LE8A 2FMYA 1A36A 2HQ5A 5J4YA 1TQPA 4EV0A 2XIGA 1FC3A 3H35A 5FB2A 5HDNA 3ANGA 1WKMA 4U0WA 3DBLB 4IRGA 3IKTA 1KZHA 1FOKA 3IWZA 2CQQA 1U5TB 4ZDPA 3H1CA 3F21A 1QZEA 4BQNA 3MMYB 2CFOA 2E71A 3J81Z 4L9JA 1B1BA 4GFKA 3I56I 4M74A 5KNLA 2CUEA 3OOPA 2EJRA 2X1CA 4RGUA 1TNTA 2XGCA 3MKWB 2PJPA 2IXSA 4A3MJ 3IH2A 1ZR2A 3GTKJ 3EUHC 3WTXC 2B7EA 2QQ9A 2H6CA 4M6XA 2ELHA 5J3LA 2XDVA 5TRDA 2UV1A 3CESA 4P96A 5M3FJ 3W2WA 3N4MA 3HOYJ 4UUVA 5E8IA 3JAMK 3FXLA 1FBSA 2PMZA 1YO5C 1UCRA 3HOSA 5HS8A 2XASA 2VE8A 1OCTC 2HS5A 3HYIA 1IJWC 1XMKA 1HSJA 1UELB 2WWYA 2UXNA 2C6YA 1A04A 4WIBA 4OINF 2HQNA 1JJ8C 3NQOA 3BC8A 2NVXJ 2W57A 4CHUA 2K9SA 3ABMH 3F0CA 4GCKA 1O7FA 3HOUJ 3KCCA 1ZG3A 2EFWA 2R7FA 2VBYA 4BUPA 1ETVA 4C2MJ 5M3MJ 3VSLA 4I7HA 3OYFA 2B3WA 3BTJA 5D6FA 2B0LA 2OAZA 5DD4A 1J5YA 3ZP5A 4PGGA 2DOAA 1BA5A 2QSHX 1KQ9A 1YIOA 3DV8A 2GENA 3OWTA 2VJ5A 3CDIA 1YRNB 3K2ZA 5IYCJ 5FKNA 2XAUA 4AVPA 4R8HA 1I1GA 1RC9A 3W3CA 5AQCA 4MXMA 1HDPA 2OD5A 3BLYA 4M73A 4FX4A 4XLFA 3HOZJ 2F07A 2X4HA 4DYCA 3FHNA 2ZSIB 2XC7A 3BJ6A 1IRZA 2O03A 3LJLA 3CC4I 4Y4RA 2CUFA 2ZXIA 3G1OA 1IC8A 2A61A 5J6XA 2DDAA 4CCMA 1O7LA 1JUSA 4MTDA 5LEKA 1Y0NA 2FBQA 3NRVA 1WHUA 1XGOA 5EYRA 3TW6A 5JLWA 1X19A 4A0XA 5FLVA 4A3IJ 5GPAA 3EYIA 4RLFA 5BPIA 2MH9A 1BR4A 1JGGA 3WHBA 2Y0SA 4LGWA 1Z3XA 1NG6A 1UHWA 1NK2P 3VODA 1G3SA 4F3QA 2X48A 3JRBA 2EZIA 3K69A 4BNCA 1JGSA 4M3EA 4J01A 1CQTA 5CVUA 3MZ8A 1Z6TA 2V1NA 2LC2A 4PJMA 2E34A 4LIUA 2LVSA 2QVOA 1EH8A 2OQRA 2ZXJA 2CW0F 3CJNA 2LREA 3AL0C 2V1DA 1XC5A 1ETWA 2EWNA 4WF2A 4A69C 2BBYA 4DZJA 5IT9Z 1WFXA 5HLIA 4L9VA 4HF0A 3LNQA 1STZA 3TGNA 2VPRA 1FJLA 1GV5A 4P1WA 2WGBA 3OYMA 3WGGA 1B59A 1E2XA 3IH4A 4CGZA 3BR2A 3E3VA 1PUFB 2DG8A 3F9KA 1LVKA 4LMYA 3ZMSA 4HDUA 3RZDJ 1A5JA 3GTOJ 1ZLKA 4E4HA 2KIMA 2PFBA 2TCTA 1J9IA 3ZQQA 2IGKA 1AU7A 3QPHA 3EQLF 2FSWA 1ULYA 4RAFA 4F55A 2YPRA 2OA4A 2KDOA 2R5ZB 2FF4A 3TP3A 2ZFUA 1I50J 3COAC 2LY9A 4AF5A 3QPSA 3BOQA 2ZCWA 1TW3A 4JNNA 4IZZA 2K4JA 1BI0A 1W36D 4OMZA 4Q5SF 3MZYA 5F1RA 1TW2A 1YW7A 3BR6A 4KICA 5DYMA 1G2HA 3AG3H 4MEXF 2D1HA 1PJRA 5LRSA 1TWHJ 1E3OC 5FGLA 1RIOH 4MEYF 3K10A 5HVQC 2DA3A 3DTKA 3E6DA 3H92A 3ISPA 1NK3P 4G6DA 5FO5A 3J80K 3F8BA 3SJMA 3PNVA 3H9GA 2QENA 3CCSI 2R7XA 2R7OA 2E1CA 1O4XA 3L2UA 2DU9A 1I3QJ 4ZZLA 4Y17A 1VQNI 2H27A 2E7XA 2XRLA 2DA4A 4V2FA 2HXOA 4L5EA 3JTHA 4MK6A 1F1ZA 2CMPA 2H09A 9ANTA 1I6XA 4UVBA 2R7VA 2WA0A 2XSJC 2HOEA 1XCBA 3GX4X 3RCOA 2DOFA 1X3WB 2W00A 3BTLA 5BNGA 2QWTA 3N05A 5E3LA 1QZYA 4CO8A 4NNJA 3D5LA 3E5XA 1Z3YA 3LSGA 5D6EA 1RKWA 4ZC3A 5JFRA 4QLCU 3GWZA 1MBHA 2LK2A 2L7KA 4XKCA 1Z21A 2K40A 2QKOA 4FT8A 4GCVA 3L1PA 2XKOA 4BACA 2MYSA 4H0EA 2FMLA 2BY0A 2VLAA 4G7HF 2FOWA 3FF5A 4CH7A 3ZMUA 5D4RA 2EFNA 2VBWA 2M9HA 4RB1A 1IN8A 3VW1A 4XLAA 2LF7A 4M3GA 4AIHA 2DMTA 2VC1A 2XAHA 4BGDA 1DQUA 2QSGX 1Y8RB 2W1OA 3Q0VA 5FLXZ 3ZMZA 5C4YA 4A2UA 4MGRA 2BY1A 2NYXA 3DPLC 3HJEA 3I9V2 3TEDA 1JKOC 1T08B 3IP4B 3LQQA 2RDPA 2HNHA 2OCCH 2BVMA 4IHWA 3Q3SA 4EMSA 1FNNA 3LL7A 4KIGA 2RN7A 2I5UA 3C2GA 2M7AA 2RC4A 5FHPA 2HPIA 3A0BC 3F3XA 3GLLA 2M30A 1SD6A 3FIWA 4QWQA 2DT5A 2XGDA 2WC2A 1KONA 3BQYA 1WPKA 4RAGA 3G7RA 4UUSA 1BR2A 1CF7A 3S16J 2OV7A 3A0HC 3KX2A 3QYEA 5LHGA 1WSUA 2P81A 2R3SA 5EDNA 3SHFA 1X1AA 2HYGD 2Q1ZB 3DXJF 3PFYA 2VQLA 2IP2A 1RKTA 3PNYA 3H3ZA 1QRYA 3HRUA 1MD0A 2VQGA 5LGNA 4HX4A 3IRRA 3ECOA 3M1EA 5FRNA 3J7AY 2HVQA 1QVUA 5F08A 5LHIA 4A3KJ 1FWZA 1OCZH 1Y39A 1ZRFA 1GXPA 2O8KA 2OQGA 2STTA 4XLNF 4ABZA 4XN0A 1HSTA 1S29A 2BVLA 3LFUA 1WCMJ 4A3GJ 1BW6A 4WX9A 3ML6A 1WZ2A 4BY1J 2RKHA 2DK8A 2KIUA 1LVAA 3DKYA 3DLLF 3RJPA 4FASD 1W5TA 4IL6C 1XMAA 2JJ7A 5EGOA 2ZMEB 2Z2SB 1X2MA 3C7JA 2X1EA 3J7AO 2EIJH 1QGPA 3F8CA 4WXCA 4IKFA 5A2QZ 2AQEA 1R7JA 3MVPA 2V6EA 3P9CA 3BJBA 1LFBA 2K9LA 2R7SA 5CXIA 1NHAA 1S72I 3MFKA 4C9YA 5CQEA 2G7HA 4IEJA 1R5GA 2XB0X 4HKUA 5J40A 2FBKA 4LG0A 4G9YA 1J09A 4C30A 1MDMA 3VB2A 1OCCH 2QGUA 2BE5F 4A3DJ 4PZJA 5AIPA 4IHVA 3OL3A 1G59A 3IAS2 1N25A 1YW9A 1B8IA 3HPHA 5DAJA 1F43A 3OYCA 1IW7F 3LOCA 3QODA 2WB1N 5L3DA 4DJAA 3F6OA 2YUSA 2I10A 1WJDA 3CDHA 4G6QA 3LSJA 1YS6A 1P92A 4EM2A 4EJTA 3FM5A 3EUPA 3AAFA 3W6KB 3FMQA 3PJRA 2WTEA 1O3TA 2IU5A 3Q0WA 1ZTRA 1IRGA 1OCOH 2TRTA 2ZB9A 2E1MC 3DLAA 4MQVA 1YE9A 3NNRA 2JPBA 3GTJJ 1G3YA 3KYCB 4IRHA 2ELJA 5F1JA 1FEXA 1K78B 2DFIA 4UUTA 4RM3A 2P6SA 3VYRB 2EK5A 3CMYA 3NWSA 3CP8A 4I99C 4GFLA 4HYEA 2LFBA 4II3A 3J81K 1IRXA 2G3BA 2OI8A 1QO0D 3IV5A 3K4BA 5HBUA 1BI3A 4BY7J 1HDDC 1LB2A 2GOXB 2NOJB 1PP8F 2LKXA 4XMYA 3ZCOA 3COLA 2KRCA 1YHQI 1SGMA 1W4MA 5BOXA 4B43A 1FX7A 4DIQA 3U21A 1I3AA 3R0AA 3C2BA 2OZ6A 3ZGKA 2WB1A 3GYHX 3U9GA 1BJZA 1PDNC 1SVLA 1XD7A 3BPVA 1J2XA 2DCEA 2CYYA 4LJZF 3OYJA 2CGPA 2BGCA 2HVSA 3KIOA 1PUEE 1U8BA 2R7TA 1BOBA 4QTRA 1TWAJ 4UV8A 5CVJA 4B1RA 3K1MA 2K9QA 1V5GA 3BROA 4KYWA 4E7ZA 4B44A 3ASNH 1GT0C 4LK1F 1LQ1A 1Z0XA 3QU3A 3TDUC 3I59A 2ME0A 2A05A 4TV7A 1MNDA 4IRIA 1W7PA 2PX9A 4FX0A 4AIDA 1VQ4I 3PSFA 1FY7A 2G9WA 5M5YJ 2QKMB 4ZYAA 1EV7A 3MQ0A 3VDXA 3CCRI 1UZCA 4XRFA 3GTPJ 4ZDLA 4HZFA 4PJNA 2VT3A 3M8EA 2AXTC 2O0YA 4HSTA 2LF8A 2WBMA 2WAFA 5CVVA 3LSRA 2ZY9A 5FFZA 2L02A 4NN1A 2GQQA 2ZXHA 1TWGJ 1W5SA 5C44J 4OIOF 1Y1VJ 2NXNB 2KIQA 3CUOA 1T33A 3OYKA 1DGWY 3VW0A 4B47A 4A6EA 5HOOA 4F91B 4XICA 3ABUA 5HDGA 4AYBN 1MH4A 1SMTA 1F36A 4EVIA 1FTTA 4UV9A 2BXZA 3FK7A 5DTDA 3ZQ7A 3QP5A 2Z5UA 3O2PE 1SMYF 1N77A 1FBQA 1XTAA 2DJIA 3AG1H 2M7BA 4M9ZA 2V26A 4HQEA 3LHQA 2X1DA 4B48A 4EM0B 3WTSC 3CCJI 3A4CA 2P6TA 1B9NA 1OPCA 2EB7A 1MIJA 2EFPA 2MG4A 4FE7A 3SFIA 5LFAA 1KU7A 2I8DA 4KMFA 2E5NA 1N78A 5K5QA 3CCQI 1HW1A 2L9RA 1LDDA 2GLOA 5GTIC 2E36A 1V54H 3R6SA 3K9TA 4U9NA 2MD0A 2L9VA 1MKMA 3F72A 3H36A 3WE3A 1X4PA 2CQ7A 3PUFA 1R5HA 5J47A 1Z7LA 2CUZA 1OKRA 1IO2A 4IJAA 3DWLE 4U0YA 3P5JA 1MW7A 1WVRA 2J5OA 4X6AJ 3H5RA 5ILVA 2P7CB 2V6CA 4U88A 4IVNA 1OFCX 1Y0UA 3HRMA 3K4KA 1MJ9A 1X4OA 4E7KA 2OU2A 4NUBA 3OYHA 2B1EA 1C0WA 1D5VA 3JRCA 1W1WE 2YU3A 4HSRA 2DMPA 1I6HJ 3VUQA 1JI8A 2D1VA 4O5VA 1BI1A 1I39A 3VPRA 1YJWI 2FQ3A 5ICCA 2VKVA 1D0YA 4ZYGA 1FPQA 5IOYA 4A3CJ 2WAQN 2HKUA 1IN5A 1GHCA 1MJBA 2LKSA 3KFWX 4GO1A 3O3KA 3HOWJ 3I53A 3CO7C 3TKYA 3WTUC 2IA2A 2MA3A 3S1NJ 2K9MA 1YX3A 3BG9A 5E20A 1JHFA 2KHMA 2IS2A 2FEZA 4G12A 1SFXA 4ANJA 2Z33A
chains in the Genus database with same CATH topology
1Y1WJ 4MXMA 1HDPA 4JX4A 2HYTA 3KKCA 1K83J 3HOZJ 2F07A 4JYKA 4MO7A 1SFOJ 4DYCA 1RESA 2EZHA 2ECCA 2DMUA 1IRZA 3GBGA 3LJLA 5GP9A 2DA6A 3NI7A 4QSHA 2CUFA 2XGEA 5H9TA 3OSFA 1S7EA 3MNLA 4GCLA 2MGQA 3H3VK 3G1OA 1U9NA 5CXGA 1IC8A 3VVYA 4I76A 3G56A 1JUSA 3HOXJ 3HM5A 3IH3A 4A3JJ 2FX0A 1VI0A 2FBQA 5EYRA 1ZR4A 3TW6A 3F1BA 5JLWA 2NVQJ 3IUVA 1RETA 1VF9A 5FLVA 4A3IJ 5GPAA 2CQXA 1JGGA 3WHBA 2UXHA 4ACIA 5C3EJ 1WH7A 3CQZJ 5E3NA 3W6VA 1NK2P 4YZEA 2X48A 1NTCA 4D5CA 5K7FA 3JRBA 2EZIA 4M3EA 5EFYA 2E2IJ 1CQTA 1R9TJ 3VW2A 3NARA 3SDGA 2AO9A 3NPIA 1Z77A 4V2GA 2L0KA 5HODA 2D5VA 2LVSA 3FK6A 1FTZA 1XC5A 1ETWA 3DEWA 3BCGA 4A69C 4AC0A 4DZJA 5E3OA 5EGOB 2R92J 3HTHA 2X6OA 3KNWA 4JX6A 3LNQA 5FJ8J 3JRFA 2VPRA 3BTIA 1FJLA 1GV5A 2WGBA 2ZCMA 2JA6J 3IH4A 4W97A 3BR2A 1PUFB 1HCRA 2DG8A 1ETOA 3HKZN 2GUHA 2O7OA 3RZDJ 1A5JA 3GTOJ 4B3AA 2DA5A 2TCTA 5F0HA 4A3LJ 2G7GA 1RPWA 2Y31A 1T56A 1AU7A 3M3YJ 3ON4A 1EF4A 5F0FA 1LFUP 1TC3C 1JUMA 3JRGA 3S1RJ 1MSFC 2B63J 3B6AA 2XB5A 1B8IB 1Q1VA 5FKLA 3TP3A 2R5ZB 3O8GA 5DS9A 1I50J 2LY9A 4AF5A 2DTZA 3QPSA 2M0CA 3JRAA 3O60A 3A02A 2VUMJ 3HBLA 4JNNA 4Y7NJ 4BBSJ 1MBGA 2O7TA 3LWJA 3DCFA 2X9DA 3BR6A 3BRUA 2EQRA 3GEUA 3VOKA 1G2HA 1BW5A 3CCYA 1OJLA 1XG1A 1TWHJ 1E3OC 2Y2ZA 2E19A 1PUFA 5FGLA 3GZIA 4D5FA 3K2AA 4JL3A 1JKPC 1DU6A 2L7ZA 3JSJA 2DA3A 2DG7A 1TWFJ 2HYJA 4ME9A 1JT6A 2RASA 1NK3P 3H0GJ 5C4JJ 4FCYA 5HAWA 3SJMA 1HOMA 2ID6A 4M3BA 3S5RA 4MIMA 1O4XA 1SANA 3KZ9A 1ORKA 4AC6A 3ANPA 3BNIA 1I3QJ 4JKZA 5IP6A 4B4CA 2R5ZA 1ZGWA 2XPUA 1WH5A 2G7SA 5GPCA 2XRLA 2DA4A 4V2FA 2KT0A 2DA2A 2HXOA 4L5EA 3LSPA 1K61A 3EGQA 4MK6A 4MFDA 4IHYA 9ANTA 2DMNA 5EF6A 2HDDA 3HGGA 3P9TA 1H8AC 3GTMJ 2Q24A 2EZKA 2HXIA 3E7LA 3BTLA 5BNGA 2VKEA 3D1NI 2E2JJ 2ELKA 2QWTA 2ZCNA 3QBMA 5E3LA 3OSGA 3C07A 4A3BJ 2V57A 4UDSA 2LP0A 4PXIA 3BG5A 1QVTA 3LSGA 1RKWA 5E3MA 4CYCB 1MBHA 2LK2A 2HOAA 3UKGA 2FJ1A 2PZ9A 1A6IA 2FD5A 1ITYA 2XPVA 3WHCA 2DMQA 2K40A 2QKOA 4KWAA 3BT9A 3L1PA 1WGXA 3HTIA 2NP5A 2EZLA 4UUSB 2PBXA 1MH3A 1OCPA 2M9HA 1VNDA 2OPTA 3VW1A 3S1QJ 3BQZA 2JN6A 5D1RA 2Y9YA 4M3GA 1W0UA 2DMTA 2WUIA 3RD3A 4Y52J 1X2NA 3G1MA 2D6YA 2KDZA 2L7MP 3HTJA 5K7HA 3Q0VA 3MN2A 2L7FP 3PO3J 5C4YA 1ETKA 3QPLA 1RR7A 3I4MJ 2JWTA 3BR1A 2YVHA 3TEDA 1JKOC 1YRNA 1MBEA 3RKQA 1U78A 1GV2A 3AQTA 4W1UA 4IHWA 3Q3SA 1MBFA 1X58A 1ETQA 3ZQCA 3PPBA 2HOSA 1POGA 5FHPA 2CJJA 2DA7A 2IAIA 3S1MJ 4XK4A 4HNVA 5D18A 2IEKA 3FIWA 3HGYA 2CU7A 4XIDA 4XRSA 1JTXA 1ETYA 3A01B 3JRHA 2UXIA 2XGDA 3BQYA 1WPKA 3G7RA 4M6VA 4UUSA 2YU9J 3GTGJ 3S16J 3ZOBA 2QCOA 2H8RA 1P7IA 2P81A 3PM1A 1B72B 5EDNA 5D19A 3G1LA 3K7AJ 3JR9A 5M5WJ 2XSDC 5IP7J 3HB9A 1RKTA 3HE0A 4EEFG 1QRYA 3ZQFA 4L62A 5EZHA 2LLKA 1QVUA 2QTQA 2PMZN 5F08A 3QQAA 4A3KJ 4D7MA 4DYRA 4DYQA 1IV6A 2W53A 1UHSA 2Y9ZA 1ZQ3P 2O8KA 3Q0UA 4ABZA 1JUPA 1WCMJ 4A3GJ 1BW6A 2G0EA 1JTYA 5F0CA 3ZQGA 3VOXA 1H88C 3NXCA 4BY1J 5EG0B 3HOVJ 1DU0A 3A01A 3S2HJ 2QIBA 2JJ7A 5EGOA 1X2MA 2YS9A 3JRDA 3BG3A 1BL0A 2M8GX 1GVDA 5J1RA 2ZOYA 3TW7A 2COBA 2JA5J 4CGRA 3MVPA 2CRGA 4IHXA 4MLOA 3BJBA 4NELA 5HSZA 1LFBA 2W48A 5CXIA 4QIWN 4IEJA 1MBJA 2DA1A 2XB0X 1AKHB 4HKUA 4AUXA 2LTPA 3V6GA 1FIPA 3BHQA 2UXPA 1GUUA 3FRQA 4A3DJ 2NS7A 3VVXA 4M3DA 3KKDA 3CDLA 3RQIA 4IHVA 5IOZA 5JLXA 3S14J 1GDTA 5K7ZA 1B8IA 5DAJA 3BR3A 2MW8A 1ZK8A 1F43A 3HIMA 2G7LA 5IP9J 3LOCA 4NDLA 2QOPA 2HI3A 5EG0A 1IDYA 2WB1N 4C3IJ 2ME6A 1UG2A 2YUSA 4BBRJ 5FKMA 2I10A 3LSJA 3A03A 2K9NA 3NRGA 2LR8A 4FISA 2XDNA 3EUPA 2O9LA 2VI6A 3VIBA 3OIOA 2IU5A 1W0TA 3Q0WA 1ZTRA 3O8HA 1WI3A 2TRTA 5IYBJ 2ZB9A 4X1EA 4RBOA 3GTQJ 2REKA 3NNRA 3GTJJ 5F1JA 1FEXA 3CJDA 3I4NJ 5K58A 3FISA 4UUTA 4C3JJ 4FE4A 3E7QA 2Y0SN 3CMYA 2ZCXA 2ECBA 4GFLA 1ZKGA 2LFBA 3GTLJ 3PASA 2OI8A 2OF7A 2G3BA 2DN0A 2H1KA 3IV5A 5HBUA 4BY7J 1HDDC 2NOGA 3MKLA 1FIAA 2LKXA 3COLA 1UI6A 2JK3A 1SGMA 4ICHA 5EZGA 2GFNA 3BR5A 5FKOA 3CRJA 2RHAA 3C2BA 5M5XJ 1BJZA 3HDDA 2NS8A 2XPWA 4JX5A 5FLMJ 2ID3A 1LE8B 1U8BA 4QTRA 2HOTA 1TWAJ 4B1RA 3BR0A 3RZOJ 4CYCA 3QKXA 3BTCA 2K9QA 1APLC 3HEFA 2M34A 1IG7A 1ETXA 3B6CA 2NVYJ 3AQSA 1GT0C 4D7NA 2JA8J 3B81A 1Z0XA 2GM4A 2ME0A 2R0QC 2N8GA 2YVEA 2MSYA 4FTHA 1MSEC 4GFBA 5C4XJ 5EEAA 2AHQA 3VP5A 3NAUA 5M5YJ 2UXUA 2ZOZA 1HF0A 3GTPJ 1UI5A 1ENHA 3JRIA 3JREA 3HTAA 4S0HB 1JKRC 1TWCJ 2R5YB 2JMWA 1UMQA 3ON2A 1JT0A 1IDZA 2GBYA 3S15J 2LD5A 3LSRA 2E1OA 1MNMC 1MBKA 1P7JA 1IGNA 5FMPA 4NN1A 1LE8A 1TWGJ 2HQ5A 5C44J 1Y1VJ 2WV1A 5J1UA 1T33A 1QPIA 4M3FA 3ANGA 3VW0A 1VFCA 1XS9A 4JP0A 4LOCA 4XICA 4AYBN 5IYDJ 1MH4A 3S2DJ 2RAEA 1F36A 4C3HJ 1D5YA 1FTTA 2CQQA 4DW6A 3T6NA 3FK7A 5DTDA 4A93J 4J19A 4XRMA 4MFEA 2UXOA 2IBDA 3V78A 3DPJA 2NVTJ 3LHQA 1B72A 4FE7A 3SFIA 2MG4A 4GFKA 2OERA 2CUEA 5IPAA 3TP0A 4A3FJ 2XGCA 2L9RA 4XRSG 2GLOA 4A3MJ 3IH2A 1ZR2A 3GTKJ 2R5YA 4DZPA 3FKIJ 5J3LA 4RDUA 2NX4A 1IUFA 2EBIA 5M3FJ 3HOYJ 3VVZA 3OOUA 2M2EA 3PO2J 1OCTC 2R7ZJ 4X6AJ 1IJWC 2R93J 5F27A 2E2HJ 1OFCX 1JJ8C 3S17J 4BKXA 5F04A 2NVXJ 2QF7A 2K9SA 3F0CA 2Y30A 4GCKA 3ZQIA 3JRCA 3HOUJ 1JJ6C 1AHDP 1H89C 2DJNA 4GCTA 1I6HJ 2DMPA 3VUQA 4I6ZA 1ETVA 4C2MJ 5M3MJ 3M4OJ 3VPRA 3BTJA 2VKVA 4A3CJ 5IOYA 2HKUA 1AKHA 2EH3A 2WAQN 1JKQC 1U9OA 2FQ4A 1BA5A 4A3EJ 4BXXJ 2GENA 3RH2A 1HLVA 3HOWJ 3CWRA 3ZQLA 3ZQHA 1YRNB 5IYCJ 3S1NJ 5CW8A 3BG9A 5FKNA 5FKKA 5J1YA 4G12A 2JA7J 2NP3A 5AQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W J;  4MXM A;  1HDP A;  4JX4 A;  2HYT A;  3KKC A;  1K83 J;  3HOZ J;  2F07 A;  4JYK A;  4MO7 A;  1SFO J;  4DYC A;  1RES A;  2EZH A;  2ECC A;  2DMU A;  1IRZ A;  3GBG A;  3LJL A;  5GP9 A;  2DA6 A;  3NI7 A;  4QSH A;  2CUF A;  2XGE A;  5H9T A;  3OSF A;  1S7E A;  3MNL A;  4GCL A;  2MGQ A;  3H3V K;  3G1O A;  1U9N A;  5CXG A;  1IC8 A;  3VVY A;  4I76 A;  3G56 A;  1JUS A;  3HOX J;  3HM5 A;  3IH3 A;  4A3J J;  2FX0 A;  1VI0 A;  2FBQ A;  5EYR A;  1ZR4 A;  3TW6 A;  3F1B A;  5JLW A;  2NVQ J;  3IUV A;  1RET A;  1VF9 A;  5FLV A;  4A3I J;  5GPA A;  2CQX A;  1JGG A;  3WHB A;  2UXH A;  4ACI A;  5C3E J;  1WH7 A;  3CQZ J;  5E3N A;  3W6V A;  1NK2 P;  4YZE A;  2X48 A;  1NTC A;  4D5C A;  5K7F A;  3JRB A;  2EZI A;  4M3E A;  5EFY A;  2E2I J;  1CQT A;  1R9T J;  3VW2 A;  3NAR A;  3SDG A;  2AO9 A;  3NPI A;  1Z77 A;  4V2G A;  2L0K A;  5HOD A;  2D5V A;  2LVS A;  3FK6 A;  1FTZ A;  1XC5 A;  1ETW A;  3DEW A;  3BCG A;  4A69 C;  4AC0 A;  4DZJ A;  5E3O A;  5EGO B;  2R92 J;  3HTH A;  2X6O A;  3KNW A;  4JX6 A;  3LNQ A;  5FJ8 J;  3JRF A;  2VPR A;  3BTI A;  1FJL A;  1GV5 A;  2WGB A;  2ZCM A;  2JA6 J;  3IH4 A;  4W97 A;  3BR2 A;  1PUF B;  1HCR A;  2DG8 A;  1ETO A;  3HKZ N;  2GUH A;  2O7O A;  3RZD J;  1A5J A;  3GTO J;  4B3A A;  2DA5 A;  2TCT A;  5F0H A;  4A3L J;  2G7G A;  1RPW A;  2Y31 A;  1T56 A;  1AU7 A;  3M3Y J;  3ON4 A;  1EF4 A;  5F0F A;  1LFU P;  1TC3 C;  1JUM A;  3JRG A;  3S1R J;  1MSF C;  2B63 J;  3B6A A;  2XB5 A;  1B8I B;  1Q1V A;  5FKL A;  3TP3 A;  2R5Z B;  3O8G A;  5DS9 A;  1I50 J;  2LY9 A;  4AF5 A;  2DTZ A;  3QPS A;  2M0C A;  3JRA A;  3O60 A;  3A02 A;  2VUM J;  3HBL A;  4JNN A;  4Y7N J;  4BBS J;  1MBG A;  2O7T A;  3LWJ A;  3DCF A;  2X9D A;  3BR6 A;  3BRU A;  2EQR A;  3GEU A;  3VOK A;  1G2H A;  1BW5 A;  3CCY A;  1OJL A;  1XG1 A;  1TWH J;  1E3O C;  2Y2Z A;  2E19 A;  1PUF A;  5FGL A;  3GZI A;  4D5F A;  3K2A A;  4JL3 A;  1JKP C;  1DU6 A;  2L7Z A;  3JSJ A;  2DA3 A;  2DG7 A;  1TWF J;  2HYJ A;  4ME9 A;  1JT6 A;  2RAS A;  1NK3 P;  3H0G J;  5C4J J;  4FCY A;  5HAW A;  3SJM A;  1HOM A;  2ID6 A;  4M3B A;  3S5R A;  4MIM A;  1O4X A;  1SAN A;  3KZ9 A;  1ORK A;  4AC6 A;  3ANP A;  3BNI A;  1I3Q J;  4JKZ A;  5IP6 A;  4B4C A;  2R5Z A;  1ZGW A;  2XPU A;  1WH5 A;  2G7S A;  5GPC A;  2XRL A;  2DA4 A;  4V2F A;  2KT0 A;  2DA2 A;  2HXO A;  4L5E A;  3LSP A;  1K61 A;  3EGQ A;  4MK6 A;  4MFD A;  4IHY A;  9ANT A;  2DMN A;  5EF6 A;  2HDD A;  3HGG A;  3P9T A;  1H8A C;  3GTM J;  2Q24 A;  2EZK A;  2HXI A;  3E7L A;  3BTL A;  5BNG A;  2VKE A;  3D1N I;  2E2J J;  2ELK A;  2QWT A;  2ZCN A;  3QBM A;  5E3L A;  3OSG A;  3C07 A;  4A3B J;  2V57 A;  4UDS A;  2LP0 A;  4PXI A;  3BG5 A;  1QVT A;  3LSG A;  1RKW A;  5E3M A;  4CYC B;  1MBH A;  2LK2 A;  2HOA A;  3UKG A;  2FJ1 A;  2PZ9 A;  1A6I A;  2FD5 A;  1ITY A;  2XPV A;  3WHC A;  2DMQ A;  2K40 A;  2QKO A;  4KWA A;  3BT9 A;  3L1P A;  1WGX A;  3HTI A;  2NP5 A;  2EZL A;  4UUS B;  2PBX A;  1MH3 A;  1OCP A;  2M9H A;  1VND A;  2OPT A;  3VW1 A;  3S1Q J;  3BQZ A;  2JN6 A;  5D1R A;  2Y9Y A;  4M3G A;  1W0U A;  2DMT A;  2WUI A;  3RD3 A;  4Y52 J;  1X2N A;  3G1M A;  2D6Y A;  2KDZ A;  2L7M P;  3HTJ A;  5K7H A;  3Q0V A;  3MN2 A;  2L7F P;  3PO3 J;  5C4Y A;  1ETK A;  3QPL A;  1RR7 A;  3I4M J;  2JWT A;  3BR1 A;  2YVH A;  3TED A;  1JKO C;  1YRN A;  1MBE A;  3RKQ A;  1U78 A;  1GV2 A;  3AQT A;  4W1U A;  4IHW A;  3Q3S A;  1MBF A;  1X58 A;  1ETQ A;  3ZQC A;  3PPB A;  2HOS A;  1POG A;  5FHP A;  2CJJ A;  2DA7 A;  2IAI A;  3S1M J;  4XK4 A;  4HNV A;  5D18 A;  2IEK A;  3FIW A;  3HGY A;  2CU7 A;  4XID A;  4XRS A;  1JTX A;  1ETY A;  3A01 B;  3JRH A;  2UXI A;  2XGD A;  3BQY A;  1WPK A;  3G7R A;  4M6V A;  4UUS A;  2YU9 J;  3GTG J;  3S16 J;  3ZOB A;  2QCO A;  2H8R A;  1P7I A;  2P81 A;  3PM1 A;  1B72 B;  5EDN A;  5D19 A;  3G1L A;  3K7A J;  3JR9 A;  5M5W J;  2XSD C;  5IP7 J;  3HB9 A;  1RKT A;  3HE0 A;  4EEF G;  1QRY A;  3ZQF A;  4L62 A;  5EZH A;  2LLK A;  1QVU A;  2QTQ A;  2PMZ N;  5F08 A;  3QQA A;  4A3K J;  4D7M A;  4DYR A;  4DYQ A;  1IV6 A;  2W53 A;  1UHS A;  2Y9Z A;  1ZQ3 P;  2O8K A;  3Q0U A;  4ABZ A;  1JUP A;  1WCM J;  4A3G J;  1BW6 A;  2G0E A;  1JTY A;  5F0C A;  3ZQG A;  3VOX A;  1H88 C;  3NXC A;  4BY1 J;  5EG0 B;  3HOV J;  1DU0 A;  3A01 A;  3S2H J;  2QIB A;  2JJ7 A;  5EGO A;  1X2M A;  2YS9 A;  3JRD A;  3BG3 A;  1BL0 A;  2M8G X;  1GVD A;  5J1R A;  2ZOY A;  3TW7 A;  2COB A;  2JA5 J;  4CGR A;  3MVP A;  2CRG A;  4IHX A;  4MLO A;  3BJB A;  4NEL A;  5HSZ A;  1LFB A;  2W48 A;  5CXI A;  4QIW N;  4IEJ A;  1MBJ A;  2DA1 A;  2XB0 X;  1AKH B;  4HKU A;  4AUX A;  2LTP A;  3V6G A;  1FIP A;  3BHQ A;  2UXP A;  1GUU A;  3FRQ A;  4A3D J;  2NS7 A;  3VVX A;  4M3D A;  3KKD A;  3CDL A;  3RQI A;  4IHV A;  5IOZ A;  5JLX A;  3S14 J;  1GDT A;  5K7Z A;  1B8I A;  5DAJ A;  3BR3 A;  2MW8 A;  1ZK8 A;  1F43 A;  3HIM A;  2G7L A;  5IP9 J;  3LOC A;  4NDL A;  2QOP A;  2HI3 A;  5EG0 A;  1IDY A;  2WB1 N;  4C3I J;  2ME6 A;  1UG2 A;  2YUS A;  4BBR J;  5FKM A;  2I10 A;  3LSJ A;  3A03 A;  2K9N A;  3NRG A;  2LR8 A;  4FIS A;  2XDN A;  3EUP A;  2O9L A;  2VI6 A;  3VIB A;  3OIO A;  2IU5 A;  1W0T A;  3Q0W A;  1ZTR A;  3O8H A;  1WI3 A;  2TRT A;  5IYB J;  2ZB9 A;  4X1E A;  4RBO A;  3GTQ J;  2REK A;  3NNR A;  3GTJ J;  5F1J A;  1FEX A;  3CJD A;  3I4N J;  5K58 A;  3FIS A;  4UUT A;  4C3J J;  4FE4 A;  3E7Q A;  2Y0S N;  3CMY A;  2ZCX A;  2ECB A;  4GFL A;  1ZKG A;  2LFB A;  3GTL J;  3PAS A;  2OI8 A;  2OF7 A;  2G3B A;  2DN0 A;  2H1K A;  3IV5 A;  5HBU A;  4BY7 J;  1HDD C;  2NOG A;  3MKL A;  1FIA A;  2LKX A;  3COL A;  1UI6 A;  2JK3 A;  1SGM A;  4ICH A;  5EZG A;  2GFN A;  3BR5 A;  5FKO A;  3CRJ A;  2RHA A;  3C2B A;  5M5X J;  1BJZ A;  3HDD A;  2NS8 A;  2XPW A;  4JX5 A;  5FLM J;  2ID3 A;  1LE8 B;  1U8B A;  4QTR A;  2HOT A;  1TWA J;  4B1R A;  3BR0 A;  3RZO J;  4CYC A;  3QKX A;  3BTC A;  2K9Q A;  1APL C;  3HEF A;  2M34 A;  1IG7 A;  1ETX A;  3B6C A;  2NVY J;  3AQS A;  1GT0 C;  4D7N A;  2JA8 J;  3B81 A;  1Z0X A;  2GM4 A;  2ME0 A;  2R0Q C;  2N8G A;  2YVE A;  2MSY A;  4FTH A;  1MSE C;  4GFB A;  5C4X J;  5EEA A;  2AHQ A;  3VP5 A;  3NAU A;  5M5Y J;  2UXU A;  2ZOZ A;  1HF0 A;  3GTP J;  1UI5 A;  1ENH A;  3JRI A;  3JRE A;  3HTA A;  4S0H B;  1JKR C;  1TWC J;  2R5Y B;  2JMW A;  1UMQ A;  3ON2 A;  1JT0 A;  1IDZ A;  2GBY A;  3S15 J;  2LD5 A;  3LSR A;  2E1O A;  1MNM C;  1MBK A;  1P7J A;  1IGN A;  5FMP A;  4NN1 A;  1LE8 A;  1TWG J;  2HQ5 A;  5C44 J;  1Y1V J;  2WV1 A;  5J1U A;  1T33 A;  1QPI A;  4M3F A;  3ANG A;  3VW0 A;  1VFC A;  1XS9 A;  4JP0 A;  4LOC A;  4XIC A;  4AYB N;  5IYD J;  1MH4 A;  3S2D J;  2RAE A;  1F36 A;  4C3H J;  1D5Y A;  1FTT A;  2CQQ A;  4DW6 A;  3T6N A;  3FK7 A;  5DTD A;  4A93 J;  4J19 A;  4XRM A;  4MFE A;  2UXO A;  2IBD A;  3V78 A;  3DPJ A;  2NVT J;  3LHQ A;  1B72 A;  4FE7 A;  3SFI A;  2MG4 A;  4GFK A;  2OER A;  2CUE A;  5IPA A;  3TP0 A;  4A3F J;  2XGC A;  2L9R A;  4XRS G;  2GLO A;  4A3M J;  3IH2 A;  1ZR2 A;  3GTK J;  2R5Y A;  4DZP A;  3FKI J;  5J3L A;  4RDU A;  2NX4 A;  1IUF A;  2EBI A;  5M3F J;  3HOY J;  3VVZ A;  3OOU A;  2M2E A;  3PO2 J;  1OCT C;  2R7Z J;  4X6A J;  1IJW C;  2R93 J;  5F27 A;  2E2H J;  1OFC X;  1JJ8 C;  3S17 J;  4BKX A;  5F04 A;  2NVX J;  2QF7 A;  2K9S A;  3F0C A;  2Y30 A;  4GCK A;  3ZQI A;  3JRC A;  3HOU J;  1JJ6 C;  1AHD P;  1H89 C;  2DJN A;  4GCT A;  1I6H J;  2DMP A;  3VUQ A;  4I6Z A;  1ETV A;  4C2M J;  5M3M J;  3M4O J;  3VPR A;  3BTJ A;  2VKV A;  4A3C J;  5IOY A;  2HKU A;  1AKH A;  2EH3 A;  2WAQ N;  1JKQ C;  1U9O A;  2FQ4 A;  1BA5 A;  4A3E J;  4BXX J;  2GEN A;  3RH2 A;  1HLV A;  3HOW J;  3CWR A;  3ZQL A;  3ZQH A;  1YRN B;  5IYC J;  3S1N J;  5CW8 A;  3BG9 A;  5FKN A;  5FKK A;  5J1Y A;  4G12 A;  2JA7 J;  2NP3 A;  5AQC A; 
#chains in the Genus database with same CATH topology
 2KL4 A;  2E60 A;  3AFH A;  1MJA A;  2EA2 A;  2E35 A;  2ZJP F;  2A2F X;  3QYF A;  4MO7 A;  4CCO A;  5D4S A;  3OV8 A;  4F52 A;  1SFO J;  1RES A;  2EZH A;  2ECC A;  2DMU A;  2YX4 A;  5KVR A;  4QPQ A;  4QSH A;  2VT2 A;  1YS7 A;  1K7A A;  2XAQ A;  4XM3 A;  3MNL A;  3E1S A;  5F64 A;  3H3V K;  3PUB A;  3DKW A;  3VVY A;  2FNP A;  2GA2 A;  4I76 A;  2PQ8 A;  4MTE A;  4AVZ A;  3PL8 A;  2EA4 A;  1WQ2 A;  3PSI A;  2FX0 A;  1VI0 A;  1KU2 A;  3KPH A;  1J0R A;  3ESW B;  3IUV A;  3V42 A;  3FXK A;  2UXH A;  1XPX A;  5C3E J;  1O57 A;  3W6V A;  2P5K A;  1WI9 A;  2HKO A;  5L3E A;  4DQ2 A;  2M0M A;  3WU2 C;  5EFY A;  5HS7 A;  1Z05 A;  4M72 A;  3VW2 A;  3SDG A;  1AOY A;  4CCJ A;  4OD5 A;  2COM A;  2L0K A;  2D5V A;  1WJF A;  2DAO A;  3RPU D;  1FTZ A;  3DEW A;  3IWF A;  2QM3 A;  3S8P A;  4IOA F;  5EGO B;  4CSW A;  1O3R A;  3HTH A;  1PYV A;  4UHT A;  4RLQ A;  3JRF A;  3SQN A;  1E3H A;  2O6G E;  4NHJ A;  2ZCM A;  4PCQ A;  4W97 A;  4KDP A;  3NS4 A;  1ETO A;  1SFE A;  3DFG A;  2FBH A;  3HKZ N;  3EPZ A;  1SFU A;  2VOD A;  4A6D A;  1XSD A;  1FMV A;  1HC8 A;  2ZME C;  4B3A A;  2F5F A;  5FD5 A;  2DA5 A;  2DO7 A;  3CZ6 A;  5F0H A;  1AA7 A;  4LG0 B;  1T56 A;  3QRF F;  4PGH A;  1MDM B;  2DXI A;  3M3Y J;  5F0F A;  4ESJ A;  1LFU P;  2PMU A;  2F4O B;  3CJR B;  4EM1 A;  3JRG A;  3S1R J;  2B63 J;  3B6A A;  4G6T B;  2XB5 A;  1B8I B;  5FKL A;  4U0V A;  4ZYD A;  3GZ5 A;  2DTZ A;  1I27 A;  2M0C A;  4MNU A;  4BH9 A;  2KKO A;  5FLX K;  2MLK A;  3RYR A;  2ZO4 A;  4Y7N J;  3GME A;  3DU5 A;  4LK0 F;  2O7T A;  2CW8 A;  3KP7 A;  3BRU A;  2LBF A;  2EQR A;  3I71 A;  3D5S C;  3Q5F A;  1OJL A;  1XG1 A;  3BY6 A;  2K85 A;  1Z9C A;  3VOE A;  3F8N A;  3IUO A;  2VB6 A;  3PFI A;  2V1X A;  2ADU A;  5DD8 A;  4C2M A;  2IW5 A;  3KZY A;  3OIP A;  4ENM A;  2DK5 A;  3GZN B;  4RB0 A;  3SZG A;  3JSJ A;  3ONQ A;  5L3G A;  1TWF J;  4Y3O A;  1ZG1 A;  1JT6 A;  1ZGA A;  2RAS A;  2BOL A;  1YQA A;  4H4K C;  3S3M A;  1HOM A;  3ABK H;  1R00 A;  2KLO A;  1SAN A;  4E7L A;  2K86 A;  1ORK A;  3E6C C;  3ANP A;  5DCM B;  5IP6 A;  1X1C A;  4B4C A;  3VWB A;  2F5E A;  1ZGW A;  2XPU A;  3M8J A;  4EJV A;  1P4X A;  2KT0 A;  1K61 A;  1BOA A;  4CCK A;  2H8W A;  1G3T A;  4HLX A;  4F93 B;  4PFO A;  4Y15 A;  2ZXW H;  2M4G A;  1ODD A;  2HDD A;  2OTJ I;  3QOP A;  2XAG A;  5GTH C;  2R4G A;  3P9T A;  3E7L A;  2ZCN A;  2W82 A;  1D3Y A;  3QBM A;  2DTR A;  2W25 A;  3FX3 A;  4ENN A;  3OSG A;  3C07 A;  3VSK A;  2FXA A;  1QVT A;  3ABL H;  1BJA A;  5E3M A;  3DP7 A;  2E1M B;  3OYD A;  2HOA A;  3H9J A;  2E7W A;  3UNG C;  2PZ9 A;  2BYV E;  2VXZ A;  1VTN C;  1ITY A;  2XPV A;  5CPR B;  4F92 B;  2IT0 A;  3OMY A;  2VQC A;  3BT9 A;  4XOT A;  2ESN A;  1VQ6 I;  3V8K A;  3I59 B;  2NP5 A;  3DQV C;  4IHS A;  2L01 A;  4LD5 A;  2RV8 A;  4L9N A;  1W7P B;  5A2Q K;  4OIQ F;  1OCP A;  3IAM 2;  5KAI C;  5B1A H;  5BMZ A;  2TDX A;  2JN6 A;  5D5V B;  1A35 A;  1IXS B;  5LRR A;  4Y52 J;  2GXB A;  2KDZ A;  2F5V A;  4EGZ A;  4MQ9 F;  2HDW A;  1ZLJ A;  4HNT A;  1ZRC A;  2L7F P;  3PO3 J;  1ETK A;  2KIF A;  1RR7 A;  3GFM A;  2JWT A;  2FNA A;  3BR1 A;  3KYL A;  2AXL A;  1MBE A;  4CCL A;  2VQH A;  2QLZ A;  3KET A;  3GZ6 A;  3BG7 A;  1GV2 A;  1LNW A;  2WAD A;  3AQT A;  4W1U A;  1KYZ A;  1X58 A;  2XVC A;  5D5U B;  1ETQ A;  1PVE A;  2R7R A;  3ZQC A;  3ZMT A;  3PIO F;  2QBY A;  4BEH B;  4NB5 A;  4BYY A;  3WTW C;  3FDY A;  2L4A A;  4HNV A;  5D18 A;  2IEK A;  1Y6I A;  2CU7 A;  3A01 B;  4OMY A;  1ETY A;  2QQ8 A;  2P7V B;  3V7C A;  2X6Y A;  2XF5 A;  4M6V A;  3VYS B;  4HA8 A;  1JE8 A;  3HG9 A;  3GCM A;  2H8R A;  1P7I A;  3PM1 A;  2HR3 A;  1FT9 A;  2L54 A;  2O3F A;  5IY5 H;  1BBY A;  4IQ4 A;  3JR9 A;  2XSD C;  1OLT A;  4E6K G;  1P6R A;  1S8N A;  2BHZ A;  4LIT A;  4HRI A;  4OAZ A;  3JTG A;  3JCU C;  3ZQF A;  4L62 A;  5EZH A;  5GAG J;  2W53 A;  4DYR A;  3CCU I;  1ZQ3 P;  4HPQ A;  3RKW A;  2ZSH B;  2HDC A;  3Q0U A;  3ZQG A;  3NEU A;  2BV6 A;  1QBJ A;  2BHY A;  4DNC A;  5JI6 A;  3BZ6 A;  5HNF A;  3NXC A;  5EG0 B;  3CCM I;  1XSX A;  2DT7 B;  4UB8 C;  1QU3 A;  3BCB A;  4BE1 A;  3S2H J;  4M9S A;  3BDD A;  1BL0 A;  1GVD A;  1LDK B;  1B9M A;  2COB A;  5ILS A;  4LLN A;  3HHH A;  4MLO A;  5D8L B;  1GLN A;  3CCL I;  3CP2 A;  3PIP F;  1ON1 A;  2W48 A;  4N9H A;  4RAZ A;  2IGO A;  3DKX A;  4CCN A;  3GXO A;  3OS2 A;  4HG2 A;  1XSV A;  4HQM A;  5FRO A;  2O5R A;  2UXP A;  1GUU A;  4BJ5 C;  2LH9 A;  2VE9 A;  3E97 A;  3RQI A;  5JLX A;  1IXC A;  2LMD A;  1XDS A;  2QA4 I;  2R7W A;  3PQK A;  1UHM A;  2G7L A;  1WJA A;  3KP4 A;  5IP9 J;  4L0Z B;  2ETH A;  4NDL A;  2PMH A;  1IDY A;  2ME6 A;  1UG2 A;  4N4N B;  5FKM A;  2L3D A;  3I64 A;  1TP4 A;  2MC4 A;  1EH6 A;  1UG0 A;  2L9S A;  2WV0 A;  4ESF A;  4UNO A;  3OIO A;  4G94 A;  4KFC A;  3HUG B;  1S3J A;  2LNB A;  4DBQ A;  1YTY A;  3O8H A;  4ZH4 F;  2W85 A;  5IYB J;  4LB6 B;  2JRT A;  4RBO A;  2L5Q A;  3CJD A;  5J8C A;  4NQW A;  2FOK A;  3L09 A;  3FIS A;  4FE4 A;  5LBQ A;  2HEO A;  2ZCX A;  4GYI A;  2CQN A;  1ZAO A;  1ZKG A;  3SEZ A;  1FOX A;  1FSE A;  1ZRD A;  4IRV A;  4XOR A;  4U7B A;  4OIR F;  4XR6 A;  3I3L A;  1LUJ B;  3I4P A;  1DPR A;  5D8K B;  3E0J B;  1DPU A;  3IKV A;  5DDG A;  1UI6 A;  2NS0 A;  2IGN A;  1SEU A;  4AIK A;  1QA6 A;  4I2O A;  3BR5 A;  1T38 A;  1OR7 A;  5FKO A;  2X85 A;  3J7Z I;  2E5Z A;  2G7U A;  1YW8 A;  3S3N A;  3HDD A;  1HKQ A;  4NBQ A;  2YR2 A;  2A68 F;  3CMA I;  2RQP A;  5FLM J;  2JA2 A;  3V7R A;  3C1D A;  1LE8 B;  4AWX B;  1YIJ I;  1T0F C;  5JVG F;  5E1W A;  3RZO J;  4CYC A;  3QKX A;  1APL C;  4XLH A;  2RVC A;  1D0X A;  4UVA A;  2K3P A;  1P2F A;  1M1E B;  2K27 A;  1N75 A;  1QHH D;  4D7N A;  4HX8 A;  3KE2 A;  2EIK H;  2GAU A;  3V7S A;  2R0Q C;  1LPQ A;  5EJC A;  2XF7 A;  4M9X A;  2MSY A;  1XMX A;  2VKD A;  1FZP B;  4GFB A;  1IAW A;  3ZMD A;  3FXU A;  2UXU A;  3Q9S A;  3K1N A;  2F48 A;  1UI5 A;  2VJI A;  2F5D A;  3JRI A;  3M7G A;  1HW5 A;  2QZ8 A;  3AKZ A;  3BCA A;  2DI3 A;  3HTA A;  1JKR C;  1R4M B;  4G7Z F;  3UR3 C;  4ETS A;  4I02 A;  2GBY A;  2LD5 A;  1Q1H A;  2E1O A;  4HNU A;  5IT3 A;  3TQN A;  2QSF X;  3BZK A;  3LSH A;  2BY3 A;  3CTA A;  4DBR A;  1QPI A;  4GGG A;  1OQY A;  4M3F A;  3MWM A;  1DDN A;  4JP0 A;  3RPQ A;  2M45 A;  3OYN A;  1XGN A;  3E6B A;  4C3H J;  2GIZ A;  1QNT A;  4A93 J;  1I1S A;  2EIL H;  4J19 A;  4XRM A;  3G71 I;  4MFE A;  4CDG A;  3P7N A;  3CD6 I;  1FSH A;  4ZYH A;  1SD4 A;  3V78 A;  2NVT J;  1B72 A;  3GEZ A;  1QQI A;  3HTU A;  5JR3 A;  4BDZ A;  1JXS A;  5BPD A;  2OER A;  2DT6 A;  5IPA A;  1XCV A;  2ZC2 A;  3TP0 A;  4HBL A;  3I0T A;  1MGT A;  1L0O C;  1Z67 A;  2K3F A;  2R5Y A;  4DZP A;  1KQ0 A;  5ERI A;  1VQ9 I;  2D2W A;  4HF2 A;  3F23 A;  1F5T A;  2EBI A;  2NRA C;  1YFH A;  5TGT A;  3ZMV A;  1KYW A;  3DEE A;  4LFU A;  1HBX G;  3OOU A;  3BWG A;  4RB2 C;  2Y69 H;  5KK1 A;  2M2E A;  1Z7U A;  4X0G A;  4Y13 A;  5F27 A;  3BJA A;  3ZPL A;  2GWR A;  3KP6 A;  2E2H J;  1G8X A;  3AG2 H;  2HGC A;  5D5X B;  4ESB A;  1U5T A;  1WJE A;  4R1H A;  1D1B A;  2QF7 A;  1YI2 I;  2Y30 A;  5ICG A;  2DFE A;  3NWT A;  2JPC A;  5E1Z B;  1IN7 A;  3K70 C;  1JJ6 C;  1AHD P;  3A2K A;  4BJ6 C;  5KHD A;  1H89 C;  2DJN A;  4GCT A;  2FU4 A;  2JVG A;  4BHC A;  2PEX A;  3OYI A;  2A69 F;  1UB9 A;  3EUA A;  1MMS A;  3IC7 A;  4XKV A;  4HX7 A;  1KU3 A;  1NG7 A;  3ZXS A;  2EPF A;  1U0J A;  1AKH A;  1VQ8 I;  1JKQ C;  1U9O A;  2FQ4 A;  4OIP F;  1XGM A;  5E1X A;  4BXX J;  4PJL A;  3RH2 A;  2GOM A;  1HLV A;  5TIS C;  2LOO A;  1R36 A;  3ZQL A;  4IX7 A;  3DTE A;  2F4M B;  5HNH A;  5FKK A;  2LY1 A;  5J1Y A;  5HAW A;  1OYW A;  2NP3 A;  1O3Q A;  1DP3 A;  2Y75 A;  3VTI A;  3HXL A;  3G2B A;  3F8F A;  1G3W A;  2QBY B;  5B5E C;  2JZY A;  3GBG A;  1A6Q A;  4PJJ A;  3TO6 A;  5GP9 A;  2DA6 A;  1Z1D A;  2XGE A;  3ZN1 A;  4WXH A;  3ROU A;  1W5C C;  3GUD A;  2MGQ A;  1U9N A;  3V8L A;  3OYG A;  1QZZ A;  1VQP I;  4L18 B;  5B3S H;  3G56 A;  3HOX J;  3IH3 A;  3B02 A;  3S32 A;  2IA0 A;  2PN6 A;  4PSX A;  4CA0 A;  1RZ4 A;  3AG4 H;  4KT6 A;  3F1B A;  4KNY A;  1F9N A;  1SVO A;  4RM2 A;  3QYB A;  2NVQ J;  3KEQ A;  1VF9 A;  4HAM A;  2DFH A;  2CV0 A;  2ZJR F;  4ENK A;  2CQX A;  1X1D A;  1J7K A;  1D0Z A;  4ACI A;  1T95 A;  1QHG A;  1WH7 A;  4XKW A;  4BE0 A;  1ZH5 A;  3TBI A;  5K5O A;  3CC7 I;  1G6N A;  5K7F A;  4CZZ A;  2E1N A;  2E2I J;  1OYI A;  4XSX F;  1H0M A;  3NAR A;  4ON0 A;  3NPI A;  5GAD J;  1HKT A;  4YRV A;  2HTJ A;  1K6O A;  2ZFW A;  5KCM A;  2NNN A;  3FXQ A;  3OL4 A;  2IRF G;  4BXU A;  1IN6 A;  1H9G A;  4E7J A;  4EQQ A;  4YIR X;  4JX6 A;  2M8E A;  3BTI A;  1FBU A;  1R22 A;  3FXM A;  2W7N A;  1HCR A;  4AM3 A;  3QU6 A;  2GUH A;  2Q2E A;  2H94 A;  1IN4 A;  3EET A;  1RNL A;  2G7G A;  1RPW A;  2Y31 A;  2HKX A;  2R7Q A;  3ON4 A;  2JUC A;  1TC3 C;  3HRT A;  5ICE A;  4FHT A;  1MSF C;  1S7A A;  3ZRG A;  4KMU X;  4IF4 A;  4RAY A;  4XLP F;  3U2R A;  3HBL A;  2W24 A;  4BBS J;  4ZYE A;  3LWJ A;  3SWH A;  2QUF A;  3DCF A;  3F22 A;  4S05 A;  5H20 A;  2M1B A;  1VQL I;  2DPU A;  2Y2Z A;  1TT0 A;  3H0D A;  2E19 A;  3I54 A;  2ICW G;  3MEX A;  1PUF A;  2X51 A;  3O6B B;  3N97 A;  3K2A A;  4D0P A;  4UXN A;  4PUS A;  4HDV A;  4NQW B;  1TL8 A;  4WK8 F;  4HEA 2;  3U1K A;  2HYJ A;  1KU9 A;  4YFN F;  3LA2 A;  4ME9 A;  5HLT A;  2M5W A;  4AYB A;  5C4J J;  4YEL A;  4M3B A;  1R1V A;  2DDB A;  4MIM A;  3S5R A;  1WJC A;  3KZ9 A;  1YIT I;  1BC7 C;  2Z1D A;  4AC6 A;  4JKZ A;  1ON2 A;  4M71 A;  2QQB A;  2R5Z A;  3CCV I;  1V5F A;  1WH5 A;  3D0S A;  2QWW A;  2FE3 A;  2DA2 A;  1P4W A;  3LSP A;  3EGQ A;  4IXA A;  1YJN I;  1U3E M;  5FFX A;  6PAX A;  3RSN A;  1L3L A;  5FD6 A;  3HGG A;  4S04 A;  3GTM J;  2Q24 A;  2EZK A;  3D1N I;  2VKE A;  3CME I;  4A3B J;  2V57 A;  1TQM A;  4PXI A;  5HLH A;  3BG5 A;  5B66 C;  4CYC B;  2FBI A;  3UKG A;  5FRM A;  2Y48 A;  5E8G A;  1K4S A;  2R7U A;  3WHC A;  3L2V A;  3HIF A;  4LIV A;  4KWA A;  1IRF A;  5LGT A;  1R1U A;  3LQR A;  3HTI A;  2HQA A;  3CMM A;  3E5U A;  1SVM A;  5CVI A;  3L2Q A;  3KZZ A;  2EZL A;  4UUS B;  4RGS A;  1CF7 B;  1MH3 A;  2BY2 A;  2BW3 A;  2PLY A;  1VND A;  2OPT A;  5L3F A;  1AWC A;  3BQZ A;  4L0Y B;  2Y9Y A;  3R0J A;  4HV6 A;  3RD3 A;  3QPT A;  3G1M A;  5HDK A;  2D6Y A;  5D5W B;  3HTJ A;  3MN2 A;  3M1C A;  3ULQ B;  3CF2 A;  2DW4 A;  2WAQ A;  4K2E A;  3WOD F;  3DPT A;  3RKQ A;  4PJ0 C;  3RI4 A;  2A5Y B;  3G73 A;  3RPU A;  3PPB A;  4JQF A;  4BJT A;  2HOS A;  2CO5 A;  2CJJ A;  2DA7 A;  2IAI A;  1D1C A;  2V9P A;  3H9Q A;  2VBZ A;  1J75 A;  1R5I D;  2A07 F;  3S1M J;  4KN7 X;  1HA8 A;  3ERM A;  3VYT B;  2MAB A;  4XL9 A;  4A5N A;  4BL0 B;  3BP8 A;  2A6E F;  3HGY A;  4XRS A;  1JTX A;  2J5P A;  4FET A;  3ZR8 X;  1BI2 A;  1ERD A;  1SFK A;  1D8K A;  1T6S A;  1FOY A;  1B72 B;  5D19 A;  3J7Y J;  5M5W J;  2JT1 A;  2GA1 A;  4HV5 A;  1HQC A;  3DPU A;  3PQJ A;  2HQR A;  5IP7 J;  2EIN H;  3SFZ A;  1R71 A;  3HB9 A;  3RKX A;  1RI7 A;  2DOD A;  4YFK F;  3CUQ A;  1V5E A;  4EAT A;  4CXF A;  2VIX A;  2PMZ N;  3CLO A;  3QQA A;  4D7M A;  1UHS A;  4BHP A;  2Y9Z A;  5GAH J;  2HZT A;  4KIB A;  2EV6 A;  2BEO A;  1B6A A;  2PJR A;  5EEH A;  2G0E A;  5F0C A;  3VOX A;  4U9L A;  2KIS A;  2Z16 A;  1DU0 A;  2YVX A;  2DOE A;  2STW A;  3RYP A;  2QIB A;  2VOP A;  1KA8 A;  4V19 K;  2WY8 Q;  2YS9 A;  2A6T A;  3JRD A;  3TW7 A;  4KA4 A;  2JA5 J;  3CCE I;  1FYM A;  4IHX A;  3H5N A;  5AON A;  3L2C A;  3FHZ A;  2UZK A;  1OIS A;  2PI0 A;  1S9H A;  4KUM A;  4Y33 A;  5DM7 F;  4ZTF A;  1FYL A;  2IS4 A;  4QIW N;  2EV0 A;  1MBJ A;  2DQL A;  3WU1 B;  3HKZ A;  1AKH B;  2IS6 A;  2HYF A;  4AUX A;  2LTP A;  3V6G A;  1FIP A;  3BHQ A;  4Q48 A;  2FRH A;  5LHH A;  4RS8 A;  4EGY A;  3VVX A;  3KKD A;  3CDL A;  4OAY A;  1D1A A;  2K02 A;  3S14 J;  1GDT A;  3BR3 A;  2MC3 A;  1ZK8 A;  3RTR A;  4DVY P;  3K4N A;  2QOP A;  1H9T A;  2X6W A;  3OR1 C;  3W2A A;  4C3I J;  2DPD A;  1BM9 A;  4UY8 I;  4A12 A;  4C2U A;  1ZG5 A;  1ZGJ A;  3FXJ A;  2ZME A;  2KRH A;  1FYK A;  2LR8 A;  2YSR A;  4FIS A;  4PK4 A;  1VQM I;  2KP6 A;  3K4L A;  4BHB A;  2IS1 A;  4NC6 A;  2VON A;  4PSW A;  2VI6 A;  2Z99 A;  4N0B A;  4O3M A;  1WI3 A;  3E6M A;  2M3A A;  3GTQ J;  2REK A;  1YX5 A;  3SDB A;  1R49 A;  3R60 A;  4CIC A;  1VQ7 I;  3I4N J;  4C3J J;  3E7Q A;  2Y0S N;  3LWF A;  1BC8 C;  2ECB A;  3EUH A;  2KPM A;  3GTL J;  3PAS A;  4KIT B;  2OF7 A;  4RA2 A;  2DN0 A;  2H1K A;  2DBB A;  3L2W A;  1R6R A;  5HS9 A;  3M9A A;  3SXY A;  4KJZ A;  1HW2 A;  5K5R A;  5ILU A;  1FIA A;  1XX5 A;  4DGW B;  1V4R A;  4HLY A;  4CZC A;  5EZG A;  2GFN A;  2XGX A;  2F2E A;  1BIA A;  5LD2 C;  2RHA A;  2ZNZ A;  3D5R C;  5M5X J;  5FGM A;  5BQT A;  2NS8 A;  2MH2 A;  2XPW A;  4JX5 A;  5TJJ A;  4EJO A;  2KMU A;  2W84 A;  1RR8 C;  3BR0 A;  3GLX A;  1W36 C;  1V55 H;  2OBP A;  2P8T A;  5J4V A;  1OMI A;  2P4W A;  1VQO I;  1K78 A;  2UWM A;  2NVY J;  1F4K A;  3AQS A;  2IPQ X;  4BAY A;  4Z6Y A;  2JA8 J;  3B81 A;  2V7F A;  3DTI A;  4E7I A;  2GM4 A;  2Q2E B;  4I0B A;  1IF1 A;  1KGS A;  1O3S A;  1SAX A;  2N8G A;  4FTH A;  4ASN A;  1MSE C;  5C4X J;  5EEA A;  1VQ5 I;  2AHQ A;  2O61 A;  3NAU A;  3VP5 A;  2V9K A;  5DCF A;  1MMD A;  4G7O F;  2ZOZ A;  2HVR A;  1ENH A;  2LRD A;  2UXX A;  2ESH A;  1T8I A;  5H6Q A;  3C18 A;  2JMW A;  1ZYR F;  5J8F A;  3S15 J;  5L3C A;  2FUG 2;  2K5C A;  4Q47 A;  5DM6 F;  1MNM C;  3FXO A;  2IGM A;  1FP1 D;  1IGN A;  2X0L A;  2JRM A;  4WCG A;  5FMP A;  3TMO A;  1U2W A;  1UST A;  2HU9 A;  1R4N B;  2WV1 A;  3HSE A;  5J1U A;  1K79 A;  1VFC A;  1XS9 A;  1MZB A;  2V1U A;  2NNY A;  4LOC A;  1REP C;  5IYD J;  1IXR C;  3S2D J;  2RAE A;  3WG9 A;  2MLG A;  1D5Y A;  2VL8 A;  4DW6 A;  3T6N A;  2MD5 A;  3OYL A;  3SYT A;  2UXO A;  2IBD A;  3EUK L;  3L9F A;  3DPJ A;  4HOB A;  1A31 A;  2W4S A;  1V3F A;  1GVJ A;  3GFL A;  2HZD A;  2VAS A;  3FWE A;  2CS3 A;  4KIF A;  4A3F J;  4PDK A;  4XRS G;  3KEO A;  3U1D A;  3SZP A;  3WTT C;  1BN5 A;  3FZV A;  3VFZ A;  3FKI J;  3BZC A;  4RDU A;  2NX4 A;  1IUF A;  3BJO A;  3CLQ A;  5BS6 A;  4BU2 A;  3Q9V A;  3WTY C;  3VVZ A;  4R79 A;  5JHF A;  1YYV A;  5GAE J;  3JSO A;  1ZHF A;  2RGV A;  3PO2 J;  2R7Z J;  4OOI A;  2QQA A;  2R93 J;  1OR7 C;  2WY7 Q;  4XSZ F;  5JVT A;  2JTV A;  3W2V A;  1MMN A;  4ZZD A;  3S17 J;  4BKX A;  4A0Y A;  5F04 A;  2F5C A;  3FBI B;  3F6V A;  2EV5 A;  3ZQI A;  4B09 A;  2XAJ A;  3M07 A;  2LKP A;  2CH0 A;  3OS0 A;  3WTV C;  5H2F C;  3B73 A;  2BW3 B;  4I6Z A;  3MZH A;  4YIF A;  3M4O J;  3V8J A;  3WU0 A;  2OC6 A;  1UAA A;  4XN3 A;  2K4B A;  5CVR A;  1USS A;  2EH3 A;  1XN7 A;  2KZG A;  1DUX C;  5CLS A;  1RRJ A;  4A3E J;  1HXD A;  3ASO H;  4I98 B;  5HLG A;  3CWR A;  4MHG A;  1YG2 A;  2A5W A;  3ZQH A;  5CW8 A;  3KP5 A;  3G4S I;  5DEQ A;  4AIJ A;  2JA7 J;  2RRE A;  3QP6 A;  4B3X A;  4A0Z A;  4XQF A;  4J00 A;  1Y1W J;  4XBF A;  2GZW A;  2VPL A;  1DP7 P;  4JX4 A;  2HYT A;  1E3P A;  2CW7 A;  3KKC A;  1K83 J;  2OUM A;  4L9T A;  4YG2 F;  2YX7 A;  4JYK A;  3HC7 A;  3HPG A;  2VC0 A;  3KP2 A;  4Z2Y A;  3P9I A;  3LAP A;  5LEJ A;  3NI7 A;  5H9T A;  3OSF A;  1S7E A;  3TDZ C;  2LG4 A;  4GCL A;  5CXG A;  1VQK I;  1IUY A;  3QWL A;  3LAJ A;  4O6J A;  1FOW A;  3HM5 A;  2XAF A;  4A3J J;  2UUZ A;  1ACI A;  5EEG A;  2P5L C;  1ZR4 A;  3LST A;  5F6F A;  1RET A;  2Q8K A;  3CUQ B;  4RMN A;  1E17 A;  2EFQ A;  2AQF A;  3CQZ J;  3FBN B;  2M4K A;  3VEP A;  3K4J A;  5L3B A;  5E3N A;  3OS1 A;  5E18 F;  4YZE A;  3GW2 A;  1SD5 A;  4D1Q A;  1NTC A;  1IV8 A;  4D5C A;  3JAM Z;  4EJW A;  1OYY A;  3V4G A;  2KFD A;  2P5V A;  3L2R A;  3L00 A;  1R9T J;  2AO9 A;  3H5A A;  2PJR B;  1Z77 A;  4V2G A;  2RNJ A;  1LFP A;  4KT5 C;  4YII A;  3RDI A;  5HOD A;  3E5Q A;  2VXD A;  3FK6 A;  4N9I A;  3LSK A;  2XF6 A;  1EH7 A;  3BCG A;  4AC0 A;  5E3O A;  2LBF B;  2R92 J;  5JHU A;  3KNW A;  2X6O A;  2GXA A;  2OTL I;  2JSC A;  5FJ8 J;  2VN2 A;  4U87 A;  3OR2 C;  2MBF A;  3FXR A;  2H6B A;  3S2W A;  2JUG A;  1J59 A;  2JA6 J;  3ERE D;  3R61 A;  3ZN0 A;  2O7O A;  1U5T C;  2MFZ A;  2XUB A;  1UJ8 A;  3S3O A;  2BXY A;  2JVH A;  3HRS A;  4A3L J;  3T1B A;  4ITV A;  3SZT A;  4XLC A;  4GYG A;  5DUI A;  4XON A;  4LB5 A;  1U6G A;  2CG4 A;  3EDP A;  3OYA A;  1MNE A;  4P9U A;  1EF4 A;  1DGR M;  1JUM A;  3TOB A;  2KRF A;  1Q1V A;  2CWE A;  3O8G A;  1T0F A;  5DS9 A;  2VJ4 A;  3JRA A;  3O60 A;  2DQR A;  3A02 A;  3HOT A;  3OIQ A;  4E7H A;  2VUM J;  1BR1 A;  1S5L C;  3HSF A;  4YEJ A;  1SAU A;  1MBG A;  4P9F A;  3I58 A;  4A5M A;  2X9D A;  3GEU A;  3VOK A;  1BW5 A;  3KP3 A;  3CCY A;  1R58 A;  2HTS A;  1UFM A;  1XDU A;  2ZBK A;  4DOZ A;  5DUK A;  2CSO A;  2VBX A;  3KLN A;  2XRN A;  3GZI A;  3MAJ A;  3K4M A;  1TQI A;  4D5F A;  4JL3 A;  1YOV B;  1JKP C;  1DU6 A;  1FMW A;  2L7Z A;  1I5Z A;  3KEY A;  2DG7 A;  5AIQ A;  3I5U A;  3FMR A;  3LSI A;  3W6J B;  4BQO A;  3H0G J;  4FCY A;  3K6G A;  4U7D A;  2ID6 A;  2V79 A;  1ZEL A;  2KQR A;  3BNI A;  2V4J C;  1ZAR A;  2VKH A;  2Y0M A;  4F7Z A;  4ZJZ A;  1EA3 A;  1TZL A;  2G7S A;  5GPC A;  4NC8 A;  2OCE A;  3WG7 H;  2AS5 F;  4G8X A;  3IHU A;  4PFP A;  4MFD A;  1MMA A;  4IHY A;  1SC7 A;  2DMN A;  4CYD A;  5EF6 A;  3DU6 A;  2QEX I;  4BE2 A;  2PFV A;  1X1P A;  3M8F A;  1H8A C;  3S93 A;  3G6E I;  2HXI A;  2CFX A;  2E2J J;  1LEA A;  2ELK A;  5H6R A;  4XKB A;  4UDS A;  4NC7 A;  2LP0 A;  2VOO A;  4BS9 A;  2CQK A;  2Q0O A;  4BDY A;  2GXG A;  1Z91 A;  2FJ1 A;  1A6I A;  2FD5 A;  2X6X A;  3G3Z A;  2DMQ A;  1XGS A;  2ISY A;  1PP7 U;  2OZU A;  1WGX A;  3MKY B;  5CYV A;  2XHK A;  4XNF A;  3DEU A;  4JBA A;  4I09 A;  2PBX A;  1YLF A;  5DCM A;  2LY2 A;  2ACJ A;  3S1Q J;  1R1T A;  5D1R A;  2LDU A;  3BPX A;  1ZN2 A;  2L9N A;  3KLO A;  2NAZ A;  4JOM A;  4OWR B;  1W0U A;  4B8X A;  1X2N A;  2WUI A;  2L7M P;  2ZNY A;  5K7H A;  2XKP A;  4BQQ A;  2R7D A;  3QPL A;  2IJL A;  5B1B H;  5K1Y A;  2PBI A;  1JHH A;  2HWV A;  3I4M J;  2YVH A;  1YRN A;  3T8R A;  3K8P C;  2BZT A;  3L7W A;  1U78 A;  4YFX F;  1T98 A;  4Q4Z F;  1MBF A;  1EKE A;  3RQ4 A;  4FQG A;  2K7L A;  1POG A;  2LSO A;  3K70 D;  4AU7 A;  1P9Q C;  4XK4 A;  3RKY A;  3C3W A;  4XOP A;  2QYO A;  2B9S A;  2LYC A;  4XID A;  2CV1 A;  4GDF A;  3JRH A;  2UXI A;  1LJ9 A;  3DBR B;  3J80 Z;  2YU9 J;  3GTG J;  4HW0 A;  2ZJ2 A;  3ZOB A;  4E70 A;  1LKX A;  5E17 F;  1LDJ A;  2QCO A;  4GXO A;  4BXF A;  1W7P D;  3G1L A;  3K7A J;  4IPA A;  2FJI 1;  1IZ1 A;  2EFO A;  3EYY A;  1MMG A;  4II2 A;  2HFH A;  1RUO A;  3CJQ B;  4D9J A;  3HE0 A;  5LGU A;  1T2K A;  4EEF G;  2RQQ A;  4XLE A;  2A6H F;  2LLK A;  2QTQ A;  3AL0 B;  4HF1 A;  4DYQ A;  2RNG A;  1IV6 A;  2KJB A;  2PG4 A;  1X1B A;  1Y56 A;  1WJB A;  3I55 I;  2NVU B;  1TNS A;  3H3U A;  3LSM A;  2ISZ A;  1JUP A;  3A1Y A;  1TT5 B;  4WXD A;  4M6Y A;  4BEH A;  1JTY A;  3SEQ A;  2IVM A;  1TBX A;  3JSP A;  1H88 C;  2FA5 A;  3LA3 A;  2XRO A;  1LEB A;  3HOV J;  3K0L A;  3R4K A;  5CQG A;  1D8J A;  3A01 A;  3BG3 A;  4I01 A;  4BQA A;  2M8G X;  5J1R A;  2ZOY A;  2XV4 S;  3T5X A;  4IOC F;  1TTY A;  3DBH B;  2HPM A;  4CGR A;  2CRG A;  2OJE D;  4P55 A;  5HSZ A;  4NEL A;  4UB6 C;  2Z3Y A;  1GXQ A;  4C2T A;  1YJ9 I;  3BG6 A;  4RGR A;  1FLI A;  2DA1 A;  2DFF A;  1U8R A;  3X2Q H;  1X3Z B;  3FRQ A;  2NS7 A;  5ICF A;  3OYB A;  1K4T A;  4M3D A;  2F6C A;  2L2O A;  5IOZ A;  5K7Z A;  1HKS A;  3MCZ A;  4LLG F;  4N4O B;  3P9K A;  2MW8 A;  2WAE A;  3HSR A;  3HIM A;  4L5I A;  3IRQ A;  2HI3 A;  5EG0 A;  4CUG A;  2EIM H;  2H1L A;  2L4M A;  4L5J A;  5DV5 A;  4BBR J;  2DYR H;  3CO6 C;  3OY9 A;  3FM3 A;  4I0A A;  3A03 A;  2K9N A;  4OU0 A;  3T0Y A;  3WGI A;  3NRG A;  5IT9 K;  2XDN A;  1QPM A;  2O9L A;  3CF5 F;  3KYD B;  3VIB A;  3MD2 A;  2Z9O A;  3FKJ A;  1W0T A;  3K4C A;  4LG3 A;  3PNT A;  3GF2 A;  4GRI A;  1FP2 A;  4X1E A;  3LFK A;  3LA7 A;  5E79 C;  2F4I A;  5K58 A;  1E0E A;  4KN4 X;  2JQ7 A;  1KQ8 A;  4JK1 X;  4RGX A;  2P0W A;  3GVA A;  2CUJ A;  3HZJ A;  4P5O A;  5LLQ A;  3K1P A;  1X3U A;  3GO5 A;  3KZI C;  1ONV A;  1T39 A;  4ZDO A;  1CGP A;  2DLL A;  2NOG A;  4UVC A;  3MKL A;  4LLL A;  3ELK A;  3GFJ A;  3RIR A;  2JK3 A;  4ENJ A;  4ICH A;  4IHT A;  1G4D A;  3C2H A;  4AD9 A;  2D45 A;  1NH3 A;  4KIS A;  2JSP A;  3CUQ C;  3HL2 A;  1WWX A;  3CRJ A;  1Y8Q B;  2VJJ A;  4QPO A;  1EJ9 A;  1S7O A;  4WWC A;  2KJC A;  2IA1 A;  1P4A A;  4IQJ A;  3ABT A;  1B4A A;  2ID3 A;  1ZRE A;  5CKT A;  4E7S A;  3HUG A;  2HOT A;  4RB3 C;  5CJ9 A;  4IO9 F;  3BTC A;  3FMS A;  3HEF A;  2M34 A;  2A3S A;  3TO9 A;  1TLH B;  3WTZ A;  1IG7 A;  1R23 A;  1ETX A;  3B6C A;  1BIB A;  1XB4 A;  3WE2 A;  1S6L A;  2ZKZ A;  3TOA A;  2DYS H;  3TL4 X;  5KAF C;  4ZTJ A;  3CJT B;  2YVE A;  3IL2 A;  3QOE A;  1Z6R A;  3F8M A;  3ECH A;  3VYU B;  5ED4 A;  3GFI A;  4OD4 A;  2O8X A;  3LMM A;  2QKL B;  3CC2 I;  1WJ5 A;  2GIV A;  1HF0 A;  1RUN A;  2CV2 A;  3HTS B;  3JW4 A;  3REO A;  1WRJ A;  1SD7 A;  3DF8 A;  3JRE A;  1VZ0 A;  4S0H B;  1TWC J;  2R5Y B;  3ON2 A;  1UMQ A;  3T8T A;  3QAH A;  1JT0 A;  3TO7 A;  1IDZ A;  3MKZ A;  2V9V A;  4EJU A;  3WGH A;  3HHG A;  2ZJQ F;  1OCR H;  1MBK A;  1K6Y A;  1P7J A;  2KZV A;  3OYE A;  2M87 A;  1LE8 A;  2FMY A;  1A36 A;  2HQ5 A;  5J4Y A;  1TQP A;  4EV0 A;  2XIG A;  1FC3 A;  3H35 A;  5FB2 A;  5HDN A;  3ANG A;  1WKM A;  4U0W A;  3DBL B;  4IRG A;  3IKT A;  1KZH A;  1FOK A;  3IWZ A;  2CQQ A;  1U5T B;  4ZDP A;  3H1C A;  3F21 A;  1QZE A;  4BQN A;  3MMY B;  2CFO A;  2E71 A;  3J81 Z;  4L9J A;  1B1B A;  4GFK A;  3I56 I;  4M74 A;  5KNL A;  2CUE A;  3OOP A;  2EJR A;  2X1C A;  4RGU A;  1TNT A;  2XGC A;  3MKW B;  2PJP A;  2IXS A;  4A3M J;  3IH2 A;  1ZR2 A;  3GTK J;  3EUH C;  3WTX C;  2B7E A;  2QQ9 A;  2H6C A;  4M6X A;  2ELH A;  5J3L A;  2XDV A;  5TRD A;  2UV1 A;  3CES A;  4P96 A;  5M3F J;  3W2W A;  3N4M A;  3HOY J;  4UUV A;  5E8I A;  3JAM K;  3FXL A;  1FBS A;  2PMZ A;  1YO5 C;  1UCR A;  3HOS A;  5HS8 A;  2XAS A;  2VE8 A;  1OCT C;  2HS5 A;  3HYI A;  1IJW C;  1XMK A;  1HSJ A;  1UEL B;  2WWY A;  2UXN A;  2C6Y A;  1A04 A;  4WIB A;  4OIN F;  2HQN A;  1JJ8 C;  3NQO A;  3BC8 A;  2NVX J;  2W57 A;  4CHU A;  2K9S A;  3ABM H;  3F0C A;  4GCK A;  1O7F A;  3HOU J;  3KCC A;  1ZG3 A;  2EFW A;  2R7F A;  2VBY A;  4BUP A;  1ETV A;  4C2M J;  5M3M J;  3VSL A;  4I7H A;  3OYF A;  2B3W A;  3BTJ A;  5D6F A;  2B0L A;  2OAZ A;  5DD4 A;  1J5Y A;  3ZP5 A;  4PGG A;  2DOA A;  1BA5 A;  2QSH X;  1KQ9 A;  1YIO A;  3DV8 A;  2GEN A;  3OWT A;  2VJ5 A;  3CDI A;  1YRN B;  3K2Z A;  5IYC J;  5FKN A;  2XAU A;  4AVP A;  4R8H A;  1I1G A;  1RC9 A;  3W3C A;  5AQC A;  4MXM A;  1HDP A;  2OD5 A;  3BLY A;  4M73 A;  4FX4 A;  4XLF A;  3HOZ J;  2F07 A;  2X4H A;  4DYC A;  3FHN A;  2ZSI B;  2XC7 A;  3BJ6 A;  1IRZ A;  2O03 A;  3LJL A;  3CC4 I;  4Y4R A;  2CUF A;  2ZXI A;  3G1O A;  1IC8 A;  2A61 A;  5J6X A;  2DDA A;  4CCM A;  1O7L A;  1JUS A;  4MTD A;  5LEK A;  1Y0N A;  2FBQ A;  3NRV A;  1WHU A;  1XGO A;  5EYR A;  3TW6 A;  5JLW A;  1X19 A;  4A0X A;  5FLV A;  4A3I J;  5GPA A;  3EYI A;  4RLF A;  5BPI A;  2MH9 A;  1BR4 A;  1JGG A;  3WHB A;  2Y0S A;  4LGW A;  1Z3X A;  1NG6 A;  1UHW A;  1NK2 P;  3VOD A;  1G3S A;  4F3Q A;  2X48 A;  3JRB A;  2EZI A;  3K69 A;  4BNC A;  1JGS A;  4M3E A;  4J01 A;  1CQT A;  5CVU A;  3MZ8 A;  1Z6T A;  2V1N A;  2LC2 A;  4PJM A;  2E34 A;  4LIU A;  2LVS A;  2QVO A;  1EH8 A;  2OQR A;  2ZXJ A;  2CW0 F;  3CJN A;  2LRE A;  3AL0 C;  2V1D A;  1XC5 A;  1ETW A;  2EWN A;  4WF2 A;  4A69 C;  2BBY A;  4DZJ A;  5IT9 Z;  1WFX A;  5HLI A;  4L9V A;  4HF0 A;  3LNQ A;  1STZ A;  3TGN A;  2VPR A;  1FJL A;  1GV5 A;  4P1W A;  2WGB A;  3OYM A;  3WGG A;  1B59 A;  1E2X A;  3IH4 A;  4CGZ A;  3BR2 A;  3E3V A;  1PUF B;  2DG8 A;  3F9K A;  1LVK A;  4LMY A;  3ZMS A;  4HDU A;  3RZD J;  1A5J A;  3GTO J;  1ZLK A;  4E4H A;  2KIM A;  2PFB A;  2TCT A;  1J9I A;  3ZQQ A;  2IGK A;  1AU7 A;  3QPH A;  3EQL F;  2FSW A;  1ULY A;  4RAF A;  4F55 A;  2YPR A;  2OA4 A;  2KDO A;  2R5Z B;  2FF4 A;  3TP3 A;  2ZFU A;  1I50 J;  3COA C;  2LY9 A;  4AF5 A;  3QPS A;  3BOQ A;  2ZCW A;  1TW3 A;  4JNN A;  4IZZ A;  2K4J A;  1BI0 A;  1W36 D;  4OMZ A;  4Q5S F;  3MZY A;  5F1R A;  1TW2 A;  1YW7 A;  3BR6 A;  4KIC A;  5DYM A;  1G2H A;  3AG3 H;  4MEX F;  2D1H A;  1PJR A;  5LRS A;  1TWH J;  1E3O C;  5FGL A;  1RIO H;  4MEY F;  3K10 A;  5HVQ C;  2DA3 A;  3DTK A;  3E6D A;  3H92 A;  3ISP A;  1NK3 P;  4G6D A;  5FO5 A;  3J80 K;  3F8B A;  3SJM A;  3PNV A;  3H9G A;  2QEN A;  3CCS I;  2R7X A;  2R7O A;  2E1C A;  1O4X A;  3L2U A;  2DU9 A;  1I3Q J;  4ZZL A;  4Y17 A;  1VQN I;  2H27 A;  2E7X A;  2XRL A;  2DA4 A;  4V2F A;  2HXO A;  4L5E A;  3JTH A;  4MK6 A;  1F1Z A;  2CMP A;  2H09 A;  9ANT A;  1I6X A;  4UVB A;  2R7V A;  2WA0 A;  2XSJ C;  2HOE A;  1XCB A;  3GX4 X;  3RCO A;  2DOF A;  1X3W B;  2W00 A;  3BTL A;  5BNG A;  2QWT A;  3N05 A;  5E3L A;  1QZY A;  4CO8 A;  4NNJ A;  3D5L A;  3E5X A;  1Z3Y A;  3LSG A;  5D6E A;  1RKW A;  4ZC3 A;  5JFR A;  4QLC U;  3GWZ A;  1MBH A;  2LK2 A;  2L7K A;  4XKC A;  1Z21 A;  2K40 A;  2QKO A;  4FT8 A;  4GCV A;  3L1P A;  2XKO A;  4BAC A;  2MYS A;  4H0E A;  2FML A;  2BY0 A;  2VLA A;  4G7H F;  2FOW A;  3FF5 A;  4CH7 A;  3ZMU A;  5D4R A;  2EFN A;  2VBW A;  2M9H A;  4RB1 A;  1IN8 A;  3VW1 A;  4XLA A;  2LF7 A;  4M3G A;  4AIH A;  2DMT A;  2VC1 A;  2XAH A;  4BGD A;  1DQU A;  2QSG X;  1Y8R B;  2W1O A;  3Q0V A;  5FLX Z;  3ZMZ A;  5C4Y A;  4A2U A;  4MGR A;  2BY1 A;  2NYX A;  3DPL C;  3HJE A;  3I9V 2;  3TED A;  1JKO C;  1T08 B;  3IP4 B;  3LQQ A;  2RDP A;  2HNH A;  2OCC H;  2BVM A;  4IHW A;  3Q3S A;  4EMS A;  1FNN A;  3LL7 A;  4KIG A;  2RN7 A;  2I5U A;  3C2G A;  2M7A A;  2RC4 A;  5FHP A;  2HPI A;  3A0B C;  3F3X A;  3GLL A;  2M30 A;  1SD6 A;  3FIW A;  4QWQ A;  2DT5 A;  2XGD A;  2WC2 A;  1KON A;  3BQY A;  1WPK A;  4RAG A;  3G7R A;  4UUS A;  1BR2 A;  1CF7 A;  3S16 J;  2OV7 A;  3A0H C;  3KX2 A;  3QYE A;  5LHG A;  1WSU A;  2P81 A;  2R3S A;  5EDN A;  3SHF A;  1X1A A;  2HYG D;  2Q1Z B;  3DXJ F;  3PFY A;  2VQL A;  2IP2 A;  1RKT A;  3PNY A;  3H3Z A;  1QRY A;  3HRU A;  1MD0 A;  2VQG A;  5LGN A;  4HX4 A;  3IRR A;  3ECO A;  3M1E A;  5FRN A;  3J7A Y;  2HVQ A;  1QVU A;  5F08 A;  5LHI A;  4A3K J;  1FWZ A;  1OCZ H;  1Y39 A;  1ZRF A;  1GXP A;  2O8K A;  2OQG A;  2STT A;  4XLN F;  4ABZ A;  4XN0 A;  1HST A;  1S29 A;  2BVL A;  3LFU A;  1WCM J;  4A3G J;  1BW6 A;  4WX9 A;  3ML6 A;  1WZ2 A;  4BY1 J;  2RKH A;  2DK8 A;  2KIU A;  1LVA A;  3DKY A;  3DLL F;  3RJP A;  4FAS D;  1W5T A;  4IL6 C;  1XMA A;  2JJ7 A;  5EGO A;  2ZME B;  2Z2S B;  1X2M A;  3C7J A;  2X1E A;  3J7A O;  2EIJ H;  1QGP A;  3F8C A;  4WXC A;  4IKF A;  5A2Q Z;  2AQE A;  1R7J A;  3MVP A;  2V6E A;  3P9C A;  3BJB A;  1LFB A;  2K9L A;  2R7S A;  5CXI A;  1NHA A;  1S72 I;  3MFK A;  4C9Y A;  5CQE A;  2G7H A;  4IEJ A;  1R5G A;  2XB0 X;  4HKU A;  5J40 A;  2FBK A;  4LG0 A;  4G9Y A;  1J09 A;  4C30 A;  1MDM A;  3VB2 A;  1OCC H;  2QGU A;  2BE5 F;  4A3D J;  4PZJ A;  5AIP A;  4IHV A;  3OL3 A;  1G59 A;  3IAS 2;  1N25 A;  1YW9 A;  1B8I A;  3HPH A;  5DAJ A;  1F43 A;  3OYC A;  1IW7 F;  3LOC A;  3QOD A;  2WB1 N;  5L3D A;  4DJA A;  3F6O A;  2YUS A;  2I10 A;  1WJD A;  3CDH A;  4G6Q A;  3LSJ A;  1YS6 A;  1P92 A;  4EM2 A;  4EJT A;  3FM5 A;  3EUP A;  3AAF A;  3W6K B;  3FMQ A;  3PJR A;  2WTE A;  1O3T A;  2IU5 A;  3Q0W A;  1ZTR A;  1IRG A;  1OCO H;  2TRT A;  2ZB9 A;  2E1M C;  3DLA A;  4MQV A;  1YE9 A;  3NNR A;  2JPB A;  3GTJ J;  1G3Y A;  3KYC B;  4IRH A;  2ELJ A;  5F1J A;  1FEX A;  1K78 B;  2DFI A;  4UUT A;  4RM3 A;  2P6S A;  3VYR B;  2EK5 A;  3CMY A;  3NWS A;  3CP8 A;  4I99 C;  4GFL A;  4HYE A;  2LFB A;  4II3 A;  3J81 K;  1IRX A;  2G3B A;  2OI8 A;  1QO0 D;  3IV5 A;  3K4B A;  5HBU A;  1BI3 A;  4BY7 J;  1HDD C;  1LB2 A;  2GOX B;  2NOJ B;  1PP8 F;  2LKX A;  4XMY A;  3ZCO A;  3COL A;  2KRC A;  1YHQ I;  1SGM A;  1W4M A;  5BOX A;  4B43 A;  1FX7 A;  4DIQ A;  3U21 A;  1I3A A;  3R0A A;  3C2B A;  2OZ6 A;  3ZGK A;  2WB1 A;  3GYH X;  3U9G A;  1BJZ A;  1PDN C;  1SVL A;  1XD7 A;  3BPV A;  1J2X A;  2DCE A;  2CYY A;  4LJZ F;  3OYJ A;  2CGP A;  2BGC A;  2HVS A;  3KIO A;  1PUE E;  1U8B A;  2R7T A;  1BOB A;  4QTR A;  1TWA J;  4UV8 A;  5CVJ A;  4B1R A;  3K1M A;  2K9Q A;  1V5G A;  3BRO A;  4KYW A;  4E7Z A;  4B44 A;  3ASN H;  1GT0 C;  4LK1 F;  1LQ1 A;  1Z0X A;  3QU3 A;  3TDU C;  3I59 A;  2ME0 A;  2A05 A;  4TV7 A;  1MND A;  4IRI A;  1W7P A;  2PX9 A;  4FX0 A;  4AID A;  1VQ4 I;  3PSF A;  1FY7 A;  2G9W A;  5M5Y J;  2QKM B;  4ZYA A;  1EV7 A;  3MQ0 A;  3VDX A;  3CCR I;  1UZC A;  4XRF A;  3GTP J;  4ZDL A;  4HZF A;  4PJN A;  2VT3 A;  3M8E A;  2AXT C;  2O0Y A;  4HST A;  2LF8 A;  2WBM A;  2WAF A;  5CVV A;  3LSR A;  2ZY9 A;  5FFZ A;  2L02 A;  4NN1 A;  2GQQ A;  2ZXH A;  1TWG J;  1W5S A;  5C44 J;  4OIO F;  1Y1V J;  2NXN B;  2KIQ A;  3CUO A;  1T33 A;  3OYK A;  1DGW Y;  3VW0 A;  4B47 A;  4A6E A;  5HOO A;  4F91 B;  4XIC A;  3ABU A;  5HDG A;  4AYB N;  1MH4 A;  1SMT A;  1F36 A;  4EVI A;  1FTT A;  4UV9 A;  2BXZ A;  3FK7 A;  5DTD A;  3ZQ7 A;  3QP5 A;  2Z5U A;  3O2P E;  1SMY F;  1N77 A;  1FBQ A;  1XTA A;  2DJI A;  3AG1 H;  2M7B A;  4M9Z A;  2V26 A;  4HQE A;  3LHQ A;  2X1D A;  4B48 A;  4EM0 B;  3WTS C;  3CCJ I;  3A4C A;  2P6T A;  1B9N A;  1OPC A;  2EB7 A;  1MIJ A;  2EFP A;  2MG4 A;  4FE7 A;  3SFI A;  5LFA A;  1KU7 A;  2I8D A;  4KMF A;  2E5N A;  1N78 A;  5K5Q A;  3CCQ I;  1HW1 A;  2L9R A;  1LDD A;  2GLO A;  5GTI C;  2E36 A;  1V54 H;  3R6S A;  3K9T A;  4U9N A;  2MD0 A;  2L9V A;  1MKM A;  3F72 A;  3H36 A;  3WE3 A;  1X4P A;  2CQ7 A;  3PUF A;  1R5H A;  5J47 A;  1Z7L A;  2CUZ A;  1OKR A;  1IO2 A;  4IJA A;  3DWL E;  4U0Y A;  3P5J A;  1MW7 A;  1WVR A;  2J5O A;  4X6A J;  3H5R A;  5ILV A;  2P7C B;  2V6C A;  4U88 A;  4IVN A;  1OFC X;  1Y0U A;  3HRM A;  3K4K A;  1MJ9 A;  1X4O A;  4E7K A;  2OU2 A;  4NUB A;  3OYH A;  2B1E A;  1C0W A;  1D5V A;  3JRC A;  1W1W E;  2YU3 A;  4HSR A;  2DMP A;  1I6H J;  3VUQ A;  1JI8 A;  2D1V A;  4O5V A;  1BI1 A;  1I39 A;  3VPR A;  1YJW I;  2FQ3 A;  5ICC A;  2VKV A;  1D0Y A;  4ZYG A;  1FPQ A;  5IOY A;  4A3C J;  2WAQ N;  2HKU A;  1IN5 A;  1GHC A;  1MJB A;  2LKS A;  3KFW X;  4GO1 A;  3O3K A;  3HOW J;  3I53 A;  3CO7 C;  3TKY A;  3WTU C;  2IA2 A;  2MA3 A;  3S1N J;  2K9M A;  1YX3 A;  3BG9 A;  5E20 A;  1JHF A;  2KHM A;  2IS2 A;  2FEZ A;  4G12 A;  1SFX A;  4ANJ A;  2Z33 A; 
#chains in the Genus database with same CATH homology
 1Y1W J;  4MXM A;  1HDP A;  4JX4 A;  2HYT A;  3KKC A;  1K83 J;  3HOZ J;  2F07 A;  4JYK A;  4MO7 A;  1SFO J;  4DYC A;  1RES A;  2EZH A;  2ECC A;  2DMU A;  1IRZ A;  3GBG A;  3LJL A;  5GP9 A;  2DA6 A;  3NI7 A;  4QSH A;  2CUF A;  2XGE A;  5H9T A;  3OSF A;  1S7E A;  3MNL A;  4GCL A;  2MGQ A;  3H3V K;  3G1O A;  1U9N A;  5CXG A;  1IC8 A;  3VVY A;  4I76 A;  3G56 A;  1JUS A;  3HOX J;  3HM5 A;  3IH3 A;  4A3J J;  2FX0 A;  1VI0 A;  2FBQ A;  5EYR A;  1ZR4 A;  3TW6 A;  3F1B A;  5JLW A;  2NVQ J;  3IUV A;  1RET A;  1VF9 A;  5FLV A;  4A3I J;  5GPA A;  2CQX A;  1JGG A;  3WHB A;  2UXH A;  4ACI A;  5C3E J;  1WH7 A;  3CQZ J;  5E3N A;  3W6V A;  1NK2 P;  4YZE A;  2X48 A;  1NTC A;  4D5C A;  5K7F A;  3JRB A;  2EZI A;  4M3E A;  5EFY A;  2E2I J;  1CQT A;  1R9T J;  3VW2 A;  3NAR A;  3SDG A;  2AO9 A;  3NPI A;  1Z77 A;  4V2G A;  2L0K A;  5HOD A;  2D5V A;  2LVS A;  3FK6 A;  1FTZ A;  1XC5 A;  1ETW A;  3DEW A;  3BCG A;  4A69 C;  4AC0 A;  4DZJ A;  5E3O A;  5EGO B;  2R92 J;  3HTH A;  2X6O A;  3KNW A;  4JX6 A;  3LNQ A;  5FJ8 J;  3JRF A;  2VPR A;  3BTI A;  1FJL A;  1GV5 A;  2WGB A;  2ZCM A;  2JA6 J;  3IH4 A;  4W97 A;  3BR2 A;  1PUF B;  1HCR A;  2DG8 A;  1ETO A;  3HKZ N;  2GUH A;  2O7O A;  3RZD J;  1A5J A;  3GTO J;  4B3A A;  2DA5 A;  2TCT A;  5F0H A;  4A3L J;  2G7G A;  1RPW A;  2Y31 A;  1T56 A;  1AU7 A;  3M3Y J;  3ON4 A;  1EF4 A;  5F0F A;  1LFU P;  1TC3 C;  1JUM A;  3JRG A;  3S1R J;  1MSF C;  2B63 J;  3B6A A;  2XB5 A;  1B8I B;  1Q1V A;  5FKL A;  3TP3 A;  2R5Z B;  3O8G A;  5DS9 A;  1I50 J;  2LY9 A;  4AF5 A;  2DTZ A;  3QPS A;  2M0C A;  3JRA A;  3O60 A;  3A02 A;  2VUM J;  3HBL A;  4JNN A;  4Y7N J;  4BBS J;  1MBG A;  2O7T A;  3LWJ A;  3DCF A;  2X9D A;  3BR6 A;  3BRU A;  2EQR A;  3GEU A;  3VOK A;  1G2H A;  1BW5 A;  3CCY A;  1OJL A;  1XG1 A;  1TWH J;  1E3O C;  2Y2Z A;  2E19 A;  1PUF A;  5FGL A;  3GZI A;  4D5F A;  3K2A A;  4JL3 A;  1JKP C;  1DU6 A;  2L7Z A;  3JSJ A;  2DA3 A;  2DG7 A;  1TWF J;  2HYJ A;  4ME9 A;  1JT6 A;  2RAS A;  1NK3 P;  3H0G J;  5C4J J;  4FCY A;  5HAW A;  3SJM A;  1HOM A;  2ID6 A;  4M3B A;  3S5R A;  4MIM A;  1O4X A;  1SAN A;  3KZ9 A;  1ORK A;  4AC6 A;  3ANP A;  3BNI A;  1I3Q J;  4JKZ A;  5IP6 A;  4B4C A;  2R5Z A;  1ZGW A;  2XPU A;  1WH5 A;  2G7S A;  5GPC A;  2XRL A;  2DA4 A;  4V2F A;  2KT0 A;  2DA2 A;  2HXO A;  4L5E A;  3LSP A;  1K61 A;  3EGQ A;  4MK6 A;  4MFD A;  4IHY A;  9ANT A;  2DMN A;  5EF6 A;  2HDD A;  3HGG A;  3P9T A;  1H8A C;  3GTM J;  2Q24 A;  2EZK A;  2HXI A;  3E7L A;  3BTL A;  5BNG A;  2VKE A;  3D1N I;  2E2J J;  2ELK A;  2QWT A;  2ZCN A;  3QBM A;  5E3L A;  3OSG A;  3C07 A;  4A3B J;  2V57 A;  4UDS A;  2LP0 A;  4PXI A;  3BG5 A;  1QVT A;  3LSG A;  1RKW A;  5E3M A;  4CYC B;  1MBH A;  2LK2 A;  2HOA A;  3UKG A;  2FJ1 A;  2PZ9 A;  1A6I A;  2FD5 A;  1ITY A;  2XPV A;  3WHC A;  2DMQ A;  2K40 A;  2QKO A;  4KWA A;  3BT9 A;  3L1P A;  1WGX A;  3HTI A;  2NP5 A;  2EZL A;  4UUS B;  2PBX A;  1MH3 A;  1OCP A;  2M9H A;  1VND A;  2OPT A;  3VW1 A;  3S1Q J;  3BQZ A;  2JN6 A;  5D1R A;  2Y9Y A;  4M3G A;  1W0U A;  2DMT A;  2WUI A;  3RD3 A;  4Y52 J;  1X2N A;  3G1M A;  2D6Y A;  2KDZ A;  2L7M P;  3HTJ A;  5K7H A;  3Q0V A;  3MN2 A;  2L7F P;  3PO3 J;  5C4Y A;  1ETK A;  3QPL A;  1RR7 A;  3I4M J;  2JWT A;  3BR1 A;  2YVH A;  3TED A;  1JKO C;  1YRN A;  1MBE A;  3RKQ A;  1U78 A;  1GV2 A;  3AQT A;  4W1U A;  4IHW A;  3Q3S A;  1MBF A;  1X58 A;  1ETQ A;  3ZQC A;  3PPB A;  2HOS A;  1POG A;  5FHP A;  2CJJ A;  2DA7 A;  2IAI A;  3S1M J;  4XK4 A;  4HNV A;  5D18 A;  2IEK A;  3FIW A;  3HGY A;  2CU7 A;  4XID A;  4XRS A;  1JTX A;  1ETY A;  3A01 B;  3JRH A;  2UXI A;  2XGD A;  3BQY A;  1WPK A;  3G7R A;  4M6V A;  4UUS A;  2YU9 J;  3GTG J;  3S16 J;  3ZOB A;  2QCO A;  2H8R A;  1P7I A;  2P81 A;  3PM1 A;  1B72 B;  5EDN A;  5D19 A;  3G1L A;  3K7A J;  3JR9 A;  5M5W J;  2XSD C;  5IP7 J;  3HB9 A;  1RKT A;  3HE0 A;  4EEF G;  1QRY A;  3ZQF A;  4L62 A;  5EZH A;  2LLK A;  1QVU A;  2QTQ A;  2PMZ N;  5F08 A;  3QQA A;  4A3K J;  4D7M A;  4DYR A;  4DYQ A;  1IV6 A;  2W53 A;  1UHS A;  2Y9Z A;  1ZQ3 P;  2O8K A;  3Q0U A;  4ABZ A;  1JUP A;  1WCM J;  4A3G J;  1BW6 A;  2G0E A;  1JTY A;  5F0C A;  3ZQG A;  3VOX A;  1H88 C;  3NXC A;  4BY1 J;  5EG0 B;  3HOV J;  1DU0 A;  3A01 A;  3S2H J;  2QIB A;  2JJ7 A;  5EGO A;  1X2M A;  2YS9 A;  3JRD A;  3BG3 A;  1BL0 A;  2M8G X;  1GVD A;  5J1R A;  2ZOY A;  3TW7 A;  2COB A;  2JA5 J;  4CGR A;  3MVP A;  2CRG A;  4IHX A;  4MLO A;  3BJB A;  4NEL A;  5HSZ A;  1LFB A;  2W48 A;  5CXI A;  4QIW N;  4IEJ A;  1MBJ A;  2DA1 A;  2XB0 X;  1AKH B;  4HKU A;  4AUX A;  2LTP A;  3V6G A;  1FIP A;  3BHQ A;  2UXP A;  1GUU A;  3FRQ A;  4A3D J;  2NS7 A;  3VVX A;  4M3D A;  3KKD A;  3CDL A;  3RQI A;  4IHV A;  5IOZ A;  5JLX A;  3S14 J;  1GDT A;  5K7Z A;  1B8I A;  5DAJ A;  3BR3 A;  2MW8 A;  1ZK8 A;  1F43 A;  3HIM A;  2G7L A;  5IP9 J;  3LOC A;  4NDL A;  2QOP A;  2HI3 A;  5EG0 A;  1IDY A;  2WB1 N;  4C3I J;  2ME6 A;  1UG2 A;  2YUS A;  4BBR J;  5FKM A;  2I10 A;  3LSJ A;  3A03 A;  2K9N A;  3NRG A;  2LR8 A;  4FIS A;  2XDN A;  3EUP A;  2O9L A;  2VI6 A;  3VIB A;  3OIO A;  2IU5 A;  1W0T A;  3Q0W A;  1ZTR A;  3O8H A;  1WI3 A;  2TRT A;  5IYB J;  2ZB9 A;  4X1E A;  4RBO A;  3GTQ J;  2REK A;  3NNR A;  3GTJ J;  5F1J A;  1FEX A;  3CJD A;  3I4N J;  5K58 A;  3FIS A;  4UUT A;  4C3J J;  4FE4 A;  3E7Q A;  2Y0S N;  3CMY A;  2ZCX A;  2ECB A;  4GFL A;  1ZKG A;  2LFB A;  3GTL J;  3PAS A;  2OI8 A;  2OF7 A;  2G3B A;  2DN0 A;  2H1K A;  3IV5 A;  5HBU A;  4BY7 J;  1HDD C;  2NOG A;  3MKL A;  1FIA A;  2LKX A;  3COL A;  1UI6 A;  2JK3 A;  1SGM A;  4ICH A;  5EZG A;  2GFN A;  3BR5 A;  5FKO A;  3CRJ A;  2RHA A;  3C2B A;  5M5X J;  1BJZ A;  3HDD A;  2NS8 A;  2XPW A;  4JX5 A;  5FLM J;  2ID3 A;  1LE8 B;  1U8B A;  4QTR A;  2HOT A;  1TWA J;  4B1R A;  3BR0 A;  3RZO J;  4CYC A;  3QKX A;  3BTC A;  2K9Q A;  1APL C;  3HEF A;  2M34 A;  1IG7 A;  1ETX A;  3B6C A;  2NVY J;  3AQS A;  1GT0 C;  4D7N A;  2JA8 J;  3B81 A;  1Z0X A;  2GM4 A;  2ME0 A;  2R0Q C;  2N8G A;  2YVE A;  2MSY A;  4FTH A;  1MSE C;  4GFB A;  5C4X J;  5EEA A;  2AHQ A;  3VP5 A;  3NAU A;  5M5Y J;  2UXU A;  2ZOZ A;  1HF0 A;  3GTP J;  1UI5 A;  1ENH A;  3JRI A;  3JRE A;  3HTA A;  4S0H B;  1JKR C;  1TWC J;  2R5Y B;  2JMW A;  1UMQ A;  3ON2 A;  1JT0 A;  1IDZ A;  2GBY A;  3S15 J;  2LD5 A;  3LSR A;  2E1O A;  1MNM C;  1MBK A;  1P7J A;  1IGN A;  5FMP A;  4NN1 A;  1LE8 A;  1TWG J;  2HQ5 A;  5C44 J;  1Y1V J;  2WV1 A;  5J1U A;  1T33 A;  1QPI A;  4M3F A;  3ANG A;  3VW0 A;  1VFC A;  1XS9 A;  4JP0 A;  4LOC A;  4XIC A;  4AYB N;  5IYD J;  1MH4 A;  3S2D J;  2RAE A;  1F36 A;  4C3H J;  1D5Y A;  1FTT A;  2CQQ A;  4DW6 A;  3T6N A;  3FK7 A;  5DTD A;  4A93 J;  4J19 A;  4XRM A;  4MFE A;  2UXO A;  2IBD A;  3V78 A;  3DPJ A;  2NVT J;  3LHQ A;  1B72 A;  4FE7 A;  3SFI A;  2MG4 A;  4GFK A;  2OER A;  2CUE A;  5IPA A;  3TP0 A;  4A3F J;  2XGC A;  2L9R A;  4XRS G;  2GLO A;  4A3M J;  3IH2 A;  1ZR2 A;  3GTK J;  2R5Y A;  4DZP A;  3FKI J;  5J3L A;  4RDU A;  2NX4 A;  1IUF A;  2EBI A;  5M3F J;  3HOY J;  3VVZ A;  3OOU A;  2M2E A;  3PO2 J;  1OCT C;  2R7Z J;  4X6A J;  1IJW C;  2R93 J;  5F27 A;  2E2H J;  1OFC X;  1JJ8 C;  3S17 J;  4BKX A;  5F04 A;  2NVX J;  2QF7 A;  2K9S A;  3F0C A;  2Y30 A;  4GCK A;  3ZQI A;  3JRC A;  3HOU J;  1JJ6 C;  1AHD P;  1H89 C;  2DJN A;  4GCT A;  1I6H J;  2DMP A;  3VUQ A;  4I6Z A;  1ETV A;  4C2M J;  5M3M J;  3M4O J;  3VPR A;  3BTJ A;  2VKV A;  4A3C J;  5IOY A;  2HKU A;  1AKH A;  2EH3 A;  2WAQ N;  1JKQ C;  1U9O A;  2FQ4 A;  1BA5 A;  4A3E J;  4BXX J;  2GEN A;  3RH2 A;  1HLV A;  3HOW J;  3CWR A;  3ZQL A;  3ZQH A;  1YRN B;  5IYC J;  3S1N J;  5CW8 A;  3BG9 A;  5FKN A;  5FKK A;  5J1Y A;  4G12 A;  2JA7 J;  2NP3 A;  5AQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...