2HQ5A

Crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Multidrug-Binding Transcription Factor QacR Binds the Bivalent Aromatic Diamidines DB75 and DB359 in Multiple Positions
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hq5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hq5A02
2Y9YA 4W1UA 3WHBA 3CMYA 3S5RA 3CWRA 1XC5A 4V2GA 5IYDJ 2OI8A 1K61A 2DA5A 1T33A 2G0EA 2E2IJ 1AKHA 3ON4A 2P81A 3BR2A 1ZGWA 3RZOJ 4FTHA 3BR3A 2DA3A 2LVSA 4DW6A 5EFYA 1AHDP 2E2JJ 4XRSG 1E3OC 4G12A 3IV5A 3GTGJ 1TWCJ 2YUSA 4A3CJ 2FD5A 3F0CA 3ON2A 3F1BA 4RBOA 3HOUJ 3E7QA 1HCRA 1HLVA 4DYCA 2JA7J 1Y1WJ 3BR0A 4XK4A 3JR9A 5IYCJ 3HDDA 1OCTC 3GBGA 2EZIA 1H8AC 5K58A 5M3MJ 1U9NA 2HKUA 2MG4A 3O60A 5M5WJ 3LSJA 5E3OA 5J1YA 1UI6A 3GTLJ 4UUTA 4B4CA 4BXXJ 1I6HJ 1GT0C 2K9NA 1R9TJ 3JRAA 4IHVA 5F0HA 5J1RA 5F1JA 5M5XJ 1XS9A 2E2HJ 2R0QC 4NELA 3BCGA 3FKIJ 3QQAA 2HOTA 1ETKA 1F36A 2JK3A 2WB1N 5C4XJ 1IJWC 3LSPA 2UXUA 3HB9A 2XB5A 4MFDA 3S14J 3B81A 2E1OA 3C07A 2VKEA 4C3IJ 2HI3A 3FK7A 3HEFA 4LOCA 4GCKA 1HDDC 3NXCA 2YS9A 1WI3A 3TP0A 4A3BJ 4MFEA 3GTQJ 2WAQN 1MH3A 4A3FJ 2K9SA 2H8RA 4DZPA 2FBQA 1BJZA 4I6ZA 3MNLA 3S2HJ 3HGYA 2W53A 3VOXA 3JRFA 2QCOA 3HIMA 1MH4A 5H9TA 2ECCA 3HOWJ 3BQZA 3TP3A 3NI7A 2L7FP 4QIWN 2LD5A 2ELKA 4JKZA 4BKXA 1JJ6C 2LLKA 2QF7A 5F0FA 3GTMJ 3TW6A 2M9HA 4JP0A 2IBDA 2ZOYA 1JT6A 1RESA 1JUMA 3G1LA 2DMPA 2CUFA 2NOGA 3ANGA 2XGCA 4FISA 2DN0A 3SJMA 5DAJA 2K9QA 3BTJA 2ID6A 2RHAA 4FCYA 4JX6A 1TC3C 1SANA 2EBIA 1TWHJ 1QVUA 3PM1A 5FKKA 5IP6A 3EUPA 1ZTRA 1F43A 2HQ5A 2GBYA 3OSGA 2Q24A 2VI6A 5C44J 3QBMA 2XPWA 1W0TA 4A3JJ 1SGMA 2XRLA 1VFCA 2M0CA 4MXMA 2MSYA 1WH7A 5E3MA 3O8HA 2HDDA 2QWTA 5J1UA 2DA7A 3O8GA 2LK2A 3FK6A 5GPAA 2EQRA 1HDPA 1JGGA 3NAUA 2QOPA 3KNWA 4Y52J 3BNIA 2PMZN 1PUFB 5BNGA 1NK3P 4XRMA 5EYRA 1UMQA 2CUEA 1A5JA 1O4XA 1RKWA 3HOXJ 4MIMA 4MK6A 1Z0XA 5IPAA 2LR8A 5C3EJ 1U9OA 1TWFJ 4B1RA 2GUHA 4BY7J 1PUFA 3HOYJ 5EZHA 1TWAJ 5K7FA 2Y31A 2DA1A 2QTQA 3RH2A 5F27A 1FTZA 2QIBA 3M3YJ 5EF6A 3Q3SA 4Y7NJ 1MBJA 3LSRA 2R7ZJ 4X6AJ 2NS8A 2DG8A 2G3BA 5HODA 1H89C 3ZQHA 5F08A 4UDSA 2R93J 3ZQGA 4AC0A 2UXHA 2M34A 2EZLA 3LOCA 3S1NJ 3LHQA 4A3KJ 3GTPJ 1OFCX 5FHPA 4AF5A 4HKUA 1EF4A 4JX5A 3CCYA 4D5CA 3A01B 1B8IB 2NX4A 3D1NI 5GP9A 2IU5A 3BR5A 3K7AJ 2KT0A 4X1EA 3COLA 1JUSA 1XG1A 5EDNA 1ZK8A 3LSGA 2F07A 1D5YA 3E7LA 3ZQLA 1SFOJ 4HNVA 2NVTJ 2ME0A 2FJ1A 3FISA 4CYCB 3A01A 1B8IA 3BTCA 4M3EA 2JA5J 2GENA 3IH3A 3LWJA 4DZJA 2H1KA 3DCFA 5FMPA 1GV2A 3M4OJ 2X48A 2UXPA 1YRNB 1JTYA 1HF0A 4A3GJ 1A6IA 2R5ZB 3S1QJ 3WHCA 1JT0A 4D5FA 1MSEC 2EZHA 4CYCA 3SDGA 5FKLA 2JA8J 3S1RJ 5HSZA 2CQXA 2M8GX 1UI5A 3RQIA 4AUXA 4ME9A 2UXOA 5FKMA 2WUIA 2XGEA 1YRNA 4UUSB 2ZCNA 3HM5A 1LFBA 3QKXA 2DTZA 4JNNA 3BT9A 2R5ZA 1ETXA 1IRZA 5M5YJ 1IG7A 3PASA 1VF9A 3BQYA 1RPWA 2Y9ZA 2G7LA 2FX0A 4C3HJ 1DU6A 5C4JJ 4IHYA 4A69C 5IOZA 4UUSA 2JA6J 3HE0A 3P9TA 1ZQ3P 1MBGA 3I4NJ 5GPCA 4FE4A 2XPUA 3BTIA 3VPRA 4EEFG 4V2FA 1GUUA 1QVTA 1JJ8C 5EGOB 3OOUA 2NVQJ 2FQ4A 3VW0A 2O9LA 5K7HA 1FIAA 2PBXA 5E3LA 3CJDA 2TRTA 4XIDA 5FKOA 2QKOA 2YU9J 4DYRA 1CQTA 3BR1A 2NP3A 2LKXA 4M3DA 1MBEA 3NPIA 5EGOA 2ID3A 1TWGJ 2CJJA 5HAWA 2LFBA 3A03A 2HXOA 2DMUA 3RKQA 3JRGA 3ZQIA 1B72B 3JRBA 4NDLA 4QSHA 3S2DJ 4CGRA 1IDYA 1K83J 2Y2ZA 2GM4A 4M3GA 2CQQA 2YVHA 1QPIA 3IUVA 1IDZA 5D18A 3G56A 1B72A 2X9DA 1AU7A 3B6AA 2IEKA 3CRJA 2E19A 3Q0VA 1LE8B 1OCPA 2UXIA 2XSDC 2DA4A 2JWTA 2JMWA 1ZR2A 3I4MJ 4DYQA 2X6OA 1G2HA 2PZ9A 3EGQA 5D19A 3CQZJ 2WGBA 3DPJA 1GVDA 1P7IA 5D1RA 1BL0A 3S15J 2O7OA 3G1MA 1LE8A 3VIBA 1H88C 3AQSA 3IH4A 1POGA 1MNMC 1JKPC 3A02A 1JUPA 3HTAA 3JSJA 2XB0X 5IYBJ 3VUQA 3HTJA 1X58A 5E3NA 3VVZA 5FKNA 2VPRA 3CDLA 2DJNA 5JLWA 1UHSA 2REKA 2DG7A 3NRGA 1ZR4A 1X2MA 1BW6A 3L1PA 1MBKA 1P7JA 3NARA 3GTJJ 1I3QJ 5IP9J 3QPLA 2DMQA 4IHWA 2G7GA 9ANTA 3HTIA 2HXIA 1ETVA 3PO3J 1GDTA 1FIPA 2NVYJ 4D7NA 3V6GA 4BBSJ 1BA5A 1I50J 4L5EA 1NTCA 3OSFA 3VW2A 3HTHA 2ME6A 2LTPA 2ZCMA 4A3MJ 3Q0WA 5F04A 2JJ7A 2Y0SN 4GFKA 3MKLA 1MSFC 3G1OA 3H3VK 2ZCXA 5FLMJ 2B63J 1RETA 4A93J 3NNRA 1ETWA 2HYJA 1JKQC 2I10A 2OPTA 5M3FJ 2IAIA 4A3IJ 4NN1A 1WCMJ 2RAEA 1APLC 4JX4A 4XRSA 2R5YB 4KWAA 2XPVA 1HOMA 1GV5A 5AQCA 3BG3A 5DS9A 3BRUA 5IP7J 2ZOZA 2NP5A 2M2EA 3BJBA 3HBLA 2VKVA 4MO7A 3LJLA 5EEAA 2R92J 1IC8A 1S7EA 1FEXA 3GZIA 4YZEA 2COBA 2LP0A 5CW8A 4ACIA 4PXIA 2AHQA 2L9RA 1ZKGA 4IHXA 3BG5A 1U8BA 3KKDA 2R5YA 2XGDA 2D6YA 3PPBA 1Z77A 3B6CA 2AO9A 4FE7A 1MBFA 2TCTA 2YVEA 2ECBA 5DTDA 5FLVA 3T6NA 3HOVJ 3ZQFA 3LNQA 3ZQCA 3MN2A 4XICA 2OERA 4W97A 5CXGA 3JRHA 4GFLA 2Y30A 2K40A 4M3FA 3H0GJ 2WV1A 1IGNA 2D5VA 4GFBA 2EZKA 1OJLA 1W0UA 1FJLA 4A3DJ 1ITYA 4D7MA 3FRQA 2OF7A 2DA2A 1Q1VA 5FJ8J 2EH3A 1U78A 5JLXA 1ENHA 3JRDA 4M6VA 2HYTA 2DA6A 2VUMJ 1ETQA 1JTXA 1ETOA 3OIOA 1WPKA 2CRGA 3TW7A 5IOYA 3RZDJ 5EZGA 3PO2J 2HOSA 3BG9A 1VI0A 4C2MJ 4MLOA 2L7MP 3JRCA 2KDZA 1DU0A 1IUFA 3C2BA 4A3LJ 3BHQA 3JRIA 2DMTA 3S17J 2V57A 3AQTA 4B3AA 3ZOBA 1UG2A 4ICHA 3K2AA 4GCLA 3GEUA 2DMNA 4S0HB 1JKRC 2NVXJ 1Y1VJ 3QPSA 5C4YA 1BW5A 3BTLA 1JKOC 4C3JJ 1QRYA 2GLOA 1ETYA 2CU7A 2L7ZA 3GTOJ 3GTKJ 3DEWA 1MBHA 3JREA 2G7SA 3MVPA 4A3EJ 3FIWA 4M3BA 4J19A 4AYBN 2MW8A 3IH2A 1NK2P 4QTRA 5F0CA 4I76A 5K7ZA 4RDUA 1LFUP 3KKCA 3VVXA 5J3LA 4GCTA 3S1MJ 3TEDA 2RASA 4BY1J 2XDNA 3SFIA 2LY9A 1X2NA 3ANPA 5CXIA 1WH5A 3KZ9A 3RD3A 4BBRJ 3W6VA 3HGGA 1WGXA 1T56A 5EG0B 4JYKA 4L62A 4IEJA 3Q0UA 2NS7A 5HBUA 3VVYA 2W48A 3HOZJ 3VOKA 3VW1A 3BR6A 2L0KA 3VP5A 4ABZA 2HOAA 5EG0A 1ORKA 2JN6A 3S16J 2O7TA 1IV6A 1VNDA 1RKTA 5FGLA 3UKGA 2GFNA 2O8KA 4JL3A 1AKHB 3V78A 2ZB9A 1FTTA 3G7RA 3HKZN 4AC6A 1RR7A 2MGQA 2N8GA
chains in the Genus database with same CATH superfamily
1PDNC 2Y9YA 1TZLA 4W1UA 4UVBA 2E1MB 1XC5A 5IYDJ 5DCMB 2DA5A 1J5YA 1T33A 2E2IJ 1AKHA 2CQNA 2EV6A 2ZKZA 2DOAA 1LPQA 3CC4I 5DEQA 2BGCA 5K5RA 4FTHA 3HPGA 2CS3A 5EFYA 1KONA 1XDUA 3WTTC 3H0DA 2E2JJ 4UVAA 5D6FA 5LHHA 3GTGJ 3CTAA 3K9TA 2FQ3A 1TWCJ 2YUSA 2LYCA 3F1BA 4HX8A 2WADA 3HOUJ 3E7QA 3F8NA 2VXZA 4ZZLA 4CA0A 3FMSA 4HZFA 4XN3A 4RB1A 3MQ0A 4U87A 2EZIA 1H8AC 4E7KA 2GIZA 2X0LA 3BDDA 1K4SA 5HLTA 5E3OA 2XF6A 1X4OA 3CUQA 3GTLJ 4BXXJ 2W25A 1HC8A 1A35A 3DPUA 2PJRB 2EA4A 3JRAA 5F0HA 2UXXA 4A0ZA 4R8HA 1XS9A 1YW7A 3DWLE 2R0QC 4NELA 2A6TA 2EFQA 1F4KA 3FKIJ 1MGTA 1RC9A 2H1LA 4OU0A 3BJOA 4HDUA 4ZC3A 1VQMI 1BM9A 2XB5A 1BJAA 3HB9A 3PUBA 3B81A 2LC2A 1OCRH 4DGWB 1HKSA 4MTDA 3HEFA 4LOCA 1WJAA 4LLLA 3I64A 3I3LA 3NXCA 2DU9A 2YVXA 3TP0A 1WI3A 1RUNA 1IUYA 4RLFA 3E0JB 3ZMZA 2GQQA 1MH3A 1HQCA 2NXNB 2WAQN 3BCAA 2K9SA 4A3FJ 2QSFX 3L2CA 2KLOA 2H8RA 4DZPA 4M9ZA 1BJZA 4OIPF 2DYRH 4I6ZA 4HSRA 5FD5A 2DOFA 2Y0MA 2QENA 3S2HJ 4CCLA 2YX4A 3PFIA 2GIVA 2ECCA 3CZ6A 3NI7A 2M0MA 4CCOA 3VYRB 2LD5A 3VTIA 1U5TA 2VT2A 4A0XA 3RSNA 2ELHA 2ZY9A 2HOEA 5TRDA 5BQTA 4BKXA 2LLKA 2QF7A 3AL0B 1SC7A 2ZOYA 1JT6A 3FXMA 1MMGA 4FX0A 3A0HC 1B59A 1JUMA 2DMPA 2CUFA 4DOZA 4RB3C 1R4NB 1CF7A 4IO9F 3HJEA 2XGCA 2CH0A 3SJMA 3W3CA 2XAHA 4B48A 3IAM2 1KA8A 4HV5A 2O03A 1TC3C 1SANA 3PM1A 4HPQA 3EUPA 2RV8A 5LRRA 1XMAA 1W0TA 3BZ6A 4A3JJ 4MXMA 3D5SC 1O3QA 3FF5A 3HL2A 2GA2A 3IC7A 2F5VA 5IT9K 2EIKH 1HDPA 2EQRA 5F6FA 2UZKA 3KNWA 1UG0A 2G7UA 4RS8A 1PP7U 4KIFA 5KCMA 3ZMUA 1NG7A 4IXAA 3O6BB 4XRFA 3BJAA 3JW4A 5E1ZB 4MIMA 1Z0XA 5IPAA 4B8XA 4PK4A 3CCVI 2W4SA 2XASA 2OBPA 3KEYA 3RPUD 3HOYJ 3GZ5A 2CQ7A 3JAMK 5K7FA 2QTQA 2W24A 3RH2A 3H9GA 2QIBA 2YR2A 1U8RA 1SMYF 2LSOA 3DBLB 4Y7NJ 1MBJA 3OS1A 3IWFA 1D0ZA 2W1OA 2G3BA 4ITVA 1R58A 3OYFA 1H89C 5F08A 2VC1A 3L09A 4UDSA 5ED4A 2M34A 3LSIA 4NB5A 1EV7A 2O0YA 1YS6A 3S1NJ 1D3YA 3FWEA 1OKRA 4EM2A 2HYGD 3DEEA 3LMMA 3CCYA 3KYDB 5LHIA 3PFYA 3VOEA 4PJNA 2HWVA 3A01B 2DT5A 3U21A 3CJTB 4HX4A 4U9NA 3C2HA 3K7AJ 3K4BA 4OIRF 1JUSA 5FFXA 3HG9A 2COMA 5J4VA 2OCCH 2F07A 2ZXWH 1D5YA 1FWZA 3ZQLA 2K85A 3NRVA 1XGNA 2FJ1A 4NC7A 3F6OA 3K6GA 3BTCA 4M3EA 2X1DA 2YSRA 2JA5J 2K86A 2FJI1 1D5VA 2EIMH 2LMDA 1GV2A 2OJED 3SXYA 3M4OJ 1BI2A 3ZN1A 3ASNH 4RMNA 1JTYA 1RR8C 1A6IA 4CO8A 2R5ZB 4XLCA 3DV8A 3QPHA 1O3TA 2JA8J 3BY6A 3SDGA 4CYCA 2WA0A 3U9GA 4HV6A 1UI5A 4C9YA 1O7LA 3MZHA 2GXAA 2UXOA 1YRNA 4IL6C 1LFBA 3HUGA 1UELB 1SD7A 3ULQB 3CJNA 2GZWA 2IS2A 5M5YJ 2JVHA 3AG4H 1VF9A 2CV1A 2G7LA 3HTSB 3IL2A 2DDBA 1QNTA 5C4JJ 4A5MA 1G3SA 2DT6A 4LIVA 2LKSA 1VQKI 5FRNA 3J80K 2HZDA 1LNWA 2NRAC 3I4NJ 2FEZA 3MZYA 2L9VA 2XPUA 4I0BA 3VPRA 2KFDA 4ENJA 3GYHX 2LG4A 2ZFUA 1QVTA 2FQ4A 4LG0A 4ZYHA 3VW0A 2JPBA 3R6SA 5E3LA 3F8BA 3CJDA 1H9TA 5ILSA 3R60A 4BXFA 2YU9J 5DM7F 5BMZA 3RYPA 3SQNA 4DYRA 5L3GA 4MHGA 5FLXK 3PNVA 2FNPA 3BR1A 5BS6A 1MBEA 4HF2A 1A04A 4XLAA 4L5JA 1XSXA 1TWGJ 5JFRA 5HAWA 2XF5A 2QYOA 2DMUA 4KMFA 2BW3A 4XNFA 4EM1A 4BQNA 2CGPA 4CGRA 3I59A 1BC7C 3WU2C 2E1NA 2HGCA 3JSOA 2GM4A 3UR3C 1P4WA 2YVHA 2Q1ZB 2ZJ2A 2JQ7A 1IDZA 4M74A 3VFZA 3EQLF 1W5SA 2MFZA 4ETSA 1B72A 4GYIA 2F6CA 1AU7A 2IEKA 3CRJA 3MCZA 1LE8B 2OA4A 3N05A 1QHHD 1XB4A 2O8XA 3KZYA 2JWTA 5L3EA 1ZR2A 1G2HA 1LEBA 3CQZJ 1ZH5A 1P7IA 4BXUA 4RAGA 5D1RA 1HSJA 3S8PA 1DGRM 1BIBA 3SFZA 3L2UA 5CVUA 1KYZA 2KISA 1POGA 2DQRA 2IGNA 2O3FA 2X6XA 2YPRA 4RB2C 3K4MA 4RM3A 1TBXA 4Y33A 2XROA 1JGSA 4PJJA 3R4KA 5E17F 2GOXB 2R7QA 2DJNA 3F8FA 4H4KC 5ICFA 2R7WA 3CCLI 2A05A 2QGUA 1UHSA 3ZGKA 1ZRDA 1I1SA 5H6RA 3NRGA 3GO5A 3J7AY 1J9IA 1TW2A 3BZCA 3KLNA 1YX5A 3NARA 4CZCA 4AIKA 5JHFA 3GTJJ 1I3QJ 4ZDLA 4CDGA 2DMQA 3GFIA 1SD4A 9ANTA 3HZJA 2HXIA 3KETA 1YJWI 3GX4X 5H2FC 2NVYJ 4G6DA 3ASOH 4KUMA 4BBSJ 2FRHA 2A6HF 3EUKL 5E79C 3V7CA 5ILVA 4MQ9F 1XGMA 3HTHA 3ZMTA 2NS0A 2ME6A 3H9JA 2P6SA 2NYXA 1W4MA 3PNYA 5F04A 3DQVC 1RIOH 3OIQA 3H3VK 2ZBKA 5FLMJ 4S05A 1RETA 1QBJA 1R36A 2F5DA 2HYJA 2B63J 1D1CA 4XLPF 1B1BA 4HW0A 1Z3XA 4B44A 4KN4X 3GW2A 4BGDA 4XRSA 5HVQC 4BEHB 5TGTA 1OCCH 2M2EA 4WX9A 3HBLA 4I09A 4MO7A 3LJLA 3BLYA 2R92J 1YG2A 3CESA 2MC3A 5DDGA 2ESNA 4PXIA 5D4SA 2AHQA 2L9RA 2L2OA 3KKDA 2R7SA 3PPBA 4FE7A 1YO5C 3BG7A 4O3MA 2YVEA 1U6GA 4YIRX 2EFWA 3T6NA 1ZG5A 3ZQCA 3BOQA 1MMDA 2DPDA 3U1DA 4UUVA 1YE9A 1D8JA 2IPQX 3F72A 2BVLA 3KLOA 3FXJA 5HS9A 4HA8A 1FZPB 3PJRA 4GFLA 4QPOA 2V26A 2Z3YA 2ESHA 1ZYRF 4PJLA 2HYFA 4DQ2A 3OWTA 4FASD 1YITI 4A3DJ 2JT1A 1ITYA 2CQKA 2M45A 3FRQA 2IS6A 2OF7A 2DA2A 1Q1VA 5FJ8J 2EH3A 1U78A 3VDXA 2BHZA 3KP5A 2VUMJ 1ETQA 2ZJPF 4CXFA 5D5VB 4EQQA 3OYJA 2WAQA 4L0YB 1S7OA 3PSFA 4UVCA 3TW7A 1HW2A 3DKWA 3BG9A 1ON1A 2LF7A 2DYSH 2HPIA 3QU6A 3IHUA 3BHQA 5B1AH 5K5OA 4NUBA 3OYHA 2A3SA 5A2QK 3AQTA 4B3AA 3DBHB 3ZOBA 3MKWB 3O3KA 4ICHA 4GO1A 3GEUA 4WWCA 4S0HB 4NQWA 3EUHC 2OQGA 1JXSA 4A5NA 1BW5A 2MLGA 2GLOA 1QRYA 2CU7A 2FUG2 2L7KA 3DEWA 2WV0A 4L0ZB 1QZYA 3JREA 4XLHA 2G7SA 2E71A 3E5XA 4CYDA 4OMYA 1Y8QB 2RQPA 4AYBN 2MW8A 3VVXA 1T0FA 2CW7A 4I2OA 2RASA 1X1CA 2XDNA 3B02A 1B9NA 4WF2A 4BQAA 2XV4S 1JHHA 2F5CA 4EATA 2QQAA 4BBRJ 3W6VA 3HGGA 3NEUA 3FBIB 4ZTFA 4L62A 1MNEA 4IEJA 2HQNA 4BQQA 3Q0UA 2VE8A 4GCVA 4AIHA 4M72A 4M9SA 2R7RA 3I9V2 3VP5A 2QBYA 4YIIA 2UUZA 2LDUA 3HSEA 1ORKA 2JN6A 1VNDA 3NWTA 4AIDA 3PIPF 5FGLA 5DCFA 3VYTB 3K4JA 2HNHA 1FTTA 3ONQA 2IA0A 2B3WA 1U3EM 2O6GE 2JA2A 3W6JB 3F8CA 4IHSA 2V1XA 2VJ5A 2RDPA 2MGQA 4FETA 3COAC 4J19A 3WHBA 2MD0A 3J81Z 2PI0A 3CWRA 3S5RA 3SWHA 4V2GA 3V7SA 4IQJA 1K61A 1FMVA 4CH7A 3ON4A 3TOAA 2QZ8A 2ZMEB 2JSPA 2NOJB 1E3OC 4E7IA 5DCMA 1NHAA 4A3CJ 3BP8A 2PFBA 5TISC 1RI7A 3F0CA 5HLGA 4IX7A 4RBOA 3S3OA 4CCJA 1T95A 3JR9A 2KL4A 3HDDA 4N9IA 3GBGA 2GWRA 3GEZA 3F6VA 4UXNA 5K58A 3D5LA 1BBYA 1R1UA 1ZG1A 4ANJA 2MG4A 5DD8A 1SD6A 5M5WJ 1P4AA 2HKOA 5J1YA 4UUTA 4B4CA 3WGHA 5L3FA 1GT0C 3KFWX 1EJ9A 1R9TJ 3I71A 4BS9A 1WKMA 1OCOH 1LJ9A 3S93A 1S9HA 3M8EA 3WTXC 3L2VA 4EGZA 1R4MB 2LKPA 4M73A 4KN7X 1UFMA 3RIRA 2HOTA 2EINH 3E6DA 2IT0A 2LY2A 2WB1N 5E1WA 1IJWC 1LVKA 1TW3A 2G7HA 3WTUC 2P5VA 3B73A 2PJRA 4PZJA 4C30A 4DIQA 4F55A 2ZNZA 2VKEA 2HI3A 2DK8A 1IN8A 1S7AA 4BU2A 4ZYDA 2XSJC 2VBXA 2YS9A 2BBYA 2LY1A 3HRSA 3IRQA 4UNOA 4AU7A 5ICEA 1IXRC 4II3A 1UJ8A 4RGXA 2P4WA 3MNLA 3HGYA 4IJAA 1IN7A 4LIUA 4RB0A 1D8KA 3LSTA 2QCOA 1UCRA 5H9TA 1UHMA 1T39A 4E7JA 6PAXA 2P8TA 3EDPA 5ERIA 4BJ6C 3N97A 2A2FX 2BE5F 4G6TB 4G6QA 1MMNA 5F0FA 2F4IA 1XX5A 3CCSI 1YQAA 2A68F 1ZG3A 4YFKF 1DP3A 4ZYEA 2HU9A 1TT0A 3G1LA 2PJPA 4YFXF 1FOXA 2ZFWA 2DN0A 5DAJA 2K9QA 3BTJA 2ID6A 2VLAA 2ACJA 4JX6A 1K6YA 1I39A 1QVUA 3BWGA 3OS2A 3G4SI 2Y69H 4BDYA 1V5FA 1ZTRA 2FBKA 3OSGA 1F43A 2Q24A 2EIJH 3QBMA 3GZ6A 2EFOA 5JI6A 1E0EA 4XOTA 1VFCA 2M4KA 1U5TC 3M9AA 2QWTA 1FSHA 2VJIA 5GPAA 5K5QA 5DYMA 3TDZC 1EH7A 4LG3A 1OR7C 4ZDOA 1PUFB 5HNFA 2K02A 4F93B 2EPFA 2ZSHB 4M6YA 4MNUA 5GADJ 1NK3P 1N25A 3ZCOA 1IRGA 1UMQA 2K9MA 3K0LA 3QPTA 5BPDA 3LSKA 1A5JA 4HLXA 5KK1A 2JSCA 5HNHA 1U9OA 1TWFJ 4EV0A 5HLIA 4BDZA 4BY7J 1YS7A 1PUEE 3A4CA 2DA1A 5HDGA 4I0AA 3CO6C 3K2ZA 3KP2A 3LFKA 3RKWA 4AIJA 2R7ZJ 4X6AJ 4KMUX 2HKXA 5CKTA 5DV5A 3J7YJ 3FBNB 3CF2A 4PGGA 2ZCWA 4XKCA 3OYMA 1SMTA 3ZQGA 4AC0A 2EZLA 2R4GA 3LOCA 3OYGA 1S72I 4LMYA 1OFCX 2V79A 3OYKA 5FHPA 1EF4A 4AF5A 1S29A 1SFUA 5JHUA 4D5CA 2VQGA 2K4JA 1B8IB 5A2QZ 5HS8A 5GP9A 2IU5A 3WE2A 2PX9A 2KT0A 2WAEA 3COLA 2J5OA 5EDNA 1XG1A 2CFXA 3JSPA 5KAIC 4D9JA 1ZK8A 3F23A 2MH9A 4RAFA 2QQ8A 1ZREA 1WZ2A 3VYSB 1G8XA 1XSVA 2NVTJ 2ME0A 2C6YA 2EJRA 3A01A 1KYWA 5D5WB 1R1TA 5LGUA 4DZJA 1RNLA 5CLSA 3WTSC 2OV7A 3DPTA 3WG7H 5FRMA 5FMPA 2L4MA 3Q9SA 5J8FA 2W84A 4HQMA 1HF0A 1IRXA 3DP7A 1VQ8I 3S1QJ 3WHCA 4IZZA 2FBHA 4D5FA 1MSEC 4P9UA 5FKLA 3HSRA 2CQXA 4CHUA 4XM3A 2KRCA 4R79A 3FM5A 4Y4RA 2ZCNA 5FKMA 2WUIA 2XGEA 3RDIA 3HM5A 1B6AA 1V55H 2R5ZA 2PQ8A 1FP2A 3ECHA 1VQ4I 3W2WA 3GF2A 2FU4A 4E70A 4C3HJ 3OYEA 1DU6A 2ZSIB 1R5GA 4PJ0C 4IHYA 1VQ6I 4A69C 3QODA 4L9NA 5IOZA 2JA6J 2DFHA 4ZYGA 2FF4A 3FMQA 3HYIA 3P9TA 3WGIA 2VONA 2H6BA 3QWLA 1ZQ3P 2E35A 3KIOA 3CF5F 1UHWA 2VN2A 4V2FA 2J5PA 3OYNA 4LLNA 2IGKA 2NVQJ 5JVTA 1O7FA 4ESFA 2LF8A 1G3TA 2XVCA 1VQ9I 4BHPA 3KEQA 4BHCA 4MGRA 1IXSB 4M3DA 1T98A 1W5CC 1VQ7I 4CCNA 1GLNA 2H09A 4FHTA 2QKMB 2LFBA 5DUIA 2HXOA 3RKQA 1XDSA 3JRGA 3GLLA 3ZQIA 2Q2EB 2EV0A 3H5RA 3JRBA 1EKEA 4MEYF 4NDLA 3S2DJ 4HNUA 3VWBA 2PMHA 1V5EA 1Z67A 2K9LA 2Y2ZA 3T1BA 1J09A 5D18A 4G9YA 4HF1A 2K3PA 4PUSA 4E7HA 3G56A 2P0WA 2DFIA 2X9DA 3B6AA 4E7LA 4AYBA 2X1EA 2UXNA 3V8KA 5E8GA 1Z1DA 2JMWA 2K7LA 2CW0F 3I4MJ 2X6OA 3ZMVA 1UZCA 1HA8A 4BE0A 1ON2A 2KPMA 3OYDA 5BPIA 4Y17A 3CMMA 1FYLA 5B1BH 3IRRA 3H5AA 3S15J 2FE3A 3G1MA 4XLNF 3TKYA 4XLEA 1W7PD 1LE8A 3AQSA 3VIBA 3IH4A 2NNNA 1JKPC 3LA7A 3E5UA 1G4DA 4LFUA 2Z16A 3HRTA 4XOPA 2GXGA 1HBXG 5FKNA 3CDLA 3AG3H 4LLGF 2M1BA 4EVIA 2REKA 3GFMA 2HVQA 1EH8A 5GTIC 3E3VA 1ZR4A 2L9SA 1X2MA 1YHQI 3CO7C 1MBKA 1AWCA 2IVMA 2YU3A 2DBBA 3HTIA 1R22A 4HOBA 3CLQA 4EM0B 3K4CA 1GDTA 1FIPA 1X3WB 2P6TA 2E36A 3RKXA 1IN5A 2VT3A 1HW5A 4YRVA 2XDVA 3K4NA 1NTCA 2LTPA 4B3XA 5E1XA 3C3WA 3HHHA 2Y0SA 3IKVA 2BYVE 3ROUA 4ZJZA 4C2UA 2ZCXA 2DODA 1R71A 4XN0A 4IQ4A 2OPTA 4A3IJ 2IAIA 3KEOA 4KFCA 4NN1A 2IA1A 1XMKA 3LL7A 2QLZA 3MFKA 1APLC 2PFVA 4JX4A 2R5YB 1GV5A 2OCEA 5DS9A 3BJBA 2XAGA 2MA3A 2PG4A 4U0YA 3I58A 2K27A 4XORA 4U7BA 1IC8A 3GZIA 2DK5A 2LP0A 4F7ZA 3K70C 3DTKA 3CD6I 4DJAA 2DLLA 1WWXA 3L2QA 1OISA 2D6YA 4BEHA 1YFHA 3RQ4A 3E1SA 3OIPA 2QQBA 5LHGA 1X1DA 2L9NA 4XICA 2OERA 4W97A 5CVRA 3WTYC 1IF1A 2STWA 2WB1A 3JRHA 1Z7UA 2Y30A 2OQRA 5FB2A 2BY0A 2D5VA 1W0UA 3OYIA 3V7RA 4D7MA 5JLXA 1ENHA 4UB8C 3JRDA 4M6VA 1JTXA 1ETOA 3OIOA 1FPQA 1YOVB 4PGHA 3ERED 2EFNA 2L01A 4HQEA 1DU0A 1IUFA 2VKHA 3C2BA 4BUPA 1SD5A 2DI3A 4I98B 4N9HA 2F4OB 2D45A 4NBQA 1R1VA 1FYMA 3ECOA 4UV9A 2RKHA 3QYBA 3LAPA 1JI8A 1DQUA 1G6NA 4IPAA 2DMNA 2GAUA 1JKRC 1X1AA 2Z99A 1Y1VJ 2EB7A 2KJBA 4CUGA 3DLLF 4HDVA 2VB6A 3Q9VA 3UNGC 4WK8F 4C3JJ 2XC7A 2VBYA 1ETYA 1FX7A 2Q0OA 3GTOJ 3S2WA 3Q5FA 3GTKJ 3D0SA 1RRJA 1X19A 4E7SA 1HW1A 3V4GA 3W2VA 3CDIA 4KNYA 1FMWA 4I76A 4L5IA 4RGUA 5F0CA 1LFUP 5J4YA 4GCTA 2M5WA 1W7PB 2V4JC 3FHNA 4WIBA 2HZTA 4BY1J 2HDWA 1ERDA 1X2NA 5CXIA 3LWFA 2QKLB 3KP3A 5EG0B 2V1NA 4JYKA 4KT6A 4XL9A 3U2RA 1TNSA 4WXHA 1F9NA 4OAZA 5HBUA 2L0KA 3MKYB 4ZYAA 4Y15A 3L9FA 4C2TA 1MKMA 3S16J 2O7TA 1IV6A 5FO5A 3G71I 1R23A 4CGZA 5FROA 4JL3A 2KZVA 1T0FC 1H0MA 1I3AA 1A31A 3E5QA 3G7RA 3HKZN 4U7DA 2FSWA 1Q1HA 4AC6A 1Z3YA 1RR7A 1J0RA 2EWNA 2N8GA 2EZKA 3FXOA 4LGWA 2HQAA 2K3FA 2XAQA 1MJ9A 3P7NA 2G0EA 2F5EA 5D8KB 1VQ5I 2IGMA 2P81A 4LJZF 4RM2A 1ZGWA 1SVLA 1XD7A 2DA3A 4DW6A 4HX7A 1KQ8A 1AHDP 4XRSG 2FXAA 3IUOA 4QLCU 3ON2A 2W00A 1PJRA 4ENNA 2I8DA 1FSEA 1XSDA 5D4RA 3ISPA 3KP6A 1HCRA 3IWZA 4K2EA 2ZMEA 1YTYA 5GAEJ 3T5XA 3K69A 3DF8A 1WFXA 2E7WA 3LSMA 1OCTC 1U0JA 4O6JA 1HKQA 4IKFA 5M3MJ 3JTGA 1BC8C 3O2PE 5IY5H 2JUGA 3HSFA 2NNYA 2QWWA 1VQPI 2OTJI 3O60A 3LSJA 4G8XA 3ZQ7A 5J6XA 4PSWA 2K9NA 1QGPA 5IT9Z 5EEGA 2R7TA 1LUJB 1E3HA 5J1RA 5M5XJ 2QM3A 1K78B 3BCGA 3IAS2 2VQCA 4YELA 4B09A 2P7CB 4CCMA 2DFFA 1F36A 3S3NA 2JK3A 2WC2A 1QZZA 5GTHC 3FX3A 1X1BA 3M1EA 1WRJA 4MFDA 3HIFA 3C07A 2XUBA 1ONVA 3P9KA 3L00A 1QPMA 1TP4A 1HSTA 2RC4A 2R7XA 1Z05A 4A3BJ 3JAMZ 2FOWA 4MFEA 3I0TA 3J7ZI 3PQJA 1FOWA 2A61A 3A1YA 1H9GA 1KQ9A 3G73A 1XCBA 1F5TA 3JCUC 5HDKA 2AXLA 1K4TA 3VOXA 2VASA 1V5GA 1MH4A 3HOWJ 3TP3A 4WXCA 1TNTA 2L7FP 4QIWN 2DFEA 1L3LA 3DBRB 1XCVA 1S6LA 1JJ6C 2WAFA 3ABUA 3G6EI 3DU6A 1STZA 2ZNYA 4OIQF 3GTMJ 3TW6A 2M9HA 2IBDA 4JP0A 1ULYA 4WXDA 3WTWC 1GXPA 2Z2SB 1TL8A 2QUFA 4GYGA 4NNJA 2LBFB 2OAZA 3FM3A 1LKXA 3LQQA 2NOGA 1WHUA 5IT3A 1E2XA 3H1CA 2VC0A 4FISA 1BR2A 2RHAA 1YI2I 1XN7A 4PJMA 3T8RA 1TWHJ 3SYTA 3BROA 1T8IA 5IP6A 3GUDA 3A2KA 3ZP5A 2GBYA 3KCCA 2VI6A 5C44J 2CUZA 2XPWA 4KT5C 4KICA 1HXDA 2M0CA 1I5ZA 2MSYA 2CFOA 3ZR8X 1WH7A 2MH2A 5LGTA 2VJ4A 3CLOA 3OL3A 3O8GA 4BH9A 2LK2A 3FK6A 4P1WA 2HDDA 4C2MA 3EYIA 1JGGA 3NAUA 3AKZA 3WGGA 2QOPA 3DXJF 2DO7A 4Y52J 2PMZN 1OQYA 3L7WA 5BNGA 4AWXB 5E8IA 4XRMA 1MD0A 5EYRA 1ZHFA 4XBFA 3QRFF 2CUEA 4S04A 3M1CA 2AQFA 1RKWA 2VQHA 2VXDA 3HOXJ 4B1RA 4HEA2 1G3YA 2CV0A 3AL0C 1PUFA 2RN7A 2LH9A 3BJ6A 3J80Z 3CMEI 2A5WA 1TWAJ 2IXSA 2JUCA 3OR1C 5J47A 1TTYA 1WJ5A 5EF6A 3Q3SA 3SDBA 2B1EA 2NS8A 4OD5A 1G59A 2DG8A 4CSWA 1DPUA 2E7XA 2H94A 3ZQHA 5HODA 2R93J 2BOLA 2HVSA 2VQLA 2HFHA 3SZPA 1T6SA 2P5KA 5FLXZ 4ASNA 3GTPJ 2GOMA 4OWRB 2KIQA 2XRNA 4X0GA 4Z6YA 3CCUI 4HKUA 1ZRCA 2IA2A 1USTA 5LRSA 2RQQA 3BR5A 5AIQA 4XKWA 1BR4A 2DCEA 4UHTA 1G3WA 4G94A 4XR6A 4BNCA 2XKOA 4Q47A 3MZ8A 3CCRI 3FZVA 3E7LA 4G7OF 4P9FA 4HNVA 3GMEA 1Z6RA 1B8IA 3CCMI 1W36C 4BQOA 2B0LA 3IH3A 5AONA 3DCFA 4PFPA 3MD2A 2X48A 3ESWB 2UXPA 1USSA 2NAZA 4A3GJ 1JT0A 4HNTA 4DBRA 1V4RA 4Q5SF 1QO0D 1FLIA 4GRIA 2MABA 2H6CA 4IF4A 3NQOA 5ICGA 2BY3A 3IKTA 4UUSB 1HKTA 4XLFA 2E34A 5E18F 2KIUA 5LGNA 3BQYA 2Y9ZA 3CUQC 5D6EA 2QSHX 2FX0A 2R7UA 2E5NA 3QOEA 3K1PA 3VB2A 1SFEA 4YEJA 4U88A 1MBGA 1R5HA 3H3ZA 4RGRA 3G3ZA 4I01A 2Q8KA 2VODA 2L02A 3BTIA 3ZPLA 1E17A 2A5YB 1GUUA 1MIJA 5EGOB 2FMYA 3RKYA 2O9LA 1W5TA 3FKJA 1FIAA 3ZMDA 2PBXA 3QAHA 4ESBA 2V6CA 4XIDA 1Y6IA 5FKOA 2QEXI 1GHCA 3CC2I 1XTAA 3QP5A 1R00A 4GGGA 2JZYA 3AAFA 2KMUA 1YW9A 3FXQA 4J01A 3EUAA 3NPIA 2V1DA 4A6EA 2VBZA 2X85A 1WI9A 3A03A 1PYVA 1FY7A 3REOA 1UAAA 3ZQQA 1OLTA 2LRDA 2E5ZA 2ETHA 2ZXHA 4JQFA 4QSHA 2DOEA 4YFNF 3KE2A 1IDYA 1K83J 4O5VA 4KYWA 3QU3A 2CQQA 2BY2A 1NH3A 2CWEA 5J40A 4N4NB 2KKOA 1X3ZB 4IRVA 5L3BA 4TV7A 4H0EA 2WTEA 2BXZA 2Q2EA 3EPZA 3BCBA 1OCPA 2UXIA 3ZXSA 1P9QC 2XSDC 4NHJA 5F1RA 4V19K 4DYQA 5D19A 2A69F 3CP2A 3LA3A 4IHTA 2WGBA 3DPJA 1ZGAA 4L9JA 5B66C 3I56I 2XF7A 4EJOA 1BL0A 3L2RA 5L3DA 5ICCA 3HOTA 5E20A 4XSXF 1H88C 1MNMC 1IN6A 4NC6A 3HTAA 3H35A 2EV5A 4A0YA 1X58A 5E3NA 3VVZA 2VPRA 3W6KB 4LB6B 2IGOA 5JLWA 1TQIA 2EA2A 4HYEA 4BAYA 2R3SA 3RCOA 4EJWA 2CYYA 3CCQI 2RGVA 1P7JA 1YW8A 2R7OA 3K10A 3HC7A 1VTNC 5LEJA 2QSGX 2G7GA 1O3RA 1ZLKA 1ETVA 1K6OA 3HOSA 3PO3J 1B9MA 1OYIA 1YJ9I 1XGOA 2Z33A 3GLXA 1AA7A 4Q4ZF 1W36D 3OR2C 2XHKA 1Y0UA 1ZN2A 3VW2A 2OU2A 2ZCMA 2F5FA 2FMLA 2VL8A 4JK1X 4A3MJ 2XAUA 3PNTA 2JJ7A 4GFKA 3G1OA 1D1BA 5FFZA 3LAJA 2FNAA 1ETWA 4OMZA 2JVGA 1WCMJ 2L54A 3FHZA 1MNDA 2Z9OA 2RAEA 1QQIA 2KRFA 3QYFA 4KWAA 2XPVA 3DTIA 1HOMA 4IVNA 5AQCA 3DTEA 1LDKB 3BRUA 2OD5A 2ZOZA 2NP5A 1E3PA 4NC8A 2KP6A 3FXRA 1X4PA 3OYBA 3TOBA 3C18A 5HOOA 4YZEA 3DPLC 4BJ5C 5LLQA 2VBWA 3ZRGA 2BXYA 2DXIA 3I4PA 3MAJA 2R5YA 2XGDA 2IRFG 1LDJA 1Z77A 2AO9A 2RNJA 1REPC 3R0JA 1MBFA 3TDUC 2WY8Q 4KDPA 2DPUA 3WTZA 2KZGA 4XKVA 4LB5A 3ZQFA 3BG6A 3LNQA 4BL0B 2RVCA 2F48A 5CXGA 2A6EF 2CV2A 1WSUA 3ZMSA 3WG9A 1FP1D 2KDOA 2VKDA 3DLAA 3H0GJ 4KIBA 4M3FA 3HPHA 3MMYB 4EJVA 5JVGF 2QQ9A 4ZTJA 1FJLA 3W2AA 4AM3A 2RNGA 1IW7F 2PEXA 5CPRB 4IOAF 3H92A 2CRGA 3OYLA 2DT7B 5EZGA 3PO2J 2HOSA 2IW5A 1VI0A 4N0BA 2CMPA 1MMSA 4OAYA 2HPMA 3KPHA 2DMTA 1KU7A 4XONA 4DNCA 3S17J 5EJCA 2F4MB 2V57A 2KRHA 3TBIA 1UG2A 4GCLA 4M9XA 4CZZA 2NVXJ 3C1DA 1O57A 4F91B 2AQEA 1VZ0A 1OR7A 1P92A 2L7ZA 4UY8I 3TGNA 2M30A 3D5RC 3MVPA 3DFGA 3T0YA 4M3BA 4I99C 2V9KA 3IH2A 2HQRA 1NK2P 3CDHA 4QTRA 5K7ZA 4RDUA 4LK0F 2VE9A 1L0OC 5HDNA 5DUKA 1DPRA 4Z2YA 3GVAA 3TEDA 4WCGA 3SFIA 3U1KA 3IP4B 2LY9A 1WH5A 4EGYA 1Y0NA 3GXOA 2OTLI 1BOAA 1J7KA 1FC3A 3KP7A 1I1GA 3M7GA 1ACIA 1W7PA 1IAWA 2HTSA 3RPUA 3I54A 3HOZJ 1J2XA 3VOKA 1JHFA 2M7AA 2PMZA 1RZ4A 3CCEI 1MDMB 4ABZA 4DBQA 5EG0A 5LD2C 2GXBA 2FA5A 3TO7A 3WU0A 4YG2F 3HHGA 5HLHA 1RKTA 3A0BC 2IP2A 3UKGA 1AKHB 2ZB9A 3QOPA 4LITA 2MLKA 3OYAA 3M8JA 1ZLJA 5KVRA 3CMYA 1Z9CA 1LQ1A 2OI8A 3PSIA 2XIGA 1DDNA 4A2UA 1WJFA 1BI1A 1OYYA 3FXLA 1VQNI 5BOXA 3BR2A 3RZOJ 3BPVA 3BR3A 2LVSA 1XPXA 2BV6A 1IXCA 2D1VA 2M87A 4KJZA 3QP6A 4G12A 3IV5A 5JR3A 2FD5A 4PCQA 4KA4A 1XGSA 3MWMA 2VOOA 3OL4A 1SFKA 2F2EA 3CUQB 1HLVA 4II2A 4DYCA 2JA7J 1A6QA 1Y1WJ 3F22A 3BR0A 2BZTA 4I7HA 4XK4A 1ZRFA 5IYCJ 3KX2A 3CC7I 2X1CA 1S8NA 2KIMA 3WODF 5FD6A 1U9NA 2HKUA 4QPQA 1KU3A 2BVMA 4JOMA 1UI6A 3F8MA 1S5LC 1I6HJ 3ABMH 3N4MA 2W82A 4IHVA 4E7ZA 3OS0A 1J75A 4IRHA 4BHBA 5F1JA 2L5QA 3R0AA 2E2HJ 1IRFA 1Z6TA 3KZIC 1DP7P 3EYYA 2D1HA 3QQAA 1ETKA 2QA4I 5C4XJ 3RTRA 2CW8A 2KIFA 3LSPA 3H9QA 2ZMEC 2UXUA 1EH6A 3S14J 2E1OA 2V7FA 4C3IJ 3FK7A 1K78A 4GCKA 1X1PA 1HDDC 4CCKA 2PN6A 1TQPA 2K5CA 3GTQJ 3RYRA 1IN4A 1LB2A 1OMIA 3DKYA 2DQLA 2FBQA 1U5TB 2Z1DA 2BHYA 2Y48A 2MBFA 2W53A 3VEPA 1KU2A 5KNLA 3JRFA 3E97A 2V9PA 3CJRB 3HIMA 3J81K 4XMYA 3C7JA 3BQZA 4OD4A 3E6MA 2WY7Q 3DEUA 4RGSA 2XAFA 3VYUB 2ZXIA 1CF7B 2ELKA 2P7VB 5LEKA 4JKZA 2X51A 1QHGA 1V3FA 3J7AO 4FX4A 3WE3A 4Y3OA 1Y39A 3TMOA 1RESA 2Y75A 5L3CA 2ZO4A 4YIFA 3ELKA 4AD9A 3ANGA 1YX3A 3C2GA 4AVZA 4FCYA 2EBIA 3FXKA 5FKKA 1MJAA 4PDKA 3MEXA 2HQ5A 2LBFA 2ZC2A 2CG4A 2LNBA 1SGMA 2XRLA 4CICA 1S3JA 3CCJI 3OV8A 4I02A 5E3MA 2DJIA 3O8HA 1EA3A 2DA7A 4PSXA 5J1UA 4A6DA 1DGWY 4LK1F 2R7VA 1Y56A 3K4KA 5KHDA 4ZZDA 3BNIA 2L3DA 4HAMA 4E6KG 3T8TA 3PQKA 3H36A 3K1NA 3DU5A 3TO6A 1O4XA 5EEHA 2JRTA 2G9WA 3OMYA 4MK6A 5C3EJ 2LR8A 2ELJA 2IJLA 2GUHA 1FT9A 3H5NA 5EZHA 2Y31A 1KGSA 3P5JA 5F27A 1FTZA 1Z21A 1Y8RB 3M3YJ 3BZKA 3LSRA 4J00A 3HXLA 1MZBA 2ZJQF 2R7FA 3GWZA 4EJUA 1FNNA 2AS5F 3L2WA 4RAZA 3MKZA 5H6QA 2UXHA 1N75A 2L4AA 2OUMA 1TT5B 4F52A 3CMAI 2OZ6A 3LHQA 2YX7A 3SZGA 3K70D 4A3KJ 1BI3A 4JX5A 4U0VA 2NX4A 1W1WE 3D1NI 1ZGJA 4BJTA 2DAOA 3RJPA 2X6YA 4AVPA 1R49A 4X1EA 4RAYA 4Y13A 3LSGA 2I5UA 4RA2A 5ILUA 2IS1A 3RI4A 2ISZA 1F1ZA 1SFOJ 1JE8A 3FISA 2DW4A 4CYCB 2IS4A 3TO9A 1AOYA 5D5UB 1IZ1A 1YLFA 4ENKA 5F64A 2GENA 2H1KA 3LWJA 4HBLA 2EFPA 1FYKA 2HDCA 4G7ZF 1BR1A 2XKPA 4Q48A 3JTHA 4UV8A 1YRNB 2A07F 1BIAA 3HUGB 2E1MC 3OYCA 3VODA 2ZXJA 2EZHA 3S1RJ 1QA6A 5HSZA 1BOBA 2EILH 2M8GX 3FMRA 4ON0A 1FBUA 3RQIA 1MW7A 4AUXA 4ENMA 3ABTA 4ME9A 1YJNI 4B47A 3QKXA 1BN5A 3LQRA 1QU3A 3GZNB 5DM6F 2DTZA 4BE1A 3BT9A 1DUXC 4JNNA 1ETXA 1IRZA 1ODDA 1X3UA 1N78A 1IG7A 4DVYP 2Z5UA 3PASA 1RPWA 5B3SH 2LOOA 2W7NA 5CYVA 5J8CA 4U0WA 4LG0B 3FDYA 4UUSA 5H20A 3AG1H 3HE0A 2W85A 2FOKA 3KP4A 4ESJA 2VIXA 5GAHJ 5GPCA 2JRMA 4FE4A 1OCZH 1C0WA 1IO2A 4EEFG 3P9IA 2AXTC 3PUFA 1MMAA 3HRUA 4E4HA 5KAFC 3NWSA 3OOUA 3OY9A 1QZEA 1JJ8C 5K7HA 1NG6A 4L9TA 3ZN0A 3SEZA 2TRTA 5D8LB 1OPCA 2KJCA 2BW3B 3AFHA 3GCMA 3R61A 2V9VA 3V8JA 3VSKA 1CQTA 3I59B 2NP3A 2LKXA 1K79A 1SVOA 2QVOA 1KQ0A 5EGOA 2ID3A 2CJJA 5K1YA 1D0XA 5LBQA 2OC6A 4UB6C 1B72B 1VQOI 4FQGA 1PVEA 5HS7A 5FGMA 2HVRA 3I53A 2K4BA 3KYLA 1FOKA 4KISA 4QWQA 3E6BA 4M3GA 3GFJA 4MTEA 1QPIA 3IUVA 4D0PA 4EMSA 1WJDA 3HTUA 3SZTA 2W57A 2V1UA 2O61A 2E19A 3Q0VA 1R6RA 2QKOA 2DA4A 1I27A 4IOCF 2E1CA 3EGQA 2PZ9A 1ZAOA 2MD5A 2X4HA 1GVDA 1WJBA 4ZDPA 1CGPA 2O7OA 1T2KA 4HRIA 2WWYA 3A02A 1JUPA 3JSJA 1V54H 1T38A 4KIGA 5D5XB 2XB0X 5IYBJ 3KYCB 3VUQA 3HTJA 1N77A 1O3SA 2CSOA 2PBIA 2NVUB 2DG7A 1D0YA 3GFLA 4JBAA 4HF0A 3L1PA 1BW6A 3PIOF 2V6EA 3V8LA 1SEUA 2JPCA 2M7BA 4PFOA 5IP9J 3QPLA 1TQMA 2HEOA 3ABKH 3S32A 2ISYA 4IHWA 2RREA 3S3MA 4MEXF 2CO5A 4D7NA 3V6GA 1WQ2A 4HLYA 2VJJA 1BA5A 1I50J 2ZJRF 1FBQA 1SFXA 2KQRA 4L5EA 4OINF 4D1QA 4B43A 3OSFA 1B4AA 2M3AA 2B7EA 1MJBA 2UV1A 3Q0WA 3CJQB 2Y0SN 4M71A 3MKLA 2P5LC 4ZH4F 1MSFC 3K8PC 2MC4A 2MYSA 1SAXA 4A93J 3NNRA 5GAGJ 1JKQC 1YYVA 2I10A 5M3FJ 1GVJA 1P2FA 3I55I 1UB9A 2DTRA 4IRIA 4GXOA 3BG3A 5IP7J 1M1EB 2O5RA 3TQNA 1KZHA 2VKVA 4R1HA 2VOPA 2PLYA 3G2BA 5EEAA 1S7EA 1FEXA 4A12A 2COBA 5CW8A 4ACIA 4OOIA 3VSLA 1ZKGA 4IHXA 4XSZF 2EK5A 3BG5A 1U8BA 2STTA 3ML6A 1I6XA 3M07A 5LFAA 3B6CA 5CVJA 5CQEA 2XGXA 2TCTA 1LFPA 2ECBA 5DTDA 5CVIA 5FLVA 1T08B 3HOVJ 5B5EC 1RUOA 3BC8A 2M4GA 3MN2A 1XMXA 3WU1B 1K7AA 2HTJA 3TL4X 2JTVA 2LREA 3HRMA 3H3UA 3EUHA 3P9CA 1LEAA 2K40A 3FXUA 2WV1A 1KU9A 1IGNA 4GFBA 1OJLA 1SVMA 2CUJA 2VPLA 1WVRA 4BYYA 2BY1A 2HYTA 2DA6A 4XQFA 3F3XA 1WPKA 5IOYA 3RZDJ 4BE2A 1U2WA 3M8FA 4M6XA 2PMUA 1A36A 5CQGA 4NQWB 1ZARA 4C2MJ 4MLOA 2L7MP 3JRCA 2KDZA 1ZELA 1FBSA 2H8WA 2HR3A 3PL8A 4OIOF 1R7JA 3QYEA 4A3LJ 3SHFA 3JRIA 5DD4A 3CP8A 5TJJA 1R5ID 1D1AA 3KZZA 3NS4A 2X6WA 1TLHB 2GA1A 3K2AA 4N4OB 3SEQA 1BI0A 3WTVC 3E6CC 3F21A 4BACA 5AIPA 3QPSA 5C4YA 4U9LA 3BTLA 1JKOC 2R7DA 2ADUA 3RPQA 4HSTA 1MBHA 2B9SA 3F9KA 3AG2H 4A3EJ 3FIWA 3I5UA 1IV8A 2UWMA 3K4LA 3BPXA 3KKCA 5CJ9A 2M8EA 1VQLI 1FOYA 5J3LA 4P96A 3S1MJ 4L9VA 2OZUA 3ANPA 4LD5A 1WJEA 3DKXA 4MQVA 3KZ9A 2QBYB 3RD3A 2TDXA 1WGXA 1T56A 1LDDA 1PP8F 1Z91A 2WBMA 1SAUA 1OYWA 4L18B 3ERMA 4IRGA 4HG2A 2H27A 4RLQA 3V42A 3EETA 1P4XA 4G7HF 1P6RA 3LSHA 2NS7A 3VVYA 2W48A 3VW1A 3BR6A 1YIJI 1J59A 4GDFA 2BEOA 3ABLH 4XKBA 1Z7LA 1YIOA 2XAJA 3CUOA 2HOAA 4KITB 1WJCA 5CVVA 1GXQA 4P5OA 3X2QH 2GFNA 2DDAA 3K1MA 2O8KA 4F3QA 2KHMA 3LFUA 4F92B 1LVAA 2E60A 3V78A 4EJTA 4FT8A 2FBIA 3HKZA 4P55A 2ICWG 1MDMA 3LA2A 2HS5A 2D2WA 3OOPA
chains in the Genus database with same CATH topology
2Y9YA 4W1UA 3WHBA 3CMYA 3S5RA 3CWRA 1XC5A 4V2GA 5IYDJ 2OI8A 1K61A 2DA5A 1T33A 2G0EA 2E2IJ 1AKHA 3ON4A 2P81A 3BR2A 1ZGWA 3RZOJ 4FTHA 3BR3A 2DA3A 2LVSA 4DW6A 5EFYA 1AHDP 2E2JJ 4XRSG 1E3OC 4G12A 3IV5A 3GTGJ 1TWCJ 2YUSA 4A3CJ 2FD5A 3F0CA 3ON2A 3F1BA 4RBOA 3HOUJ 3E7QA 1HCRA 1HLVA 4DYCA 2JA7J 1Y1WJ 3BR0A 4XK4A 3JR9A 5IYCJ 3HDDA 1OCTC 3GBGA 2EZIA 1H8AC 5K58A 5M3MJ 1U9NA 2HKUA 2MG4A 3O60A 5M5WJ 3LSJA 5E3OA 5J1YA 1UI6A 3GTLJ 4UUTA 4B4CA 4BXXJ 1I6HJ 1GT0C 2K9NA 1R9TJ 3JRAA 4IHVA 5F0HA 5J1RA 5F1JA 5M5XJ 1XS9A 2E2HJ 2R0QC 4NELA 3BCGA 3FKIJ 3QQAA 2HOTA 1ETKA 1F36A 2JK3A 2WB1N 5C4XJ 1IJWC 3LSPA 2UXUA 3HB9A 2XB5A 4MFDA 3S14J 3B81A 2E1OA 3C07A 2VKEA 4C3IJ 2HI3A 3FK7A 3HEFA 4LOCA 4GCKA 1HDDC 3NXCA 2YS9A 1WI3A 3TP0A 4A3BJ 4MFEA 3GTQJ 2WAQN 1MH3A 4A3FJ 2K9SA 2H8RA 4DZPA 2FBQA 1BJZA 4I6ZA 3MNLA 3S2HJ 3HGYA 2W53A 3VOXA 3JRFA 2QCOA 3HIMA 1MH4A 5H9TA 2ECCA 3HOWJ 3BQZA 3TP3A 3NI7A 2L7FP 4QIWN 2LD5A 2ELKA 4JKZA 4BKXA 1JJ6C 2LLKA 2QF7A 5F0FA 3GTMJ 3TW6A 2M9HA 4JP0A 2IBDA 2ZOYA 1JT6A 1RESA 1JUMA 3G1LA 2DMPA 2CUFA 2NOGA 3ANGA 2XGCA 4FISA 2DN0A 3SJMA 5DAJA 2K9QA 3BTJA 2ID6A 2RHAA 4FCYA 4JX6A 1TC3C 1SANA 2EBIA 1TWHJ 1QVUA 3PM1A 5FKKA 5IP6A 3EUPA 1ZTRA 1F43A 2HQ5A 2GBYA 3OSGA 2Q24A 2VI6A 5C44J 3QBMA 2XPWA 1W0TA 4A3JJ 1SGMA 2XRLA 1VFCA 2M0CA 4MXMA 2MSYA 1WH7A 5E3MA 3O8HA 2HDDA 2QWTA 5J1UA 2DA7A 3O8GA 2LK2A 3FK6A 5GPAA 2EQRA 1HDPA 1JGGA 3NAUA 2QOPA 3KNWA 4Y52J 3BNIA 2PMZN 1PUFB 5BNGA 1NK3P 4XRMA 5EYRA 1UMQA 2CUEA 1A5JA 1O4XA 1RKWA 3HOXJ 4MIMA 4MK6A 1Z0XA 5IPAA 2LR8A 5C3EJ 1U9OA 1TWFJ 4B1RA 2GUHA 4BY7J 1PUFA 3HOYJ 5EZHA 1TWAJ 5K7FA 2Y31A 2DA1A 2QTQA 3RH2A 5F27A 1FTZA 2QIBA 3M3YJ 5EF6A 3Q3SA 4Y7NJ 1MBJA 3LSRA 2R7ZJ 4X6AJ 2NS8A 2DG8A 2G3BA 5HODA 1H89C 3ZQHA 5F08A 4UDSA 2R93J 3ZQGA 4AC0A 2UXHA 2M34A 2EZLA 3LOCA 3S1NJ 3LHQA 4A3KJ 3GTPJ 1OFCX 5FHPA 4AF5A 4HKUA 1EF4A 4JX5A 3CCYA 4D5CA 3A01B 1B8IB 2NX4A 3D1NI 5GP9A 2IU5A 3BR5A 3K7AJ 2KT0A 4X1EA 3COLA 1JUSA 1XG1A 5EDNA 1ZK8A 3LSGA 2F07A 1D5YA 3E7LA 3ZQLA 1SFOJ 4HNVA 2NVTJ 2ME0A 2FJ1A 3FISA 4CYCB 3A01A 1B8IA 3BTCA 4M3EA 2JA5J 2GENA 3IH3A 3LWJA 4DZJA 2H1KA 3DCFA 5FMPA 1GV2A 3M4OJ 2X48A 2UXPA 1YRNB 1JTYA 1HF0A 4A3GJ 1A6IA 2R5ZB 3S1QJ 3WHCA 1JT0A 4D5FA 1MSEC 2EZHA 4CYCA 3SDGA 5FKLA 2JA8J 3S1RJ 5HSZA 2CQXA 2M8GX 1UI5A 3RQIA 4AUXA 4ME9A 2UXOA 5FKMA 2WUIA 2XGEA 1YRNA 4UUSB 2ZCNA 3HM5A 1LFBA 3QKXA 2DTZA 4JNNA 3BT9A 2R5ZA 1ETXA 1IRZA 5M5YJ 1IG7A 3PASA 1VF9A 3BQYA 1RPWA 2Y9ZA 2G7LA 2FX0A 4C3HJ 1DU6A 5C4JJ 4IHYA 4A69C 5IOZA 4UUSA 2JA6J 3HE0A 3P9TA 1ZQ3P 1MBGA 3I4NJ 5GPCA 4FE4A 2XPUA 3BTIA 3VPRA 4EEFG 4V2FA 1GUUA 1QVTA 1JJ8C 5EGOB 3OOUA 2NVQJ 2FQ4A 3VW0A 2O9LA 5K7HA 1FIAA 2PBXA 5E3LA 3CJDA 2TRTA 4XIDA 5FKOA 2QKOA 2YU9J 4DYRA 1CQTA 3BR1A 2NP3A 2LKXA 4M3DA 1MBEA 3NPIA 5EGOA 2ID3A 1TWGJ 2CJJA 5HAWA 2LFBA 3A03A 2HXOA 2DMUA 3RKQA 3JRGA 3ZQIA 1B72B 3JRBA 4NDLA 4QSHA 3S2DJ 4CGRA 1IDYA 1K83J 2Y2ZA 2GM4A 4M3GA 2CQQA 2YVHA 1QPIA 3IUVA 1IDZA 5D18A 3G56A 1B72A 2X9DA 1AU7A 3B6AA 2IEKA 3CRJA 2E19A 3Q0VA 1LE8B 1OCPA 2UXIA 2XSDC 2DA4A 2JWTA 2JMWA 1ZR2A 3I4MJ 4DYQA 2X6OA 1G2HA 2PZ9A 3EGQA 5D19A 3CQZJ 2WGBA 3DPJA 1GVDA 1P7IA 5D1RA 1BL0A 3S15J 2O7OA 3G1MA 1LE8A 3VIBA 1H88C 3AQSA 3IH4A 1POGA 1MNMC 1JKPC 3A02A 1JUPA 3HTAA 3JSJA 2XB0X 5IYBJ 3VUQA 3HTJA 1X58A 5E3NA 3VVZA 5FKNA 2VPRA 3CDLA 2DJNA 5JLWA 1UHSA 2REKA 2DG7A 3NRGA 1ZR4A 1X2MA 1BW6A 3L1PA 1MBKA 1P7JA 3NARA 3GTJJ 1I3QJ 5IP9J 3QPLA 2DMQA 4IHWA 2G7GA 9ANTA 3HTIA 2HXIA 1ETVA 3PO3J 1GDTA 1FIPA 2NVYJ 4D7NA 3V6GA 4BBSJ 1BA5A 1I50J 4L5EA 1NTCA 3OSFA 3VW2A 3HTHA 2ME6A 2LTPA 2ZCMA 4A3MJ 3Q0WA 5F04A 2JJ7A 2Y0SN 4GFKA 3MKLA 1MSFC 3G1OA 3H3VK 2ZCXA 5FLMJ 2B63J 1RETA 4A93J 3NNRA 1ETWA 2HYJA 1JKQC 2I10A 2OPTA 5M3FJ 2IAIA 4A3IJ 4NN1A 1WCMJ 2RAEA 1APLC 4JX4A 4XRSA 2R5YB 4KWAA 2XPVA 1HOMA 1GV5A 5AQCA 3BG3A 5DS9A 3BRUA 5IP7J 2ZOZA 2NP5A 2M2EA 3BJBA 3HBLA 2VKVA 4MO7A 3LJLA 5EEAA 2R92J 1IC8A 1S7EA 1FEXA 3GZIA 4YZEA 2COBA 2LP0A 5CW8A 4ACIA 4PXIA 2AHQA 2L9RA 1ZKGA 4IHXA 3BG5A 1U8BA 3KKDA 2R5YA 2XGDA 2D6YA 3PPBA 1Z77A 3B6CA 2AO9A 4FE7A 1MBFA 2TCTA 2YVEA 2ECBA 5DTDA 5FLVA 3T6NA 3HOVJ 3ZQFA 3LNQA 3ZQCA 3MN2A 4XICA 2OERA 4W97A 5CXGA 3JRHA 4GFLA 2Y30A 2K40A 4M3FA 3H0GJ 2WV1A 1IGNA 2D5VA 4GFBA 2EZKA 1OJLA 1W0UA 1FJLA 4A3DJ 1ITYA 4D7MA 3FRQA 2OF7A 2DA2A 1Q1VA 5FJ8J 2EH3A 1U78A 5JLXA 1ENHA 3JRDA 4M6VA 2HYTA 2DA6A 2VUMJ 1ETQA 1JTXA 1ETOA 3OIOA 1WPKA 2CRGA 3TW7A 5IOYA 3RZDJ 5EZGA 3PO2J 2HOSA 3BG9A 1VI0A 4C2MJ 4MLOA 2L7MP 3JRCA 2KDZA 1DU0A 1IUFA 3C2BA 4A3LJ 3BHQA 3JRIA 2DMTA 3S17J 2V57A 3AQTA 4B3AA 3ZOBA 1UG2A 4ICHA 3K2AA 4GCLA 3GEUA 2DMNA 4S0HB 1JKRC 2NVXJ 1Y1VJ 3QPSA 5C4YA 1BW5A 3BTLA 1JKOC 4C3JJ 1QRYA 2GLOA 1ETYA 2CU7A 2L7ZA 3GTOJ 3GTKJ 3DEWA 1MBHA 3JREA 2G7SA 3MVPA 4A3EJ 3FIWA 4M3BA 4J19A 4AYBN 2MW8A 3IH2A 1NK2P 4QTRA 5F0CA 4I76A 5K7ZA 4RDUA 1LFUP 3KKCA 3VVXA 5J3LA 4GCTA 3S1MJ 3TEDA 2RASA 4BY1J 2XDNA 3SFIA 2LY9A 1X2NA 3ANPA 5CXIA 1WH5A 3KZ9A 3RD3A 4BBRJ 3W6VA 3HGGA 1WGXA 1T56A 5EG0B 4JYKA 4L62A 4IEJA 3Q0UA 2NS7A 5HBUA 3VVYA 2W48A 3HOZJ 3VOKA 3VW1A 3BR6A 2L0KA 3VP5A 4ABZA 2HOAA 5EG0A 1ORKA 2JN6A 3S16J 2O7TA 1IV6A 1VNDA 1RKTA 5FGLA 3UKGA 2GFNA 2O8KA 4JL3A 1AKHB 3V78A 2ZB9A 1FTTA 3G7RA 3HKZN 4AC6A 1RR7A 2MGQA 2N8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9Y A;  4W1U A;  3WHB A;  3CMY A;  3S5R A;  3CWR A;  1XC5 A;  4V2G A;  5IYD J;  2OI8 A;  1K61 A;  2DA5 A;  1T33 A;  2G0E A;  2E2I J;  1AKH A;  3ON4 A;  2P81 A;  3BR2 A;  1ZGW A;  3RZO J;  4FTH A;  3BR3 A;  2DA3 A;  2LVS A;  4DW6 A;  5EFY A;  1AHD P;  2E2J J;  4XRS G;  1E3O C;  4G12 A;  3IV5 A;  3GTG J;  1TWC J;  2YUS A;  4A3C J;  2FD5 A;  3F0C A;  3ON2 A;  3F1B A;  4RBO A;  3HOU J;  3E7Q A;  1HCR A;  1HLV A;  4DYC A;  2JA7 J;  1Y1W J;  3BR0 A;  4XK4 A;  3JR9 A;  5IYC J;  3HDD A;  1OCT C;  3GBG A;  2EZI A;  1H8A C;  5K58 A;  5M3M J;  1U9N A;  2HKU A;  2MG4 A;  3O60 A;  5M5W J;  3LSJ A;  5E3O A;  5J1Y A;  1UI6 A;  3GTL J;  4UUT A;  4B4C A;  4BXX J;  1I6H J;  1GT0 C;  2K9N A;  1R9T J;  3JRA A;  4IHV A;  5F0H A;  5J1R A;  5F1J A;  5M5X J;  1XS9 A;  2E2H J;  2R0Q C;  4NEL A;  3BCG A;  3FKI J;  3QQA A;  2HOT A;  1ETK A;  1F36 A;  2JK3 A;  2WB1 N;  5C4X J;  1IJW C;  3LSP A;  2UXU A;  3HB9 A;  2XB5 A;  4MFD A;  3S14 J;  3B81 A;  2E1O A;  3C07 A;  2VKE A;  4C3I J;  2HI3 A;  3FK7 A;  3HEF A;  4LOC A;  4GCK A;  1HDD C;  3NXC A;  2YS9 A;  1WI3 A;  3TP0 A;  4A3B J;  4MFE A;  3GTQ J;  2WAQ N;  1MH3 A;  4A3F J;  2K9S A;  2H8R A;  4DZP A;  2FBQ A;  1BJZ A;  4I6Z A;  3MNL A;  3S2H J;  3HGY A;  2W53 A;  3VOX A;  3JRF A;  2QCO A;  3HIM A;  1MH4 A;  5H9T A;  2ECC A;  3HOW J;  3BQZ A;  3TP3 A;  3NI7 A;  2L7F P;  4QIW N;  2LD5 A;  2ELK A;  4JKZ A;  4BKX A;  1JJ6 C;  2LLK A;  2QF7 A;  5F0F A;  3GTM J;  3TW6 A;  2M9H A;  4JP0 A;  2IBD A;  2ZOY A;  1JT6 A;  1RES A;  1JUM A;  3G1L A;  2DMP A;  2CUF A;  2NOG A;  3ANG A;  2XGC A;  4FIS A;  2DN0 A;  3SJM A;  5DAJ A;  2K9Q A;  3BTJ A;  2ID6 A;  2RHA A;  4FCY A;  4JX6 A;  1TC3 C;  1SAN A;  2EBI A;  1TWH J;  1QVU A;  3PM1 A;  5FKK A;  5IP6 A;  3EUP A;  1ZTR A;  1F43 A;  2HQ5 A;  2GBY A;  3OSG A;  2Q24 A;  2VI6 A;  5C44 J;  3QBM A;  2XPW A;  1W0T A;  4A3J J;  1SGM A;  2XRL A;  1VFC A;  2M0C A;  4MXM A;  2MSY A;  1WH7 A;  5E3M A;  3O8H A;  2HDD A;  2QWT A;  5J1U A;  2DA7 A;  3O8G A;  2LK2 A;  3FK6 A;  5GPA A;  2EQR A;  1HDP A;  1JGG A;  3NAU A;  2QOP A;  3KNW A;  4Y52 J;  3BNI A;  2PMZ N;  1PUF B;  5BNG A;  1NK3 P;  4XRM A;  5EYR A;  1UMQ A;  2CUE A;  1A5J A;  1O4X A;  1RKW A;  3HOX J;  4MIM A;  4MK6 A;  1Z0X A;  5IPA A;  2LR8 A;  5C3E J;  1U9O A;  1TWF J;  4B1R A;  2GUH A;  4BY7 J;  1PUF A;  3HOY J;  5EZH A;  1TWA J;  5K7F A;  2Y31 A;  2DA1 A;  2QTQ A;  3RH2 A;  5F27 A;  1FTZ A;  2QIB A;  3M3Y J;  5EF6 A;  3Q3S A;  4Y7N J;  1MBJ A;  3LSR A;  2R7Z J;  4X6A J;  2NS8 A;  2DG8 A;  2G3B A;  5HOD A;  1H89 C;  3ZQH A;  5F08 A;  4UDS A;  2R93 J;  3ZQG A;  4AC0 A;  2UXH A;  2M34 A;  2EZL A;  3LOC A;  3S1N J;  3LHQ A;  4A3K J;  3GTP J;  1OFC X;  5FHP A;  4AF5 A;  4HKU A;  1EF4 A;  4JX5 A;  3CCY A;  4D5C A;  3A01 B;  1B8I B;  2NX4 A;  3D1N I;  5GP9 A;  2IU5 A;  3BR5 A;  3K7A J;  2KT0 A;  4X1E A;  3COL A;  1JUS A;  1XG1 A;  5EDN A;  1ZK8 A;  3LSG A;  2F07 A;  1D5Y A;  3E7L A;  3ZQL A;  1SFO J;  4HNV A;  2NVT J;  2ME0 A;  2FJ1 A;  3FIS A;  4CYC B;  3A01 A;  1B8I A;  3BTC A;  4M3E A;  2JA5 J;  2GEN A;  3IH3 A;  3LWJ A;  4DZJ A;  2H1K A;  3DCF A;  5FMP A;  1GV2 A;  3M4O J;  2X48 A;  2UXP A;  1YRN B;  1JTY A;  1HF0 A;  4A3G J;  1A6I A;  2R5Z B;  3S1Q J;  3WHC A;  1JT0 A;  4D5F A;  1MSE C;  2EZH A;  4CYC A;  3SDG A;  5FKL A;  2JA8 J;  3S1R J;  5HSZ A;  2CQX A;  2M8G X;  1UI5 A;  3RQI A;  4AUX A;  4ME9 A;  2UXO A;  5FKM A;  2WUI A;  2XGE A;  1YRN A;  4UUS B;  2ZCN A;  3HM5 A;  1LFB A;  3QKX A;  2DTZ A;  4JNN A;  3BT9 A;  2R5Z A;  1ETX A;  1IRZ A;  5M5Y J;  1IG7 A;  3PAS A;  1VF9 A;  3BQY A;  1RPW A;  2Y9Z A;  2G7L A;  2FX0 A;  4C3H J;  1DU6 A;  5C4J J;  4IHY A;  4A69 C;  5IOZ A;  4UUS A;  2JA6 J;  3HE0 A;  3P9T A;  1ZQ3 P;  1MBG A;  3I4N J;  5GPC A;  4FE4 A;  2XPU A;  3BTI A;  3VPR A;  4EEF G;  4V2F A;  1GUU A;  1QVT A;  1JJ8 C;  5EGO B;  3OOU A;  2NVQ J;  2FQ4 A;  3VW0 A;  2O9L A;  5K7H A;  1FIA A;  2PBX A;  5E3L A;  3CJD A;  2TRT A;  4XID A;  5FKO A;  2QKO A;  2YU9 J;  4DYR A;  1CQT A;  3BR1 A;  2NP3 A;  2LKX A;  4M3D A;  1MBE A;  3NPI A;  5EGO A;  2ID3 A;  1TWG J;  2CJJ A;  5HAW A;  2LFB A;  3A03 A;  2HXO A;  2DMU A;  3RKQ A;  3JRG A;  3ZQI A;  1B72 B;  3JRB A;  4NDL A;  4QSH A;  3S2D J;  4CGR A;  1IDY A;  1K83 J;  2Y2Z A;  2GM4 A;  4M3G A;  2CQQ A;  2YVH A;  1QPI A;  3IUV A;  1IDZ A;  5D18 A;  3G56 A;  1B72 A;  2X9D A;  1AU7 A;  3B6A A;  2IEK A;  3CRJ A;  2E19 A;  3Q0V A;  1LE8 B;  1OCP A;  2UXI A;  2XSD C;  2DA4 A;  2JWT A;  2JMW A;  1ZR2 A;  3I4M J;  4DYQ A;  2X6O A;  1G2H A;  2PZ9 A;  3EGQ A;  5D19 A;  3CQZ J;  2WGB A;  3DPJ A;  1GVD A;  1P7I A;  5D1R A;  1BL0 A;  3S15 J;  2O7O A;  3G1M A;  1LE8 A;  3VIB A;  1H88 C;  3AQS A;  3IH4 A;  1POG A;  1MNM C;  1JKP C;  3A02 A;  1JUP A;  3HTA A;  3JSJ A;  2XB0 X;  5IYB J;  3VUQ A;  3HTJ A;  1X58 A;  5E3N A;  3VVZ A;  5FKN A;  2VPR A;  3CDL A;  2DJN A;  5JLW A;  1UHS A;  2REK A;  2DG7 A;  3NRG A;  1ZR4 A;  1X2M A;  1BW6 A;  3L1P A;  1MBK A;  1P7J A;  3NAR A;  3GTJ J;  1I3Q J;  5IP9 J;  3QPL A;  2DMQ A;  4IHW A;  2G7G A;  9ANT A;  3HTI A;  2HXI A;  1ETV A;  3PO3 J;  1GDT A;  1FIP A;  2NVY J;  4D7N A;  3V6G A;  4BBS J;  1BA5 A;  1I50 J;  4L5E A;  1NTC A;  3OSF A;  3VW2 A;  3HTH A;  2ME6 A;  2LTP A;  2ZCM A;  4A3M J;  3Q0W A;  5F04 A;  2JJ7 A;  2Y0S N;  4GFK A;  3MKL A;  1MSF C;  3G1O A;  3H3V K;  2ZCX A;  5FLM J;  2B63 J;  1RET A;  4A93 J;  3NNR A;  1ETW A;  2HYJ A;  1JKQ C;  2I10 A;  2OPT A;  5M3F J;  2IAI A;  4A3I J;  4NN1 A;  1WCM J;  2RAE A;  1APL C;  4JX4 A;  4XRS A;  2R5Y B;  4KWA A;  2XPV A;  1HOM A;  1GV5 A;  5AQC A;  3BG3 A;  5DS9 A;  3BRU A;  5IP7 J;  2ZOZ A;  2NP5 A;  2M2E A;  3BJB A;  3HBL A;  2VKV A;  4MO7 A;  3LJL A;  5EEA A;  2R92 J;  1IC8 A;  1S7E A;  1FEX A;  3GZI A;  4YZE A;  2COB A;  2LP0 A;  5CW8 A;  4ACI A;  4PXI A;  2AHQ A;  2L9R A;  1ZKG A;  4IHX A;  3BG5 A;  1U8B A;  3KKD A;  2R5Y A;  2XGD A;  2D6Y A;  3PPB A;  1Z77 A;  3B6C A;  2AO9 A;  4FE7 A;  1MBF A;  2TCT A;  2YVE A;  2ECB A;  5DTD A;  5FLV A;  3T6N A;  3HOV J;  3ZQF A;  3LNQ A;  3ZQC A;  3MN2 A;  4XIC A;  2OER A;  4W97 A;  5CXG A;  3JRH A;  4GFL A;  2Y30 A;  2K40 A;  4M3F A;  3H0G J;  2WV1 A;  1IGN A;  2D5V A;  4GFB A;  2EZK A;  1OJL A;  1W0U A;  1FJL A;  4A3D J;  1ITY A;  4D7M A;  3FRQ A;  2OF7 A;  2DA2 A;  1Q1V A;  5FJ8 J;  2EH3 A;  1U78 A;  5JLX A;  1ENH A;  3JRD A;  4M6V A;  2HYT A;  2DA6 A;  2VUM J;  1ETQ A;  1JTX A;  1ETO A;  3OIO A;  1WPK A;  2CRG A;  3TW7 A;  5IOY A;  3RZD J;  5EZG A;  3PO2 J;  2HOS A;  3BG9 A;  1VI0 A;  4C2M J;  4MLO A;  2L7M P;  3JRC A;  2KDZ A;  1DU0 A;  1IUF A;  3C2B A;  4A3L J;  3BHQ A;  3JRI A;  2DMT A;  3S17 J;  2V57 A;  3AQT A;  4B3A A;  3ZOB A;  1UG2 A;  4ICH A;  3K2A A;  4GCL A;  3GEU A;  2DMN A;  4S0H B;  1JKR C;  2NVX J;  1Y1V J;  3QPS A;  5C4Y A;  1BW5 A;  3BTL A;  1JKO C;  4C3J J;  1QRY A;  2GLO A;  1ETY A;  2CU7 A;  2L7Z A;  3GTO J;  3GTK J;  3DEW A;  1MBH A;  3JRE A;  2G7S A;  3MVP A;  4A3E J;  3FIW A;  4M3B A;  4J19 A;  4AYB N;  2MW8 A;  3IH2 A;  1NK2 P;  4QTR A;  5F0C A;  4I76 A;  5K7Z A;  4RDU A;  1LFU P;  3KKC A;  3VVX A;  5J3L A;  4GCT A;  3S1M J;  3TED A;  2RAS A;  4BY1 J;  2XDN A;  3SFI A;  2LY9 A;  1X2N A;  3ANP A;  5CXI A;  1WH5 A;  3KZ9 A;  3RD3 A;  4BBR J;  3W6V A;  3HGG A;  1WGX A;  1T56 A;  5EG0 B;  4JYK A;  4L62 A;  4IEJ A;  3Q0U A;  2NS7 A;  5HBU A;  3VVY A;  2W48 A;  3HOZ J;  3VOK A;  3VW1 A;  3BR6 A;  2L0K A;  3VP5 A;  4ABZ A;  2HOA A;  5EG0 A;  1ORK A;  2JN6 A;  3S16 J;  2O7T A;  1IV6 A;  1VND A;  1RKT A;  5FGL A;  3UKG A;  2GFN A;  2O8K A;  4JL3 A;  1AKH B;  3V78 A;  2ZB9 A;  1FTT A;  3G7R A;  3HKZ N;  4AC6 A;  1RR7 A;  2MGQ A;  2N8G A; 
#chains in the Genus database with same CATH topology
 1PDN C;  2Y9Y A;  1TZL A;  4W1U A;  4UVB A;  2E1M B;  1XC5 A;  5IYD J;  5DCM B;  2DA5 A;  1J5Y A;  1T33 A;  2E2I J;  1AKH A;  2CQN A;  2EV6 A;  2ZKZ A;  2DOA A;  1LPQ A;  3CC4 I;  5DEQ A;  2BGC A;  5K5R A;  4FTH A;  3HPG A;  2CS3 A;  5EFY A;  1KON A;  1XDU A;  3WTT C;  3H0D A;  2E2J J;  4UVA A;  5D6F A;  5LHH A;  3GTG J;  3CTA A;  3K9T A;  2FQ3 A;  1TWC J;  2YUS A;  2LYC A;  3F1B A;  4HX8 A;  2WAD A;  3HOU J;  3E7Q A;  3F8N A;  2VXZ A;  4ZZL A;  4CA0 A;  3FMS A;  4HZF A;  4XN3 A;  4RB1 A;  3MQ0 A;  4U87 A;  2EZI A;  1H8A C;  4E7K A;  2GIZ A;  2X0L A;  3BDD A;  1K4S A;  5HLT A;  5E3O A;  2XF6 A;  1X4O A;  3CUQ A;  3GTL J;  4BXX J;  2W25 A;  1HC8 A;  1A35 A;  3DPU A;  2PJR B;  2EA4 A;  3JRA A;  5F0H A;  2UXX A;  4A0Z A;  4R8H A;  1XS9 A;  1YW7 A;  3DWL E;  2R0Q C;  4NEL A;  2A6T A;  2EFQ A;  1F4K A;  3FKI J;  1MGT A;  1RC9 A;  2H1L A;  4OU0 A;  3BJO A;  4HDU A;  4ZC3 A;  1VQM I;  1BM9 A;  2XB5 A;  1BJA A;  3HB9 A;  3PUB A;  3B81 A;  2LC2 A;  1OCR H;  4DGW B;  1HKS A;  4MTD A;  3HEF A;  4LOC A;  1WJA A;  4LLL A;  3I64 A;  3I3L A;  3NXC A;  2DU9 A;  2YVX A;  3TP0 A;  1WI3 A;  1RUN A;  1IUY A;  4RLF A;  3E0J B;  3ZMZ A;  2GQQ A;  1MH3 A;  1HQC A;  2NXN B;  2WAQ N;  3BCA A;  2K9S A;  4A3F J;  2QSF X;  3L2C A;  2KLO A;  2H8R A;  4DZP A;  4M9Z A;  1BJZ A;  4OIP F;  2DYR H;  4I6Z A;  4HSR A;  5FD5 A;  2DOF A;  2Y0M A;  2QEN A;  3S2H J;  4CCL A;  2YX4 A;  3PFI A;  2GIV A;  2ECC A;  3CZ6 A;  3NI7 A;  2M0M A;  4CCO A;  3VYR B;  2LD5 A;  3VTI A;  1U5T A;  2VT2 A;  4A0X A;  3RSN A;  2ELH A;  2ZY9 A;  2HOE A;  5TRD A;  5BQT A;  4BKX A;  2LLK A;  2QF7 A;  3AL0 B;  1SC7 A;  2ZOY A;  1JT6 A;  3FXM A;  1MMG A;  4FX0 A;  3A0H C;  1B59 A;  1JUM A;  2DMP A;  2CUF A;  4DOZ A;  4RB3 C;  1R4N B;  1CF7 A;  4IO9 F;  3HJE A;  2XGC A;  2CH0 A;  3SJM A;  3W3C A;  2XAH A;  4B48 A;  3IAM 2;  1KA8 A;  4HV5 A;  2O03 A;  1TC3 C;  1SAN A;  3PM1 A;  4HPQ A;  3EUP A;  2RV8 A;  5LRR A;  1XMA A;  1W0T A;  3BZ6 A;  4A3J J;  4MXM A;  3D5S C;  1O3Q A;  3FF5 A;  3HL2 A;  2GA2 A;  3IC7 A;  2F5V A;  5IT9 K;  2EIK H;  1HDP A;  2EQR A;  5F6F A;  2UZK A;  3KNW A;  1UG0 A;  2G7U A;  4RS8 A;  1PP7 U;  4KIF A;  5KCM A;  3ZMU A;  1NG7 A;  4IXA A;  3O6B B;  4XRF A;  3BJA A;  3JW4 A;  5E1Z B;  4MIM A;  1Z0X A;  5IPA A;  4B8X A;  4PK4 A;  3CCV I;  2W4S A;  2XAS A;  2OBP A;  3KEY A;  3RPU D;  3HOY J;  3GZ5 A;  2CQ7 A;  3JAM K;  5K7F A;  2QTQ A;  2W24 A;  3RH2 A;  3H9G A;  2QIB A;  2YR2 A;  1U8R A;  1SMY F;  2LSO A;  3DBL B;  4Y7N J;  1MBJ A;  3OS1 A;  3IWF A;  1D0Z A;  2W1O A;  2G3B A;  4ITV A;  1R58 A;  3OYF A;  1H89 C;  5F08 A;  2VC1 A;  3L09 A;  4UDS A;  5ED4 A;  2M34 A;  3LSI A;  4NB5 A;  1EV7 A;  2O0Y A;  1YS6 A;  3S1N J;  1D3Y A;  3FWE A;  1OKR A;  4EM2 A;  2HYG D;  3DEE A;  3LMM A;  3CCY A;  3KYD B;  5LHI A;  3PFY A;  3VOE A;  4PJN A;  2HWV A;  3A01 B;  2DT5 A;  3U21 A;  3CJT B;  4HX4 A;  4U9N A;  3C2H A;  3K7A J;  3K4B A;  4OIR F;  1JUS A;  5FFX A;  3HG9 A;  2COM A;  5J4V A;  2OCC H;  2F07 A;  2ZXW H;  1D5Y A;  1FWZ A;  3ZQL A;  2K85 A;  3NRV A;  1XGN A;  2FJ1 A;  4NC7 A;  3F6O A;  3K6G A;  3BTC A;  4M3E A;  2X1D A;  2YSR A;  2JA5 J;  2K86 A;  2FJI 1;  1D5V A;  2EIM H;  2LMD A;  1GV2 A;  2OJE D;  3SXY A;  3M4O J;  1BI2 A;  3ZN1 A;  3ASN H;  4RMN A;  1JTY A;  1RR8 C;  1A6I A;  4CO8 A;  2R5Z B;  4XLC A;  3DV8 A;  3QPH A;  1O3T A;  2JA8 J;  3BY6 A;  3SDG A;  4CYC A;  2WA0 A;  3U9G A;  4HV6 A;  1UI5 A;  4C9Y A;  1O7L A;  3MZH A;  2GXA A;  2UXO A;  1YRN A;  4IL6 C;  1LFB A;  3HUG A;  1UEL B;  1SD7 A;  3ULQ B;  3CJN A;  2GZW A;  2IS2 A;  5M5Y J;  2JVH A;  3AG4 H;  1VF9 A;  2CV1 A;  2G7L A;  3HTS B;  3IL2 A;  2DDB A;  1QNT A;  5C4J J;  4A5M A;  1G3S A;  2DT6 A;  4LIV A;  2LKS A;  1VQK I;  5FRN A;  3J80 K;  2HZD A;  1LNW A;  2NRA C;  3I4N J;  2FEZ A;  3MZY A;  2L9V A;  2XPU A;  4I0B A;  3VPR A;  2KFD A;  4ENJ A;  3GYH X;  2LG4 A;  2ZFU A;  1QVT A;  2FQ4 A;  4LG0 A;  4ZYH A;  3VW0 A;  2JPB A;  3R6S A;  5E3L A;  3F8B A;  3CJD A;  1H9T A;  5ILS A;  3R60 A;  4BXF A;  2YU9 J;  5DM7 F;  5BMZ A;  3RYP A;  3SQN A;  4DYR A;  5L3G A;  4MHG A;  5FLX K;  3PNV A;  2FNP A;  3BR1 A;  5BS6 A;  1MBE A;  4HF2 A;  1A04 A;  4XLA A;  4L5J A;  1XSX A;  1TWG J;  5JFR A;  5HAW A;  2XF5 A;  2QYO A;  2DMU A;  4KMF A;  2BW3 A;  4XNF A;  4EM1 A;  4BQN A;  2CGP A;  4CGR A;  3I59 A;  1BC7 C;  3WU2 C;  2E1N A;  2HGC A;  3JSO A;  2GM4 A;  3UR3 C;  1P4W A;  2YVH A;  2Q1Z B;  2ZJ2 A;  2JQ7 A;  1IDZ A;  4M74 A;  3VFZ A;  3EQL F;  1W5S A;  2MFZ A;  4ETS A;  1B72 A;  4GYI A;  2F6C A;  1AU7 A;  2IEK A;  3CRJ A;  3MCZ A;  1LE8 B;  2OA4 A;  3N05 A;  1QHH D;  1XB4 A;  2O8X A;  3KZY A;  2JWT A;  5L3E A;  1ZR2 A;  1G2H A;  1LEB A;  3CQZ J;  1ZH5 A;  1P7I A;  4BXU A;  4RAG A;  5D1R A;  1HSJ A;  3S8P A;  1DGR M;  1BIB A;  3SFZ A;  3L2U A;  5CVU A;  1KYZ A;  2KIS A;  1POG A;  2DQR A;  2IGN A;  2O3F A;  2X6X A;  2YPR A;  4RB2 C;  3K4M A;  4RM3 A;  1TBX A;  4Y33 A;  2XRO A;  1JGS A;  4PJJ A;  3R4K A;  5E17 F;  2GOX B;  2R7Q A;  2DJN A;  3F8F A;  4H4K C;  5ICF A;  2R7W A;  3CCL I;  2A05 A;  2QGU A;  1UHS A;  3ZGK A;  1ZRD A;  1I1S A;  5H6R A;  3NRG A;  3GO5 A;  3J7A Y;  1J9I A;  1TW2 A;  3BZC A;  3KLN A;  1YX5 A;  3NAR A;  4CZC A;  4AIK A;  5JHF A;  3GTJ J;  1I3Q J;  4ZDL A;  4CDG A;  2DMQ A;  3GFI A;  1SD4 A;  9ANT A;  3HZJ A;  2HXI A;  3KET A;  1YJW I;  3GX4 X;  5H2F C;  2NVY J;  4G6D A;  3ASO H;  4KUM A;  4BBS J;  2FRH A;  2A6H F;  3EUK L;  5E79 C;  3V7C A;  5ILV A;  4MQ9 F;  1XGM A;  3HTH A;  3ZMT A;  2NS0 A;  2ME6 A;  3H9J A;  2P6S A;  2NYX A;  1W4M A;  3PNY A;  5F04 A;  3DQV C;  1RIO H;  3OIQ A;  3H3V K;  2ZBK A;  5FLM J;  4S05 A;  1RET A;  1QBJ A;  1R36 A;  2F5D A;  2HYJ A;  2B63 J;  1D1C A;  4XLP F;  1B1B A;  4HW0 A;  1Z3X A;  4B44 A;  4KN4 X;  3GW2 A;  4BGD A;  4XRS A;  5HVQ C;  4BEH B;  5TGT A;  1OCC H;  2M2E A;  4WX9 A;  3HBL A;  4I09 A;  4MO7 A;  3LJL A;  3BLY A;  2R92 J;  1YG2 A;  3CES A;  2MC3 A;  5DDG A;  2ESN A;  4PXI A;  5D4S A;  2AHQ A;  2L9R A;  2L2O A;  3KKD A;  2R7S A;  3PPB A;  4FE7 A;  1YO5 C;  3BG7 A;  4O3M A;  2YVE A;  1U6G A;  4YIR X;  2EFW A;  3T6N A;  1ZG5 A;  3ZQC A;  3BOQ A;  1MMD A;  2DPD A;  3U1D A;  4UUV A;  1YE9 A;  1D8J A;  2IPQ X;  3F72 A;  2BVL A;  3KLO A;  3FXJ A;  5HS9 A;  4HA8 A;  1FZP B;  3PJR A;  4GFL A;  4QPO A;  2V26 A;  2Z3Y A;  2ESH A;  1ZYR F;  4PJL A;  2HYF A;  4DQ2 A;  3OWT A;  4FAS D;  1YIT I;  4A3D J;  2JT1 A;  1ITY A;  2CQK A;  2M45 A;  3FRQ A;  2IS6 A;  2OF7 A;  2DA2 A;  1Q1V A;  5FJ8 J;  2EH3 A;  1U78 A;  3VDX A;  2BHZ A;  3KP5 A;  2VUM J;  1ETQ A;  2ZJP F;  4CXF A;  5D5V B;  4EQQ A;  3OYJ A;  2WAQ A;  4L0Y B;  1S7O A;  3PSF A;  4UVC A;  3TW7 A;  1HW2 A;  3DKW A;  3BG9 A;  1ON1 A;  2LF7 A;  2DYS H;  2HPI A;  3QU6 A;  3IHU A;  3BHQ A;  5B1A H;  5K5O A;  4NUB A;  3OYH A;  2A3S A;  5A2Q K;  3AQT A;  4B3A A;  3DBH B;  3ZOB A;  3MKW B;  3O3K A;  4ICH A;  4GO1 A;  3GEU A;  4WWC A;  4S0H B;  4NQW A;  3EUH C;  2OQG A;  1JXS A;  4A5N A;  1BW5 A;  2MLG A;  2GLO A;  1QRY A;  2CU7 A;  2FUG 2;  2L7K A;  3DEW A;  2WV0 A;  4L0Z B;  1QZY A;  3JRE A;  4XLH A;  2G7S A;  2E71 A;  3E5X A;  4CYD A;  4OMY A;  1Y8Q B;  2RQP A;  4AYB N;  2MW8 A;  3VVX A;  1T0F A;  2CW7 A;  4I2O A;  2RAS A;  1X1C A;  2XDN A;  3B02 A;  1B9N A;  4WF2 A;  4BQA A;  2XV4 S;  1JHH A;  2F5C A;  4EAT A;  2QQA A;  4BBR J;  3W6V A;  3HGG A;  3NEU A;  3FBI B;  4ZTF A;  4L62 A;  1MNE A;  4IEJ A;  2HQN A;  4BQQ A;  3Q0U A;  2VE8 A;  4GCV A;  4AIH A;  4M72 A;  4M9S A;  2R7R A;  3I9V 2;  3VP5 A;  2QBY A;  4YII A;  2UUZ A;  2LDU A;  3HSE A;  1ORK A;  2JN6 A;  1VND A;  3NWT A;  4AID A;  3PIP F;  5FGL A;  5DCF A;  3VYT B;  3K4J A;  2HNH A;  1FTT A;  3ONQ A;  2IA0 A;  2B3W A;  1U3E M;  2O6G E;  2JA2 A;  3W6J B;  3F8C A;  4IHS A;  2V1X A;  2VJ5 A;  2RDP A;  2MGQ A;  4FET A;  3COA C;  4J19 A;  3WHB A;  2MD0 A;  3J81 Z;  2PI0 A;  3CWR A;  3S5R A;  3SWH A;  4V2G A;  3V7S A;  4IQJ A;  1K61 A;  1FMV A;  4CH7 A;  3ON4 A;  3TOA A;  2QZ8 A;  2ZME B;  2JSP A;  2NOJ B;  1E3O C;  4E7I A;  5DCM A;  1NHA A;  4A3C J;  3BP8 A;  2PFB A;  5TIS C;  1RI7 A;  3F0C A;  5HLG A;  4IX7 A;  4RBO A;  3S3O A;  4CCJ A;  1T95 A;  3JR9 A;  2KL4 A;  3HDD A;  4N9I A;  3GBG A;  2GWR A;  3GEZ A;  3F6V A;  4UXN A;  5K58 A;  3D5L A;  1BBY A;  1R1U A;  1ZG1 A;  4ANJ A;  2MG4 A;  5DD8 A;  1SD6 A;  5M5W J;  1P4A A;  2HKO A;  5J1Y A;  4UUT A;  4B4C A;  3WGH A;  5L3F A;  1GT0 C;  3KFW X;  1EJ9 A;  1R9T J;  3I71 A;  4BS9 A;  1WKM A;  1OCO H;  1LJ9 A;  3S93 A;  1S9H A;  3M8E A;  3WTX C;  3L2V A;  4EGZ A;  1R4M B;  2LKP A;  4M73 A;  4KN7 X;  1UFM A;  3RIR A;  2HOT A;  2EIN H;  3E6D A;  2IT0 A;  2LY2 A;  2WB1 N;  5E1W A;  1IJW C;  1LVK A;  1TW3 A;  2G7H A;  3WTU C;  2P5V A;  3B73 A;  2PJR A;  4PZJ A;  4C30 A;  4DIQ A;  4F55 A;  2ZNZ A;  2VKE A;  2HI3 A;  2DK8 A;  1IN8 A;  1S7A A;  4BU2 A;  4ZYD A;  2XSJ C;  2VBX A;  2YS9 A;  2BBY A;  2LY1 A;  3HRS A;  3IRQ A;  4UNO A;  4AU7 A;  5ICE A;  1IXR C;  4II3 A;  1UJ8 A;  4RGX A;  2P4W A;  3MNL A;  3HGY A;  4IJA A;  1IN7 A;  4LIU A;  4RB0 A;  1D8K A;  3LST A;  2QCO A;  1UCR A;  5H9T A;  1UHM A;  1T39 A;  4E7J A;  6PAX A;  2P8T A;  3EDP A;  5ERI A;  4BJ6 C;  3N97 A;  2A2F X;  2BE5 F;  4G6T B;  4G6Q A;  1MMN A;  5F0F A;  2F4I A;  1XX5 A;  3CCS I;  1YQA A;  2A68 F;  1ZG3 A;  4YFK F;  1DP3 A;  4ZYE A;  2HU9 A;  1TT0 A;  3G1L A;  2PJP A;  4YFX F;  1FOX A;  2ZFW A;  2DN0 A;  5DAJ A;  2K9Q A;  3BTJ A;  2ID6 A;  2VLA A;  2ACJ A;  4JX6 A;  1K6Y A;  1I39 A;  1QVU A;  3BWG A;  3OS2 A;  3G4S I;  2Y69 H;  4BDY A;  1V5F A;  1ZTR A;  2FBK A;  3OSG A;  1F43 A;  2Q24 A;  2EIJ H;  3QBM A;  3GZ6 A;  2EFO A;  5JI6 A;  1E0E A;  4XOT A;  1VFC A;  2M4K A;  1U5T C;  3M9A A;  2QWT A;  1FSH A;  2VJI A;  5GPA A;  5K5Q A;  5DYM A;  3TDZ C;  1EH7 A;  4LG3 A;  1OR7 C;  4ZDO A;  1PUF B;  5HNF A;  2K02 A;  4F93 B;  2EPF A;  2ZSH B;  4M6Y A;  4MNU A;  5GAD J;  1NK3 P;  1N25 A;  3ZCO A;  1IRG A;  1UMQ A;  2K9M A;  3K0L A;  3QPT A;  5BPD A;  3LSK A;  1A5J A;  4HLX A;  5KK1 A;  2JSC A;  5HNH A;  1U9O A;  1TWF J;  4EV0 A;  5HLI A;  4BDZ A;  4BY7 J;  1YS7 A;  1PUE E;  3A4C A;  2DA1 A;  5HDG A;  4I0A A;  3CO6 C;  3K2Z A;  3KP2 A;  3LFK A;  3RKW A;  4AIJ A;  2R7Z J;  4X6A J;  4KMU X;  2HKX A;  5CKT A;  5DV5 A;  3J7Y J;  3FBN B;  3CF2 A;  4PGG A;  2ZCW A;  4XKC A;  3OYM A;  1SMT A;  3ZQG A;  4AC0 A;  2EZL A;  2R4G A;  3LOC A;  3OYG A;  1S72 I;  4LMY A;  1OFC X;  2V79 A;  3OYK A;  5FHP A;  1EF4 A;  4AF5 A;  1S29 A;  1SFU A;  5JHU A;  4D5C A;  2VQG A;  2K4J A;  1B8I B;  5A2Q Z;  5HS8 A;  5GP9 A;  2IU5 A;  3WE2 A;  2PX9 A;  2KT0 A;  2WAE A;  3COL A;  2J5O A;  5EDN A;  1XG1 A;  2CFX A;  3JSP A;  5KAI C;  4D9J A;  1ZK8 A;  3F23 A;  2MH9 A;  4RAF A;  2QQ8 A;  1ZRE A;  1WZ2 A;  3VYS B;  1G8X A;  1XSV A;  2NVT J;  2ME0 A;  2C6Y A;  2EJR A;  3A01 A;  1KYW A;  5D5W B;  1R1T A;  5LGU A;  4DZJ A;  1RNL A;  5CLS A;  3WTS C;  2OV7 A;  3DPT A;  3WG7 H;  5FRM A;  5FMP A;  2L4M A;  3Q9S A;  5J8F A;  2W84 A;  4HQM A;  1HF0 A;  1IRX A;  3DP7 A;  1VQ8 I;  3S1Q J;  3WHC A;  4IZZ A;  2FBH A;  4D5F A;  1MSE C;  4P9U A;  5FKL A;  3HSR A;  2CQX A;  4CHU A;  4XM3 A;  2KRC A;  4R79 A;  3FM5 A;  4Y4R A;  2ZCN A;  5FKM A;  2WUI A;  2XGE A;  3RDI A;  3HM5 A;  1B6A A;  1V55 H;  2R5Z A;  2PQ8 A;  1FP2 A;  3ECH A;  1VQ4 I;  3W2W A;  3GF2 A;  2FU4 A;  4E70 A;  4C3H J;  3OYE A;  1DU6 A;  2ZSI B;  1R5G A;  4PJ0 C;  4IHY A;  1VQ6 I;  4A69 C;  3QOD A;  4L9N A;  5IOZ A;  2JA6 J;  2DFH A;  4ZYG A;  2FF4 A;  3FMQ A;  3HYI A;  3P9T A;  3WGI A;  2VON A;  2H6B A;  3QWL A;  1ZQ3 P;  2E35 A;  3KIO A;  3CF5 F;  1UHW A;  2VN2 A;  4V2F A;  2J5P A;  3OYN A;  4LLN A;  2IGK A;  2NVQ J;  5JVT A;  1O7F A;  4ESF A;  2LF8 A;  1G3T A;  2XVC A;  1VQ9 I;  4BHP A;  3KEQ A;  4BHC A;  4MGR A;  1IXS B;  4M3D A;  1T98 A;  1W5C C;  1VQ7 I;  4CCN A;  1GLN A;  2H09 A;  4FHT A;  2QKM B;  2LFB A;  5DUI A;  2HXO A;  3RKQ A;  1XDS A;  3JRG A;  3GLL A;  3ZQI A;  2Q2E B;  2EV0 A;  3H5R A;  3JRB A;  1EKE A;  4MEY F;  4NDL A;  3S2D J;  4HNU A;  3VWB A;  2PMH A;  1V5E A;  1Z67 A;  2K9L A;  2Y2Z A;  3T1B A;  1J09 A;  5D18 A;  4G9Y A;  4HF1 A;  2K3P A;  4PUS A;  4E7H A;  3G56 A;  2P0W A;  2DFI A;  2X9D A;  3B6A A;  4E7L A;  4AYB A;  2X1E A;  2UXN A;  3V8K A;  5E8G A;  1Z1D A;  2JMW A;  2K7L A;  2CW0 F;  3I4M J;  2X6O A;  3ZMV A;  1UZC A;  1HA8 A;  4BE0 A;  1ON2 A;  2KPM A;  3OYD A;  5BPI A;  4Y17 A;  3CMM A;  1FYL A;  5B1B H;  3IRR A;  3H5A A;  3S15 J;  2FE3 A;  3G1M A;  4XLN F;  3TKY A;  4XLE A;  1W7P D;  1LE8 A;  3AQS A;  3VIB A;  3IH4 A;  2NNN A;  1JKP C;  3LA7 A;  3E5U A;  1G4D A;  4LFU A;  2Z16 A;  3HRT A;  4XOP A;  2GXG A;  1HBX G;  5FKN A;  3CDL A;  3AG3 H;  4LLG F;  2M1B A;  4EVI A;  2REK A;  3GFM A;  2HVQ A;  1EH8 A;  5GTI C;  3E3V A;  1ZR4 A;  2L9S A;  1X2M A;  1YHQ I;  3CO7 C;  1MBK A;  1AWC A;  2IVM A;  2YU3 A;  2DBB A;  3HTI A;  1R22 A;  4HOB A;  3CLQ A;  4EM0 B;  3K4C A;  1GDT A;  1FIP A;  1X3W B;  2P6T A;  2E36 A;  3RKX A;  1IN5 A;  2VT3 A;  1HW5 A;  4YRV A;  2XDV A;  3K4N A;  1NTC A;  2LTP A;  4B3X A;  5E1X A;  3C3W A;  3HHH A;  2Y0S A;  3IKV A;  2BYV E;  3ROU A;  4ZJZ A;  4C2U A;  2ZCX A;  2DOD A;  1R71 A;  4XN0 A;  4IQ4 A;  2OPT A;  4A3I J;  2IAI A;  3KEO A;  4KFC A;  4NN1 A;  2IA1 A;  1XMK A;  3LL7 A;  2QLZ A;  3MFK A;  1APL C;  2PFV A;  4JX4 A;  2R5Y B;  1GV5 A;  2OCE A;  5DS9 A;  3BJB A;  2XAG A;  2MA3 A;  2PG4 A;  4U0Y A;  3I58 A;  2K27 A;  4XOR A;  4U7B A;  1IC8 A;  3GZI A;  2DK5 A;  2LP0 A;  4F7Z A;  3K70 C;  3DTK A;  3CD6 I;  4DJA A;  2DLL A;  1WWX A;  3L2Q A;  1OIS A;  2D6Y A;  4BEH A;  1YFH A;  3RQ4 A;  3E1S A;  3OIP A;  2QQB A;  5LHG A;  1X1D A;  2L9N A;  4XIC A;  2OER A;  4W97 A;  5CVR A;  3WTY C;  1IF1 A;  2STW A;  2WB1 A;  3JRH A;  1Z7U A;  2Y30 A;  2OQR A;  5FB2 A;  2BY0 A;  2D5V A;  1W0U A;  3OYI A;  3V7R A;  4D7M A;  5JLX A;  1ENH A;  4UB8 C;  3JRD A;  4M6V A;  1JTX A;  1ETO A;  3OIO A;  1FPQ A;  1YOV B;  4PGH A;  3ERE D;  2EFN A;  2L01 A;  4HQE A;  1DU0 A;  1IUF A;  2VKH A;  3C2B A;  4BUP A;  1SD5 A;  2DI3 A;  4I98 B;  4N9H A;  2F4O B;  2D45 A;  4NBQ A;  1R1V A;  1FYM A;  3ECO A;  4UV9 A;  2RKH A;  3QYB A;  3LAP A;  1JI8 A;  1DQU A;  1G6N A;  4IPA A;  2DMN A;  2GAU A;  1JKR C;  1X1A A;  2Z99 A;  1Y1V J;  2EB7 A;  2KJB A;  4CUG A;  3DLL F;  4HDV A;  2VB6 A;  3Q9V A;  3UNG C;  4WK8 F;  4C3J J;  2XC7 A;  2VBY A;  1ETY A;  1FX7 A;  2Q0O A;  3GTO J;  3S2W A;  3Q5F A;  3GTK J;  3D0S A;  1RRJ A;  1X19 A;  4E7S A;  1HW1 A;  3V4G A;  3W2V A;  3CDI A;  4KNY A;  1FMW A;  4I76 A;  4L5I A;  4RGU A;  5F0C A;  1LFU P;  5J4Y A;  4GCT A;  2M5W A;  1W7P B;  2V4J C;  3FHN A;  4WIB A;  2HZT A;  4BY1 J;  2HDW A;  1ERD A;  1X2N A;  5CXI A;  3LWF A;  2QKL B;  3KP3 A;  5EG0 B;  2V1N A;  4JYK A;  4KT6 A;  4XL9 A;  3U2R A;  1TNS A;  4WXH A;  1F9N A;  4OAZ A;  5HBU A;  2L0K A;  3MKY B;  4ZYA A;  4Y15 A;  3L9F A;  4C2T A;  1MKM A;  3S16 J;  2O7T A;  1IV6 A;  5FO5 A;  3G71 I;  1R23 A;  4CGZ A;  5FRO A;  4JL3 A;  2KZV A;  1T0F C;  1H0M A;  1I3A A;  1A31 A;  3E5Q A;  3G7R A;  3HKZ N;  4U7D A;  2FSW A;  1Q1H A;  4AC6 A;  1Z3Y A;  1RR7 A;  1J0R A;  2EWN A;  2N8G A;  2EZK A;  3FXO A;  4LGW A;  2HQA A;  2K3F A;  2XAQ A;  1MJ9 A;  3P7N A;  2G0E A;  2F5E A;  5D8K B;  1VQ5 I;  2IGM A;  2P81 A;  4LJZ F;  4RM2 A;  1ZGW A;  1SVL A;  1XD7 A;  2DA3 A;  4DW6 A;  4HX7 A;  1KQ8 A;  1AHD P;  4XRS G;  2FXA A;  3IUO A;  4QLC U;  3ON2 A;  2W00 A;  1PJR A;  4ENN A;  2I8D A;  1FSE A;  1XSD A;  5D4R A;  3ISP A;  3KP6 A;  1HCR A;  3IWZ A;  4K2E A;  2ZME A;  1YTY A;  5GAE J;  3T5X A;  3K69 A;  3DF8 A;  1WFX A;  2E7W A;  3LSM A;  1OCT C;  1U0J A;  4O6J A;  1HKQ A;  4IKF A;  5M3M J;  3JTG A;  1BC8 C;  3O2P E;  5IY5 H;  2JUG A;  3HSF A;  2NNY A;  2QWW A;  1VQP I;  2OTJ I;  3O60 A;  3LSJ A;  4G8X A;  3ZQ7 A;  5J6X A;  4PSW A;  2K9N A;  1QGP A;  5IT9 Z;  5EEG A;  2R7T A;  1LUJ B;  1E3H A;  5J1R A;  5M5X J;  2QM3 A;  1K78 B;  3BCG A;  3IAS 2;  2VQC A;  4YEL A;  4B09 A;  2P7C B;  4CCM A;  2DFF A;  1F36 A;  3S3N A;  2JK3 A;  2WC2 A;  1QZZ A;  5GTH C;  3FX3 A;  1X1B A;  3M1E A;  1WRJ A;  4MFD A;  3HIF A;  3C07 A;  2XUB A;  1ONV A;  3P9K A;  3L00 A;  1QPM A;  1TP4 A;  1HST A;  2RC4 A;  2R7X A;  1Z05 A;  4A3B J;  3JAM Z;  2FOW A;  4MFE A;  3I0T A;  3J7Z I;  3PQJ A;  1FOW A;  2A61 A;  3A1Y A;  1H9G A;  1KQ9 A;  3G73 A;  1XCB A;  1F5T A;  3JCU C;  5HDK A;  2AXL A;  1K4T A;  3VOX A;  2VAS A;  1V5G A;  1MH4 A;  3HOW J;  3TP3 A;  4WXC A;  1TNT A;  2L7F P;  4QIW N;  2DFE A;  1L3L A;  3DBR B;  1XCV A;  1S6L A;  1JJ6 C;  2WAF A;  3ABU A;  3G6E I;  3DU6 A;  1STZ A;  2ZNY A;  4OIQ F;  3GTM J;  3TW6 A;  2M9H A;  2IBD A;  4JP0 A;  1ULY A;  4WXD A;  3WTW C;  1GXP A;  2Z2S B;  1TL8 A;  2QUF A;  4GYG A;  4NNJ A;  2LBF B;  2OAZ A;  3FM3 A;  1LKX A;  3LQQ A;  2NOG A;  1WHU A;  5IT3 A;  1E2X A;  3H1C A;  2VC0 A;  4FIS A;  1BR2 A;  2RHA A;  1YI2 I;  1XN7 A;  4PJM A;  3T8R A;  1TWH J;  3SYT A;  3BRO A;  1T8I A;  5IP6 A;  3GUD A;  3A2K A;  3ZP5 A;  2GBY A;  3KCC A;  2VI6 A;  5C44 J;  2CUZ A;  2XPW A;  4KT5 C;  4KIC A;  1HXD A;  2M0C A;  1I5Z A;  2MSY A;  2CFO A;  3ZR8 X;  1WH7 A;  2MH2 A;  5LGT A;  2VJ4 A;  3CLO A;  3OL3 A;  3O8G A;  4BH9 A;  2LK2 A;  3FK6 A;  4P1W A;  2HDD A;  4C2M A;  3EYI A;  1JGG A;  3NAU A;  3AKZ A;  3WGG A;  2QOP A;  3DXJ F;  2DO7 A;  4Y52 J;  2PMZ N;  1OQY A;  3L7W A;  5BNG A;  4AWX B;  5E8I A;  4XRM A;  1MD0 A;  5EYR A;  1ZHF A;  4XBF A;  3QRF F;  2CUE A;  4S04 A;  3M1C A;  2AQF A;  1RKW A;  2VQH A;  2VXD A;  3HOX J;  4B1R A;  4HEA 2;  1G3Y A;  2CV0 A;  3AL0 C;  1PUF A;  2RN7 A;  2LH9 A;  3BJ6 A;  3J80 Z;  3CME I;  2A5W A;  1TWA J;  2IXS A;  2JUC A;  3OR1 C;  5J47 A;  1TTY A;  1WJ5 A;  5EF6 A;  3Q3S A;  3SDB A;  2B1E A;  2NS8 A;  4OD5 A;  1G59 A;  2DG8 A;  4CSW A;  1DPU A;  2E7X A;  2H94 A;  3ZQH A;  5HOD A;  2R93 J;  2BOL A;  2HVS A;  2VQL A;  2HFH A;  3SZP A;  1T6S A;  2P5K A;  5FLX Z;  4ASN A;  3GTP J;  2GOM A;  4OWR B;  2KIQ A;  2XRN A;  4X0G A;  4Z6Y A;  3CCU I;  4HKU A;  1ZRC A;  2IA2 A;  1UST A;  5LRS A;  2RQQ A;  3BR5 A;  5AIQ A;  4XKW A;  1BR4 A;  2DCE A;  4UHT A;  1G3W A;  4G94 A;  4XR6 A;  4BNC A;  2XKO A;  4Q47 A;  3MZ8 A;  3CCR I;  3FZV A;  3E7L A;  4G7O F;  4P9F A;  4HNV A;  3GME A;  1Z6R A;  1B8I A;  3CCM I;  1W36 C;  4BQO A;  2B0L A;  3IH3 A;  5AON A;  3DCF A;  4PFP A;  3MD2 A;  2X48 A;  3ESW B;  2UXP A;  1USS A;  2NAZ A;  4A3G J;  1JT0 A;  4HNT A;  4DBR A;  1V4R A;  4Q5S F;  1QO0 D;  1FLI A;  4GRI A;  2MAB A;  2H6C A;  4IF4 A;  3NQO A;  5ICG A;  2BY3 A;  3IKT A;  4UUS B;  1HKT A;  4XLF A;  2E34 A;  5E18 F;  2KIU A;  5LGN A;  3BQY A;  2Y9Z A;  3CUQ C;  5D6E A;  2QSH X;  2FX0 A;  2R7U A;  2E5N A;  3QOE A;  3K1P A;  3VB2 A;  1SFE A;  4YEJ A;  4U88 A;  1MBG A;  1R5H A;  3H3Z A;  4RGR A;  3G3Z A;  4I01 A;  2Q8K A;  2VOD A;  2L02 A;  3BTI A;  3ZPL A;  1E17 A;  2A5Y B;  1GUU A;  1MIJ A;  5EGO B;  2FMY A;  3RKY A;  2O9L A;  1W5T A;  3FKJ A;  1FIA A;  3ZMD A;  2PBX A;  3QAH A;  4ESB A;  2V6C A;  4XID A;  1Y6I A;  5FKO A;  2QEX I;  1GHC A;  3CC2 I;  1XTA A;  3QP5 A;  1R00 A;  4GGG A;  2JZY A;  3AAF A;  2KMU A;  1YW9 A;  3FXQ A;  4J01 A;  3EUA A;  3NPI A;  2V1D A;  4A6E A;  2VBZ A;  2X85 A;  1WI9 A;  3A03 A;  1PYV A;  1FY7 A;  3REO A;  1UAA A;  3ZQQ A;  1OLT A;  2LRD A;  2E5Z A;  2ETH A;  2ZXH A;  4JQF A;  4QSH A;  2DOE A;  4YFN F;  3KE2 A;  1IDY A;  1K83 J;  4O5V A;  4KYW A;  3QU3 A;  2CQQ A;  2BY2 A;  1NH3 A;  2CWE A;  5J40 A;  4N4N B;  2KKO A;  1X3Z B;  4IRV A;  5L3B A;  4TV7 A;  4H0E A;  2WTE A;  2BXZ A;  2Q2E A;  3EPZ A;  3BCB A;  1OCP A;  2UXI A;  3ZXS A;  1P9Q C;  2XSD C;  4NHJ A;  5F1R A;  4V19 K;  4DYQ A;  5D19 A;  2A69 F;  3CP2 A;  3LA3 A;  4IHT A;  2WGB A;  3DPJ A;  1ZGA A;  4L9J A;  5B66 C;  3I56 I;  2XF7 A;  4EJO A;  1BL0 A;  3L2R A;  5L3D A;  5ICC A;  3HOT A;  5E20 A;  4XSX F;  1H88 C;  1MNM C;  1IN6 A;  4NC6 A;  3HTA A;  3H35 A;  2EV5 A;  4A0Y A;  1X58 A;  5E3N A;  3VVZ A;  2VPR A;  3W6K B;  4LB6 B;  2IGO A;  5JLW A;  1TQI A;  2EA2 A;  4HYE A;  4BAY A;  2R3S A;  3RCO A;  4EJW A;  2CYY A;  3CCQ I;  2RGV A;  1P7J A;  1YW8 A;  2R7O A;  3K10 A;  3HC7 A;  1VTN C;  5LEJ A;  2QSG X;  2G7G A;  1O3R A;  1ZLK A;  1ETV A;  1K6O A;  3HOS A;  3PO3 J;  1B9M A;  1OYI A;  1YJ9 I;  1XGO A;  2Z33 A;  3GLX A;  1AA7 A;  4Q4Z F;  1W36 D;  3OR2 C;  2XHK A;  1Y0U A;  1ZN2 A;  3VW2 A;  2OU2 A;  2ZCM A;  2F5F A;  2FML A;  2VL8 A;  4JK1 X;  4A3M J;  2XAU A;  3PNT A;  2JJ7 A;  4GFK A;  3G1O A;  1D1B A;  5FFZ A;  3LAJ A;  2FNA A;  1ETW A;  4OMZ A;  2JVG A;  1WCM J;  2L54 A;  3FHZ A;  1MND A;  2Z9O A;  2RAE A;  1QQI A;  2KRF A;  3QYF A;  4KWA A;  2XPV A;  3DTI A;  1HOM A;  4IVN A;  5AQC A;  3DTE A;  1LDK B;  3BRU A;  2OD5 A;  2ZOZ A;  2NP5 A;  1E3P A;  4NC8 A;  2KP6 A;  3FXR A;  1X4P A;  3OYB A;  3TOB A;  3C18 A;  5HOO A;  4YZE A;  3DPL C;  4BJ5 C;  5LLQ A;  2VBW A;  3ZRG A;  2BXY A;  2DXI A;  3I4P A;  3MAJ A;  2R5Y A;  2XGD A;  2IRF G;  1LDJ A;  1Z77 A;  2AO9 A;  2RNJ A;  1REP C;  3R0J A;  1MBF A;  3TDU C;  2WY8 Q;  4KDP A;  2DPU A;  3WTZ A;  2KZG A;  4XKV A;  4LB5 A;  3ZQF A;  3BG6 A;  3LNQ A;  4BL0 B;  2RVC A;  2F48 A;  5CXG A;  2A6E F;  2CV2 A;  1WSU A;  3ZMS A;  3WG9 A;  1FP1 D;  2KDO A;  2VKD A;  3DLA A;  3H0G J;  4KIB A;  4M3F A;  3HPH A;  3MMY B;  4EJV A;  5JVG F;  2QQ9 A;  4ZTJ A;  1FJL A;  3W2A A;  4AM3 A;  2RNG A;  1IW7 F;  2PEX A;  5CPR B;  4IOA F;  3H92 A;  2CRG A;  3OYL A;  2DT7 B;  5EZG A;  3PO2 J;  2HOS A;  2IW5 A;  1VI0 A;  4N0B A;  2CMP A;  1MMS A;  4OAY A;  2HPM A;  3KPH A;  2DMT A;  1KU7 A;  4XON A;  4DNC A;  3S17 J;  5EJC A;  2F4M B;  2V57 A;  2KRH A;  3TBI A;  1UG2 A;  4GCL A;  4M9X A;  4CZZ A;  2NVX J;  3C1D A;  1O57 A;  4F91 B;  2AQE A;  1VZ0 A;  1OR7 A;  1P92 A;  2L7Z A;  4UY8 I;  3TGN A;  2M30 A;  3D5R C;  3MVP A;  3DFG A;  3T0Y A;  4M3B A;  4I99 C;  2V9K A;  3IH2 A;  2HQR A;  1NK2 P;  3CDH A;  4QTR A;  5K7Z A;  4RDU A;  4LK0 F;  2VE9 A;  1L0O C;  5HDN A;  5DUK A;  1DPR A;  4Z2Y A;  3GVA A;  3TED A;  4WCG A;  3SFI A;  3U1K A;  3IP4 B;  2LY9 A;  1WH5 A;  4EGY A;  1Y0N A;  3GXO A;  2OTL I;  1BOA A;  1J7K A;  1FC3 A;  3KP7 A;  1I1G A;  3M7G A;  1ACI A;  1W7P A;  1IAW A;  2HTS A;  3RPU A;  3I54 A;  3HOZ J;  1J2X A;  3VOK A;  1JHF A;  2M7A A;  2PMZ A;  1RZ4 A;  3CCE I;  1MDM B;  4ABZ A;  4DBQ A;  5EG0 A;  5LD2 C;  2GXB A;  2FA5 A;  3TO7 A;  3WU0 A;  4YG2 F;  3HHG A;  5HLH A;  1RKT A;  3A0B C;  2IP2 A;  3UKG A;  1AKH B;  2ZB9 A;  3QOP A;  4LIT A;  2MLK A;  3OYA A;  3M8J A;  1ZLJ A;  5KVR A;  3CMY A;  1Z9C A;  1LQ1 A;  2OI8 A;  3PSI A;  2XIG A;  1DDN A;  4A2U A;  1WJF A;  1BI1 A;  1OYY A;  3FXL A;  1VQN I;  5BOX A;  3BR2 A;  3RZO J;  3BPV A;  3BR3 A;  2LVS A;  1XPX A;  2BV6 A;  1IXC A;  2D1V A;  2M87 A;  4KJZ A;  3QP6 A;  4G12 A;  3IV5 A;  5JR3 A;  2FD5 A;  4PCQ A;  4KA4 A;  1XGS A;  3MWM A;  2VOO A;  3OL4 A;  1SFK A;  2F2E A;  3CUQ B;  1HLV A;  4II2 A;  4DYC A;  2JA7 J;  1A6Q A;  1Y1W J;  3F22 A;  3BR0 A;  2BZT A;  4I7H A;  4XK4 A;  1ZRF A;  5IYC J;  3KX2 A;  3CC7 I;  2X1C A;  1S8N A;  2KIM A;  3WOD F;  5FD6 A;  1U9N A;  2HKU A;  4QPQ A;  1KU3 A;  2BVM A;  4JOM A;  1UI6 A;  3F8M A;  1S5L C;  1I6H J;  3ABM H;  3N4M A;  2W82 A;  4IHV A;  4E7Z A;  3OS0 A;  1J75 A;  4IRH A;  4BHB A;  5F1J A;  2L5Q A;  3R0A A;  2E2H J;  1IRF A;  1Z6T A;  3KZI C;  1DP7 P;  3EYY A;  2D1H A;  3QQA A;  1ETK A;  2QA4 I;  5C4X J;  3RTR A;  2CW8 A;  2KIF A;  3LSP A;  3H9Q A;  2ZME C;  2UXU A;  1EH6 A;  3S14 J;  2E1O A;  2V7F A;  4C3I J;  3FK7 A;  1K78 A;  4GCK A;  1X1P A;  1HDD C;  4CCK A;  2PN6 A;  1TQP A;  2K5C A;  3GTQ J;  3RYR A;  1IN4 A;  1LB2 A;  1OMI A;  3DKY A;  2DQL A;  2FBQ A;  1U5T B;  2Z1D A;  2BHY A;  2Y48 A;  2MBF A;  2W53 A;  3VEP A;  1KU2 A;  5KNL A;  3JRF A;  3E97 A;  2V9P A;  3CJR B;  3HIM A;  3J81 K;  4XMY A;  3C7J A;  3BQZ A;  4OD4 A;  3E6M A;  2WY7 Q;  3DEU A;  4RGS A;  2XAF A;  3VYU B;  2ZXI A;  1CF7 B;  2ELK A;  2P7V B;  5LEK A;  4JKZ A;  2X51 A;  1QHG A;  1V3F A;  3J7A O;  4FX4 A;  3WE3 A;  4Y3O A;  1Y39 A;  3TMO A;  1RES A;  2Y75 A;  5L3C A;  2ZO4 A;  4YIF A;  3ELK A;  4AD9 A;  3ANG A;  1YX3 A;  3C2G A;  4AVZ A;  4FCY A;  2EBI A;  3FXK A;  5FKK A;  1MJA A;  4PDK A;  3MEX A;  2HQ5 A;  2LBF A;  2ZC2 A;  2CG4 A;  2LNB A;  1SGM A;  2XRL A;  4CIC A;  1S3J A;  3CCJ I;  3OV8 A;  4I02 A;  5E3M A;  2DJI A;  3O8H A;  1EA3 A;  2DA7 A;  4PSX A;  5J1U A;  4A6D A;  1DGW Y;  4LK1 F;  2R7V A;  1Y56 A;  3K4K A;  5KHD A;  4ZZD A;  3BNI A;  2L3D A;  4HAM A;  4E6K G;  3T8T A;  3PQK A;  3H36 A;  3K1N A;  3DU5 A;  3TO6 A;  1O4X A;  5EEH A;  2JRT A;  2G9W A;  3OMY A;  4MK6 A;  5C3E J;  2LR8 A;  2ELJ A;  2IJL A;  2GUH A;  1FT9 A;  3H5N A;  5EZH A;  2Y31 A;  1KGS A;  3P5J A;  5F27 A;  1FTZ A;  1Z21 A;  1Y8R B;  3M3Y J;  3BZK A;  3LSR A;  4J00 A;  3HXL A;  1MZB A;  2ZJQ F;  2R7F A;  3GWZ A;  4EJU A;  1FNN A;  2AS5 F;  3L2W A;  4RAZ A;  3MKZ A;  5H6Q A;  2UXH A;  1N75 A;  2L4A A;  2OUM A;  1TT5 B;  4F52 A;  3CMA I;  2OZ6 A;  3LHQ A;  2YX7 A;  3SZG A;  3K70 D;  4A3K J;  1BI3 A;  4JX5 A;  4U0V A;  2NX4 A;  1W1W E;  3D1N I;  1ZGJ A;  4BJT A;  2DAO A;  3RJP A;  2X6Y A;  4AVP A;  1R49 A;  4X1E A;  4RAY A;  4Y13 A;  3LSG A;  2I5U A;  4RA2 A;  5ILU A;  2IS1 A;  3RI4 A;  2ISZ A;  1F1Z A;  1SFO J;  1JE8 A;  3FIS A;  2DW4 A;  4CYC B;  2IS4 A;  3TO9 A;  1AOY A;  5D5U B;  1IZ1 A;  1YLF A;  4ENK A;  5F64 A;  2GEN A;  2H1K A;  3LWJ A;  4HBL A;  2EFP A;  1FYK A;  2HDC A;  4G7Z F;  1BR1 A;  2XKP A;  4Q48 A;  3JTH A;  4UV8 A;  1YRN B;  2A07 F;  1BIA A;  3HUG B;  2E1M C;  3OYC A;  3VOD A;  2ZXJ A;  2EZH A;  3S1R J;  1QA6 A;  5HSZ A;  1BOB A;  2EIL H;  2M8G X;  3FMR A;  4ON0 A;  1FBU A;  3RQI A;  1MW7 A;  4AUX A;  4ENM A;  3ABT A;  4ME9 A;  1YJN I;  4B47 A;  3QKX A;  1BN5 A;  3LQR A;  1QU3 A;  3GZN B;  5DM6 F;  2DTZ A;  4BE1 A;  3BT9 A;  1DUX C;  4JNN A;  1ETX A;  1IRZ A;  1ODD A;  1X3U A;  1N78 A;  1IG7 A;  4DVY P;  2Z5U A;  3PAS A;  1RPW A;  5B3S H;  2LOO A;  2W7N A;  5CYV A;  5J8C A;  4U0W A;  4LG0 B;  3FDY A;  4UUS A;  5H20 A;  3AG1 H;  3HE0 A;  2W85 A;  2FOK A;  3KP4 A;  4ESJ A;  2VIX A;  5GAH J;  5GPC A;  2JRM A;  4FE4 A;  1OCZ H;  1C0W A;  1IO2 A;  4EEF G;  3P9I A;  2AXT C;  3PUF A;  1MMA A;  3HRU A;  4E4H A;  5KAF C;  3NWS A;  3OOU A;  3OY9 A;  1QZE A;  1JJ8 C;  5K7H A;  1NG6 A;  4L9T A;  3ZN0 A;  3SEZ A;  2TRT A;  5D8L B;  1OPC A;  2KJC A;  2BW3 B;  3AFH A;  3GCM A;  3R61 A;  2V9V A;  3V8J A;  3VSK A;  1CQT A;  3I59 B;  2NP3 A;  2LKX A;  1K79 A;  1SVO A;  2QVO A;  1KQ0 A;  5EGO A;  2ID3 A;  2CJJ A;  5K1Y A;  1D0X A;  5LBQ A;  2OC6 A;  4UB6 C;  1B72 B;  1VQO I;  4FQG A;  1PVE A;  5HS7 A;  5FGM A;  2HVR A;  3I53 A;  2K4B A;  3KYL A;  1FOK A;  4KIS A;  4QWQ A;  3E6B A;  4M3G A;  3GFJ A;  4MTE A;  1QPI A;  3IUV A;  4D0P A;  4EMS A;  1WJD A;  3HTU A;  3SZT A;  2W57 A;  2V1U A;  2O61 A;  2E19 A;  3Q0V A;  1R6R A;  2QKO A;  2DA4 A;  1I27 A;  4IOC F;  2E1C A;  3EGQ A;  2PZ9 A;  1ZAO A;  2MD5 A;  2X4H A;  1GVD A;  1WJB A;  4ZDP A;  1CGP A;  2O7O A;  1T2K A;  4HRI A;  2WWY A;  3A02 A;  1JUP A;  3JSJ A;  1V54 H;  1T38 A;  4KIG A;  5D5X B;  2XB0 X;  5IYB J;  3KYC B;  3VUQ A;  3HTJ A;  1N77 A;  1O3S A;  2CSO A;  2PBI A;  2NVU B;  2DG7 A;  1D0Y A;  3GFL A;  4JBA A;  4HF0 A;  3L1P A;  1BW6 A;  3PIO F;  2V6E A;  3V8L A;  1SEU A;  2JPC A;  2M7B A;  4PFO A;  5IP9 J;  3QPL A;  1TQM A;  2HEO A;  3ABK H;  3S32 A;  2ISY A;  4IHW A;  2RRE A;  3S3M A;  4MEX F;  2CO5 A;  4D7N A;  3V6G A;  1WQ2 A;  4HLY A;  2VJJ A;  1BA5 A;  1I50 J;  2ZJR F;  1FBQ A;  1SFX A;  2KQR A;  4L5E A;  4OIN F;  4D1Q A;  4B43 A;  3OSF A;  1B4A A;  2M3A A;  2B7E A;  1MJB A;  2UV1 A;  3Q0W A;  3CJQ B;  2Y0S N;  4M71 A;  3MKL A;  2P5L C;  4ZH4 F;  1MSF C;  3K8P C;  2MC4 A;  2MYS A;  1SAX A;  4A93 J;  3NNR A;  5GAG J;  1JKQ C;  1YYV A;  2I10 A;  5M3F J;  1GVJ A;  1P2F A;  3I55 I;  1UB9 A;  2DTR A;  4IRI A;  4GXO A;  3BG3 A;  5IP7 J;  1M1E B;  2O5R A;  3TQN A;  1KZH A;  2VKV A;  4R1H A;  2VOP A;  2PLY A;  3G2B A;  5EEA A;  1S7E A;  1FEX A;  4A12 A;  2COB A;  5CW8 A;  4ACI A;  4OOI A;  3VSL A;  1ZKG A;  4IHX A;  4XSZ F;  2EK5 A;  3BG5 A;  1U8B A;  2STT A;  3ML6 A;  1I6X A;  3M07 A;  5LFA A;  3B6C A;  5CVJ A;  5CQE A;  2XGX A;  2TCT A;  1LFP A;  2ECB A;  5DTD A;  5CVI A;  5FLV A;  1T08 B;  3HOV J;  5B5E C;  1RUO A;  3BC8 A;  2M4G A;  3MN2 A;  1XMX A;  3WU1 B;  1K7A A;  2HTJ A;  3TL4 X;  2JTV A;  2LRE A;  3HRM A;  3H3U A;  3EUH A;  3P9C A;  1LEA A;  2K40 A;  3FXU A;  2WV1 A;  1KU9 A;  1IGN A;  4GFB A;  1OJL A;  1SVM A;  2CUJ A;  2VPL A;  1WVR A;  4BYY A;  2BY1 A;  2HYT A;  2DA6 A;  4XQF A;  3F3X A;  1WPK A;  5IOY A;  3RZD J;  4BE2 A;  1U2W A;  3M8F A;  4M6X A;  2PMU A;  1A36 A;  5CQG A;  4NQW B;  1ZAR A;  4C2M J;  4MLO A;  2L7M P;  3JRC A;  2KDZ A;  1ZEL A;  1FBS A;  2H8W A;  2HR3 A;  3PL8 A;  4OIO F;  1R7J A;  3QYE A;  4A3L J;  3SHF A;  3JRI A;  5DD4 A;  3CP8 A;  5TJJ A;  1R5I D;  1D1A A;  3KZZ A;  3NS4 A;  2X6W A;  1TLH B;  2GA1 A;  3K2A A;  4N4O B;  3SEQ A;  1BI0 A;  3WTV C;  3E6C C;  3F21 A;  4BAC A;  5AIP A;  3QPS A;  5C4Y A;  4U9L A;  3BTL A;  1JKO C;  2R7D A;  2ADU A;  3RPQ A;  4HST A;  1MBH A;  2B9S A;  3F9K A;  3AG2 H;  4A3E J;  3FIW A;  3I5U A;  1IV8 A;  2UWM A;  3K4L A;  3BPX A;  3KKC A;  5CJ9 A;  2M8E A;  1VQL I;  1FOY A;  5J3L A;  4P96 A;  3S1M J;  4L9V A;  2OZU A;  3ANP A;  4LD5 A;  1WJE A;  3DKX A;  4MQV A;  3KZ9 A;  2QBY B;  3RD3 A;  2TDX A;  1WGX A;  1T56 A;  1LDD A;  1PP8 F;  1Z91 A;  2WBM A;  1SAU A;  1OYW A;  4L18 B;  3ERM A;  4IRG A;  4HG2 A;  2H27 A;  4RLQ A;  3V42 A;  3EET A;  1P4X A;  4G7H F;  1P6R A;  3LSH A;  2NS7 A;  3VVY A;  2W48 A;  3VW1 A;  3BR6 A;  1YIJ I;  1J59 A;  4GDF A;  2BEO A;  3ABL H;  4XKB A;  1Z7L A;  1YIO A;  2XAJ A;  3CUO A;  2HOA A;  4KIT B;  1WJC A;  5CVV A;  1GXQ A;  4P5O A;  3X2Q H;  2GFN A;  2DDA A;  3K1M A;  2O8K A;  4F3Q A;  2KHM A;  3LFU A;  4F92 B;  1LVA A;  2E60 A;  3V78 A;  4EJT A;  4FT8 A;  2FBI A;  3HKZ A;  4P55 A;  2ICW G;  1MDM A;  3LA2 A;  2HS5 A;  2D2W A;  3OOP A; 
#chains in the Genus database with same CATH homology
 2Y9Y A;  4W1U A;  3WHB A;  3CMY A;  3S5R A;  3CWR A;  1XC5 A;  4V2G A;  5IYD J;  2OI8 A;  1K61 A;  2DA5 A;  1T33 A;  2G0E A;  2E2I J;  1AKH A;  3ON4 A;  2P81 A;  3BR2 A;  1ZGW A;  3RZO J;  4FTH A;  3BR3 A;  2DA3 A;  2LVS A;  4DW6 A;  5EFY A;  1AHD P;  2E2J J;  4XRS G;  1E3O C;  4G12 A;  3IV5 A;  3GTG J;  1TWC J;  2YUS A;  4A3C J;  2FD5 A;  3F0C A;  3ON2 A;  3F1B A;  4RBO A;  3HOU J;  3E7Q A;  1HCR A;  1HLV A;  4DYC A;  2JA7 J;  1Y1W J;  3BR0 A;  4XK4 A;  3JR9 A;  5IYC J;  3HDD A;  1OCT C;  3GBG A;  2EZI A;  1H8A C;  5K58 A;  5M3M J;  1U9N A;  2HKU A;  2MG4 A;  3O60 A;  5M5W J;  3LSJ A;  5E3O A;  5J1Y A;  1UI6 A;  3GTL J;  4UUT A;  4B4C A;  4BXX J;  1I6H J;  1GT0 C;  2K9N A;  1R9T J;  3JRA A;  4IHV A;  5F0H A;  5J1R A;  5F1J A;  5M5X J;  1XS9 A;  2E2H J;  2R0Q C;  4NEL A;  3BCG A;  3FKI J;  3QQA A;  2HOT A;  1ETK A;  1F36 A;  2JK3 A;  2WB1 N;  5C4X J;  1IJW C;  3LSP A;  2UXU A;  3HB9 A;  2XB5 A;  4MFD A;  3S14 J;  3B81 A;  2E1O A;  3C07 A;  2VKE A;  4C3I J;  2HI3 A;  3FK7 A;  3HEF A;  4LOC A;  4GCK A;  1HDD C;  3NXC A;  2YS9 A;  1WI3 A;  3TP0 A;  4A3B J;  4MFE A;  3GTQ J;  2WAQ N;  1MH3 A;  4A3F J;  2K9S A;  2H8R A;  4DZP A;  2FBQ A;  1BJZ A;  4I6Z A;  3MNL A;  3S2H J;  3HGY A;  2W53 A;  3VOX A;  3JRF A;  2QCO A;  3HIM A;  1MH4 A;  5H9T A;  2ECC A;  3HOW J;  3BQZ A;  3TP3 A;  3NI7 A;  2L7F P;  4QIW N;  2LD5 A;  2ELK A;  4JKZ A;  4BKX A;  1JJ6 C;  2LLK A;  2QF7 A;  5F0F A;  3GTM J;  3TW6 A;  2M9H A;  4JP0 A;  2IBD A;  2ZOY A;  1JT6 A;  1RES A;  1JUM A;  3G1L A;  2DMP A;  2CUF A;  2NOG A;  3ANG A;  2XGC A;  4FIS A;  2DN0 A;  3SJM A;  5DAJ A;  2K9Q A;  3BTJ A;  2ID6 A;  2RHA A;  4FCY A;  4JX6 A;  1TC3 C;  1SAN A;  2EBI A;  1TWH J;  1QVU A;  3PM1 A;  5FKK A;  5IP6 A;  3EUP A;  1ZTR A;  1F43 A;  2HQ5 A;  2GBY A;  3OSG A;  2Q24 A;  2VI6 A;  5C44 J;  3QBM A;  2XPW A;  1W0T A;  4A3J J;  1SGM A;  2XRL A;  1VFC A;  2M0C A;  4MXM A;  2MSY A;  1WH7 A;  5E3M A;  3O8H A;  2HDD A;  2QWT A;  5J1U A;  2DA7 A;  3O8G A;  2LK2 A;  3FK6 A;  5GPA A;  2EQR A;  1HDP A;  1JGG A;  3NAU A;  2QOP A;  3KNW A;  4Y52 J;  3BNI A;  2PMZ N;  1PUF B;  5BNG A;  1NK3 P;  4XRM A;  5EYR A;  1UMQ A;  2CUE A;  1A5J A;  1O4X A;  1RKW A;  3HOX J;  4MIM A;  4MK6 A;  1Z0X A;  5IPA A;  2LR8 A;  5C3E J;  1U9O A;  1TWF J;  4B1R A;  2GUH A;  4BY7 J;  1PUF A;  3HOY J;  5EZH A;  1TWA J;  5K7F A;  2Y31 A;  2DA1 A;  2QTQ A;  3RH2 A;  5F27 A;  1FTZ A;  2QIB A;  3M3Y J;  5EF6 A;  3Q3S A;  4Y7N J;  1MBJ A;  3LSR A;  2R7Z J;  4X6A J;  2NS8 A;  2DG8 A;  2G3B A;  5HOD A;  1H89 C;  3ZQH A;  5F08 A;  4UDS A;  2R93 J;  3ZQG A;  4AC0 A;  2UXH A;  2M34 A;  2EZL A;  3LOC A;  3S1N J;  3LHQ A;  4A3K J;  3GTP J;  1OFC X;  5FHP A;  4AF5 A;  4HKU A;  1EF4 A;  4JX5 A;  3CCY A;  4D5C A;  3A01 B;  1B8I B;  2NX4 A;  3D1N I;  5GP9 A;  2IU5 A;  3BR5 A;  3K7A J;  2KT0 A;  4X1E A;  3COL A;  1JUS A;  1XG1 A;  5EDN A;  1ZK8 A;  3LSG A;  2F07 A;  1D5Y A;  3E7L A;  3ZQL A;  1SFO J;  4HNV A;  2NVT J;  2ME0 A;  2FJ1 A;  3FIS A;  4CYC B;  3A01 A;  1B8I A;  3BTC A;  4M3E A;  2JA5 J;  2GEN A;  3IH3 A;  3LWJ A;  4DZJ A;  2H1K A;  3DCF A;  5FMP A;  1GV2 A;  3M4O J;  2X48 A;  2UXP A;  1YRN B;  1JTY A;  1HF0 A;  4A3G J;  1A6I A;  2R5Z B;  3S1Q J;  3WHC A;  1JT0 A;  4D5F A;  1MSE C;  2EZH A;  4CYC A;  3SDG A;  5FKL A;  2JA8 J;  3S1R J;  5HSZ A;  2CQX A;  2M8G X;  1UI5 A;  3RQI A;  4AUX A;  4ME9 A;  2UXO A;  5FKM A;  2WUI A;  2XGE A;  1YRN A;  4UUS B;  2ZCN A;  3HM5 A;  1LFB A;  3QKX A;  2DTZ A;  4JNN A;  3BT9 A;  2R5Z A;  1ETX A;  1IRZ A;  5M5Y J;  1IG7 A;  3PAS A;  1VF9 A;  3BQY A;  1RPW A;  2Y9Z A;  2G7L A;  2FX0 A;  4C3H J;  1DU6 A;  5C4J J;  4IHY A;  4A69 C;  5IOZ A;  4UUS A;  2JA6 J;  3HE0 A;  3P9T A;  1ZQ3 P;  1MBG A;  3I4N J;  5GPC A;  4FE4 A;  2XPU A;  3BTI A;  3VPR A;  4EEF G;  4V2F A;  1GUU A;  1QVT A;  1JJ8 C;  5EGO B;  3OOU A;  2NVQ J;  2FQ4 A;  3VW0 A;  2O9L A;  5K7H A;  1FIA A;  2PBX A;  5E3L A;  3CJD A;  2TRT A;  4XID A;  5FKO A;  2QKO A;  2YU9 J;  4DYR A;  1CQT A;  3BR1 A;  2NP3 A;  2LKX A;  4M3D A;  1MBE A;  3NPI A;  5EGO A;  2ID3 A;  1TWG J;  2CJJ A;  5HAW A;  2LFB A;  3A03 A;  2HXO A;  2DMU A;  3RKQ A;  3JRG A;  3ZQI A;  1B72 B;  3JRB A;  4NDL A;  4QSH A;  3S2D J;  4CGR A;  1IDY A;  1K83 J;  2Y2Z A;  2GM4 A;  4M3G A;  2CQQ A;  2YVH A;  1QPI A;  3IUV A;  1IDZ A;  5D18 A;  3G56 A;  1B72 A;  2X9D A;  1AU7 A;  3B6A A;  2IEK A;  3CRJ A;  2E19 A;  3Q0V A;  1LE8 B;  1OCP A;  2UXI A;  2XSD C;  2DA4 A;  2JWT A;  2JMW A;  1ZR2 A;  3I4M J;  4DYQ A;  2X6O A;  1G2H A;  2PZ9 A;  3EGQ A;  5D19 A;  3CQZ J;  2WGB A;  3DPJ A;  1GVD A;  1P7I A;  5D1R A;  1BL0 A;  3S15 J;  2O7O A;  3G1M A;  1LE8 A;  3VIB A;  1H88 C;  3AQS A;  3IH4 A;  1POG A;  1MNM C;  1JKP C;  3A02 A;  1JUP A;  3HTA A;  3JSJ A;  2XB0 X;  5IYB J;  3VUQ A;  3HTJ A;  1X58 A;  5E3N A;  3VVZ A;  5FKN A;  2VPR A;  3CDL A;  2DJN A;  5JLW A;  1UHS A;  2REK A;  2DG7 A;  3NRG A;  1ZR4 A;  1X2M A;  1BW6 A;  3L1P A;  1MBK A;  1P7J A;  3NAR A;  3GTJ J;  1I3Q J;  5IP9 J;  3QPL A;  2DMQ A;  4IHW A;  2G7G A;  9ANT A;  3HTI A;  2HXI A;  1ETV A;  3PO3 J;  1GDT A;  1FIP A;  2NVY J;  4D7N A;  3V6G A;  4BBS J;  1BA5 A;  1I50 J;  4L5E A;  1NTC A;  3OSF A;  3VW2 A;  3HTH A;  2ME6 A;  2LTP A;  2ZCM A;  4A3M J;  3Q0W A;  5F04 A;  2JJ7 A;  2Y0S N;  4GFK A;  3MKL A;  1MSF C;  3G1O A;  3H3V K;  2ZCX A;  5FLM J;  2B63 J;  1RET A;  4A93 J;  3NNR A;  1ETW A;  2HYJ A;  1JKQ C;  2I10 A;  2OPT A;  5M3F J;  2IAI A;  4A3I J;  4NN1 A;  1WCM J;  2RAE A;  1APL C;  4JX4 A;  4XRS A;  2R5Y B;  4KWA A;  2XPV A;  1HOM A;  1GV5 A;  5AQC A;  3BG3 A;  5DS9 A;  3BRU A;  5IP7 J;  2ZOZ A;  2NP5 A;  2M2E A;  3BJB A;  3HBL A;  2VKV A;  4MO7 A;  3LJL A;  5EEA A;  2R92 J;  1IC8 A;  1S7E A;  1FEX A;  3GZI A;  4YZE A;  2COB A;  2LP0 A;  5CW8 A;  4ACI A;  4PXI A;  2AHQ A;  2L9R A;  1ZKG A;  4IHX A;  3BG5 A;  1U8B A;  3KKD A;  2R5Y A;  2XGD A;  2D6Y A;  3PPB A;  1Z77 A;  3B6C A;  2AO9 A;  4FE7 A;  1MBF A;  2TCT A;  2YVE A;  2ECB A;  5DTD A;  5FLV A;  3T6N A;  3HOV J;  3ZQF A;  3LNQ A;  3ZQC A;  3MN2 A;  4XIC A;  2OER A;  4W97 A;  5CXG A;  3JRH A;  4GFL A;  2Y30 A;  2K40 A;  4M3F A;  3H0G J;  2WV1 A;  1IGN A;  2D5V A;  4GFB A;  2EZK A;  1OJL A;  1W0U A;  1FJL A;  4A3D J;  1ITY A;  4D7M A;  3FRQ A;  2OF7 A;  2DA2 A;  1Q1V A;  5FJ8 J;  2EH3 A;  1U78 A;  5JLX A;  1ENH A;  3JRD A;  4M6V A;  2HYT A;  2DA6 A;  2VUM J;  1ETQ A;  1JTX A;  1ETO A;  3OIO A;  1WPK A;  2CRG A;  3TW7 A;  5IOY A;  3RZD J;  5EZG A;  3PO2 J;  2HOS A;  3BG9 A;  1VI0 A;  4C2M J;  4MLO A;  2L7M P;  3JRC A;  2KDZ A;  1DU0 A;  1IUF A;  3C2B A;  4A3L J;  3BHQ A;  3JRI A;  2DMT A;  3S17 J;  2V57 A;  3AQT A;  4B3A A;  3ZOB A;  1UG2 A;  4ICH A;  3K2A A;  4GCL A;  3GEU A;  2DMN A;  4S0H B;  1JKR C;  2NVX J;  1Y1V J;  3QPS A;  5C4Y A;  1BW5 A;  3BTL A;  1JKO C;  4C3J J;  1QRY A;  2GLO A;  1ETY A;  2CU7 A;  2L7Z A;  3GTO J;  3GTK J;  3DEW A;  1MBH A;  3JRE A;  2G7S A;  3MVP A;  4A3E J;  3FIW A;  4M3B A;  4J19 A;  4AYB N;  2MW8 A;  3IH2 A;  1NK2 P;  4QTR A;  5F0C A;  4I76 A;  5K7Z A;  4RDU A;  1LFU P;  3KKC A;  3VVX A;  5J3L A;  4GCT A;  3S1M J;  3TED A;  2RAS A;  4BY1 J;  2XDN A;  3SFI A;  2LY9 A;  1X2N A;  3ANP A;  5CXI A;  1WH5 A;  3KZ9 A;  3RD3 A;  4BBR J;  3W6V A;  3HGG A;  1WGX A;  1T56 A;  5EG0 B;  4JYK A;  4L62 A;  4IEJ A;  3Q0U A;  2NS7 A;  5HBU A;  3VVY A;  2W48 A;  3HOZ J;  3VOK A;  3VW1 A;  3BR6 A;  2L0K A;  3VP5 A;  4ABZ A;  2HOA A;  5EG0 A;  1ORK A;  2JN6 A;  3S16 J;  2O7T A;  1IV6 A;  1VND A;  1RKT A;  5FGL A;  3UKG A;  2GFN A;  2O8K A;  4JL3 A;  1AKH B;  3V78 A;  2ZB9 A;  1FTT A;  3G7R A;  3HKZ N;  4AC6 A;  1RR7 A;  2MGQ A;  2N8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...