2HQ5A

Crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multidrug-Binding Transcription Factor QacR Binds the Bivalent Aromatic Diamidines DB75 and DB359 in Multiple Positions
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hq5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hq5A02
3NAUA 2ID6A 5IYDJ 2QIBA 4L62A 1WH5A 5FLMJ 1UI5A 3S1RJ 3P9TA 3VP5A 4AF5A 4FCYA 2YS9A 5J1YA 5F1JA 4S0HB 3OOUA 2OERA 1JUSA 5JLWA 1BW5A 1TC3C 1F36A 2Y0SN 2HOAA 3IH2A 4W97A 3ZQGA 4IHXA 2LFBA 2W48A 3IH4A 2R0QC 2R93J 2EZIA 1APLC 4JX6A 2NP5A 4D7NA 3UKGA 1WI3A 3JRIA 3IUVA 4ABZA 5IYCJ 4MFDA 4IHVA 2G7LA 5AQCA 3IH3A 5M5YJ 1XC5A 2K40A 5K7ZA 1HDPA 3B6CA 1Y1WJ 2CJJA 3OSGA 4JX4A 3WHBA 1ETQA 4MK6A 4HNVA 1VI0A 5FKKA 1D5YA 3QPLA 2OI8A 3KZ9A 2ECBA 2I10A 3BRUA 3QKXA 2XRLA 3E7QA 3BQYA 3CRJA 1VFCA 2K9SA 2X6OA 3ANPA 2O7OA 1LFBA 1JJ6C 3Q0VA 2HDDA 1S7EA 2NVYJ 2X48A 3LSRA 1VF9A 2E2JJ 1MBGA 3CJDA 4MO7A 3TW7A 3FIWA 3FK7A 1ZGWA 2ZCNA 2L7FP 4UUTA 5K58A 3BT9A 4Y52J 1UMQA 1CQTA 5DTDA 4JL3A 3RZOJ 1TWGJ 3BJBA 3GTGJ 5IOZA 3GTPJ 2OPTA 2EH3A 3NRGA 3BG3A 3LJLA 4XK4A 3ZQCA 1BJZA 2XGDA 3BR3A 1JUMA 2LK2A 3LSPA 1OFCX 5C4YA 2DA7A 5EZHA 2GFNA 3BTJA 3NARA 2FQ4A 3T6NA 1H89C 1JT0A 2LTPA 1Z0XA 1LFUP 1YRNB 5FHPA 2DMPA 5FKMA 3VVZA 3VW2A 3CCYA 4XICA 3HGGA 4A3MJ 3MKLA 1QRYA 5J3LA 2GBYA 3JRDA 2KDZA 1F43A 2CUFA 3PASA 1PUFB 4HKUA 5E3MA 2L0KA 2COBA 3HM5A 2JA8J 1T56A 5EGOB 4CYCA 4FTHA 4RDUA 3EUPA 1AHDP 3S1NJ 4DZJA 1HLVA 1ETOA 3I4MJ 3QBMA 1MBKA 5FGLA 2M34A 5M3FJ 5FLVA 2JA6J 4GFKA 4UUSB 2R7ZJ 2ELKA 3S1QJ 1WCMJ 1POGA 4I6ZA 1IC8A 2M0CA 4M6VA 4ME9A 1I50J 2D5VA 2MGQA 5D1RA 2IU5A 2YVHA 2DMQA 3S15J 2JJ7A 5BNGA 1IRZA 3BTLA 1GVDA 5IPAA 1B8IA 1RETA 3RD3A 4D5CA 4DZPA 3SFIA 2O8KA 2NVQJ 5DAJA 5EFYA 2EZKA 3S1MJ 4G12A 3FKIJ 2LLKA 5FKLA 4BY1J 2NVXJ 4A3FJ 1B72B 3V78A 3MVPA 2O7TA 2DA2A 4NELA 2JK3A 3RQIA 4X6AJ 2CRGA 3HDDA 2N8GA 1PUFA 2XPWA 4KWAA 3W6VA 3S14J 2ZOYA 2DMUA 2LP0A 3CQZJ 1LE8B 1B72A 2NVTJ 2LR8A 1FTTA 2VPRA 2Y2ZA 5M5WJ 1JKQC 1W0TA 4AUXA 3HTAA 1DU6A 1E3OC 1EF4A 1T33A 2NOGA 3VPRA 2DTZA 3TP3A 2UXPA 3A01B 5F0FA 1QVTA 1ETWA 1GV2A 2HQ5A 5F27A 2JA5J 1MBHA 3JRFA 1TWHJ 2M2EA 3NPIA 4A93J 3K2AA 2DG8A 3F1BA 2G0EA 4UUSA 3HOXJ 1P7IA 4BBSJ 2XGEA 3G1LA 1W0UA 2DA4A 4XRMA 1MBJA 1TWCJ 2ME0A 1JJ8C 1MBEA 3HBLA 2ZOZA 3DPJA 3C07A 2XPUA 3S2DJ 3A03A 3QQAA 3MN2A 5IOYA 1U9OA 1R9TJ 3LSJA 2Y30A 3QPSA 2R5ZA 1JTYA 1K83J 2RHAA 2D6YA 1IUFA 1VNDA 3C2BA 3BR5A 2HOTA 1OJLA 1TWFJ 2HXOA 3M3YJ 2WV1A 3VIBA 5F08A 3JSJA 5D18A 1FEXA 2GUHA 5EG0B 4GCTA 2E2HJ 5D19A 5EYRA 1H8AC 2GM4A 2EZHA 5C44J 3NI7A 4A69C 3VOXA 3Q0WA 5HBUA 3G1OA 1HF0A 3BQZA 4C3IJ 5K7HA 5J1RA 1MSFC 2H8RA 4IHWA 4UDSA 4A3LJ 3JRGA 2MW8A 5H9TA 3SDGA 3O8GA 1TWAJ 4C3HJ 3FISA 4I76A 5FJ8J 3VW0A 4ACIA 5IP6A 2HYTA 3TP0A 1GV5A 3ZQHA 2F07A 3GTQJ 2G3BA 2Y31A 2FJ1A 1OCPA 4A3EJ 4V2GA 1HDDC 2YU9J 5C4XJ 3HTHA 3HB9A 5FKOA 3MNLA 1IDYA 5FMPA 1RPWA 3BTCA 4AC6A 4PXIA 2IBDA 1MNMC 1ZR4A 3KNWA 4M3EA 1SANA 1WH7A 4B3AA 2WGBA 2R92J 2UXOA 2ID3A 2AHQA 4BXXJ 3CWRA 4XRSG 3E7LA 1ITYA 2MG4A 4BKXA 1OCTC 5DS9A 5IP9J 3HE0A 2RAEA 2VUMJ 2IAIA 1BA5A 3ON2A 2NS7A 3RH2A 1RR7A 3VW1A 3EGQA 2TCTA 3RZDJ 4W1UA 2DMNA 2L7ZA 1MSEC 2DG7A 3CMYA 3ZQLA 2XB5A 2XSDC 3BNIA 2E19A 1UHSA 2DA6A 3BG9A 3B81A 4DW6A 2FBQA 3GEUA 4YZEA 5HODA 4DYQA 3WHCA 3F0CA 4GFLA 3DCFA 1X58A 3ZOBA 2JWTA 1ZK8A 3HGYA 4FE7A 4QTRA 4A3GJ 2HYJA 1BL0A 2QKOA 1MBFA 4C2MJ 3G7RA 4J19A 2EQRA 5F04A 5IYBJ 3I4NJ 1QPIA 3HKZN 4D5FA 3OSFA 4GCLA 1I6HJ 1O4XA 2CQQA 2QWTA 3CDLA 4FISA 2PMZN 1U78A 3NNRA 2H1KA 4BBRJ 1IG7A 3PO2J 3GTKJ 5GPCA 5HAWA 2VI6A 3H3VK 3KKCA 2LD5A 2HI3A 2LVSA 1JTXA 2JMWA 3VOKA 3HEFA 4GFBA 1FIAA 1ETYA 1BW6A 1Y1VJ 1ZKGA 3DEWA 1GT0C 2HKUA 3O8HA 3BG5A 5HSZA 4A3IJ 2G7GA 1XS9A 3BCGA 3TW6A 2JA7J 5IP7J 4MLOA 4AC0A 2UXUA 4NDLA 3BTIA 3PO3J 1FTZA 1FJLA 1SGMA 2PBXA 4A3DJ 3COLA 1Z77A 2ME6A 2ECCA 4JKZA 2XPVA 1IDZA 5GP9A 2O9LA 2G7SA 2GLOA 4A3BJ 2VKVA 3ANGA 1XG1A 5M5XJ 1JKPC 4C3JJ 1JT6A 2B63J 3BR0A 4D7MA 3LSGA 3A01A 4MXMA 1NTCA 4A3JJ 3M4OJ 2AO9A 3LNQA 4L5EA 4GCKA 3AQTA 1A5JA 1NK3P 3G1MA 1UG2A 3LHQA 3VVYA 2E2IJ 3SJMA 1AKHB 1IV6A 2ZCMA 2IEKA 1JGGA 4M3BA 3TEDA 2YUSA 3JRHA 5CXGA 4EEFG 3S2HJ 2K9NA 3GBGA 2GENA 1WGXA 1MH4A 9ANTA 2DA1A 1JKRC 3GTMJ 1G2HA 1X2MA 1MH3A 3A02A 2QCOA 3NXCA 4NN1A 4JYKA 3BR6A 5JLXA 1ZTRA 1FIPA 2L9RA 4DYRA 2MSYA 2R5ZB 2NX4A 3O60A 2L7MP 3LOCA 3S17J 4JX5A 1H88C 3GTOJ 3PPBA 5E3OA 3D1NI 3FK6A 4RBOA 3L1PA 2V57A 1ETKA 2W53A 5EF6A 3RKQA 2P81A 3AQSA 4X1EA 5FKNA 2JN6A 1RKTA 2R5YA 2QOPA 1UI6A 2Y9ZA 3Q0UA 4M3GA 2PZ9A 1QVUA 3HTJA 1RKWA 2M8GX 1SFOJ 4MFEA 1K61A 1DU0A 3PM1A 5E3LA 2DA3A 4A3CJ 1I3QJ 3BR2A 2X9DA 4CGRA 5EG0A 2VKEA 3JRCA 2Q24A 2NP3A 4XIDA 3OIOA 3ON4A 1AKHA 2DN0A 4DYCA 3H0GJ 5EDNA 5EGOA 4CYCB 4JP0A 3KKDA 2Y9YA 2XB0X 3K7AJ 5EZGA 3HOWJ 2ZB9A 3LWJA 4AYBN 1WPKA 5K7FA 4M3FA 3HTIA 1RESA 4IEJA 5J1UA 2QTQA 2XDNA 4QSHA 1U8BA 2CQXA 4QIWN 3HOZJ 1ETXA 1JUPA 4A3KJ 2CUEA 1HCRA 2E1OA 2LKXA 2QF7A 1ORKA 3S16J 1A6IA 2YVEA 2K9QA 1X2NA 1IGNA 1U9NA 4V2FA 2FX0A 3S5RA 2XGCA 4Y7NJ 3B6AA 1GUUA 3HOVJ 3VVXA 1IJWC 2WUIA 1P7JA 3HOYJ 1B8IB 5C4JJ 1ZR2A 2REKA 1AU7A 5E3NA 2R5YB 3JREA 3VUQA 5M3MJ 2FD5A 2NS8A 2EZLA 1Q1VA 2HOSA 2RASA 2EBIA 2CU7A 2LY9A 3HIMA 4MIMA 5F0HA 4IHYA 5EEAA 5F0CA 5CXIA 1HOMA 2UXHA 3BHQA 1YRNA 1ENHA 2WAQN 3ZQFA 1JKOC 2DA5A 1NK2P 1LE8A 2DJNA 4XRSA 3JRAA 4ICHA 2HXIA 3G56A 2OF7A 1ZQ3P 2UXIA 4LOCA 3Q3SA 2DMTA 4B4CA 1GDTA 4M3DA 3JRBA 2TRTA 3FRQA 3GZIA 3V6GA 4JNNA 5CW8A 4FE4A 3GTJJ 1ETVA 5C3EJ 3JR9A 3BR1A 4B1RA 2ZCXA 3IV5A 2KT0A 3GTLJ 3ZQIA 4BY7J 2M9HA 3HOUJ 2WB1N 5GPAA
chains in the Genus database with same CATH superfamily
1RZ4A 1W7PD 2ID6A 3ZCOA 4LB5A 2QIBA 1YW8A 2CV0A 4IHWA 3FF5A 3PL8A 2X1EA 4C30A 3VP5A 4BQQA 5LEJA 3K6GA 1T39A 2ZFWA 2FBKA 3HHHA 2OERA 1SVOA 2YX7A 2CGPA 2MC3A 1LVAA 1P4AA 4G6DA 5JLWA 2ISZA 2ZJPF 2Y0SN 3OOPA 2HDWA 4W97A 3DPUA 3RKXA 4A0XA 4HF0A 2LFBA 3G4SI 2EZIA 2OD5A 3I3LA 4ENMA 3CCSI 1V4RA 2CG4A 2NP5A 1SAUA 4BE1A 1A31A 3JRIA 2V1XA 4UV8A 1R7JA 4IHVA 2X6WA 4A5NA 2BEOA 4WXDA 2VC1A 1PUEE 3OYAA 3M1EA 5M5YJ 2K40A 1XMKA 2FF4A 3S2WA 2EV5A 3WHBA 3OYFA 5FKKA 1OCOH 3QKXA 5E17F 2M1BA 2RQQA 3BQYA 3CRJA 2K9SA 2X6OA 1UJ8A 5CJ9A 1DDNA 3Q0VA 2HDDA 2WY7Q 5D5WB 2X48A 1VF9A 2E2JJ 1MBGA 4I7HA 1FWZA 2K4BA 3PFIA 3V8JA 1ZGWA 2QENA 2P6SA 4HDUA 4Y52J 1UMQA 3GF2A 1CQTA 3HTUA 1J09A 4QPOA 4JL3A 1TWGJ 2GXGA 3ELKA 2JQ7A 1KA8A 1K6YA 2JTVA 3NRGA 4ZYAA 3OYCA 2XGDA 1QA6A 3ZMUA 4YRVA 1JUMA 2LK2A 1OFCX 2DA7A 1OYIA 4EMSA 4BDZA 2GFNA 2EA2A 2JPBA 2JSPA 5BMZA 3DEEA 1VQPI 4HQEA 5L3DA 2PX9A 5FHPA 3FWEA 1MW7A 3CCYA 5K5OA 3HGGA 2F5FA 2XF5A 3V7CA 1TQIA 4RGSA 4Q5SF 4ZJZA 3T0YA 3J80K 4EATA 2COBA 3HM5A 4PDKA 3FXJA 1VQ7I 4FTHA 1Y8RB 3CF5F 1X1CA 3BPXA 4XSZF 3FXOA 3T1BA 1G6NA 1IF1A 3QBMA 1MBKA 5FGLA 3ULQB 3J7AO 4GFKA 3PNVA 4S04A 3A4CA 2DXIA 5L3CA 1WCMJ 1POGA 1J7KA 4I6ZA 1BR4A 1LPQA 1I50J 2LSOA 3KP3A 3GW2A 2IU5A 2DMQA 3K70D 1XSXA 1B8IA 1YJWI 3OIPA 2LH9A 4D5CA 4DZPA 3SFIA 3CCEI 1FC3A 3LMMA 4G12A 5FKLA 5BPDA 2LF8A 3U21A 3L9FA 2KLOA 3ABTA 3BROA 4A3FJ 3ZQQA 2EV0A 3MVPA 5A2QZ 6PAXA 3HHGA 5HDGA 4RGXA 3TO9A 2CRGA 2QBYA 2XSJC 1PUFA 4YIRX 3OV8A 4RB1A 3WTVC 2LP0A 4G7OF 1B72A 4CZZA 2L9VA 3QPHA 3EYIA 2A3SA 2VPRA 1ON1A 5M5WJ 3TOAA 3NWTA 2WTEA 2ZXWH 2KFDA 4UV9A 2L9SA 2LOOA 3CZ6A 2JVGA 1ETWA 3FM3A 1RUOA 2HQ5A 2QYOA 2HYFA 4CCJA 3OS1A 3D5RC 1R49A 3CCVI 2GIZA 3NPIA 5DCFA 1K4TA 2HFHA 4M71A 4M72A 3I59A 4RB2C 3AG4H 2DYSH 1L3LA 2AXTC 1MIJA 2XGEA 3G1LA 1TP4A 2VONA 2JSCA 2WAEA 5HDNA 3A03A 2HZTA 1U9OA 4I2OA 2EPFA 4KMFA 4M74A 4HF2A 2RHAA 4XLEA 4BAYA 3JSOA 1H0MA 3BR5A 2CV2A 1GLNA 4AIDA 1TWFJ 3WGHA 2HXOA 3PNTA 2WV1A 3JSJA 4JBAA 1FEXA 1XMAA 5EG0B 4N0BA 4EJVA 2FBIA 2VJ4A 2NXNB 4ZDLA 2FA5A 4XKWA 3VOXA 3KETA 2BZTA 3KP5A 3Q0WA 3CP2A 3G1OA 1HF0A 4C3IJ 2HTSA 2HEOA 3KEYA 3EETA 4NB5A 3JRGA 1SD4A 5D5VB 2MW8A 2EIJH 4MTDA 4C3HJ 4FX4A 1WJBA 2BGCA 4XOTA 3FISA 2M3AA 4I76A 4RGUA 5IP6A 3BOQA 3WE2A 1MJBA 2QM3A 2R3SA 2G3BA 2JZYA 2FJ1A 3U1KA 1YO5C 4RM3A 4V2GA 4IHTA 2IS6A 4O6JA 2YU9J 2Z3YA 5HS7A 3CUQC 5ILSA 4AYBA 3OYLA 4PXIA 2ZMEB 1YI2I 2IBDA 1IUYA 4CXFA 1MMSA 2FNAA 1SANA 1XMXA 1FYKA 3F9KA 2VJ5A 4ZH4F 2PMUA 2RVCA 4PSWA 1PP8F 5BPIA 3AFHA 3HOTA 3E7LA 4KT6A 1BR2A 1LEAA 1OCTC 5DS9A 1I1GA 2A5YB 1Y56A 3RH2A 1RR7A 2WWYA 1R1UA 4CCNA 2VASA 4CH7A 3EGQA 2K27A 2TCTA 1R1VA 2HYGD 3K0LA 2V9KA 1B1BA 2DMNA 3HRSA 2L7ZA 2YSRA 3QYBA 3MKWB 4PJ0C 3CMYA 2Z33A 2XB5A 3I71A 2XSDC 1S7AA 2PBIA 2R7DA 4IQJA 3BG9A 5B1AH 1JXSA 2FBQA 4DYQA 1VQ5I 4ZDOA 3IWZA 2BW3A 2OU2A 4KFCA 3HGYA 4A3GJ 2BY3A 2HYJA 5LBQA 3GEZA 4U87A 2DI3A 2K85A 3QOPA 2GA1A 4KITB 4J19A 5DM6F 1OMIA 3MQ0A 2DDAA 1LQ1A 2ISYA 3F8MA 4YEJA 4D5FA 3OSFA 1M1EB 2YU3A 1O4XA 2CQQA 2ZXHA 4XLHA 2KKOA 1FZPB 3E6CC 4XKVA 1Y8QB 3BJOA 1U78A 1ODDA 1TZLA 2PMZN 3F6VA 3NNRA 3PSFA 5KVRA 2H1KA 3PQKA 1HC8A 4Q47A 2HI3A 5GAGJ 5DCMB 2KZVA 2R7FA 2OQGA 1ETYA 1BW6A 2EFPA 2WB1A 3ZMSA 1BM9A 3TBIA 3J7ZI 3BG5A 2V1UA 4MQVA 3VTIA 1MNEA 2E36A 1YW9A 2BXZA 2G7GA 1DGWY 3BCGA 4MLOA 5D6FA 4BU2A 3ML6A 2QBYB 2PBXA 4L9NA 4FQGA 2M45A 1K7AA 4JKZA 5D5XB 5FD6A 1IDZA 1JGSA 4BXUA 2O61A 4GO1A 5M5XJ 2B63J 3CLQA 4ZTJA 3A01A 4MXMA 2E5NA 3M4OJ 2PG4A 1Z67A 3I54A 2XAUA 4L5EA 4WXHA 5DYMA 3G1MA 2DYRH 1S9HA 2EB7A 3LHQA 3VVYA 3WE3A 2A5WA 3SJMA 4UXNA 4IPAA 3C3WA 4M3BA 2WA0A 1XSDA 3JRHA 1HSJA 2Y75A 3LSKA 4AIKA 4X0GA 1J5YA 2ZMEA 4UVBA 4QLCU 5JVTA 1MH4A 2IGOA 2DA1A 2OTJI 1UHWA 3A02A 1X2MA 2QCOA 4P5OA 2HWVA 1QZZA 2L3DA 2X6YA 1FIPA 1I1SA 2MSYA 2R5ZB 3O60A 2L7MP 3LOCA 3S17J 2RGVA 1H88C 1K79A 2XUBA 3ZRGA 2EFWA 2RN7A 2V57A 2M30A 2MFZA 1BI3A 3IL2A 3CDHA 3F72A 2Q1ZB 4BE2A 1O57A 2LKSA 5L3GA 4IKFA 1SFOJ 2FUG2 2MH9A 2ZC2A 3KLNA 5HNFA 1K61A 1D8JA 2DA3A 3BJ6A 2X9DA 4M9SA 1V55H 5EG0A 2VKEA 2Q24A 5EGOA 4CYCB 4JP0A 1UFMA 2QQ8A 5CYVA 1SD7A 5KHDA 3F23A 1QO0D 5EZGA 2ZCWA 3LWJA 4AYBN 1WPKA 3IP4B 4IZZA 2ELJA 1RESA 4IEJA 2RC4A 3GCMA 1SMTA 1U8BA 3EDPA 1ETXA 3A2KA 1TNSA 2HVSA 3VOEA 3ABMH 1A6IA 1R22A 3BC8A 5GAHJ 3CCQI 3DLAA 4V2FA 1P2FA 4LG0B 1W5CC 3S5RA 2GIVA 2NVUB 2XGCA 3MWMA 4HX7A 4Y7NJ 1JHHA 3B6AA 1P6RA 2VLAA 2K9LA 1P7JA 4P1WA 5A2QK 3HOYJ 2WUIA 5C4JJ 2PJRB 3LQQA 4B3XA 3SZTA 3H5AA 4KYWA 2P6TA 3VUQA 3ABKH 4G9YA 1W1WE 4BHCA 2RASA 4EJUA 4MIMA 3DEUA 3J81Z 1PVEA 3DTKA 5F0CA 2FU4A 4YFNF 3PUBA 1FBUA 3ECHA 1X1DA 3VEPA 2H6CA 2DA5A 3NQOA 2RKHA 1ZRCA 2DJNA 4IL6C 3JRAA 1RRJA 4ICHA 2F4MB 1ZQ3P 2UXIA 3AL0C 3Q3SA 3HIFA 1R00A 1FSEA 3JRBA 1EV7A 3FRQA 4CICA 3ZGKA 4WXCA 3GZIA 4UB8C 4JNNA 4F52A 2XHKA 3GLLA 3VYTB 3RCOA 3JR9A 1GHCA 1OCZH 2ZCXA 4E7ZA 3J80Z 1TNTA 1ZYRF 3IV5A 3GTLJ 3PQJA 5E20A 4A6EA 1F5TA 3DBLB 1YQAA 4PZJA 2XVCA 3L7WA 3DKWA 1W5SA 3HOUJ 3V7RA 2EA4A 2Y0SA 5GPAA 1Z6TA 2MLGA 1X1AA 4LLLA 2L02A 4L62A 3KZYA 1W36C 3P9TA 2D45A 2BVMA 2X51A 4CZCA 4BXFA 1HSTA 4E7HA 1ZLKA 3L2UA 3IAS2 3QPTA 3P9IA 2E1MB 2ZSIB 2M87A 2KMUA 4V19K 4RA2A 1MJ9A 3SDBA 2HOAA 4LB6B 5AONA 3J7YJ 4OWRB 3CP8A 2QQAA 3IH4A 3LFUA 3RIRA 1APLC 4G6QA 4A6DA 4D7NA 3DTIA 3UKGA 5DD4A 4P55A 5FD5A 4MFDA 5IYCJ 1JE8A 1DP7P 3DKYA 2G7LA 5AQCA 2H27A 1LDJA 4E7SA 4EJTA 3SYTA 2CV1A 2X0LA 1WRJA 1HDPA 5DV5A 3T5XA 3OY9A 3OSGA 2CUZA 3LA2A 3I55I 5CKTA 1ETQA 4L0ZB 4MK6A 3U2RA 4BGDA 3IKTA 2HVQA 3QPLA 2OI8A 3KZ9A 2ECBA 4U9LA 3WTTC 4FETA 4Z2YA 4A12A 5CPRB 1R23A 1VFCA 2GA2A 1VZ0A 1QPMA 4KICA 5LLQA 1S3JA 2F5DA 1CF7A 1S7EA 2NVYJ 1XGNA 4HAMA 3GZ5A 3H35A 4MO7A 1U0JA 1EKEA 1UZCA 4XRFA 4OIOF 2BBYA 1H9TA 5DTDA 1PDNC 3RZOJ 3BJBA 3GTGJ 5IOZA 3ZMVA 2FJI1 5D5UB 3BG3A 4XK4A 3ZQCA 1FT9A 4DQ2A 1BIBA 1P9QC 2QKMB 3BR3A 4OOIA 3RDIA 1LUJB 1S72I 5EZHA 1EJ9A 3BTJA 2Z9OA 3NARA 3MEXA 4LIVA 3T6NA 4U7DA 1DPRA 2K02A 4JOMA 4PGGA 2LTPA 3PSIA 3V42A 5FLXZ 4OIQF 1XD7A 1XSVA 4XKBA 4R1HA 2XGXA 5L3FA 4U9NA 5J3LA 5HS9A 1Y0NA 4CCLA 4BYYA 1CGPA 4XLAA 5J47A 2A69F 3RQ4A 4HKUA 2KHMA 2L0KA 2JA8J 2OUMA 2XAGA 2HQRA 2ZNYA 2FXAA 1B59A 3HPGA 1AHDP 2ELHA 5J4VA 2VC0A 5LFAA 4ZZLA 3Q5FA 1HLVA 3I4MJ 2Y69H 3UNGC 1BC8C 2E35A 5M3FJ 1NG7A 3Q9SA 3WG7H 3I9V2 3S1QJ 2BY0A 2CQKA 2GWRA 1Z6RA 4ME9A 2MYSA 3SEZA 3ABUA 4M73A 4MEYF 2D5VA 2IRFG 2WY8Q 3H9GA 5BNGA 5ILUA 5IPAA 1GVDA 1I39A 3OYBA 2FQ3A 4L5JA 5IT9Z 2MH2A 4BY1J 4WX9A 4HZFA 1B72B 3V78A 3IRQA 3MKZA 1BN5A 2DA2A 3TGNA 3BLYA 4ASNA 3CCUI 4NELA 3RQIA 1U3EM 2N8GA 4RAGA 2XPWA 4P9UA 4KWAA 2ZOYA 3HUGA 2DMUA 1V54H 3CQZJ 3FHNA 4WWCA 4R79A 3TMOA 2MD5A 3NS4A 3FXLA 2LR8A 3E5XA 1FTTA 1JKQC 5CQEA 5LHHA 3HTAA 4NC6A 3JTHA 1EF4A 3BPVA 1T33A 2BY1A 2BYVE 2DTZA 3RYRA 3TP3A 5DM7F 5F0FA 2O03A 1OR7C 4XR6A 4AVPA 1MMNA 4A93J 3K2AA 1JI8A 2G0EA 3DV8A 3F8FA 2E7XA 2IGMA 1E17A 3GVAA 3K10A 3EPZA 1W0UA 3L2WA 3E0JB 1MBJA 3N4MA 1TWCJ 2ME0A 1JJ8C 2DODA 5DCMA 2V26A 1FYLA 3HBLA 2ZOZA 3I59B 3S2DJ 5IOYA 4FX0A 5HS8A 3LSJA 4EGZA 1FMWA 3ONQA 1QHGA 1LB2A 4WK8F 1S6LA 2W24A 2HOTA 2Q0OA 4U0YA 3WTYC 5D18A 4RM2A 4AIJA 4GCTA 2OCEA 2IA2A 1WJFA 1ZGAA 4CUGA 1V5EA 1H8AC 2EZHA 3NI7A 4A69C 2ZFUA 5EEGA 2OAZA 1LNWA 1WJEA 4E7IA 1U8RA 3BQZA 5J1RA 3HJEA 4RLFA 2MABA 2O5RA 4KT5C 4RAYA 2VXDA 3ERED 4PGHA 3U1DA 1U5TA 1XCVA 1T0FC 4II2A 3O8GA 2LY1A 4KDPA 2AQFA 2Z5UA 4HQMA 5TGTA 3K4KA 2KIQA 2H94A 2UZKA 1WHUA 4ACIA 4M6XA 4XN0A 5D4RA 1S5LC 5B3SH 1BBYA 5E8GA 4KIBA 2DPDA 3M07A 4NUBA 2X6XA 3HB9A 5FKOA 1F1ZA 4BQOA 2BHYA 4F55A 1ZR4A 2A2FX 4E7LA 4DBRA 3KNWA 4M3EA 3OS0A 3OYJA 2WAFA 2LNBA 3CLOA 4B3AA 4M9ZA 2CFOA 2ZKZA 2CQ7A 2ID3A 2KRCA 2AHQA 4BXXJ 2XAJA 4XRSG 1XPXA 1LJ9A 1NHAA 2ACJA 2COMA 1ZN2A 4IVNA 2VUMJ 2IAIA 4KUMA 3ON2A 3VW1A 2V9PA 2RREA 1ACIA 2V1DA 1K78A 3M8FA 4HRIA 1IAWA 2DOAA 3K4LA 3SFZA 1O7FA 3M8JA 2LG4A 2CQNA 1ON2A 1YW7A 3ZQLA 1UHSA 2DA6A 2O0YA 3GEUA 4DW6A 4YZEA 5HODA 3F0CA 1K4SA 1HW2A 3ZOBA 3RSNA 4FE7A 3K4JA 4QTRA 2I5UA 4EVIA 2HPIA 3ZMDA 2QKOA 4RMNA 4C2MJ 2M8EA 1R71A 2KRFA 3S3OA 3VYUB 4EJOA 2X1CA 1EH7A 3HKZN 3ZQ7A 3CCLI 2HOEA 5AIPA 3OL4A 1UAAA 2RDPA 3CDLA 3OL3A 1IRGA 1U6GA 2GZWA 2EFQA 5D8LB 2IS2A 2XDVA 2HQAA 1IG7A 3PO2J 4M6YA 1WZ2A 3GTKJ 4MTEA 5HAWA 3OYIA 2LD5A 5ED4A 1SD6A 1JTXA 2JMWA 4I01A 3VOKA 3K4BA 3LL7A 4BHBA 1GT0C 4HBLA 2PJRA 2HKUA 5DDGA 3BZKA 3LSMA 1R4MB 1IO2A 3MFKA 1RC9A 1Y39A 1FYMA 2JA7J 3GFLA 2DO7A 5IP7J 4HG2A 4LLNA 4AC0A 1WVRA 1YTYA 1E3HA 4NDLA 3CJQB 3DBHB 2W85A 4ZYDA 1FTZA 1ZG3A 2KIMA 1T2KA 1A35A 3HOSA 2ME6A 2ECCA 2XC7A 3LSHA 4ESJA 2OA4A 3WTSC 2PMHA 2VKVA 4AD9A 1TT0A 1JKPC 3LAJA 3CUQB 1KQ0A 1P4WA 5LGNA 2P4WA 3DFGA 3LSGA 5FRMA 1QQIA 1S7OA 1VQ8I 4NHJA 1A5JA 4YFKF 5B5EC 1NK3P 4LFUA 1UG2A 1IV8A 3HSFA 2W4SA 4PFPA 2J5PA 3MZHA 1AKHB 1IV6A 3P5JA 3HRMA 2XF6A 1RIOH 1ZAOA 2YUSA 3E5UA 4MHGA 2FMYA 4U0VA 2P5KA 4JK1X 3S2HJ 3I58A 2KDOA 1MMDA 5LHGA 3QU6A 2QQ9A 1X19A 4JYKA 5B1BH 4NN1A 2M0MA 5F1RA 1YLFA 1ZTRA 2UXXA 5JLXA 1XB4A 4CDGA 3W6KB 4DYRA 2CW8A 5E8IA 1LDKB 3QP6A 2YR2A 4JX5A 2LDUA 5AIQA 1SFKA 4OINF 3D1NI 4PJMA 4RBOA 1HW1A 2MC4A 4ZDPA 5EF6A 2VBXA 4ZYGA 2DJIA 2P81A 2Q2EA 1YOVB 4KISA 2O6GE 4S05A 2JN6A 3OR2C 2R5YA 2Y9ZA 3Q0UA 3KP6A 5FFXA 3GYHX 4CHUA 1ULYA 3CO6C 3PM1A 2HR3A 2UUZA 3QAHA 5LRRA 1I3QJ 5FB2A 2ICWG 3K1PA 4L9TA 1MNDA 3KYCB 3RJPA 1UG0A 4Y33A 1IXRC 1T95A 2M4GA 3HXLA 3M8EA 1AKHA 2EIKH 4DYCA 3GX4X 3H0GJ 3KKDA 4D0PA 3HC7A 4ENJA 3QRFF 1MZBA 2F4IA 4L9VA 2HNHA 3VYSB 5J1UA 5LGTA 2QTQA 1KONA 3HOZJ 1OR7A 1HCRA 3WODF 2E1OA 1QBJA 2QF7A 1ZELA 1ZHFA 2YVEA 1IGNA 1X2NA 1U9NA 3P9CA 4UVCA 2E1NA 4ENKA 3PNYA 2OV7A 4ENNA 3HOVJ 1GUUA 3P7NA 5KAIC 3SHFA 4F7ZA 2ESHA 2F2EA 3ISPA 1ZR2A 3H9JA 1A36A 1E3PA 1AU7A 5E3NA 3W2VA 2R5YB 2VKDA 1FX7A 4XORA 4Y17A 2AS5F 4I02A 2HOSA 4NNJA 3HIMA 1XGOA 3G71I 4IHYA 5EEAA 1HOMA 2DK5A 3BHQA 2WAQN 1JKOC 3ZMTA 1U5TB 2HXIA 3ZMZA 1I5ZA 2A61A 1J59A 2DCEA 4Y4RA 2TRTA 2V4JC 3SWHA 2RNJA 2K5CA 4HX4A 5CW8A 3FMSA 2DAOA 4U88A 2E1CA 3T8TA 2PMZA 1ETVA 2OBPA 3B02A 3FBNB 5CVUA 3KYLA 2KQRA 2AQEA 3NEUA 1ZLJA 1Y6IA 4BY7J 2M9HA 4IOAF 3IAM2 1HBXG 2WB1N 4D1QA 3KP7A 3F6OA 2NNNA 1VQ4I 3D5SC 5FLMJ 4XSXF 3S1RJ 2Z16A 1PP7U 4GDFA 3W2WA 1MMGA 1E2XA 5H6QA 5LEKA 3N97A 1SAXA 4AF5A 4FCYA 4HNUA 5CVJA 5HLIA 5J1YA 4S0HB 3OOUA 3JAMK 1J9IA 4LMYA 3S3MA 2ZBKA 1BW5A 1KZHA 3KZZA 4M9XA 2BVLA 2QUFA 2W00A 3IH2A 4HA8A 4ZZDA 4BACA 3ZR8X 4GCVA 4F93B 4IHXA 2B9SA 2W48A 1DGRM 2R0QC 3L2VA 3CMAI 2CWEA 4JX6A 1W7PB 2VPLA 2M7BA 3E6BA 4B48A 1KU7A 5LHIA 2VB6A 4OIRF 1QGPA 3HPHA 4ABZA 3IUVA 4NQWA 4II3A 2O8XA 1WJCA 1I6XA 4ZTFA 5K7ZA 2EWNA 1N75A 3W3CA 3B6CA 4YELA 1Y1WJ 4NC8A 4HNVA 1VI0A 2DFFA 4OMYA 4EJWA 1D5YA 3TOBA 3VDXA 5HOOA 3BRUA 2XRLA 4DNCA 3E7QA 1NG6A 3ANPA 2O7OA 1JJ6C 3H5NA 1SFXA 2F5CA 3K1MA 1BI0A 1G3TA 1HQCA 1R4NB 4ZYEA 3VFZA 2UWMA 5K58A 2LF7A 2L7FP 4LIUA 4BUPA 1J2XA 2VQGA 3BT9A 2W7NA 4H0EA 3KFWX 2B3WA 2L54A 3CMMA 1JHFA 2XIGA 2KPMA 3EQLF 3LFKA 5E79C 4B09A 3GTPJ 1LDDA 2GXAA 2BOLA 1PYVA 3O2PE 1BJZA 2BXYA 2OCCH 4C2UA 5C4YA 3LSPA 4K2EA 1HW5A 2CYYA 1KQ9A 4G7ZF 3IWFA 3CF2A 4KNYA 1YRNB 3DTEA 2DMPA 3VW2A 2VN2A 4A3MJ 1R5HA 1QRYA 3JTGA 2GBYA 2K86A 1T98A 3QYFA 2NRAC 1F43A 1FOXA 3EUKL 3CDIA 3D5LA 1PUFB 5E3MA 2L01A 2IGNA 3O6BB 3GFMA 1BI1A 2VJIA 4CGZA 3EUPA 4IXAA 1VQLI 5L3BA 2DFEA 4DZJA 3DU6A 3R0JA 4G7HF 4MNUA 2M34A 5FLVA 4DGWB 5HVQC 4XL9A 3E1SA 2W25A 3NWSA 2JUCA 1IC8A 3CC4I 2ESNA 2D1VA 1J75A 2GOMA 4OU0A 2MGQA 3KE2A 4BS9A 2W1OA 5K5QA 2JJ7A 1IRZA 3BTLA 1RETA 5ERIA 2D2WA 2XROA 2NVQJ 2DLLA 2QKLB 1BC7C 3GO5A 3RKWA 5DAJA 1LEBA 5TISC 3FKIJ 1YYVA 5GTIC 4RB0A 1R5ID 2FMLA 3K8PC 1XGSA 2BY2A 2DU9A 2JK3A 1F9NA 5CVVA 1W7PA 3HDDA 5EJCA 5BOXA 4Y15A 2V7FA 3W6VA 3S14J 1X4OA 1BIAA 4J01A 1LE8B 1XDUA 2NVTJ 2ZXJA 1D1BA 4BEHB 2CMPA 2Y2ZA 1O3QA 4N4OB 1W0TA 3P9KA 1E3OC 1P92A 3VPRA 2PFBA 1Z1DA 5HLTA 1QVTA 1TBXA 2FBHA 1HKQA 1QHHD 5F27A 1MBHA 3EUAA 3OYDA 1F4KA 1ZRDA 5JHFA 3R60A 3FDYA 4OAZA 4UUSA 3HOXJ 1P7IA 2LY2A 4HSTA 1IRXA 1ZH5A 1XN7A 5ILVA 3UR3C 1WKMA 2V79A 3MMYB 2DA4A 4XRMA 2DT6A 1IN5A 4AVZA 1MBEA 3CJTB 3DPJA 3ZP5A 4IRIA 3C07A 2XKOA 2XPUA 4TV7A 4QWQA 4UHTA 3QQAA 3MN2A 1R9TJ 4ESBA 3KX2A 5J4YA 3QPSA 1JTYA 1SFUA 2D6YA 1VNDA 3OWTA 3C2BA 3F21A 3V8KA 1D0XA 3M3YJ 4KMUX 2IS4A 5F08A 1IRFA 2KL4A 3QOEA 2GUHA 3R4KA 2F48A 1XCBA 5EYRA 2GM4A 5C44J 4FASD 2AXLA 2K3FA 5CVRA 1U5TC 2E7WA 5HBUA 3KEQA 5BQTA 4BQNA 1IXCA 5K7HA 4P96A 2H8RA 1HXDA 1HKSA 2ZJ2A 3E5QA 4KN7X 2VL8A 3H5RA 4XBFA 4UDSA 3CD6I 3K4MA 1ZARA 1ZREA 1A04A 3H3UA 5H9TA 4DVYP 4IRHA 3SDGA 4YFXF 2XV4S 2DT5A 2NOJB 3L00A 2FSWA 5FJ8J 3VW0A 2VQHA 2HYTA 1Z3YA 3TP0A 3Q9VA 1GV5A 3C2HA 5L3EA 1BI2A 3JSPA 2R7QA 4KA4A 3W2AA 2F07A 2Y31A 1OCPA 1D0YA 4A3EJ 1G4DA 3JCUC 4IQ4A 2PI0A 1HDDC 5C4XJ 3HTHA 1ZG1A 4BDYA 3MNLA 2KISA 2B7EA 5FMPA 4I98B 1FBQA 1UB9A 3W6JB 5IT3A 4I0AA 4CCMA 4UUVA 3FM5A 3VSLA 2WGBA 1J0RA 2QQBA 4YG2F 3CCRI 3OYKA 3CWRA 3WU2C 1U2WA 1WJ5A 1YIOA 2OQRA 4EM2A 5JFRA 3OYNA 1FOKA 2W57A 4ON0A 3T8RA 1T0FA 5D8KB 2E71A 3FXRA 1X1PA 5FO5A 2A05A 1RR8C 1TQPA 4E4HA 1G8XA 4W1UA 5HDKA 2ZJQF 3BNIA 2EFNA 2E19A 3B81A 2VE9A 3WHCA 2QA4I 5F6FA 4GFLA 3DCFA 4ITVA 1X58A 2PN6A 4XLCA 2JWTA 1ZK8A 3RYPA 5J40A 1D8KA 1BL0A 1MBFA 4GGGA 4A5MA 4BQAA 5EEHA 3G7RA 2H09A 1USTA 2YX4A 4IRVA 2EQRA 2X1DA 3SZPA 1T38A 4I0BA 5F04A 3RKYA 5DEQA 3IUOA 3I4NJ 2V6CA 3IC7A 4HEA2 4PCQA 3J81K 4GCLA 4C2MA 1N25A 2QWTA 1WQ2A 2K9MA 3OYEA 4L5IA 3SZGA 4FISA 1LKXA 3TDUC 3D0SA 4L18B 3B73A 5K5RA 1IN8A 4BJTA 4BBRJ 1VQOI 4LITA 2IT0A 2VI6A 1B9NA 1KYZA 4EM0B 4CYDA 4ETSA 2VQCA 1SFEA 1FIAA 3BJAA 1ZKGA 3R0AA 1Y1VJ 3DEWA 3TDZC 4E7JA 3X2QH 3H9QA 1VQMI 2K3PA 1FPQA 3RPUA 4OMZA 2ZY9A 1Q1HA 3S3NA 2OTLI 3A0BC 1X4PA 1C0WA 2LKPA 1FMVA 4B47A 3CCMI 3A0HC 4IHSA 4C2TA 3C7JA 3SQNA 1R1TA 2XPVA 4KIGA 2Q8KA 2G7SA 4UVAA 3DWLE 3OMYA 2GLOA 4A3BJ 1XG1A 2QVOA 5B66C 2PEXA 1UELB 3FXKA 5ICCA 4BJ5C 1O3RA 3IKVA 2PFVA 2HQNA 4IOCF 4MEXF 1XGMA 1B6AA 3DF8A 4BL0B 4D7MA 1NTCA 4A3JJ 4PJJA 2AO9A 2I8DA 2JPCA 3REOA 3LNQA 3AQTA 4ESFA 4YIIA 3BDDA 2E2IJ 2ZCMA 2IEKA 3TEDA 3DLLF 3HZJA 2QSFX 3HRTA 4EEFG 3CUOA 1MDMB 2K9NA 3GBGA 4HV6A 4XNFA 4L0YB 3VWBA 9ANTA 1JKRC 3GTMJ 4LK1F 3NXCA 3K1NA 2CH0A 1X3UA 3BR6A 3LA7A 2W84A 2E1MC 1BOAA 2JRMA 3L2QA 4A0ZA 1TQMA 4P9FA 2L2OA 2G9WA 1STZA 2VKHA 1S8NA 3GTOJ 4HX8A 4XQFA 2EV6A 2FOWA 4XN3A 2H1LA 3C1DA 1BOBA 3L1PA 1FBSA 5JI6A 1VTNC 5CQGA 4BEHA 3AQSA 2VBZA 2VJJA 2NNYA 2EK5A 3CUQA 4AIHA 1Z91A 2QOPA 1UI6A 3FZVA 2Y48A 2XF7A 2Z2SB 2PZ9A 2VOPA 1SMYF 3HTJA 1RKWA 1TLHB 3WGGA 1ERDA 4MFEA 1DU0A 1N78A 1UCRA 2WV0A 5E3LA 4A3CJ 3JW4A 3BR2A 4F3QA 1DQUA 3H3ZA 3FHZA 3CC2I 2RNGA 4XIDA 3OIOA 2OJED 3GZNB 2MD0A 1IXSB 2D1HA 3GFIA 4ZC3A 2DFIA 2XB0X 3K7AJ 4N9IA 3HTSB 3OYHA 2OZ6A 1MDMA 2ZB9A 2ETHA 5K7FA 4M3FA 1ZRFA 4O3MA 3HTIA 2OC6A 4GXOA 3S32A 2XDNA 2K7LA 3DP7A 3KCCA 1R58A 4QSHA 2CQXA 3WTZA 4QIWN 1JUPA 4A3KJ 2CUEA 4EM1A 2LKXA 4HYEA 3R6SA 2VT2A 2BE5F 4DJAA 2FX0A 4MQ9F 4G8XA 1AWCA 4XLPF 3RPUD 1IJWC 4HW0A 1SVMA 1B8IB 1O3SA 4J00A 4HOBA 2R4GA 3TKYA 2REKA 1KYWA 2P8TA 3RPQA 1E0EA 3JREA 2FD5A 2NS8A 2EZLA 1Q1VA 2DOEA 2ZSHB 3QU3A 5F64A 2CU7A 2LY9A 4LG3A 3I64A 5GADJ 2R7UA 3GUDA 1NH3A 2P7CB 2L4AA 5CXIA 1OYYA 3ROUA 4E6KG 2E5ZA 2WADA 2XASA 3FMRA 2JVHA 1A6QA 3L2CA 1YRNA 3DPLC 4YIFA 1LE8A 4XRSA 2DK8A 1T6SA 2XKPA 4BH9A 3K9TA 3TO6A 4B43A 2OF7A 4LOCA 3WTWC 1GDTA 4M3DA 2X85A 5ICFA 4XONA 2M7AA 1Z21A 2J5OA 2VT3A 3BR1A 4G94A 4B1RA 5C3EJ 3L2RA 3RI4A 2KT0A 3AG1H 1TW2A 2X4HA 2CUJA 3LSTA 3ZQIA 2GAUA 3V7SA 5DUIA 3AG3H 2XRNA 1I27A 4OD4A 2HDCA 2HVRA 2XAFA 1OPCA 3NAUA 1YIJI 1GXQA 3LQRA 1OCRH 5IYDJ 1WH5A 3K69A 4HSRA 1UI5A 3COAC 4BJ6C 1TTYA 2A68F 2YS9A 3AKZA 5F1JA 1T08B 4IRGA 4PSXA 4IF4A 1JUSA 3JAMZ 2IVMA 4RGRA 2V9VA 2ZJRF 3BCBA 1TC3C 4QPQA 1F36A 2E60A 4LLGF 1X3WB 3ZQGA 1LFPA 3KZIC 2STTA 2R93J 2LYCA 1YJ9I 1AA7A 3DPTA 5KK1A 2R7SA 2QWWA 1XX5A 5KAFC 1WI3A 1G3YA 2P7VB 5FROA 3KLOA 3V4GA 3IH3A 4IX7A 1FSHA 1XC5A 2FRHA 2L9NA 3MZYA 1OCCH 4A2UA 5ICEA 2ADUA 1QZYA 1QNTA 2CJJA 4JX4A 1WJDA 3FXUA 2EFOA 2R7TA 4EGYA 3KIOA 1W36D 2I10A 3L09A 2K4JA 4CSWA 4Z6YA 1FY7A 5TRDA 5ICGA 1LFBA 1T8IA 4DOZA 3FMQA 4PJLA 3EYYA 3GFJA 3LSRA 3DXJF 4KJZA 5DUKA 1FOYA 3CJDA 2V1NA 3FIWA 3FK7A 3TW7A 2ZCNA 4UUTA 1MD0A 1WFXA 2UXNA 3MCZA 4RAZA 5DD8A 3BG7A 3OYMA 1YITI 5FFZA 4U0WA 4LK0F 1MGTA 2OPTA 2EH3A 4HLXA 2B0LA 3S93A 3LJLA 1OLTA 4O5VA 4E7KA 2KRHA 5KCMA 3AG2H 2BHZA 2G7UA 4NBQA 2FQ4A 5E18F 4EV0A 1H89C 2VODA 2L5QA 1JT0A 2OZUA 2IJLA 5J6XA 1Z0XA 1LFUP 1YG2A 2VOOA 2P5VA 5FKMA 3VVZA 1B4AA 1SVLA 2Y0MA 3FXQA 2RV8A 4XICA 5KNLA 3MKLA 4NQWB 4Y3OA 2GXBA 3JRDA 2KDZA 2DQLA 2Q2EB 1V5FA 2JRTA 2HS5A 2CUFA 3PASA 1EA3A 1T56A 2KJCA 5EGOB 4CYCA 4RDUA 3EUHC 2QEXI 3H36A 2F4OB 3HSRA 3S1NJ 3QWLA 2LC2A 1ETOA 4G6TB 3ZN0A 4RB3C 5D6EA 1N77A 2JT1A 2JA6J 2DDBA 4UUSB 1YX5A 2R7ZJ 1RI7A 2ELKA 4B44A 2TDXA 3BWGA 2R7WA 1HKTA 2R7OA 1KU9A 3E6MA 2M0CA 3E3VA 4M6VA 5FLXK 5IY5H 1O7LA 3DU5A 4GRIA 3V8LA 2YVHA 2DQRA 5D1RA 3S15J 1W5TA 3GXOA 5E1ZB 3RD3A 1DUXC 1TL8A 3ZPLA 5H2FC 2O8KA 5EFYA 1SC7A 2A07F 2EZKA 2L7KA 3S1MJ 3CJRB 2LLKA 4PK4A 2NVXJ 3FKJA 2PJPA 2A6HF 4NC7A 2HKOA 2O7TA 1V5GA 4X6AJ 2DPUA 3ASOH 4L9JA 2VXZA 1GVJA 3KYDB 3E97A 3ESWB 1Z7LA 3CCJI 4JQFA 1G3SA 4XMYA 2CW7A 1VQ6I 1KU3A 4Y13A 3CESA 2BW3B 4AUXA 1MJAA 1DU6A 3WTXC 4ANJA 1XDSA 2NOGA 5CLSA 3M9AA 2UXPA 3A01B 1G3WA 2LBFA 4AM3A 3VYRB 4OIPF 1D3YA 3KEOA 1GV2A 1YS7A 2L4MA 5JR3A 4UNOA 1FNNA 2JA5J 3JRFA 1TWHJ 2M2EA 2IA0A 3G6EI 3IRRA 2WC2A 2DG8A 3F1BA 3C18A 3WTUC 3PIOF 2CO5A 4CCOA 2MBFA 4BBSJ 3NRVA 1B9MA 2IW5A 2MA3A 2P0WA 4XM3A 4UB6C 1DPUA 2ZXIA 1S29A 1O3TA 1YE9A 2IPQX 1RNLA 5LGUA 2Y30A 3GZ6A 2R5ZA 4D9JA 1BR1A 1K83J 3GWZA 1Z9CA 1IUFA 2R7RA 5K1YA 3ZN1A 1UHMA 2V6EA 1OJLA 3CTAA 4UY8I 3H0DA 3VIBA 3ZXSA 3K4NA 4B8XA 2E2HJ 5D19A 4AWXB 4U7BA 2QSHX 1YX3A 3AL0B 2G7HA 2CFXA 1Y0UA 3K70C 1USSA 2UV1A 2ZMEC 3CJNA 3KP2A 4LD5A 1MSFC 1D0ZA 2RQPA 1X3ZB 4A3LJ 1OISA 4OD5A 1R6RA 1TWAJ 5BS6A 4LG0A 1WWXA 4FHTA 3F8CA 2HPMA 3CC7I 3PJRA 1YS6A 1BJAA 3ZQHA 2IGKA 4N4NB 3GTQJ 2IS1A 2A6EF 3HRUA 1ZGJA 3VSKA 1IDYA 2F5VA 1RPWA 3VODA 3BTCA 4F92B 3QYEA 4AC6A 2DBBA 4HDVA 1MNMC 1YHQI 2R7VA 5JVGF 4E70A 1EH8A 1WH7A 4GYIA 4IO9F 4HV5A 3F8BA 4HF1A 3IHUA 3DBRB 4DIQA 1ONVA 1K78B 3G73A 2R92J 3BG6A 1QU3A 2UXOA 1ITYA 5H20A 1QZEA 4LGWA 2MG4A 4BKXA 3KP4A 5IP9J 5JHUA 3HE0A 2RAEA 4RAFA 1XTAA 1BA5A 2NS7A 1PJRA 2IA1A 1RUNA 5FRNA 1HA8A 4H4KC 3RZDJ 3BY6A 2VBYA 1OKRA 3GLXA 2NS0A 2F5EA 1MSEC 2DG7A 1AOYA 3F8NA 3MKYB 3I0TA 1MKMA 3F3XA 3G3ZA 2KZGA 2DTRA 2Z99A 5E1WA 3ECOA 4BHPA 5J8CA 2DT7B 4WF2A 3AAFA 3LSIA 3LAPA 2W82A 5IYBJ 2C6YA 1QPIA 4CO8A 1G59A 1I6HJ 5IT9K 4PJNA 3TL4X 5D4SA 4F91B 1W4MA 4N9HA 3SXYA 3DQVC 5GPCA 3H3VK 4R8HA 5HLHA 1VQ9I 3KKCA 4RS8A 2LVSA 2CW0F 3N05A 5GTHC 1VQKI 3HEFA 4C9YA 2STWA 4GFBA 2XAQA 3HKZA 2HKXA 4DBQA 3O8HA 1ZG5A 1TW3A 1WJAA 4HPQA 2FOKA 2IXSA 5HSZA 4XKCA 2P5LC 4A3IJ 4KN4X 2QLZA 1XS9A 3TW6A 2R7XA 4PFOA 3K2ZA 3PUFA 2UXUA 3BTIA 3G2BA 3PO3J 1FJLA 1X1BA 3FX3A 1D5VA 1SGMA 4A3DJ 2NYXA 2F6CA 3COLA 1Z77A 4I09A 1SEUA 3I53A 1DP3A 2XAHA 2QGUA 5GP9A 1IN6A 2O9LA 3I56I 3ANGA 3I5UA 3U9GA 4A0YA 3HL2A 1MMAA 4C3JJ 2YPRA 3DKXA 1JT6A 3BR0A 2HZDA 5CVIA 5HLGA 3I4PA 1IN7A 3GMEA 2QZ8A 4GCKA 3OIQA 1K6OA 2EJRA 3OR1C 3BZCA 4PUSA 1Z05A 5LRSA 2EILH 1JGGA 3ABLH 2VBWA 5CXGA 1Z3XA 2DOFA 4AU7A 2LMDA 2GENA 2ZO4A 4WIBA 1WGXA 3MD2A 2WBMA 3FXMA 2E34A 2JUGA 2DW4A 5FGMA 1MH3A 5J8FA 2MLKA 4BE0A 1G2HA 1KU2A 3SEQA 3PIPF 1FLIA 2L9RA 3QP5A 2NX4A 2FNPA 3M1CA 2DFHA 1WSUA 3WGIA 5E1XA 3PPBA 5E3OA 1YFHA 1KQ8A 4XLNF 3FK6A 4WCGA 5HNHA 1ETKA 4IJAA 2W53A 3EUHA 1D1CA 5GAEJ 2CSOA 3RKQA 4X1EA 3VB2A 2HTJA 5FKNA 2YVXA 1RKTA 4CCKA 4M3GA 4BNCA 4I99C 3CMEI 1QVUA 1FP2A 2M8GX 2LBFB 3HG9A 1R36A 1IN4A 2QSGX 5LD2C 4CGRA 2JA2A 2H6BA 3JRCA 1I3AA 2NP3A 3WU1B 3ON4A 3A1YA 1VQNI 3HUGB 4OAYA 1R5GA 2DN0A 3H1CA 4XLFA 5EDNA 2FEZA 2Y9YA 1KGSA 2ZNZA 5H6RA 1D1AA 1OYWA 1SD5A 3HOWJ 2VQLA 3BCAA 4Q4ZF 3QODA 1LVKA 3H92A 3HSEA 3R61A 4ZYHA 2LRDA 3MAJA 1ORKA 2BV6A 4Q48A 3S16J 2K9QA 3J7AY 2FE3A 3M7GA 3E6DA 2HU9A 1V3FA 1OQYA 3BZ6A 1EH6A 3VVXA 1H9GA 2GOXB 1FP1D 2PLYA 1L0OC 2WAQA 4EQQA 2A6TA 5M3MJ 3OYGA 1YJNI 3S8PA 2EBIA 3PFYA 3WU0A 2VE8A 5F0HA 1GXPA 3KPHA 3CO7C 3BP8A 3LWFA 2EINH 2UXHA 3FBIB 1ENHA 3ZQFA 3O3KA 1NK2P 1IZ1A 2KIFA 3LA3A 3G56A 4HLYA 2KJBA 4FT8A 3WG9A 2DMTA 2KP6A 4LJZF 4B4CA 4MGRA 1FOWA 3RTRA 3V6GA 1P4XA 2LREA 2CS3A 2Z1DA 3MZ8A 4FE4A 4RLQA 2GQQA 2H8WA 5TJJA 3TO7A 4CA0A 1Z7UA 3GTJJ 1WI9A 2VIXA 3TQNA 4KIFA 4XOPA 2IP2A 2O3FA 1REPC 2M5WA 2KIUA 4HNTA 3ASNH 2M4KA 1TT5B 3OS2A 3HYIA 2EIMH 4GYGA 3F22A 3ERMA 2HGCA 2NAZA 2PQ8A 1CF7B 2B1EA 3K4CA 3C2GA 1IW7F
chains in the Genus database with same CATH topology
3NAUA 2ID6A 5IYDJ 2QIBA 4L62A 1WH5A 5FLMJ 1UI5A 3S1RJ 3P9TA 3VP5A 4AF5A 4FCYA 2YS9A 5J1YA 5F1JA 4S0HB 3OOUA 2OERA 1JUSA 5JLWA 1BW5A 1TC3C 1F36A 2Y0SN 2HOAA 3IH2A 4W97A 3ZQGA 4IHXA 2LFBA 2W48A 3IH4A 2R0QC 2R93J 2EZIA 1APLC 4JX6A 2NP5A 4D7NA 3UKGA 1WI3A 3JRIA 3IUVA 4ABZA 5IYCJ 4MFDA 4IHVA 2G7LA 5AQCA 3IH3A 5M5YJ 1XC5A 2K40A 5K7ZA 1HDPA 3B6CA 1Y1WJ 2CJJA 3OSGA 4JX4A 3WHBA 1ETQA 4MK6A 4HNVA 1VI0A 5FKKA 1D5YA 3QPLA 2OI8A 3KZ9A 2ECBA 2I10A 3BRUA 3QKXA 2XRLA 3E7QA 3BQYA 3CRJA 1VFCA 2K9SA 2X6OA 3ANPA 2O7OA 1LFBA 1JJ6C 3Q0VA 2HDDA 1S7EA 2NVYJ 2X48A 3LSRA 1VF9A 2E2JJ 1MBGA 3CJDA 4MO7A 3TW7A 3FIWA 3FK7A 1ZGWA 2ZCNA 2L7FP 4UUTA 5K58A 3BT9A 4Y52J 1UMQA 1CQTA 5DTDA 4JL3A 3RZOJ 1TWGJ 3BJBA 3GTGJ 5IOZA 3GTPJ 2OPTA 2EH3A 3NRGA 3BG3A 3LJLA 4XK4A 3ZQCA 1BJZA 2XGDA 3BR3A 1JUMA 2LK2A 3LSPA 1OFCX 5C4YA 2DA7A 5EZHA 2GFNA 3BTJA 3NARA 2FQ4A 3T6NA 1H89C 1JT0A 2LTPA 1Z0XA 1LFUP 1YRNB 5FHPA 2DMPA 5FKMA 3VVZA 3VW2A 3CCYA 4XICA 3HGGA 4A3MJ 3MKLA 1QRYA 5J3LA 2GBYA 3JRDA 2KDZA 1F43A 2CUFA 3PASA 1PUFB 4HKUA 5E3MA 2L0KA 2COBA 3HM5A 2JA8J 1T56A 5EGOB 4CYCA 4FTHA 4RDUA 3EUPA 1AHDP 3S1NJ 4DZJA 1HLVA 1ETOA 3I4MJ 3QBMA 1MBKA 5FGLA 2M34A 5M3FJ 5FLVA 2JA6J 4GFKA 4UUSB 2R7ZJ 2ELKA 3S1QJ 1WCMJ 1POGA 4I6ZA 1IC8A 2M0CA 4M6VA 4ME9A 1I50J 2D5VA 2MGQA 5D1RA 2IU5A 2YVHA 2DMQA 3S15J 2JJ7A 5BNGA 1IRZA 3BTLA 1GVDA 5IPAA 1B8IA 1RETA 3RD3A 4D5CA 4DZPA 3SFIA 2O8KA 2NVQJ 5DAJA 5EFYA 2EZKA 3S1MJ 4G12A 3FKIJ 2LLKA 5FKLA 4BY1J 2NVXJ 4A3FJ 1B72B 3V78A 3MVPA 2O7TA 2DA2A 4NELA 2JK3A 3RQIA 4X6AJ 2CRGA 3HDDA 2N8GA 1PUFA 2XPWA 4KWAA 3W6VA 3S14J 2ZOYA 2DMUA 2LP0A 3CQZJ 1LE8B 1B72A 2NVTJ 2LR8A 1FTTA 2VPRA 2Y2ZA 5M5WJ 1JKQC 1W0TA 4AUXA 3HTAA 1DU6A 1E3OC 1EF4A 1T33A 2NOGA 3VPRA 2DTZA 3TP3A 2UXPA 3A01B 5F0FA 1QVTA 1ETWA 1GV2A 2HQ5A 5F27A 2JA5J 1MBHA 3JRFA 1TWHJ 2M2EA 3NPIA 4A93J 3K2AA 2DG8A 3F1BA 2G0EA 4UUSA 3HOXJ 1P7IA 4BBSJ 2XGEA 3G1LA 1W0UA 2DA4A 4XRMA 1MBJA 1TWCJ 2ME0A 1JJ8C 1MBEA 3HBLA 2ZOZA 3DPJA 3C07A 2XPUA 3S2DJ 3A03A 3QQAA 3MN2A 5IOYA 1U9OA 1R9TJ 3LSJA 2Y30A 3QPSA 2R5ZA 1JTYA 1K83J 2RHAA 2D6YA 1IUFA 1VNDA 3C2BA 3BR5A 2HOTA 1OJLA 1TWFJ 2HXOA 3M3YJ 2WV1A 3VIBA 5F08A 3JSJA 5D18A 1FEXA 2GUHA 5EG0B 4GCTA 2E2HJ 5D19A 5EYRA 1H8AC 2GM4A 2EZHA 5C44J 3NI7A 4A69C 3VOXA 3Q0WA 5HBUA 3G1OA 1HF0A 3BQZA 4C3IJ 5K7HA 5J1RA 1MSFC 2H8RA 4IHWA 4UDSA 4A3LJ 3JRGA 2MW8A 5H9TA 3SDGA 3O8GA 1TWAJ 4C3HJ 3FISA 4I76A 5FJ8J 3VW0A 4ACIA 5IP6A 2HYTA 3TP0A 1GV5A 3ZQHA 2F07A 3GTQJ 2G3BA 2Y31A 2FJ1A 1OCPA 4A3EJ 4V2GA 1HDDC 2YU9J 5C4XJ 3HTHA 3HB9A 5FKOA 3MNLA 1IDYA 5FMPA 1RPWA 3BTCA 4AC6A 4PXIA 2IBDA 1MNMC 1ZR4A 3KNWA 4M3EA 1SANA 1WH7A 4B3AA 2WGBA 2R92J 2UXOA 2ID3A 2AHQA 4BXXJ 3CWRA 4XRSG 3E7LA 1ITYA 2MG4A 4BKXA 1OCTC 5DS9A 5IP9J 3HE0A 2RAEA 2VUMJ 2IAIA 1BA5A 3ON2A 2NS7A 3RH2A 1RR7A 3VW1A 3EGQA 2TCTA 3RZDJ 4W1UA 2DMNA 2L7ZA 1MSEC 2DG7A 3CMYA 3ZQLA 2XB5A 2XSDC 3BNIA 2E19A 1UHSA 2DA6A 3BG9A 3B81A 4DW6A 2FBQA 3GEUA 4YZEA 5HODA 4DYQA 3WHCA 3F0CA 4GFLA 3DCFA 1X58A 3ZOBA 2JWTA 1ZK8A 3HGYA 4FE7A 4QTRA 4A3GJ 2HYJA 1BL0A 2QKOA 1MBFA 4C2MJ 3G7RA 4J19A 2EQRA 5F04A 5IYBJ 3I4NJ 1QPIA 3HKZN 4D5FA 3OSFA 4GCLA 1I6HJ 1O4XA 2CQQA 2QWTA 3CDLA 4FISA 2PMZN 1U78A 3NNRA 2H1KA 4BBRJ 1IG7A 3PO2J 3GTKJ 5GPCA 5HAWA 2VI6A 3H3VK 3KKCA 2LD5A 2HI3A 2LVSA 1JTXA 2JMWA 3VOKA 3HEFA 4GFBA 1FIAA 1ETYA 1BW6A 1Y1VJ 1ZKGA 3DEWA 1GT0C 2HKUA 3O8HA 3BG5A 5HSZA 4A3IJ 2G7GA 1XS9A 3BCGA 3TW6A 2JA7J 5IP7J 4MLOA 4AC0A 2UXUA 4NDLA 3BTIA 3PO3J 1FTZA 1FJLA 1SGMA 2PBXA 4A3DJ 3COLA 1Z77A 2ME6A 2ECCA 4JKZA 2XPVA 1IDZA 5GP9A 2O9LA 2G7SA 2GLOA 4A3BJ 2VKVA 3ANGA 1XG1A 5M5XJ 1JKPC 4C3JJ 1JT6A 2B63J 3BR0A 4D7MA 3LSGA 3A01A 4MXMA 1NTCA 4A3JJ 3M4OJ 2AO9A 3LNQA 4L5EA 4GCKA 3AQTA 1A5JA 1NK3P 3G1MA 1UG2A 3LHQA 3VVYA 2E2IJ 3SJMA 1AKHB 1IV6A 2ZCMA 2IEKA 1JGGA 4M3BA 3TEDA 2YUSA 3JRHA 5CXGA 4EEFG 3S2HJ 2K9NA 3GBGA 2GENA 1WGXA 1MH4A 9ANTA 2DA1A 1JKRC 3GTMJ 1G2HA 1X2MA 1MH3A 3A02A 2QCOA 3NXCA 4NN1A 4JYKA 3BR6A 5JLXA 1ZTRA 1FIPA 2L9RA 4DYRA 2MSYA 2R5ZB 2NX4A 3O60A 2L7MP 3LOCA 3S17J 4JX5A 1H88C 3GTOJ 3PPBA 5E3OA 3D1NI 3FK6A 4RBOA 3L1PA 2V57A 1ETKA 2W53A 5EF6A 3RKQA 2P81A 3AQSA 4X1EA 5FKNA 2JN6A 1RKTA 2R5YA 2QOPA 1UI6A 2Y9ZA 3Q0UA 4M3GA 2PZ9A 1QVUA 3HTJA 1RKWA 2M8GX 1SFOJ 4MFEA 1K61A 1DU0A 3PM1A 5E3LA 2DA3A 4A3CJ 1I3QJ 3BR2A 2X9DA 4CGRA 5EG0A 2VKEA 3JRCA 2Q24A 2NP3A 4XIDA 3OIOA 3ON4A 1AKHA 2DN0A 4DYCA 3H0GJ 5EDNA 5EGOA 4CYCB 4JP0A 3KKDA 2Y9YA 2XB0X 3K7AJ 5EZGA 3HOWJ 2ZB9A 3LWJA 4AYBN 1WPKA 5K7FA 4M3FA 3HTIA 1RESA 4IEJA 5J1UA 2QTQA 2XDNA 4QSHA 1U8BA 2CQXA 4QIWN 3HOZJ 1ETXA 1JUPA 4A3KJ 2CUEA 1HCRA 2E1OA 2LKXA 2QF7A 1ORKA 3S16J 1A6IA 2YVEA 2K9QA 1X2NA 1IGNA 1U9NA 4V2FA 2FX0A 3S5RA 2XGCA 4Y7NJ 3B6AA 1GUUA 3HOVJ 3VVXA 1IJWC 2WUIA 1P7JA 3HOYJ 1B8IB 5C4JJ 1ZR2A 2REKA 1AU7A 5E3NA 2R5YB 3JREA 3VUQA 5M3MJ 2FD5A 2NS8A 2EZLA 1Q1VA 2HOSA 2RASA 2EBIA 2CU7A 2LY9A 3HIMA 4MIMA 5F0HA 4IHYA 5EEAA 5F0CA 5CXIA 1HOMA 2UXHA 3BHQA 1YRNA 1ENHA 2WAQN 3ZQFA 1JKOC 2DA5A 1NK2P 1LE8A 2DJNA 4XRSA 3JRAA 4ICHA 2HXIA 3G56A 2OF7A 1ZQ3P 2UXIA 4LOCA 3Q3SA 2DMTA 4B4CA 1GDTA 4M3DA 3JRBA 2TRTA 3FRQA 3GZIA 3V6GA 4JNNA 5CW8A 4FE4A 3GTJJ 1ETVA 5C3EJ 3JR9A 3BR1A 4B1RA 2ZCXA 3IV5A 2KT0A 3GTLJ 3ZQIA 4BY7J 2M9HA 3HOUJ 2WB1N 5GPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NAU A;  2ID6 A;  5IYD J;  2QIB A;  4L62 A;  1WH5 A;  5FLM J;  1UI5 A;  3S1R J;  3P9T A;  3VP5 A;  4AF5 A;  4FCY A;  2YS9 A;  5J1Y A;  5F1J A;  4S0H B;  3OOU A;  2OER A;  1JUS A;  5JLW A;  1BW5 A;  1TC3 C;  1F36 A;  2Y0S N;  2HOA A;  3IH2 A;  4W97 A;  3ZQG A;  4IHX A;  2LFB A;  2W48 A;  3IH4 A;  2R0Q C;  2R93 J;  2EZI A;  1APL C;  4JX6 A;  2NP5 A;  4D7N A;  3UKG A;  1WI3 A;  3JRI A;  3IUV A;  4ABZ A;  5IYC J;  4MFD A;  4IHV A;  2G7L A;  5AQC A;  3IH3 A;  5M5Y J;  1XC5 A;  2K40 A;  5K7Z A;  1HDP A;  3B6C A;  1Y1W J;  2CJJ A;  3OSG A;  4JX4 A;  3WHB A;  1ETQ A;  4MK6 A;  4HNV A;  1VI0 A;  5FKK A;  1D5Y A;  3QPL A;  2OI8 A;  3KZ9 A;  2ECB A;  2I10 A;  3BRU A;  3QKX A;  2XRL A;  3E7Q A;  3BQY A;  3CRJ A;  1VFC A;  2K9S A;  2X6O A;  3ANP A;  2O7O A;  1LFB A;  1JJ6 C;  3Q0V A;  2HDD A;  1S7E A;  2NVY J;  2X48 A;  3LSR A;  1VF9 A;  2E2J J;  1MBG A;  3CJD A;  4MO7 A;  3TW7 A;  3FIW A;  3FK7 A;  1ZGW A;  2ZCN A;  2L7F P;  4UUT A;  5K58 A;  3BT9 A;  4Y52 J;  1UMQ A;  1CQT A;  5DTD A;  4JL3 A;  3RZO J;  1TWG J;  3BJB A;  3GTG J;  5IOZ A;  3GTP J;  2OPT A;  2EH3 A;  3NRG A;  3BG3 A;  3LJL A;  4XK4 A;  3ZQC A;  1BJZ A;  2XGD A;  3BR3 A;  1JUM A;  2LK2 A;  3LSP A;  1OFC X;  5C4Y A;  2DA7 A;  5EZH A;  2GFN A;  3BTJ A;  3NAR A;  2FQ4 A;  3T6N A;  1H89 C;  1JT0 A;  2LTP A;  1Z0X A;  1LFU P;  1YRN B;  5FHP A;  2DMP A;  5FKM A;  3VVZ A;  3VW2 A;  3CCY A;  4XIC A;  3HGG A;  4A3M J;  3MKL A;  1QRY A;  5J3L A;  2GBY A;  3JRD A;  2KDZ A;  1F43 A;  2CUF A;  3PAS A;  1PUF B;  4HKU A;  5E3M A;  2L0K A;  2COB A;  3HM5 A;  2JA8 J;  1T56 A;  5EGO B;  4CYC A;  4FTH A;  4RDU A;  3EUP A;  1AHD P;  3S1N J;  4DZJ A;  1HLV A;  1ETO A;  3I4M J;  3QBM A;  1MBK A;  5FGL A;  2M34 A;  5M3F J;  5FLV A;  2JA6 J;  4GFK A;  4UUS B;  2R7Z J;  2ELK A;  3S1Q J;  1WCM J;  1POG A;  4I6Z A;  1IC8 A;  2M0C A;  4M6V A;  4ME9 A;  1I50 J;  2D5V A;  2MGQ A;  5D1R A;  2IU5 A;  2YVH A;  2DMQ A;  3S15 J;  2JJ7 A;  5BNG A;  1IRZ A;  3BTL A;  1GVD A;  5IPA A;  1B8I A;  1RET A;  3RD3 A;  4D5C A;  4DZP A;  3SFI A;  2O8K A;  2NVQ J;  5DAJ A;  5EFY A;  2EZK A;  3S1M J;  4G12 A;  3FKI J;  2LLK A;  5FKL A;  4BY1 J;  2NVX J;  4A3F J;  1B72 B;  3V78 A;  3MVP A;  2O7T A;  2DA2 A;  4NEL A;  2JK3 A;  3RQI A;  4X6A J;  2CRG A;  3HDD A;  2N8G A;  1PUF A;  2XPW A;  4KWA A;  3W6V A;  3S14 J;  2ZOY A;  2DMU A;  2LP0 A;  3CQZ J;  1LE8 B;  1B72 A;  2NVT J;  2LR8 A;  1FTT A;  2VPR A;  2Y2Z A;  5M5W J;  1JKQ C;  1W0T A;  4AUX A;  3HTA A;  1DU6 A;  1E3O C;  1EF4 A;  1T33 A;  2NOG A;  3VPR A;  2DTZ A;  3TP3 A;  2UXP A;  3A01 B;  5F0F A;  1QVT A;  1ETW A;  1GV2 A;  2HQ5 A;  5F27 A;  2JA5 J;  1MBH A;  3JRF A;  1TWH J;  2M2E A;  3NPI A;  4A93 J;  3K2A A;  2DG8 A;  3F1B A;  2G0E A;  4UUS A;  3HOX J;  1P7I A;  4BBS J;  2XGE A;  3G1L A;  1W0U A;  2DA4 A;  4XRM A;  1MBJ A;  1TWC J;  2ME0 A;  1JJ8 C;  1MBE A;  3HBL A;  2ZOZ A;  3DPJ A;  3C07 A;  2XPU A;  3S2D J;  3A03 A;  3QQA A;  3MN2 A;  5IOY A;  1U9O A;  1R9T J;  3LSJ A;  2Y30 A;  3QPS A;  2R5Z A;  1JTY A;  1K83 J;  2RHA A;  2D6Y A;  1IUF A;  1VND A;  3C2B A;  3BR5 A;  2HOT A;  1OJL A;  1TWF J;  2HXO A;  3M3Y J;  2WV1 A;  3VIB A;  5F08 A;  3JSJ A;  5D18 A;  1FEX A;  2GUH A;  5EG0 B;  4GCT A;  2E2H J;  5D19 A;  5EYR A;  1H8A C;  2GM4 A;  2EZH A;  5C44 J;  3NI7 A;  4A69 C;  3VOX A;  3Q0W A;  5HBU A;  3G1O A;  1HF0 A;  3BQZ A;  4C3I J;  5K7H A;  5J1R A;  1MSF C;  2H8R A;  4IHW A;  4UDS A;  4A3L J;  3JRG A;  2MW8 A;  5H9T A;  3SDG A;  3O8G A;  1TWA J;  4C3H J;  3FIS A;  4I76 A;  5FJ8 J;  3VW0 A;  4ACI A;  5IP6 A;  2HYT A;  3TP0 A;  1GV5 A;  3ZQH A;  2F07 A;  3GTQ J;  2G3B A;  2Y31 A;  2FJ1 A;  1OCP A;  4A3E J;  4V2G A;  1HDD C;  2YU9 J;  5C4X J;  3HTH A;  3HB9 A;  5FKO A;  3MNL A;  1IDY A;  5FMP A;  1RPW A;  3BTC A;  4AC6 A;  4PXI A;  2IBD A;  1MNM C;  1ZR4 A;  3KNW A;  4M3E A;  1SAN A;  1WH7 A;  4B3A A;  2WGB A;  2R92 J;  2UXO A;  2ID3 A;  2AHQ A;  4BXX J;  3CWR A;  4XRS G;  3E7L A;  1ITY A;  2MG4 A;  4BKX A;  1OCT C;  5DS9 A;  5IP9 J;  3HE0 A;  2RAE A;  2VUM J;  2IAI A;  1BA5 A;  3ON2 A;  2NS7 A;  3RH2 A;  1RR7 A;  3VW1 A;  3EGQ A;  2TCT A;  3RZD J;  4W1U A;  2DMN A;  2L7Z A;  1MSE C;  2DG7 A;  3CMY A;  3ZQL A;  2XB5 A;  2XSD C;  3BNI A;  2E19 A;  1UHS A;  2DA6 A;  3BG9 A;  3B81 A;  4DW6 A;  2FBQ A;  3GEU A;  4YZE A;  5HOD A;  4DYQ A;  3WHC A;  3F0C A;  4GFL A;  3DCF A;  1X58 A;  3ZOB A;  2JWT A;  1ZK8 A;  3HGY A;  4FE7 A;  4QTR A;  4A3G J;  2HYJ A;  1BL0 A;  2QKO A;  1MBF A;  4C2M J;  3G7R A;  4J19 A;  2EQR A;  5F04 A;  5IYB J;  3I4N J;  1QPI A;  3HKZ N;  4D5F A;  3OSF A;  4GCL A;  1I6H J;  1O4X A;  2CQQ A;  2QWT A;  3CDL A;  4FIS A;  2PMZ N;  1U78 A;  3NNR A;  2H1K A;  4BBR J;  1IG7 A;  3PO2 J;  3GTK J;  5GPC A;  5HAW A;  2VI6 A;  3H3V K;  3KKC A;  2LD5 A;  2HI3 A;  2LVS A;  1JTX A;  2JMW A;  3VOK A;  3HEF A;  4GFB A;  1FIA A;  1ETY A;  1BW6 A;  1Y1V J;  1ZKG A;  3DEW A;  1GT0 C;  2HKU A;  3O8H A;  3BG5 A;  5HSZ A;  4A3I J;  2G7G A;  1XS9 A;  3BCG A;  3TW6 A;  2JA7 J;  5IP7 J;  4MLO A;  4AC0 A;  2UXU A;  4NDL A;  3BTI A;  3PO3 J;  1FTZ A;  1FJL A;  1SGM A;  2PBX A;  4A3D J;  3COL A;  1Z77 A;  2ME6 A;  2ECC A;  4JKZ A;  2XPV A;  1IDZ A;  5GP9 A;  2O9L A;  2G7S A;  2GLO A;  4A3B J;  2VKV A;  3ANG A;  1XG1 A;  5M5X J;  1JKP C;  4C3J J;  1JT6 A;  2B63 J;  3BR0 A;  4D7M A;  3LSG A;  3A01 A;  4MXM A;  1NTC A;  4A3J J;  3M4O J;  2AO9 A;  3LNQ A;  4L5E A;  4GCK A;  3AQT A;  1A5J A;  1NK3 P;  3G1M A;  1UG2 A;  3LHQ A;  3VVY A;  2E2I J;  3SJM A;  1AKH B;  1IV6 A;  2ZCM A;  2IEK A;  1JGG A;  4M3B A;  3TED A;  2YUS A;  3JRH A;  5CXG A;  4EEF G;  3S2H J;  2K9N A;  3GBG A;  2GEN A;  1WGX A;  1MH4 A;  9ANT A;  2DA1 A;  1JKR C;  3GTM J;  1G2H A;  1X2M A;  1MH3 A;  3A02 A;  2QCO A;  3NXC A;  4NN1 A;  4JYK A;  3BR6 A;  5JLX A;  1ZTR A;  1FIP A;  2L9R A;  4DYR A;  2MSY A;  2R5Z B;  2NX4 A;  3O60 A;  2L7M P;  3LOC A;  3S17 J;  4JX5 A;  1H88 C;  3GTO J;  3PPB A;  5E3O A;  3D1N I;  3FK6 A;  4RBO A;  3L1P A;  2V57 A;  1ETK A;  2W53 A;  5EF6 A;  3RKQ A;  2P81 A;  3AQS A;  4X1E A;  5FKN A;  2JN6 A;  1RKT A;  2R5Y A;  2QOP A;  1UI6 A;  2Y9Z A;  3Q0U A;  4M3G A;  2PZ9 A;  1QVU A;  3HTJ A;  1RKW A;  2M8G X;  1SFO J;  4MFE A;  1K61 A;  1DU0 A;  3PM1 A;  5E3L A;  2DA3 A;  4A3C J;  1I3Q J;  3BR2 A;  2X9D A;  4CGR A;  5EG0 A;  2VKE A;  3JRC A;  2Q24 A;  2NP3 A;  4XID A;  3OIO A;  3ON4 A;  1AKH A;  2DN0 A;  4DYC A;  3H0G J;  5EDN A;  5EGO A;  4CYC B;  4JP0 A;  3KKD A;  2Y9Y A;  2XB0 X;  3K7A J;  5EZG A;  3HOW J;  2ZB9 A;  3LWJ A;  4AYB N;  1WPK A;  5K7F A;  4M3F A;  3HTI A;  1RES A;  4IEJ A;  5J1U A;  2QTQ A;  2XDN A;  4QSH A;  1U8B A;  2CQX A;  4QIW N;  3HOZ J;  1ETX A;  1JUP A;  4A3K J;  2CUE A;  1HCR A;  2E1O A;  2LKX A;  2QF7 A;  1ORK A;  3S16 J;  1A6I A;  2YVE A;  2K9Q A;  1X2N A;  1IGN A;  1U9N A;  4V2F A;  2FX0 A;  3S5R A;  2XGC A;  4Y7N J;  3B6A A;  1GUU A;  3HOV J;  3VVX A;  1IJW C;  2WUI A;  1P7J A;  3HOY J;  1B8I B;  5C4J J;  1ZR2 A;  2REK A;  1AU7 A;  5E3N A;  2R5Y B;  3JRE A;  3VUQ A;  5M3M J;  2FD5 A;  2NS8 A;  2EZL A;  1Q1V A;  2HOS A;  2RAS A;  2EBI A;  2CU7 A;  2LY9 A;  3HIM A;  4MIM A;  5F0H A;  4IHY A;  5EEA A;  5F0C A;  5CXI A;  1HOM A;  2UXH A;  3BHQ A;  1YRN A;  1ENH A;  2WAQ N;  3ZQF A;  1JKO C;  2DA5 A;  1NK2 P;  1LE8 A;  2DJN A;  4XRS A;  3JRA A;  4ICH A;  2HXI A;  3G56 A;  2OF7 A;  1ZQ3 P;  2UXI A;  4LOC A;  3Q3S A;  2DMT A;  4B4C A;  1GDT A;  4M3D A;  3JRB A;  2TRT A;  3FRQ A;  3GZI A;  3V6G A;  4JNN A;  5CW8 A;  4FE4 A;  3GTJ J;  1ETV A;  5C3E J;  3JR9 A;  3BR1 A;  4B1R A;  2ZCX A;  3IV5 A;  2KT0 A;  3GTL J;  3ZQI A;  4BY7 J;  2M9H A;  3HOU J;  2WB1 N;  5GPA A; 
#chains in the Genus database with same CATH topology
 1RZ4 A;  1W7P D;  2ID6 A;  3ZCO A;  4LB5 A;  2QIB A;  1YW8 A;  2CV0 A;  4IHW A;  3FF5 A;  3PL8 A;  2X1E A;  4C30 A;  3VP5 A;  4BQQ A;  5LEJ A;  3K6G A;  1T39 A;  2ZFW A;  2FBK A;  3HHH A;  2OER A;  1SVO A;  2YX7 A;  2CGP A;  2MC3 A;  1LVA A;  1P4A A;  4G6D A;  5JLW A;  2ISZ A;  2ZJP F;  2Y0S N;  3OOP A;  2HDW A;  4W97 A;  3DPU A;  3RKX A;  4A0X A;  4HF0 A;  2LFB A;  3G4S I;  2EZI A;  2OD5 A;  3I3L A;  4ENM A;  3CCS I;  1V4R A;  2CG4 A;  2NP5 A;  1SAU A;  4BE1 A;  1A31 A;  3JRI A;  2V1X A;  4UV8 A;  1R7J A;  4IHV A;  2X6W A;  4A5N A;  2BEO A;  4WXD A;  2VC1 A;  1PUE E;  3OYA A;  3M1E A;  5M5Y J;  2K40 A;  1XMK A;  2FF4 A;  3S2W A;  2EV5 A;  3WHB A;  3OYF A;  5FKK A;  1OCO H;  3QKX A;  5E17 F;  2M1B A;  2RQQ A;  3BQY A;  3CRJ A;  2K9S A;  2X6O A;  1UJ8 A;  5CJ9 A;  1DDN A;  3Q0V A;  2HDD A;  2WY7 Q;  5D5W B;  2X48 A;  1VF9 A;  2E2J J;  1MBG A;  4I7H A;  1FWZ A;  2K4B A;  3PFI A;  3V8J A;  1ZGW A;  2QEN A;  2P6S A;  4HDU A;  4Y52 J;  1UMQ A;  3GF2 A;  1CQT A;  3HTU A;  1J09 A;  4QPO A;  4JL3 A;  1TWG J;  2GXG A;  3ELK A;  2JQ7 A;  1KA8 A;  1K6Y A;  2JTV A;  3NRG A;  4ZYA A;  3OYC A;  2XGD A;  1QA6 A;  3ZMU A;  4YRV A;  1JUM A;  2LK2 A;  1OFC X;  2DA7 A;  1OYI A;  4EMS A;  4BDZ A;  2GFN A;  2EA2 A;  2JPB A;  2JSP A;  5BMZ A;  3DEE A;  1VQP I;  4HQE A;  5L3D A;  2PX9 A;  5FHP A;  3FWE A;  1MW7 A;  3CCY A;  5K5O A;  3HGG A;  2F5F A;  2XF5 A;  3V7C A;  1TQI A;  4RGS A;  4Q5S F;  4ZJZ A;  3T0Y A;  3J80 K;  4EAT A;  2COB A;  3HM5 A;  4PDK A;  3FXJ A;  1VQ7 I;  4FTH A;  1Y8R B;  3CF5 F;  1X1C A;  3BPX A;  4XSZ F;  3FXO A;  3T1B A;  1G6N A;  1IF1 A;  3QBM A;  1MBK A;  5FGL A;  3ULQ B;  3J7A O;  4GFK A;  3PNV A;  4S04 A;  3A4C A;  2DXI A;  5L3C A;  1WCM J;  1POG A;  1J7K A;  4I6Z A;  1BR4 A;  1LPQ A;  1I50 J;  2LSO A;  3KP3 A;  3GW2 A;  2IU5 A;  2DMQ A;  3K70 D;  1XSX A;  1B8I A;  1YJW I;  3OIP A;  2LH9 A;  4D5C A;  4DZP A;  3SFI A;  3CCE I;  1FC3 A;  3LMM A;  4G12 A;  5FKL A;  5BPD A;  2LF8 A;  3U21 A;  3L9F A;  2KLO A;  3ABT A;  3BRO A;  4A3F J;  3ZQQ A;  2EV0 A;  3MVP A;  5A2Q Z;  6PAX A;  3HHG A;  5HDG A;  4RGX A;  3TO9 A;  2CRG A;  2QBY A;  2XSJ C;  1PUF A;  4YIR X;  3OV8 A;  4RB1 A;  3WTV C;  2LP0 A;  4G7O F;  1B72 A;  4CZZ A;  2L9V A;  3QPH A;  3EYI A;  2A3S A;  2VPR A;  1ON1 A;  5M5W J;  3TOA A;  3NWT A;  2WTE A;  2ZXW H;  2KFD A;  4UV9 A;  2L9S A;  2LOO A;  3CZ6 A;  2JVG A;  1ETW A;  3FM3 A;  1RUO A;  2HQ5 A;  2QYO A;  2HYF A;  4CCJ A;  3OS1 A;  3D5R C;  1R49 A;  3CCV I;  2GIZ A;  3NPI A;  5DCF A;  1K4T A;  2HFH A;  4M71 A;  4M72 A;  3I59 A;  4RB2 C;  3AG4 H;  2DYS H;  1L3L A;  2AXT C;  1MIJ A;  2XGE A;  3G1L A;  1TP4 A;  2VON A;  2JSC A;  2WAE A;  5HDN A;  3A03 A;  2HZT A;  1U9O A;  4I2O A;  2EPF A;  4KMF A;  4M74 A;  4HF2 A;  2RHA A;  4XLE A;  4BAY A;  3JSO A;  1H0M A;  3BR5 A;  2CV2 A;  1GLN A;  4AID A;  1TWF J;  3WGH A;  2HXO A;  3PNT A;  2WV1 A;  3JSJ A;  4JBA A;  1FEX A;  1XMA A;  5EG0 B;  4N0B A;  4EJV A;  2FBI A;  2VJ4 A;  2NXN B;  4ZDL A;  2FA5 A;  4XKW A;  3VOX A;  3KET A;  2BZT A;  3KP5 A;  3Q0W A;  3CP2 A;  3G1O A;  1HF0 A;  4C3I J;  2HTS A;  2HEO A;  3KEY A;  3EET A;  4NB5 A;  3JRG A;  1SD4 A;  5D5V B;  2MW8 A;  2EIJ H;  4MTD A;  4C3H J;  4FX4 A;  1WJB A;  2BGC A;  4XOT A;  3FIS A;  2M3A A;  4I76 A;  4RGU A;  5IP6 A;  3BOQ A;  3WE2 A;  1MJB A;  2QM3 A;  2R3S A;  2G3B A;  2JZY A;  2FJ1 A;  3U1K A;  1YO5 C;  4RM3 A;  4V2G A;  4IHT A;  2IS6 A;  4O6J A;  2YU9 J;  2Z3Y A;  5HS7 A;  3CUQ C;  5ILS A;  4AYB A;  3OYL A;  4PXI A;  2ZME B;  1YI2 I;  2IBD A;  1IUY A;  4CXF A;  1MMS A;  2FNA A;  1SAN A;  1XMX A;  1FYK A;  3F9K A;  2VJ5 A;  4ZH4 F;  2PMU A;  2RVC A;  4PSW A;  1PP8 F;  5BPI A;  3AFH A;  3HOT A;  3E7L A;  4KT6 A;  1BR2 A;  1LEA A;  1OCT C;  5DS9 A;  1I1G A;  2A5Y B;  1Y56 A;  3RH2 A;  1RR7 A;  2WWY A;  1R1U A;  4CCN A;  2VAS A;  4CH7 A;  3EGQ A;  2K27 A;  2TCT A;  1R1V A;  2HYG D;  3K0L A;  2V9K A;  1B1B A;  2DMN A;  3HRS A;  2L7Z A;  2YSR A;  3QYB A;  3MKW B;  4PJ0 C;  3CMY A;  2Z33 A;  2XB5 A;  3I71 A;  2XSD C;  1S7A A;  2PBI A;  2R7D A;  4IQJ A;  3BG9 A;  5B1A H;  1JXS A;  2FBQ A;  4DYQ A;  1VQ5 I;  4ZDO A;  3IWZ A;  2BW3 A;  2OU2 A;  4KFC A;  3HGY A;  4A3G J;  2BY3 A;  2HYJ A;  5LBQ A;  3GEZ A;  4U87 A;  2DI3 A;  2K85 A;  3QOP A;  2GA1 A;  4KIT B;  4J19 A;  5DM6 F;  1OMI A;  3MQ0 A;  2DDA A;  1LQ1 A;  2ISY A;  3F8M A;  4YEJ A;  4D5F A;  3OSF A;  1M1E B;  2YU3 A;  1O4X A;  2CQQ A;  2ZXH A;  4XLH A;  2KKO A;  1FZP B;  3E6C C;  4XKV A;  1Y8Q B;  3BJO A;  1U78 A;  1ODD A;  1TZL A;  2PMZ N;  3F6V A;  3NNR A;  3PSF A;  5KVR A;  2H1K A;  3PQK A;  1HC8 A;  4Q47 A;  2HI3 A;  5GAG J;  5DCM B;  2KZV A;  2R7F A;  2OQG A;  1ETY A;  1BW6 A;  2EFP A;  2WB1 A;  3ZMS A;  1BM9 A;  3TBI A;  3J7Z I;  3BG5 A;  2V1U A;  4MQV A;  3VTI A;  1MNE A;  2E36 A;  1YW9 A;  2BXZ A;  2G7G A;  1DGW Y;  3BCG A;  4MLO A;  5D6F A;  4BU2 A;  3ML6 A;  2QBY B;  2PBX A;  4L9N A;  4FQG A;  2M45 A;  1K7A A;  4JKZ A;  5D5X B;  5FD6 A;  1IDZ A;  1JGS A;  4BXU A;  2O61 A;  4GO1 A;  5M5X J;  2B63 J;  3CLQ A;  4ZTJ A;  3A01 A;  4MXM A;  2E5N A;  3M4O J;  2PG4 A;  1Z67 A;  3I54 A;  2XAU A;  4L5E A;  4WXH A;  5DYM A;  3G1M A;  2DYR H;  1S9H A;  2EB7 A;  3LHQ A;  3VVY A;  3WE3 A;  2A5W A;  3SJM A;  4UXN A;  4IPA A;  3C3W A;  4M3B A;  2WA0 A;  1XSD A;  3JRH A;  1HSJ A;  2Y75 A;  3LSK A;  4AIK A;  4X0G A;  1J5Y A;  2ZME A;  4UVB A;  4QLC U;  5JVT A;  1MH4 A;  2IGO A;  2DA1 A;  2OTJ I;  1UHW A;  3A02 A;  1X2M A;  2QCO A;  4P5O A;  2HWV A;  1QZZ A;  2L3D A;  2X6Y A;  1FIP A;  1I1S A;  2MSY A;  2R5Z B;  3O60 A;  2L7M P;  3LOC A;  3S17 J;  2RGV A;  1H88 C;  1K79 A;  2XUB A;  3ZRG A;  2EFW A;  2RN7 A;  2V57 A;  2M30 A;  2MFZ A;  1BI3 A;  3IL2 A;  3CDH A;  3F72 A;  2Q1Z B;  4BE2 A;  1O57 A;  2LKS A;  5L3G A;  4IKF A;  1SFO J;  2FUG 2;  2MH9 A;  2ZC2 A;  3KLN A;  5HNF A;  1K61 A;  1D8J A;  2DA3 A;  3BJ6 A;  2X9D A;  4M9S A;  1V55 H;  5EG0 A;  2VKE A;  2Q24 A;  5EGO A;  4CYC B;  4JP0 A;  1UFM A;  2QQ8 A;  5CYV A;  1SD7 A;  5KHD A;  3F23 A;  1QO0 D;  5EZG A;  2ZCW A;  3LWJ A;  4AYB N;  1WPK A;  3IP4 B;  4IZZ A;  2ELJ A;  1RES A;  4IEJ A;  2RC4 A;  3GCM A;  1SMT A;  1U8B A;  3EDP A;  1ETX A;  3A2K A;  1TNS A;  2HVS A;  3VOE A;  3ABM H;  1A6I A;  1R22 A;  3BC8 A;  5GAH J;  3CCQ I;  3DLA A;  4V2F A;  1P2F A;  4LG0 B;  1W5C C;  3S5R A;  2GIV A;  2NVU B;  2XGC A;  3MWM A;  4HX7 A;  4Y7N J;  1JHH A;  3B6A A;  1P6R A;  2VLA A;  2K9L A;  1P7J A;  4P1W A;  5A2Q K;  3HOY J;  2WUI A;  5C4J J;  2PJR B;  3LQQ A;  4B3X A;  3SZT A;  3H5A A;  4KYW A;  2P6T A;  3VUQ A;  3ABK H;  4G9Y A;  1W1W E;  4BHC A;  2RAS A;  4EJU A;  4MIM A;  3DEU A;  3J81 Z;  1PVE A;  3DTK A;  5F0C A;  2FU4 A;  4YFN F;  3PUB A;  1FBU A;  3ECH A;  1X1D A;  3VEP A;  2H6C A;  2DA5 A;  3NQO A;  2RKH A;  1ZRC A;  2DJN A;  4IL6 C;  3JRA A;  1RRJ A;  4ICH A;  2F4M B;  1ZQ3 P;  2UXI A;  3AL0 C;  3Q3S A;  3HIF A;  1R00 A;  1FSE A;  3JRB A;  1EV7 A;  3FRQ A;  4CIC A;  3ZGK A;  4WXC A;  3GZI A;  4UB8 C;  4JNN A;  4F52 A;  2XHK A;  3GLL A;  3VYT B;  3RCO A;  3JR9 A;  1GHC A;  1OCZ H;  2ZCX A;  4E7Z A;  3J80 Z;  1TNT A;  1ZYR F;  3IV5 A;  3GTL J;  3PQJ A;  5E20 A;  4A6E A;  1F5T A;  3DBL B;  1YQA A;  4PZJ A;  2XVC A;  3L7W A;  3DKW A;  1W5S A;  3HOU J;  3V7R A;  2EA4 A;  2Y0S A;  5GPA A;  1Z6T A;  2MLG A;  1X1A A;  4LLL A;  2L02 A;  4L62 A;  3KZY A;  1W36 C;  3P9T A;  2D45 A;  2BVM A;  2X51 A;  4CZC A;  4BXF A;  1HST A;  4E7H A;  1ZLK A;  3L2U A;  3IAS 2;  3QPT A;  3P9I A;  2E1M B;  2ZSI B;  2M87 A;  2KMU A;  4V19 K;  4RA2 A;  1MJ9 A;  3SDB A;  2HOA A;  4LB6 B;  5AON A;  3J7Y J;  4OWR B;  3CP8 A;  2QQA A;  3IH4 A;  3LFU A;  3RIR A;  1APL C;  4G6Q A;  4A6D A;  4D7N A;  3DTI A;  3UKG A;  5DD4 A;  4P55 A;  5FD5 A;  4MFD A;  5IYC J;  1JE8 A;  1DP7 P;  3DKY A;  2G7L A;  5AQC A;  2H27 A;  1LDJ A;  4E7S A;  4EJT A;  3SYT A;  2CV1 A;  2X0L A;  1WRJ A;  1HDP A;  5DV5 A;  3T5X A;  3OY9 A;  3OSG A;  2CUZ A;  3LA2 A;  3I55 I;  5CKT A;  1ETQ A;  4L0Z B;  4MK6 A;  3U2R A;  4BGD A;  3IKT A;  2HVQ A;  3QPL A;  2OI8 A;  3KZ9 A;  2ECB A;  4U9L A;  3WTT C;  4FET A;  4Z2Y A;  4A12 A;  5CPR B;  1R23 A;  1VFC A;  2GA2 A;  1VZ0 A;  1QPM A;  4KIC A;  5LLQ A;  1S3J A;  2F5D A;  1CF7 A;  1S7E A;  2NVY J;  1XGN A;  4HAM A;  3GZ5 A;  3H35 A;  4MO7 A;  1U0J A;  1EKE A;  1UZC A;  4XRF A;  4OIO F;  2BBY A;  1H9T A;  5DTD A;  1PDN C;  3RZO J;  3BJB A;  3GTG J;  5IOZ A;  3ZMV A;  2FJI 1;  5D5U B;  3BG3 A;  4XK4 A;  3ZQC A;  1FT9 A;  4DQ2 A;  1BIB A;  1P9Q C;  2QKM B;  3BR3 A;  4OOI A;  3RDI A;  1LUJ B;  1S72 I;  5EZH A;  1EJ9 A;  3BTJ A;  2Z9O A;  3NAR A;  3MEX A;  4LIV A;  3T6N A;  4U7D A;  1DPR A;  2K02 A;  4JOM A;  4PGG A;  2LTP A;  3PSI A;  3V42 A;  5FLX Z;  4OIQ F;  1XD7 A;  1XSV A;  4XKB A;  4R1H A;  2XGX A;  5L3F A;  4U9N A;  5J3L A;  5HS9 A;  1Y0N A;  4CCL A;  4BYY A;  1CGP A;  4XLA A;  5J47 A;  2A69 F;  3RQ4 A;  4HKU A;  2KHM A;  2L0K A;  2JA8 J;  2OUM A;  2XAG A;  2HQR A;  2ZNY A;  2FXA A;  1B59 A;  3HPG A;  1AHD P;  2ELH A;  5J4V A;  2VC0 A;  5LFA A;  4ZZL A;  3Q5F A;  1HLV A;  3I4M J;  2Y69 H;  3UNG C;  1BC8 C;  2E35 A;  5M3F J;  1NG7 A;  3Q9S A;  3WG7 H;  3I9V 2;  3S1Q J;  2BY0 A;  2CQK A;  2GWR A;  1Z6R A;  4ME9 A;  2MYS A;  3SEZ A;  3ABU A;  4M73 A;  4MEY F;  2D5V A;  2IRF G;  2WY8 Q;  3H9G A;  5BNG A;  5ILU A;  5IPA A;  1GVD A;  1I39 A;  3OYB A;  2FQ3 A;  4L5J A;  5IT9 Z;  2MH2 A;  4BY1 J;  4WX9 A;  4HZF A;  1B72 B;  3V78 A;  3IRQ A;  3MKZ A;  1BN5 A;  2DA2 A;  3TGN A;  3BLY A;  4ASN A;  3CCU I;  4NEL A;  3RQI A;  1U3E M;  2N8G A;  4RAG A;  2XPW A;  4P9U A;  4KWA A;  2ZOY A;  3HUG A;  2DMU A;  1V54 H;  3CQZ J;  3FHN A;  4WWC A;  4R79 A;  3TMO A;  2MD5 A;  3NS4 A;  3FXL A;  2LR8 A;  3E5X A;  1FTT A;  1JKQ C;  5CQE A;  5LHH A;  3HTA A;  4NC6 A;  3JTH A;  1EF4 A;  3BPV A;  1T33 A;  2BY1 A;  2BYV E;  2DTZ A;  3RYR A;  3TP3 A;  5DM7 F;  5F0F A;  2O03 A;  1OR7 C;  4XR6 A;  4AVP A;  1MMN A;  4A93 J;  3K2A A;  1JI8 A;  2G0E A;  3DV8 A;  3F8F A;  2E7X A;  2IGM A;  1E17 A;  3GVA A;  3K10 A;  3EPZ A;  1W0U A;  3L2W A;  3E0J B;  1MBJ A;  3N4M A;  1TWC J;  2ME0 A;  1JJ8 C;  2DOD A;  5DCM A;  2V26 A;  1FYL A;  3HBL A;  2ZOZ A;  3I59 B;  3S2D J;  5IOY A;  4FX0 A;  5HS8 A;  3LSJ A;  4EGZ A;  1FMW A;  3ONQ A;  1QHG A;  1LB2 A;  4WK8 F;  1S6L A;  2W24 A;  2HOT A;  2Q0O A;  4U0Y A;  3WTY C;  5D18 A;  4RM2 A;  4AIJ A;  4GCT A;  2OCE A;  2IA2 A;  1WJF A;  1ZGA A;  4CUG A;  1V5E A;  1H8A C;  2EZH A;  3NI7 A;  4A69 C;  2ZFU A;  5EEG A;  2OAZ A;  1LNW A;  1WJE A;  4E7I A;  1U8R A;  3BQZ A;  5J1R A;  3HJE A;  4RLF A;  2MAB A;  2O5R A;  4KT5 C;  4RAY A;  2VXD A;  3ERE D;  4PGH A;  3U1D A;  1U5T A;  1XCV A;  1T0F C;  4II2 A;  3O8G A;  2LY1 A;  4KDP A;  2AQF A;  2Z5U A;  4HQM A;  5TGT A;  3K4K A;  2KIQ A;  2H94 A;  2UZK A;  1WHU A;  4ACI A;  4M6X A;  4XN0 A;  5D4R A;  1S5L C;  5B3S H;  1BBY A;  5E8G A;  4KIB A;  2DPD A;  3M07 A;  4NUB A;  2X6X A;  3HB9 A;  5FKO A;  1F1Z A;  4BQO A;  2BHY A;  4F55 A;  1ZR4 A;  2A2F X;  4E7L A;  4DBR A;  3KNW A;  4M3E A;  3OS0 A;  3OYJ A;  2WAF A;  2LNB A;  3CLO A;  4B3A A;  4M9Z A;  2CFO A;  2ZKZ A;  2CQ7 A;  2ID3 A;  2KRC A;  2AHQ A;  4BXX J;  2XAJ A;  4XRS G;  1XPX A;  1LJ9 A;  1NHA A;  2ACJ A;  2COM A;  1ZN2 A;  4IVN A;  2VUM J;  2IAI A;  4KUM A;  3ON2 A;  3VW1 A;  2V9P A;  2RRE A;  1ACI A;  2V1D A;  1K78 A;  3M8F A;  4HRI A;  1IAW A;  2DOA A;  3K4L A;  3SFZ A;  1O7F A;  3M8J A;  2LG4 A;  2CQN A;  1ON2 A;  1YW7 A;  3ZQL A;  1UHS A;  2DA6 A;  2O0Y A;  3GEU A;  4DW6 A;  4YZE A;  5HOD A;  3F0C A;  1K4S A;  1HW2 A;  3ZOB A;  3RSN A;  4FE7 A;  3K4J A;  4QTR A;  2I5U A;  4EVI A;  2HPI A;  3ZMD A;  2QKO A;  4RMN A;  4C2M J;  2M8E A;  1R71 A;  2KRF A;  3S3O A;  3VYU B;  4EJO A;  2X1C A;  1EH7 A;  3HKZ N;  3ZQ7 A;  3CCL I;  2HOE A;  5AIP A;  3OL4 A;  1UAA A;  2RDP A;  3CDL A;  3OL3 A;  1IRG A;  1U6G A;  2GZW A;  2EFQ A;  5D8L B;  2IS2 A;  2XDV A;  2HQA A;  1IG7 A;  3PO2 J;  4M6Y A;  1WZ2 A;  3GTK J;  4MTE A;  5HAW A;  3OYI A;  2LD5 A;  5ED4 A;  1SD6 A;  1JTX A;  2JMW A;  4I01 A;  3VOK A;  3K4B A;  3LL7 A;  4BHB A;  1GT0 C;  4HBL A;  2PJR A;  2HKU A;  5DDG A;  3BZK A;  3LSM A;  1R4M B;  1IO2 A;  3MFK A;  1RC9 A;  1Y39 A;  1FYM A;  2JA7 J;  3GFL A;  2DO7 A;  5IP7 J;  4HG2 A;  4LLN A;  4AC0 A;  1WVR A;  1YTY A;  1E3H A;  4NDL A;  3CJQ B;  3DBH B;  2W85 A;  4ZYD A;  1FTZ A;  1ZG3 A;  2KIM A;  1T2K A;  1A35 A;  3HOS A;  2ME6 A;  2ECC A;  2XC7 A;  3LSH A;  4ESJ A;  2OA4 A;  3WTS C;  2PMH A;  2VKV A;  4AD9 A;  1TT0 A;  1JKP C;  3LAJ A;  3CUQ B;  1KQ0 A;  1P4W A;  5LGN A;  2P4W A;  3DFG A;  3LSG A;  5FRM A;  1QQI A;  1S7O A;  1VQ8 I;  4NHJ A;  1A5J A;  4YFK F;  5B5E C;  1NK3 P;  4LFU A;  1UG2 A;  1IV8 A;  3HSF A;  2W4S A;  4PFP A;  2J5P A;  3MZH A;  1AKH B;  1IV6 A;  3P5J A;  3HRM A;  2XF6 A;  1RIO H;  1ZAO A;  2YUS A;  3E5U A;  4MHG A;  2FMY A;  4U0V A;  2P5K A;  4JK1 X;  3S2H J;  3I58 A;  2KDO A;  1MMD A;  5LHG A;  3QU6 A;  2QQ9 A;  1X19 A;  4JYK A;  5B1B H;  4NN1 A;  2M0M A;  5F1R A;  1YLF A;  1ZTR A;  2UXX A;  5JLX A;  1XB4 A;  4CDG A;  3W6K B;  4DYR A;  2CW8 A;  5E8I A;  1LDK B;  3QP6 A;  2YR2 A;  4JX5 A;  2LDU A;  5AIQ A;  1SFK A;  4OIN F;  3D1N I;  4PJM A;  4RBO A;  1HW1 A;  2MC4 A;  4ZDP A;  5EF6 A;  2VBX A;  4ZYG A;  2DJI A;  2P81 A;  2Q2E A;  1YOV B;  4KIS A;  2O6G E;  4S05 A;  2JN6 A;  3OR2 C;  2R5Y A;  2Y9Z A;  3Q0U A;  3KP6 A;  5FFX A;  3GYH X;  4CHU A;  1ULY A;  3CO6 C;  3PM1 A;  2HR3 A;  2UUZ A;  3QAH A;  5LRR A;  1I3Q J;  5FB2 A;  2ICW G;  3K1P A;  4L9T A;  1MND A;  3KYC B;  3RJP A;  1UG0 A;  4Y33 A;  1IXR C;  1T95 A;  2M4G A;  3HXL A;  3M8E A;  1AKH A;  2EIK H;  4DYC A;  3GX4 X;  3H0G J;  3KKD A;  4D0P A;  3HC7 A;  4ENJ A;  3QRF F;  1MZB A;  2F4I A;  4L9V A;  2HNH A;  3VYS B;  5J1U A;  5LGT A;  2QTQ A;  1KON A;  3HOZ J;  1OR7 A;  1HCR A;  3WOD F;  2E1O A;  1QBJ A;  2QF7 A;  1ZEL A;  1ZHF A;  2YVE A;  1IGN A;  1X2N A;  1U9N A;  3P9C A;  4UVC A;  2E1N A;  4ENK A;  3PNY A;  2OV7 A;  4ENN A;  3HOV J;  1GUU A;  3P7N A;  5KAI C;  3SHF A;  4F7Z A;  2ESH A;  2F2E A;  3ISP A;  1ZR2 A;  3H9J A;  1A36 A;  1E3P A;  1AU7 A;  5E3N A;  3W2V A;  2R5Y B;  2VKD A;  1FX7 A;  4XOR A;  4Y17 A;  2AS5 F;  4I02 A;  2HOS A;  4NNJ A;  3HIM A;  1XGO A;  3G71 I;  4IHY A;  5EEA A;  1HOM A;  2DK5 A;  3BHQ A;  2WAQ N;  1JKO C;  3ZMT A;  1U5T B;  2HXI A;  3ZMZ A;  1I5Z A;  2A61 A;  1J59 A;  2DCE A;  4Y4R A;  2TRT A;  2V4J C;  3SWH A;  2RNJ A;  2K5C A;  4HX4 A;  5CW8 A;  3FMS A;  2DAO A;  4U88 A;  2E1C A;  3T8T A;  2PMZ A;  1ETV A;  2OBP A;  3B02 A;  3FBN B;  5CVU A;  3KYL A;  2KQR A;  2AQE A;  3NEU A;  1ZLJ A;  1Y6I A;  4BY7 J;  2M9H A;  4IOA F;  3IAM 2;  1HBX G;  2WB1 N;  4D1Q A;  3KP7 A;  3F6O A;  2NNN A;  1VQ4 I;  3D5S C;  5FLM J;  4XSX F;  3S1R J;  2Z16 A;  1PP7 U;  4GDF A;  3W2W A;  1MMG A;  1E2X A;  5H6Q A;  5LEK A;  3N97 A;  1SAX A;  4AF5 A;  4FCY A;  4HNU A;  5CVJ A;  5HLI A;  5J1Y A;  4S0H B;  3OOU A;  3JAM K;  1J9I A;  4LMY A;  3S3M A;  2ZBK A;  1BW5 A;  1KZH A;  3KZZ A;  4M9X A;  2BVL A;  2QUF A;  2W00 A;  3IH2 A;  4HA8 A;  4ZZD A;  4BAC A;  3ZR8 X;  4GCV A;  4F93 B;  4IHX A;  2B9S A;  2W48 A;  1DGR M;  2R0Q C;  3L2V A;  3CMA I;  2CWE A;  4JX6 A;  1W7P B;  2VPL A;  2M7B A;  3E6B A;  4B48 A;  1KU7 A;  5LHI A;  2VB6 A;  4OIR F;  1QGP A;  3HPH A;  4ABZ A;  3IUV A;  4NQW A;  4II3 A;  2O8X A;  1WJC A;  1I6X A;  4ZTF A;  5K7Z A;  2EWN A;  1N75 A;  3W3C A;  3B6C A;  4YEL A;  1Y1W J;  4NC8 A;  4HNV A;  1VI0 A;  2DFF A;  4OMY A;  4EJW A;  1D5Y A;  3TOB A;  3VDX A;  5HOO A;  3BRU A;  2XRL A;  4DNC A;  3E7Q A;  1NG6 A;  3ANP A;  2O7O A;  1JJ6 C;  3H5N A;  1SFX A;  2F5C A;  3K1M A;  1BI0 A;  1G3T A;  1HQC A;  1R4N B;  4ZYE A;  3VFZ A;  2UWM A;  5K58 A;  2LF7 A;  2L7F P;  4LIU A;  4BUP A;  1J2X A;  2VQG A;  3BT9 A;  2W7N A;  4H0E A;  3KFW X;  2B3W A;  2L54 A;  3CMM A;  1JHF A;  2XIG A;  2KPM A;  3EQL F;  3LFK A;  5E79 C;  4B09 A;  3GTP J;  1LDD A;  2GXA A;  2BOL A;  1PYV A;  3O2P E;  1BJZ A;  2BXY A;  2OCC H;  4C2U A;  5C4Y A;  3LSP A;  4K2E A;  1HW5 A;  2CYY A;  1KQ9 A;  4G7Z F;  3IWF A;  3CF2 A;  4KNY A;  1YRN B;  3DTE A;  2DMP A;  3VW2 A;  2VN2 A;  4A3M J;  1R5H A;  1QRY A;  3JTG A;  2GBY A;  2K86 A;  1T98 A;  3QYF A;  2NRA C;  1F43 A;  1FOX A;  3EUK L;  3CDI A;  3D5L A;  1PUF B;  5E3M A;  2L01 A;  2IGN A;  3O6B B;  3GFM A;  1BI1 A;  2VJI A;  4CGZ A;  3EUP A;  4IXA A;  1VQL I;  5L3B A;  2DFE A;  4DZJ A;  3DU6 A;  3R0J A;  4G7H F;  4MNU A;  2M34 A;  5FLV A;  4DGW B;  5HVQ C;  4XL9 A;  3E1S A;  2W25 A;  3NWS A;  2JUC A;  1IC8 A;  3CC4 I;  2ESN A;  2D1V A;  1J75 A;  2GOM A;  4OU0 A;  2MGQ A;  3KE2 A;  4BS9 A;  2W1O A;  5K5Q A;  2JJ7 A;  1IRZ A;  3BTL A;  1RET A;  5ERI A;  2D2W A;  2XRO A;  2NVQ J;  2DLL A;  2QKL B;  1BC7 C;  3GO5 A;  3RKW A;  5DAJ A;  1LEB A;  5TIS C;  3FKI J;  1YYV A;  5GTI C;  4RB0 A;  1R5I D;  2FML A;  3K8P C;  1XGS A;  2BY2 A;  2DU9 A;  2JK3 A;  1F9N A;  5CVV A;  1W7P A;  3HDD A;  5EJC A;  5BOX A;  4Y15 A;  2V7F A;  3W6V A;  3S14 J;  1X4O A;  1BIA A;  4J01 A;  1LE8 B;  1XDU A;  2NVT J;  2ZXJ A;  1D1B A;  4BEH B;  2CMP A;  2Y2Z A;  1O3Q A;  4N4O B;  1W0T A;  3P9K A;  1E3O C;  1P92 A;  3VPR A;  2PFB A;  1Z1D A;  5HLT A;  1QVT A;  1TBX A;  2FBH A;  1HKQ A;  1QHH D;  5F27 A;  1MBH A;  3EUA A;  3OYD A;  1F4K A;  1ZRD A;  5JHF A;  3R60 A;  3FDY A;  4OAZ A;  4UUS A;  3HOX J;  1P7I A;  2LY2 A;  4HST A;  1IRX A;  1ZH5 A;  1XN7 A;  5ILV A;  3UR3 C;  1WKM A;  2V79 A;  3MMY B;  2DA4 A;  4XRM A;  2DT6 A;  1IN5 A;  4AVZ A;  1MBE A;  3CJT B;  3DPJ A;  3ZP5 A;  4IRI A;  3C07 A;  2XKO A;  2XPU A;  4TV7 A;  4QWQ A;  4UHT A;  3QQA A;  3MN2 A;  1R9T J;  4ESB A;  3KX2 A;  5J4Y A;  3QPS A;  1JTY A;  1SFU A;  2D6Y A;  1VND A;  3OWT A;  3C2B A;  3F21 A;  3V8K A;  1D0X A;  3M3Y J;  4KMU X;  2IS4 A;  5F08 A;  1IRF A;  2KL4 A;  3QOE A;  2GUH A;  3R4K A;  2F48 A;  1XCB A;  5EYR A;  2GM4 A;  5C44 J;  4FAS D;  2AXL A;  2K3F A;  5CVR A;  1U5T C;  2E7W A;  5HBU A;  3KEQ A;  5BQT A;  4BQN A;  1IXC A;  5K7H A;  4P96 A;  2H8R A;  1HXD A;  1HKS A;  2ZJ2 A;  3E5Q A;  4KN7 X;  2VL8 A;  3H5R A;  4XBF A;  4UDS A;  3CD6 I;  3K4M A;  1ZAR A;  1ZRE A;  1A04 A;  3H3U A;  5H9T A;  4DVY P;  4IRH A;  3SDG A;  4YFX F;  2XV4 S;  2DT5 A;  2NOJ B;  3L00 A;  2FSW A;  5FJ8 J;  3VW0 A;  2VQH A;  2HYT A;  1Z3Y A;  3TP0 A;  3Q9V A;  1GV5 A;  3C2H A;  5L3E A;  1BI2 A;  3JSP A;  2R7Q A;  4KA4 A;  3W2A A;  2F07 A;  2Y31 A;  1OCP A;  1D0Y A;  4A3E J;  1G4D A;  3JCU C;  4IQ4 A;  2PI0 A;  1HDD C;  5C4X J;  3HTH A;  1ZG1 A;  4BDY A;  3MNL A;  2KIS A;  2B7E A;  5FMP A;  4I98 B;  1FBQ A;  1UB9 A;  3W6J B;  5IT3 A;  4I0A A;  4CCM A;  4UUV A;  3FM5 A;  3VSL A;  2WGB A;  1J0R A;  2QQB A;  4YG2 F;  3CCR I;  3OYK A;  3CWR A;  3WU2 C;  1U2W A;  1WJ5 A;  1YIO A;  2OQR A;  4EM2 A;  5JFR A;  3OYN A;  1FOK A;  2W57 A;  4ON0 A;  3T8R A;  1T0F A;  5D8K B;  2E71 A;  3FXR A;  1X1P A;  5FO5 A;  2A05 A;  1RR8 C;  1TQP A;  4E4H A;  1G8X A;  4W1U A;  5HDK A;  2ZJQ F;  3BNI A;  2EFN A;  2E19 A;  3B81 A;  2VE9 A;  3WHC A;  2QA4 I;  5F6F A;  4GFL A;  3DCF A;  4ITV A;  1X58 A;  2PN6 A;  4XLC A;  2JWT A;  1ZK8 A;  3RYP A;  5J40 A;  1D8K A;  1BL0 A;  1MBF A;  4GGG A;  4A5M A;  4BQA A;  5EEH A;  3G7R A;  2H09 A;  1UST A;  2YX4 A;  4IRV A;  2EQR A;  2X1D A;  3SZP A;  1T38 A;  4I0B A;  5F04 A;  3RKY A;  5DEQ A;  3IUO A;  3I4N J;  2V6C A;  3IC7 A;  4HEA 2;  4PCQ A;  3J81 K;  4GCL A;  4C2M A;  1N25 A;  2QWT A;  1WQ2 A;  2K9M A;  3OYE A;  4L5I A;  3SZG A;  4FIS A;  1LKX A;  3TDU C;  3D0S A;  4L18 B;  3B73 A;  5K5R A;  1IN8 A;  4BJT A;  4BBR J;  1VQO I;  4LIT A;  2IT0 A;  2VI6 A;  1B9N A;  1KYZ A;  4EM0 B;  4CYD A;  4ETS A;  2VQC A;  1SFE A;  1FIA A;  3BJA A;  1ZKG A;  3R0A A;  1Y1V J;  3DEW A;  3TDZ C;  4E7J A;  3X2Q H;  3H9Q A;  1VQM I;  2K3P A;  1FPQ A;  3RPU A;  4OMZ A;  2ZY9 A;  1Q1H A;  3S3N A;  2OTL I;  3A0B C;  1X4P A;  1C0W A;  2LKP A;  1FMV A;  4B47 A;  3CCM I;  3A0H C;  4IHS A;  4C2T A;  3C7J A;  3SQN A;  1R1T A;  2XPV A;  4KIG A;  2Q8K A;  2G7S A;  4UVA A;  3DWL E;  3OMY A;  2GLO A;  4A3B J;  1XG1 A;  2QVO A;  5B66 C;  2PEX A;  1UEL B;  3FXK A;  5ICC A;  4BJ5 C;  1O3R A;  3IKV A;  2PFV A;  2HQN A;  4IOC F;  4MEX F;  1XGM A;  1B6A A;  3DF8 A;  4BL0 B;  4D7M A;  1NTC A;  4A3J J;  4PJJ A;  2AO9 A;  2I8D A;  2JPC A;  3REO A;  3LNQ A;  3AQT A;  4ESF A;  4YII A;  3BDD A;  2E2I J;  2ZCM A;  2IEK A;  3TED A;  3DLL F;  3HZJ A;  2QSF X;  3HRT A;  4EEF G;  3CUO A;  1MDM B;  2K9N A;  3GBG A;  4HV6 A;  4XNF A;  4L0Y B;  3VWB A;  9ANT A;  1JKR C;  3GTM J;  4LK1 F;  3NXC A;  3K1N A;  2CH0 A;  1X3U A;  3BR6 A;  3LA7 A;  2W84 A;  2E1M C;  1BOA A;  2JRM A;  3L2Q A;  4A0Z A;  1TQM A;  4P9F A;  2L2O A;  2G9W A;  1STZ A;  2VKH A;  1S8N A;  3GTO J;  4HX8 A;  4XQF A;  2EV6 A;  2FOW A;  4XN3 A;  2H1L A;  3C1D A;  1BOB A;  3L1P A;  1FBS A;  5JI6 A;  1VTN C;  5CQG A;  4BEH A;  3AQS A;  2VBZ A;  2VJJ A;  2NNY A;  2EK5 A;  3CUQ A;  4AIH A;  1Z91 A;  2QOP A;  1UI6 A;  3FZV A;  2Y48 A;  2XF7 A;  2Z2S B;  2PZ9 A;  2VOP A;  1SMY F;  3HTJ A;  1RKW A;  1TLH B;  3WGG A;  1ERD A;  4MFE A;  1DU0 A;  1N78 A;  1UCR A;  2WV0 A;  5E3L A;  4A3C J;  3JW4 A;  3BR2 A;  4F3Q A;  1DQU A;  3H3Z A;  3FHZ A;  3CC2 I;  2RNG A;  4XID A;  3OIO A;  2OJE D;  3GZN B;  2MD0 A;  1IXS B;  2D1H A;  3GFI A;  4ZC3 A;  2DFI A;  2XB0 X;  3K7A J;  4N9I A;  3HTS B;  3OYH A;  2OZ6 A;  1MDM A;  2ZB9 A;  2ETH A;  5K7F A;  4M3F A;  1ZRF A;  4O3M A;  3HTI A;  2OC6 A;  4GXO A;  3S32 A;  2XDN A;  2K7L A;  3DP7 A;  3KCC A;  1R58 A;  4QSH A;  2CQX A;  3WTZ A;  4QIW N;  1JUP A;  4A3K J;  2CUE A;  4EM1 A;  2LKX A;  4HYE A;  3R6S A;  2VT2 A;  2BE5 F;  4DJA A;  2FX0 A;  4MQ9 F;  4G8X A;  1AWC A;  4XLP F;  3RPU D;  1IJW C;  4HW0 A;  1SVM A;  1B8I B;  1O3S A;  4J00 A;  4HOB A;  2R4G A;  3TKY A;  2REK A;  1KYW A;  2P8T A;  3RPQ A;  1E0E A;  3JRE A;  2FD5 A;  2NS8 A;  2EZL A;  1Q1V A;  2DOE A;  2ZSH B;  3QU3 A;  5F64 A;  2CU7 A;  2LY9 A;  4LG3 A;  3I64 A;  5GAD J;  2R7U A;  3GUD A;  1NH3 A;  2P7C B;  2L4A A;  5CXI A;  1OYY A;  3ROU A;  4E6K G;  2E5Z A;  2WAD A;  2XAS A;  3FMR A;  2JVH A;  1A6Q A;  3L2C A;  1YRN A;  3DPL C;  4YIF A;  1LE8 A;  4XRS A;  2DK8 A;  1T6S A;  2XKP A;  4BH9 A;  3K9T A;  3TO6 A;  4B43 A;  2OF7 A;  4LOC A;  3WTW C;  1GDT A;  4M3D A;  2X85 A;  5ICF A;  4XON A;  2M7A A;  1Z21 A;  2J5O A;  2VT3 A;  3BR1 A;  4G94 A;  4B1R A;  5C3E J;  3L2R A;  3RI4 A;  2KT0 A;  3AG1 H;  1TW2 A;  2X4H A;  2CUJ A;  3LST A;  3ZQI A;  2GAU A;  3V7S A;  5DUI A;  3AG3 H;  2XRN A;  1I27 A;  4OD4 A;  2HDC A;  2HVR A;  2XAF A;  1OPC A;  3NAU A;  1YIJ I;  1GXQ A;  3LQR A;  1OCR H;  5IYD J;  1WH5 A;  3K69 A;  4HSR A;  1UI5 A;  3COA C;  4BJ6 C;  1TTY A;  2A68 F;  2YS9 A;  3AKZ A;  5F1J A;  1T08 B;  4IRG A;  4PSX A;  4IF4 A;  1JUS A;  3JAM Z;  2IVM A;  4RGR A;  2V9V A;  2ZJR F;  3BCB A;  1TC3 C;  4QPQ A;  1F36 A;  2E60 A;  4LLG F;  1X3W B;  3ZQG A;  1LFP A;  3KZI C;  2STT A;  2R93 J;  2LYC A;  1YJ9 I;  1AA7 A;  3DPT A;  5KK1 A;  2R7S A;  2QWW A;  1XX5 A;  5KAF C;  1WI3 A;  1G3Y A;  2P7V B;  5FRO A;  3KLO A;  3V4G A;  3IH3 A;  4IX7 A;  1FSH A;  1XC5 A;  2FRH A;  2L9N A;  3MZY A;  1OCC H;  4A2U A;  5ICE A;  2ADU A;  1QZY A;  1QNT A;  2CJJ A;  4JX4 A;  1WJD A;  3FXU A;  2EFO A;  2R7T A;  4EGY A;  3KIO A;  1W36 D;  2I10 A;  3L09 A;  2K4J A;  4CSW A;  4Z6Y A;  1FY7 A;  5TRD A;  5ICG A;  1LFB A;  1T8I A;  4DOZ A;  3FMQ A;  4PJL A;  3EYY A;  3GFJ A;  3LSR A;  3DXJ F;  4KJZ A;  5DUK A;  1FOY A;  3CJD A;  2V1N A;  3FIW A;  3FK7 A;  3TW7 A;  2ZCN A;  4UUT A;  1MD0 A;  1WFX A;  2UXN A;  3MCZ A;  4RAZ A;  5DD8 A;  3BG7 A;  3OYM A;  1YIT I;  5FFZ A;  4U0W A;  4LK0 F;  1MGT A;  2OPT A;  2EH3 A;  4HLX A;  2B0L A;  3S93 A;  3LJL A;  1OLT A;  4O5V A;  4E7K A;  2KRH A;  5KCM A;  3AG2 H;  2BHZ A;  2G7U A;  4NBQ A;  2FQ4 A;  5E18 F;  4EV0 A;  1H89 C;  2VOD A;  2L5Q A;  1JT0 A;  2OZU A;  2IJL A;  5J6X A;  1Z0X A;  1LFU P;  1YG2 A;  2VOO A;  2P5V A;  5FKM A;  3VVZ A;  1B4A A;  1SVL A;  2Y0M A;  3FXQ A;  2RV8 A;  4XIC A;  5KNL A;  3MKL A;  4NQW B;  4Y3O A;  2GXB A;  3JRD A;  2KDZ A;  2DQL A;  2Q2E B;  1V5F A;  2JRT A;  2HS5 A;  2CUF A;  3PAS A;  1EA3 A;  1T56 A;  2KJC A;  5EGO B;  4CYC A;  4RDU A;  3EUH C;  2QEX I;  3H36 A;  2F4O B;  3HSR A;  3S1N J;  3QWL A;  2LC2 A;  1ETO A;  4G6T B;  3ZN0 A;  4RB3 C;  5D6E A;  1N77 A;  2JT1 A;  2JA6 J;  2DDB A;  4UUS B;  1YX5 A;  2R7Z J;  1RI7 A;  2ELK A;  4B44 A;  2TDX A;  3BWG A;  2R7W A;  1HKT A;  2R7O A;  1KU9 A;  3E6M A;  2M0C A;  3E3V A;  4M6V A;  5FLX K;  5IY5 H;  1O7L A;  3DU5 A;  4GRI A;  3V8L A;  2YVH A;  2DQR A;  5D1R A;  3S15 J;  1W5T A;  3GXO A;  5E1Z B;  3RD3 A;  1DUX C;  1TL8 A;  3ZPL A;  5H2F C;  2O8K A;  5EFY A;  1SC7 A;  2A07 F;  2EZK A;  2L7K A;  3S1M J;  3CJR B;  2LLK A;  4PK4 A;  2NVX J;  3FKJ A;  2PJP A;  2A6H F;  4NC7 A;  2HKO A;  2O7T A;  1V5G A;  4X6A J;  2DPU A;  3ASO H;  4L9J A;  2VXZ A;  1GVJ A;  3KYD B;  3E97 A;  3ESW B;  1Z7L A;  3CCJ I;  4JQF A;  1G3S A;  4XMY A;  2CW7 A;  1VQ6 I;  1KU3 A;  4Y13 A;  3CES A;  2BW3 B;  4AUX A;  1MJA A;  1DU6 A;  3WTX C;  4ANJ A;  1XDS A;  2NOG A;  5CLS A;  3M9A A;  2UXP A;  3A01 B;  1G3W A;  2LBF A;  4AM3 A;  3VYR B;  4OIP F;  1D3Y A;  3KEO A;  1GV2 A;  1YS7 A;  2L4M A;  5JR3 A;  4UNO A;  1FNN A;  2JA5 J;  3JRF A;  1TWH J;  2M2E A;  2IA0 A;  3G6E I;  3IRR A;  2WC2 A;  2DG8 A;  3F1B A;  3C18 A;  3WTU C;  3PIO F;  2CO5 A;  4CCO A;  2MBF A;  4BBS J;  3NRV A;  1B9M A;  2IW5 A;  2MA3 A;  2P0W A;  4XM3 A;  4UB6 C;  1DPU A;  2ZXI A;  1S29 A;  1O3T A;  1YE9 A;  2IPQ X;  1RNL A;  5LGU A;  2Y30 A;  3GZ6 A;  2R5Z A;  4D9J A;  1BR1 A;  1K83 J;  3GWZ A;  1Z9C A;  1IUF A;  2R7R A;  5K1Y A;  3ZN1 A;  1UHM A;  2V6E A;  1OJL A;  3CTA A;  4UY8 I;  3H0D A;  3VIB A;  3ZXS A;  3K4N A;  4B8X A;  2E2H J;  5D19 A;  4AWX B;  4U7B A;  2QSH X;  1YX3 A;  3AL0 B;  2G7H A;  2CFX A;  1Y0U A;  3K70 C;  1USS A;  2UV1 A;  2ZME C;  3CJN A;  3KP2 A;  4LD5 A;  1MSF C;  1D0Z A;  2RQP A;  1X3Z B;  4A3L J;  1OIS A;  4OD5 A;  1R6R A;  1TWA J;  5BS6 A;  4LG0 A;  1WWX A;  4FHT A;  3F8C A;  2HPM A;  3CC7 I;  3PJR A;  1YS6 A;  1BJA A;  3ZQH A;  2IGK A;  4N4N B;  3GTQ J;  2IS1 A;  2A6E F;  3HRU A;  1ZGJ A;  3VSK A;  1IDY A;  2F5V A;  1RPW A;  3VOD A;  3BTC A;  4F92 B;  3QYE A;  4AC6 A;  2DBB A;  4HDV A;  1MNM C;  1YHQ I;  2R7V A;  5JVG F;  4E70 A;  1EH8 A;  1WH7 A;  4GYI A;  4IO9 F;  4HV5 A;  3F8B A;  4HF1 A;  3IHU A;  3DBR B;  4DIQ A;  1ONV A;  1K78 B;  3G73 A;  2R92 J;  3BG6 A;  1QU3 A;  2UXO A;  1ITY A;  5H20 A;  1QZE A;  4LGW A;  2MG4 A;  4BKX A;  3KP4 A;  5IP9 J;  5JHU A;  3HE0 A;  2RAE A;  4RAF A;  1XTA A;  1BA5 A;  2NS7 A;  1PJR A;  2IA1 A;  1RUN A;  5FRN A;  1HA8 A;  4H4K C;  3RZD J;  3BY6 A;  2VBY A;  1OKR A;  3GLX A;  2NS0 A;  2F5E A;  1MSE C;  2DG7 A;  1AOY A;  3F8N A;  3MKY B;  3I0T A;  1MKM A;  3F3X A;  3G3Z A;  2KZG A;  2DTR A;  2Z99 A;  5E1W A;  3ECO A;  4BHP A;  5J8C A;  2DT7 B;  4WF2 A;  3AAF A;  3LSI A;  3LAP A;  2W82 A;  5IYB J;  2C6Y A;  1QPI A;  4CO8 A;  1G59 A;  1I6H J;  5IT9 K;  4PJN A;  3TL4 X;  5D4S A;  4F91 B;  1W4M A;  4N9H A;  3SXY A;  3DQV C;  5GPC A;  3H3V K;  4R8H A;  5HLH A;  1VQ9 I;  3KKC A;  4RS8 A;  2LVS A;  2CW0 F;  3N05 A;  5GTH C;  1VQK I;  3HEF A;  4C9Y A;  2STW A;  4GFB A;  2XAQ A;  3HKZ A;  2HKX A;  4DBQ A;  3O8H A;  1ZG5 A;  1TW3 A;  1WJA A;  4HPQ A;  2FOK A;  2IXS A;  5HSZ A;  4XKC A;  2P5L C;  4A3I J;  4KN4 X;  2QLZ A;  1XS9 A;  3TW6 A;  2R7X A;  4PFO A;  3K2Z A;  3PUF A;  2UXU A;  3BTI A;  3G2B A;  3PO3 J;  1FJL A;  1X1B A;  3FX3 A;  1D5V A;  1SGM A;  4A3D J;  2NYX A;  2F6C A;  3COL A;  1Z77 A;  4I09 A;  1SEU A;  3I53 A;  1DP3 A;  2XAH A;  2QGU A;  5GP9 A;  1IN6 A;  2O9L A;  3I56 I;  3ANG A;  3I5U A;  3U9G A;  4A0Y A;  3HL2 A;  1MMA A;  4C3J J;  2YPR A;  3DKX A;  1JT6 A;  3BR0 A;  2HZD A;  5CVI A;  5HLG A;  3I4P A;  1IN7 A;  3GME A;  2QZ8 A;  4GCK A;  3OIQ A;  1K6O A;  2EJR A;  3OR1 C;  3BZC A;  4PUS A;  1Z05 A;  5LRS A;  2EIL H;  1JGG A;  3ABL H;  2VBW A;  5CXG A;  1Z3X A;  2DOF A;  4AU7 A;  2LMD A;  2GEN A;  2ZO4 A;  4WIB A;  1WGX A;  3MD2 A;  2WBM A;  3FXM A;  2E34 A;  2JUG A;  2DW4 A;  5FGM A;  1MH3 A;  5J8F A;  2MLK A;  4BE0 A;  1G2H A;  1KU2 A;  3SEQ A;  3PIP F;  1FLI A;  2L9R A;  3QP5 A;  2NX4 A;  2FNP A;  3M1C A;  2DFH A;  1WSU A;  3WGI A;  5E1X A;  3PPB A;  5E3O A;  1YFH A;  1KQ8 A;  4XLN F;  3FK6 A;  4WCG A;  5HNH A;  1ETK A;  4IJA A;  2W53 A;  3EUH A;  1D1C A;  5GAE J;  2CSO A;  3RKQ A;  4X1E A;  3VB2 A;  2HTJ A;  5FKN A;  2YVX A;  1RKT A;  4CCK A;  4M3G A;  4BNC A;  4I99 C;  3CME I;  1QVU A;  1FP2 A;  2M8G X;  2LBF B;  3HG9 A;  1R36 A;  1IN4 A;  2QSG X;  5LD2 C;  4CGR A;  2JA2 A;  2H6B A;  3JRC A;  1I3A A;  2NP3 A;  3WU1 B;  3ON4 A;  3A1Y A;  1VQN I;  3HUG B;  4OAY A;  1R5G A;  2DN0 A;  3H1C A;  4XLF A;  5EDN A;  2FEZ A;  2Y9Y A;  1KGS A;  2ZNZ A;  5H6R A;  1D1A A;  1OYW A;  1SD5 A;  3HOW J;  2VQL A;  3BCA A;  4Q4Z F;  3QOD A;  1LVK A;  3H92 A;  3HSE A;  3R61 A;  4ZYH A;  2LRD A;  3MAJ A;  1ORK A;  2BV6 A;  4Q48 A;  3S16 J;  2K9Q A;  3J7A Y;  2FE3 A;  3M7G A;  3E6D A;  2HU9 A;  1V3F A;  1OQY A;  3BZ6 A;  1EH6 A;  3VVX A;  1H9G A;  2GOX B;  1FP1 D;  2PLY A;  1L0O C;  2WAQ A;  4EQQ A;  2A6T A;  5M3M J;  3OYG A;  1YJN I;  3S8P A;  2EBI A;  3PFY A;  3WU0 A;  2VE8 A;  5F0H A;  1GXP A;  3KPH A;  3CO7 C;  3BP8 A;  3LWF A;  2EIN H;  2UXH A;  3FBI B;  1ENH A;  3ZQF A;  3O3K A;  1NK2 P;  1IZ1 A;  2KIF A;  3LA3 A;  3G56 A;  4HLY A;  2KJB A;  4FT8 A;  3WG9 A;  2DMT A;  2KP6 A;  4LJZ F;  4B4C A;  4MGR A;  1FOW A;  3RTR A;  3V6G A;  1P4X A;  2LRE A;  2CS3 A;  2Z1D A;  3MZ8 A;  4FE4 A;  4RLQ A;  2GQQ A;  2H8W A;  5TJJ A;  3TO7 A;  4CA0 A;  1Z7U A;  3GTJ J;  1WI9 A;  2VIX A;  3TQN A;  4KIF A;  4XOP A;  2IP2 A;  2O3F A;  1REP C;  2M5W A;  2KIU A;  4HNT A;  3ASN H;  2M4K A;  1TT5 B;  3OS2 A;  3HYI A;  2EIM H;  4GYG A;  3F22 A;  3ERM A;  2HGC A;  2NAZ A;  2PQ8 A;  1CF7 B;  2B1E A;  3K4C A;  3C2G A;  1IW7 F; 
#chains in the Genus database with same CATH homology
 3NAU A;  2ID6 A;  5IYD J;  2QIB A;  4L62 A;  1WH5 A;  5FLM J;  1UI5 A;  3S1R J;  3P9T A;  3VP5 A;  4AF5 A;  4FCY A;  2YS9 A;  5J1Y A;  5F1J A;  4S0H B;  3OOU A;  2OER A;  1JUS A;  5JLW A;  1BW5 A;  1TC3 C;  1F36 A;  2Y0S N;  2HOA A;  3IH2 A;  4W97 A;  3ZQG A;  4IHX A;  2LFB A;  2W48 A;  3IH4 A;  2R0Q C;  2R93 J;  2EZI A;  1APL C;  4JX6 A;  2NP5 A;  4D7N A;  3UKG A;  1WI3 A;  3JRI A;  3IUV A;  4ABZ A;  5IYC J;  4MFD A;  4IHV A;  2G7L A;  5AQC A;  3IH3 A;  5M5Y J;  1XC5 A;  2K40 A;  5K7Z A;  1HDP A;  3B6C A;  1Y1W J;  2CJJ A;  3OSG A;  4JX4 A;  3WHB A;  1ETQ A;  4MK6 A;  4HNV A;  1VI0 A;  5FKK A;  1D5Y A;  3QPL A;  2OI8 A;  3KZ9 A;  2ECB A;  2I10 A;  3BRU A;  3QKX A;  2XRL A;  3E7Q A;  3BQY A;  3CRJ A;  1VFC A;  2K9S A;  2X6O A;  3ANP A;  2O7O A;  1LFB A;  1JJ6 C;  3Q0V A;  2HDD A;  1S7E A;  2NVY J;  2X48 A;  3LSR A;  1VF9 A;  2E2J J;  1MBG A;  3CJD A;  4MO7 A;  3TW7 A;  3FIW A;  3FK7 A;  1ZGW A;  2ZCN A;  2L7F P;  4UUT A;  5K58 A;  3BT9 A;  4Y52 J;  1UMQ A;  1CQT A;  5DTD A;  4JL3 A;  3RZO J;  1TWG J;  3BJB A;  3GTG J;  5IOZ A;  3GTP J;  2OPT A;  2EH3 A;  3NRG A;  3BG3 A;  3LJL A;  4XK4 A;  3ZQC A;  1BJZ A;  2XGD A;  3BR3 A;  1JUM A;  2LK2 A;  3LSP A;  1OFC X;  5C4Y A;  2DA7 A;  5EZH A;  2GFN A;  3BTJ A;  3NAR A;  2FQ4 A;  3T6N A;  1H89 C;  1JT0 A;  2LTP A;  1Z0X A;  1LFU P;  1YRN B;  5FHP A;  2DMP A;  5FKM A;  3VVZ A;  3VW2 A;  3CCY A;  4XIC A;  3HGG A;  4A3M J;  3MKL A;  1QRY A;  5J3L A;  2GBY A;  3JRD A;  2KDZ A;  1F43 A;  2CUF A;  3PAS A;  1PUF B;  4HKU A;  5E3M A;  2L0K A;  2COB A;  3HM5 A;  2JA8 J;  1T56 A;  5EGO B;  4CYC A;  4FTH A;  4RDU A;  3EUP A;  1AHD P;  3S1N J;  4DZJ A;  1HLV A;  1ETO A;  3I4M J;  3QBM A;  1MBK A;  5FGL A;  2M34 A;  5M3F J;  5FLV A;  2JA6 J;  4GFK A;  4UUS B;  2R7Z J;  2ELK A;  3S1Q J;  1WCM J;  1POG A;  4I6Z A;  1IC8 A;  2M0C A;  4M6V A;  4ME9 A;  1I50 J;  2D5V A;  2MGQ A;  5D1R A;  2IU5 A;  2YVH A;  2DMQ A;  3S15 J;  2JJ7 A;  5BNG A;  1IRZ A;  3BTL A;  1GVD A;  5IPA A;  1B8I A;  1RET A;  3RD3 A;  4D5C A;  4DZP A;  3SFI A;  2O8K A;  2NVQ J;  5DAJ A;  5EFY A;  2EZK A;  3S1M J;  4G12 A;  3FKI J;  2LLK A;  5FKL A;  4BY1 J;  2NVX J;  4A3F J;  1B72 B;  3V78 A;  3MVP A;  2O7T A;  2DA2 A;  4NEL A;  2JK3 A;  3RQI A;  4X6A J;  2CRG A;  3HDD A;  2N8G A;  1PUF A;  2XPW A;  4KWA A;  3W6V A;  3S14 J;  2ZOY A;  2DMU A;  2LP0 A;  3CQZ J;  1LE8 B;  1B72 A;  2NVT J;  2LR8 A;  1FTT A;  2VPR A;  2Y2Z A;  5M5W J;  1JKQ C;  1W0T A;  4AUX A;  3HTA A;  1DU6 A;  1E3O C;  1EF4 A;  1T33 A;  2NOG A;  3VPR A;  2DTZ A;  3TP3 A;  2UXP A;  3A01 B;  5F0F A;  1QVT A;  1ETW A;  1GV2 A;  2HQ5 A;  5F27 A;  2JA5 J;  1MBH A;  3JRF A;  1TWH J;  2M2E A;  3NPI A;  4A93 J;  3K2A A;  2DG8 A;  3F1B A;  2G0E A;  4UUS A;  3HOX J;  1P7I A;  4BBS J;  2XGE A;  3G1L A;  1W0U A;  2DA4 A;  4XRM A;  1MBJ A;  1TWC J;  2ME0 A;  1JJ8 C;  1MBE A;  3HBL A;  2ZOZ A;  3DPJ A;  3C07 A;  2XPU A;  3S2D J;  3A03 A;  3QQA A;  3MN2 A;  5IOY A;  1U9O A;  1R9T J;  3LSJ A;  2Y30 A;  3QPS A;  2R5Z A;  1JTY A;  1K83 J;  2RHA A;  2D6Y A;  1IUF A;  1VND A;  3C2B A;  3BR5 A;  2HOT A;  1OJL A;  1TWF J;  2HXO A;  3M3Y J;  2WV1 A;  3VIB A;  5F08 A;  3JSJ A;  5D18 A;  1FEX A;  2GUH A;  5EG0 B;  4GCT A;  2E2H J;  5D19 A;  5EYR A;  1H8A C;  2GM4 A;  2EZH A;  5C44 J;  3NI7 A;  4A69 C;  3VOX A;  3Q0W A;  5HBU A;  3G1O A;  1HF0 A;  3BQZ A;  4C3I J;  5K7H A;  5J1R A;  1MSF C;  2H8R A;  4IHW A;  4UDS A;  4A3L J;  3JRG A;  2MW8 A;  5H9T A;  3SDG A;  3O8G A;  1TWA J;  4C3H J;  3FIS A;  4I76 A;  5FJ8 J;  3VW0 A;  4ACI A;  5IP6 A;  2HYT A;  3TP0 A;  1GV5 A;  3ZQH A;  2F07 A;  3GTQ J;  2G3B A;  2Y31 A;  2FJ1 A;  1OCP A;  4A3E J;  4V2G A;  1HDD C;  2YU9 J;  5C4X J;  3HTH A;  3HB9 A;  5FKO A;  3MNL A;  1IDY A;  5FMP A;  1RPW A;  3BTC A;  4AC6 A;  4PXI A;  2IBD A;  1MNM C;  1ZR4 A;  3KNW A;  4M3E A;  1SAN A;  1WH7 A;  4B3A A;  2WGB A;  2R92 J;  2UXO A;  2ID3 A;  2AHQ A;  4BXX J;  3CWR A;  4XRS G;  3E7L A;  1ITY A;  2MG4 A;  4BKX A;  1OCT C;  5DS9 A;  5IP9 J;  3HE0 A;  2RAE A;  2VUM J;  2IAI A;  1BA5 A;  3ON2 A;  2NS7 A;  3RH2 A;  1RR7 A;  3VW1 A;  3EGQ A;  2TCT A;  3RZD J;  4W1U A;  2DMN A;  2L7Z A;  1MSE C;  2DG7 A;  3CMY A;  3ZQL A;  2XB5 A;  2XSD C;  3BNI A;  2E19 A;  1UHS A;  2DA6 A;  3BG9 A;  3B81 A;  4DW6 A;  2FBQ A;  3GEU A;  4YZE A;  5HOD A;  4DYQ A;  3WHC A;  3F0C A;  4GFL A;  3DCF A;  1X58 A;  3ZOB A;  2JWT A;  1ZK8 A;  3HGY A;  4FE7 A;  4QTR A;  4A3G J;  2HYJ A;  1BL0 A;  2QKO A;  1MBF A;  4C2M J;  3G7R A;  4J19 A;  2EQR A;  5F04 A;  5IYB J;  3I4N J;  1QPI A;  3HKZ N;  4D5F A;  3OSF A;  4GCL A;  1I6H J;  1O4X A;  2CQQ A;  2QWT A;  3CDL A;  4FIS A;  2PMZ N;  1U78 A;  3NNR A;  2H1K A;  4BBR J;  1IG7 A;  3PO2 J;  3GTK J;  5GPC A;  5HAW A;  2VI6 A;  3H3V K;  3KKC A;  2LD5 A;  2HI3 A;  2LVS A;  1JTX A;  2JMW A;  3VOK A;  3HEF A;  4GFB A;  1FIA A;  1ETY A;  1BW6 A;  1Y1V J;  1ZKG A;  3DEW A;  1GT0 C;  2HKU A;  3O8H A;  3BG5 A;  5HSZ A;  4A3I J;  2G7G A;  1XS9 A;  3BCG A;  3TW6 A;  2JA7 J;  5IP7 J;  4MLO A;  4AC0 A;  2UXU A;  4NDL A;  3BTI A;  3PO3 J;  1FTZ A;  1FJL A;  1SGM A;  2PBX A;  4A3D J;  3COL A;  1Z77 A;  2ME6 A;  2ECC A;  4JKZ A;  2XPV A;  1IDZ A;  5GP9 A;  2O9L A;  2G7S A;  2GLO A;  4A3B J;  2VKV A;  3ANG A;  1XG1 A;  5M5X J;  1JKP C;  4C3J J;  1JT6 A;  2B63 J;  3BR0 A;  4D7M A;  3LSG A;  3A01 A;  4MXM A;  1NTC A;  4A3J J;  3M4O J;  2AO9 A;  3LNQ A;  4L5E A;  4GCK A;  3AQT A;  1A5J A;  1NK3 P;  3G1M A;  1UG2 A;  3LHQ A;  3VVY A;  2E2I J;  3SJM A;  1AKH B;  1IV6 A;  2ZCM A;  2IEK A;  1JGG A;  4M3B A;  3TED A;  2YUS A;  3JRH A;  5CXG A;  4EEF G;  3S2H J;  2K9N A;  3GBG A;  2GEN A;  1WGX A;  1MH4 A;  9ANT A;  2DA1 A;  1JKR C;  3GTM J;  1G2H A;  1X2M A;  1MH3 A;  3A02 A;  2QCO A;  3NXC A;  4NN1 A;  4JYK A;  3BR6 A;  5JLX A;  1ZTR A;  1FIP A;  2L9R A;  4DYR A;  2MSY A;  2R5Z B;  2NX4 A;  3O60 A;  2L7M P;  3LOC A;  3S17 J;  4JX5 A;  1H88 C;  3GTO J;  3PPB A;  5E3O A;  3D1N I;  3FK6 A;  4RBO A;  3L1P A;  2V57 A;  1ETK A;  2W53 A;  5EF6 A;  3RKQ A;  2P81 A;  3AQS A;  4X1E A;  5FKN A;  2JN6 A;  1RKT A;  2R5Y A;  2QOP A;  1UI6 A;  2Y9Z A;  3Q0U A;  4M3G A;  2PZ9 A;  1QVU A;  3HTJ A;  1RKW A;  2M8G X;  1SFO J;  4MFE A;  1K61 A;  1DU0 A;  3PM1 A;  5E3L A;  2DA3 A;  4A3C J;  1I3Q J;  3BR2 A;  2X9D A;  4CGR A;  5EG0 A;  2VKE A;  3JRC A;  2Q24 A;  2NP3 A;  4XID A;  3OIO A;  3ON4 A;  1AKH A;  2DN0 A;  4DYC A;  3H0G J;  5EDN A;  5EGO A;  4CYC B;  4JP0 A;  3KKD A;  2Y9Y A;  2XB0 X;  3K7A J;  5EZG A;  3HOW J;  2ZB9 A;  3LWJ A;  4AYB N;  1WPK A;  5K7F A;  4M3F A;  3HTI A;  1RES A;  4IEJ A;  5J1U A;  2QTQ A;  2XDN A;  4QSH A;  1U8B A;  2CQX A;  4QIW N;  3HOZ J;  1ETX A;  1JUP A;  4A3K J;  2CUE A;  1HCR A;  2E1O A;  2LKX A;  2QF7 A;  1ORK A;  3S16 J;  1A6I A;  2YVE A;  2K9Q A;  1X2N A;  1IGN A;  1U9N A;  4V2F A;  2FX0 A;  3S5R A;  2XGC A;  4Y7N J;  3B6A A;  1GUU A;  3HOV J;  3VVX A;  1IJW C;  2WUI A;  1P7J A;  3HOY J;  1B8I B;  5C4J J;  1ZR2 A;  2REK A;  1AU7 A;  5E3N A;  2R5Y B;  3JRE A;  3VUQ A;  5M3M J;  2FD5 A;  2NS8 A;  2EZL A;  1Q1V A;  2HOS A;  2RAS A;  2EBI A;  2CU7 A;  2LY9 A;  3HIM A;  4MIM A;  5F0H A;  4IHY A;  5EEA A;  5F0C A;  5CXI A;  1HOM A;  2UXH A;  3BHQ A;  1YRN A;  1ENH A;  2WAQ N;  3ZQF A;  1JKO C;  2DA5 A;  1NK2 P;  1LE8 A;  2DJN A;  4XRS A;  3JRA A;  4ICH A;  2HXI A;  3G56 A;  2OF7 A;  1ZQ3 P;  2UXI A;  4LOC A;  3Q3S A;  2DMT A;  4B4C A;  1GDT A;  4M3D A;  3JRB A;  2TRT A;  3FRQ A;  3GZI A;  3V6G A;  4JNN A;  5CW8 A;  4FE4 A;  3GTJ J;  1ETV A;  5C3E J;  3JR9 A;  3BR1 A;  4B1R A;  2ZCX A;  3IV5 A;  2KT0 A;  3GTL J;  3ZQI A;  4BY7 J;  2M9H A;  3HOU J;  2WB1 N;  5GPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...