2HQ5A

Crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title Multidrug-Binding Transcription Factor QacR Binds the Bivalent Aromatic Diamidines DB75 and DB359 in Multiple Positions
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hq5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hq5A02
2HI3A 3BTLA 3BTCA 2JA8J 2QKOA 3VVXA 2DJNA 2VI6A 1P7IA 2DG7A 1H89C 2CU7A 1W0TA 1D5YA 3AQTA 1Y1WJ 1E3OC 5C4XJ 2ECCA 3RKQA 3DCFA 2M34A 4HNVA 1ETKA 3HOUJ 2RAEA 3VVZA 4XK4A 2VKEA 1AKHA 2D6YA 2QIBA 3WHCA 4FE7A 1UHSA 5IOYA 1RESA 5EDNA 2K9QA 3BT9A 3WHBA 3GBGA 4XRMA 3DEWA 2QTQA 4HKUA 3S17J 1JGGA 2R7ZJ 3MN2A 2FD5A 1TWAJ 2XGCA 2V57A 2ZCMA 5K7ZA 1ETXA 2M9HA 2ELKA 2LK2A 2M2EA 3QKXA 3V78A 4IHYA 1SFOJ 3ZQHA 3A02A 1FTZA 1POGA 3O8GA 2H1KA 5EFYA 5M5YJ 1RETA 2OPTA 2MG4A 4ABZA 3IH3A 2K40A 5J1YA 3CDLA 2LLKA 3OSFA 1T33A 4MLOA 5IYBJ 2XGEA 4M3GA 1GVDA 5F04A 1HDDC 5HBUA 3G56A 4JL3A 2O7TA 1VI0A 1ZK8A 3D1NI 2G7GA 2R5YA 5C4JJ 3NNRA 3TP3A 2YUSA 2LR8A 3JRFA 5C3EJ 4MXMA 3GTQJ 1JTYA 1RR7A 3ANPA 1Q1VA 2HKUA 4JX4A 5M3FJ 3HEFA 3LSGA 4IEJA 4M3EA 3S16J 1UG2A 2UXHA 4A3JJ 3O60A 4C3IJ 3A03A 3IH2A 3S1QJ 1BL0A 2ECBA 3BR0A 2JWTA 4GFBA 5FHPA 3JREA 5GP9A 4UUSB 2MW8A 4QSHA 5M3MJ 2NVTJ 3GTGJ 3JSJA 2YU9J 3IH4A 1G2HA 4A3KJ 3GTOJ 3TEDA 3ZQLA 1OCTC 2PBXA 5D19A 4Y7NJ 3NPIA 4XICA 1MBHA 3ZQCA 4A3EJ 2NX4A 5CW8A 3OOUA 2CUFA 5E3LA 1IG7A 2DA2A 2MGQA 3MKLA 3MNLA 1ETYA 3VP5A 3RZOJ 3FK6A 3BTIA 3IV5A 1ITYA 2TRTA 2OERA 5M5WJ 1GUUA 5JLXA 3JRBA 5AQCA 2DA6A 2DN0A 4J19A 5K7FA 1HCRA 4MFEA 4DYRA 1UI5A 3CJDA 3JRAA 1AKHB 2UXOA 1X58A 5F27A 3BJBA 1I3QJ 3TW7A 4FTHA 3T6NA 3KKCA 2JMWA 4AC0A 2B63J 4NELA 3G7RA 1K83J 2XGDA 3BR6A 3BG3A 2NVXJ 3HOWJ 4AYBN 2Y0SN 3I4NJ 2ZCNA 3BG9A 4L5EA 2COBA 2DTZA 4FCYA 5FJ8J 4AF5A 5EG0A 4C3JJ 3NXCA 2GFNA 3VPRA 2CQXA 3VOKA 2JA7J 2AO9A 2FQ4A 1OFCX 1MBKA 1ZKGA 2JJ7A 2I10A 2NP5A 3BTJA 4CYCA 5IP9J 3ZOBA 4XRSA 3IUVA 3ZQIA 5EZGA 2Q24A 1O4XA 2Y2ZA 1ZQ3P 4B3AA 3UKGA 4A3FJ 2L7MP 1BW6A 2R5YB 2Y31A 3PO2J 1IUFA 2UXPA 4A3CJ 5F1JA 2MSYA 2JA6J 3KNWA 4ACIA 2YVEA 2CUEA 1RPWA 3GTMJ 2O9LA 3LWJA 3CCYA 4JX6A 4RDUA 3VW2A 4DW6A 3FRQA 3BR2A 1SGMA 1WCMJ 1NTCA 5F0HA 2X9DA 2Y9ZA 2O8KA 5HSZA 4W1UA 1IJWC 3S2DJ 4BBRJ 3EUPA 3G1LA 1TWGJ 1QRYA 3NI7A 2XB0X 4LOCA 3FISA 3H3VK 1GDTA 4BBSJ 3S1MJ 4DYCA 2L7ZA 5FLMJ 1EF4A 1H8AC 5EF6A 2LVSA 3EGQA 2FX0A 1FJLA 5IYDJ 2CJJA 2DA1A 3S2HJ 4GFKA 3NARA 5DTDA 3E7LA 5J3LA 1ZR2A 2QWTA 4GFLA 4D7NA 2G0EA 2NVYJ 5EGOA 3DPJA 4I76A 4UUTA 3ZQGA 3O8HA 1XC5A 4ICHA 4S0HB 3COLA 1JKQC 1JUPA 1AHDP 1FTTA 2DMTA 1RKWA 4DZJA 3Q3SA 1Y1VJ 1MH3A 1BA5A 3LHQA 1JT0A 3Q0UA 2HQ5A 5F0CA 3HOXJ 2M0CA 5FKLA 1WH7A 4D5CA 9ANTA 5BNGA 3JRHA 2EQRA 5F0FA 4IHWA 4JKZA 5C44J 4QTRA 2R92J 5D18A 3Q0VA 2FJ1A 4M6VA 3BG5A 5EG0B 3HGYA 5K58A 3QPLA 3HTIA 1NK3P 1HLVA 1LE8A 1B8IA 1IGNA 2E2IJ 4D7MA 3F0CA 5GPAA 4JP0A 5E3OA 3RZDJ 2ZOZA 4CYCB 3PM1A 3SDGA 3B6CA 4M3BA 1WPKA 1GT0C 1JKOC 3RH2A 2JA5J 5D1RA 3CRJA 5DAJA 2KDZA 1RKTA 3PPBA 1FIPA 1JTXA 1IRZA 3TP0A 4A3GJ 3LSRA 5IPAA 3K7AJ 1IC8A 1DU0A 2LFBA 1XS9A 3ON2A 4JYKA 3HOZJ 4PXIA 3QQAA 3HTJA 1VNDA 4QIWN 2DMPA 3PASA 5DS9A 1APLC 1QPIA 2XRLA 5EYRA 3HBLA 3HKZN 1IDYA 4AC6A 2G3BA 2GUHA 4C2MJ 5FGLA 3I4MJ 2N8GA 2KT0A 1QVUA 4A3MJ 3FK7A 3HB9A 3S15J 1VF9A 3QBMA 3FKIJ 1HDPA 5FKKA 1YRNA 3TW6A 2G7LA 4KWAA 2R5ZA 2IBDA 5FKOA 2NVQJ 4D5FA 4IHVA 4JNNA 1AU7A 3OIOA 4FE4A 1JT6A 1U8BA 4B4CA 5HODA 1TWHJ 3L1PA 3S14J 1Z77A 2L7FP 2DA4A 3BR5A 3C2BA 2ZOYA 3JR9A 1MSEC 2QCOA 1T56A 2R0QC 2DG8A 2E1OA 1U9NA 4XIDA 3B6AA 3GTJJ 2ZCXA 2LY9A 2M8GX 1ETOA 2VPRA 3GEUA 2DA7A 2VUMJ 5EGOB 3PO3J 3S5RA 2HYJA 3QPSA 3B81A 2HOSA 2QOPA 1H88C 2PZ9A 2O7OA 2OF7A 2JK3A 3GTPJ 2LD5A 5CXIA 3V6GA 5IP6A 3HTHA 2DA5A 3H0GJ 1IDZA 2ID3A 1Z0XA 3HM5A 1BW5A 2CRGA 4MK6A 1OCPA 4M3FA 2ZB9A 2D5VA 2W53A 1ETQA 1X2NA 5JLWA 3HGGA 2RHAA 1ZR4A 3OSGA 1VFCA 2G7SA 2K9SA 3HE0A 3S1NJ 1WH5A 2EH3A 5H9TA 1TWCJ 3LOCA 3NAUA 3RD3A 3VW0A 2ME6A 3LNQA 1LE8B 5EZHA 1B8IB 1GV5A 1GV2A 1MBFA 4A3DJ 1WI3A 2EZIA 1ETWA 3F1BA 2VKVA 5F08A 4JX5A 5EEAA 3G1OA 3BHQA 4EEFG 2AHQA 2DA3A 3FIWA 3ZQFA 3KZ9A 1U78A 2HOTA 4XRSG 2WV1A 1JJ6C 2K9NA 1XG1A 1MBEA 2TCTA 2LKXA 2GM4A 2X6OA 3JRDA 4A3LJ 1ENHA 3G1MA 2DMUA 1B72A 2NS7A 1JKPC 1MSFC 4DZPA 2NP3A 2IU5A 2PMZN 4W97A 4G12A 2HDDA 3A01A 1HF0A 4BY1J 4ME9A 1MBGA 2E19A 3CMYA 1LFBA 5CXGA 1A6IA 3HTAA 3VOXA 2ME0A 3JRIA 2HXIA 3M4OJ 3AQSA 3VW1A 3BCGA 3ANGA 5J1UA 2EZKA 2XSDC 2L0KA 1PUFB 1YRNB 2WGBA 1TWFJ 2R5ZB 2UXIA 4UDSA 1MH4A 1JJ8C 3HIMA 1ORKA 1LFUP 3M3YJ 2YS9A 1SANA 2LP0A 2Y30A 5FKNA 3BRUA 2YVHA 5J1RA 5IOZA 2W48A 2CQQA 4BY7J 2OI8A 1A5JA 2E2JJ 5FMPA 5E3NA 2ID6A 2Y9YA 2DMNA 5FLVA 1HOMA 1ZGWA 2RASA 4RBOA 4GCTA 3RQIA 2FBQA 2GLOA 1I50J 2IEKA 3JRGA 5C4YA 4BKXA 1I6HJ 5M5XJ 4A3IJ 2P81A 1QVTA 3SFIA 1OJLA 2DMQA 1MNMC 4GCLA 4X6AJ 1X2MA 2WAQN 4AUXA 4NN1A 3W6VA 5IP7J 4V2GA 4M3DA 3ON4A 2F07A 5K7HA 5GPCA 3BQYA 4IHXA 1JUSA 1ZTRA 3KKDA 4A93J 2EZLA 2NS8A 1DU6A 3HOVJ 2GBYA 4BXXJ 4I6ZA 5E3MA 3BR1A 2XPWA 1PUFA 3LSPA 2NOGA 2REKA 4MO7A 4GCKA 3K2AA 3LJLA 3CWRA 3BNIA 3LSJA 3HDDA 2EZHA 1TC3C 1R9TJ 1F43A 2XB5A 3P9TA 2XPUA 4B1RA 1WGXA 2L9RA 2QF7A 3S1RJ 3GTLJ 3VUQA 2GENA 1CQTA 2E2HJ 4L62A 2WB1N 3GTKJ 2IAIA 2HYTA 1FEXA 3NRGA 1B72B 2UXUA 1K61A 3JRCA 1BJZA 2HXOA 4DYQA 1FIAA 2EBIA 3BQZA 4MIMA 4YZEA 3A01B 1F36A 1JKRC 4A69C 2R93J 1ETVA 2H8RA 2WUIA 3E7QA 2X48A 5HAWA 5IYCJ 3MVPA 4UUSA 3CQZJ 4X1EA 4A3BJ 4Y52J 1P7JA 3VIBA 5FKMA 1MBJA 4MFDA 4CGRA 3BR3A 1S7EA 4V2FA 3SJMA 4NDLA 1NK2P 1JUMA 1UMQA 3C07A 3VVYA 1W0UA 2XDNA 1UI6A 1U9OA 2HOAA 3HOYJ 3Q0WA 4C3HJ 2JN6A 2LTPA 3GZIA 1IV6A 4FISA 2XPVA
chains in the Genus database with same CATH superfamily
2HI3A 3VYSB 1UB9A 2Y69H 2QKOA 1R6RA 2HOEA 2DJNA 2K02A 1AOYA 2NVUB 1D5YA 1HXDA 4KIBA 1LVAA 1EJ9A 3DCFA 5LFAA 1MD0A 4HNVA 2VBXA 5L3BA 1MKMA 2QQBA 4RMNA 3HOUJ 4M74A 3ZP5A 2QUFA 2QBYB 1KQ0A 5D5WB 2PMZA 3ZR8X 2F4MB 4GCVA 2OQRA 5LGUA 3WHBA 2XC7A 2QTQA 3MD2A 2E36A 3FX3A 3TO9A 3DWLE 1JGGA 2DPDA 2R7ZJ 4I2OA 1BR2A 1ETXA 3EQLF 4HQEA 2ELKA 3JAMK 1K78B 2NYXA 3QPHA 4CCOA 3V78A 1BN5A 2EJRA 2KQRA 3AG4H 1WJCA 3K4MA 3TDZC 4O3MA 3ABMH 4PGHA 1RETA 1ZHFA 2MG4A 4XLCA 4ABZA 5J1YA 2X6WA 3CDLA 2LLKA 1UG0A 3RYPA 4E7HA 2GIVA 3KP5A 5IYBJ 3SDBA 2HWVA 5B5EC 3WTSC 5DD4A 1HDDC 2L9VA 4M9ZA 2O7TA 3KZIC 2XAGA 3JAMZ 3D1NI 4LK0F 2R5YA 4IHSA 1CGPA 2EFNA 3NNRA 2LR8A 5ILSA 2DJIA 4L5JA 5C3EJ 2V1UA 4A2UA 1VQ9I 1DDNA 4JX4A 5M3FJ 4CGZA 3LSGA 3H3UA 4ZYEA 2PN6A 2XKOA 3SEQA 1W7PB 2Q8KA 1GXQA 2UXHA 1P4AA 4BE0A 3V7CA 4C3IJ 3A03A 3IAS2 3H36A 3CUQB 4RS8A 3L00A 1UFMA 4GFBA 5FHPA 5EJCA 2R7VA 2NVTJ 3GTGJ 2VBWA 3ZMZA 2YU9J 3OYKA 1USSA 3IH4A 4UVAA 2DOFA 4A3KJ 5BMZA 4Y7NJ 1MBHA 3RDIA 3ZQCA 4A3EJ 2OTJI 3EDPA 5CW8A 2DOAA 4HF2A 1K6YA 1OQYA 1MNDA 2MGQA 3MNLA 5TISC 1ZGAA 2L9NA 4KN4X 1OPCA 5GADJ 3OL3A 3BTIA 4N4NB 5M5WJ 2H1LA 2K3PA 4HBLA 2KJCA 5EEHA 1ACIA 2BY0A 4J19A 4MFEA 1E0EA 3HRMA 3WE2A 3HZJA 4DOZA 2QWWA 5LEJA 1L3LA 4XSXF 2BY2A 2ESHA 2RC4A 3T6NA 1J59A 2JMWA 3J81K 4AC0A 2B63J 3WTZA 1VQPI 1D3YA 3BR6A 3BG3A 5DCFA 4A5NA 3WTWC 4BL0B 2NVXJ 2DDBA 3GO5A 4ESJA 3HOWJ 2KDOA 2ZCNA 3KCCA 4L5EA 2V9VA 2COBA 3P9IA 1TQMA 2G7UA 3AG2H 2Z2SB 1FY7A 3LQRA 5EG0A 3M7GA 5LD2C 2AQEA 3NXCA 1OCZH 1T2KA 2MFZA 4IRVA 1B6AA 3WU2C 4OMZA 2NNYA 2DBBA 4CICA 2H27A 4EJOA 3VPRA 4E70A 3VOKA 2JJ7A 1OFCX 3J81Z 3GUDA 4GRIA 3ZQIA 2K27A 1GLNA 2Y2ZA 2OA4A 1B4AA 2W4SA 2L7MP 1WJBA 2R5YB 3SHFA 4HNTA 5H6RA 1IUFA 3MZHA 2IS1A 2V6EA 3HRTA 5CVJA 3KNWA 2W7NA 3U21A 3LWJA 3W2WA 3CCYA 2ZSHB 4KICA 3ZMUA 3KFWX 4G7ZF 4U7DA 3UR3C 4HEA2 4JOMA 5E1WA 2QQAA 3W2AA 1R1UA 1UHWA 1N25A 4O6JA 4BBRJ 2VE9A 2JSPA 3LSTA 2XAUA 1RI7A 3QP5A 1XCVA 3BZCA 2BHZA 2E1NA 1MGTA 3FISA 3ZMTA 4PFPA 2FU4A 3HSRA 1ULYA 3BCBA 4OIRF 4BDZA 3M9AA 4I09A 4KMUX 1ZREA 3CO7C 4WCGA 4PSWA 5FLMJ 3A2KA 1IV8A 1Z9CA 2RQPA 1ZELA 1H8AC 2LVSA 3EGQA 3VB2A 1FJLA 3BY6A 3U1DA 2UUZA 4GFKA 5HS8A 3E7LA 5J3LA 2QWTA 2O8XA 2NVYJ 3F8CA 5EGOA 3RKXA 4BHBA 4HA8A 3BP8A 4XNFA 1SVOA 2ZBKA 2EFOA 3FBNB 4U87A 3R6SA 1JKQC 3FHNA 2DU9A 2KKOA 2DMTA 2FOWA 4HV6A 5HDGA 3RSNA 5D5XB 5TJJA 1Y1VJ 1MH3A 1BA5A 2BOLA 4XKVA 2RVCA 4BHPA 2QM3A 3K4KA 3DEUA 3HTAA 1R36A 5CJ9A 4RAGA 3JRHA 4LGWA 5F0FA 4JKZA 1S9HA 2VXDA 3I58A 2HQAA 2WY8Q 3SXYA 3CCMI 3I0TA 2R92J 3OYAA 2OZUA 2FJ1A 3K0LA 4YEJA 1VQMI 4M6VA 2PJRA 6PAXA 2VJJA 3R4KA 2YPRA 5EG0B 2NOJB 1MMAA 2KFDA 3L2CA 1WQ2A 2KRCA 3L2VA 3JSPA 4KNYA 5ERIA 3F0CA 1OYIA 4JP0A 2IGMA 2OV7A 4X0GA 3MKYB 3CCRI 4ON0A 1W5SA 1WPKA 4L9JA 1U0JA 2JA5J 5DAJA 2KDZA 1OR7C 2DT5A 4P96A 1FIPA 1TBXA 4YIFA 4C2UA 3TP0A 2X0LA 3K7AJ 1J2XA 2WV0A 2LFBA 2HZTA 4JYKA 4BQQA 3G71I 1DPRA 3HTJA 3J80K 1R49A 3I59A 5EYRA 3HBLA 4NUBA 4B3XA 2EV0A 5B1BH 2G3BA 3S93A 2DCEA 4C2TA 4BJ5C 2W57A 4YG2F 3KX2A 2RNGA 4Y3OA 2JRMA 4IRGA 3QBMA 4KWAA 4A5MA 3FKIJ 2XASA 3Q9VA 5E20A 1SFXA 2A3SA 3TW6A 3BPVA 5FKOA 4JNNA 4D5FA 2EIKH 3VDXA 3BJAA 3OIOA 3QYFA 4FE4A 3GZ6A 3GMEA 3GW2A 4RAYA 4LG0A 2L7FP 4ZTJA 5AONA 3J80Z 3F6OA 2RGVA 3C2BA 2ZOYA 2D1VA 1E17A 1MSEC 2QCOA 2IGKA 3E97A 1KA8A 1OCRH 2CFOA 2LRDA 4L9VA 2E1OA 4XIDA 2IS4A 2ZCXA 2LY9A 1T8IA 1ETOA 3CP8A 3RTRA 4S05A 2VUMJ 5EGOB 4HPQA 2HYJA 3CCJI 2JTVA 3PL8A 3IKTA 3QPSA 4UB6C 2F5DA 2A05A 3SWHA 1HKSA 1XX5A 4HOBA 1D1BA 4RGSA 2F48A 3HYIA 2VASA 3CDHA 2DA5A 2DFFA 1G3TA 2ELHA 1N75A 3BDDA 4UV8A 4WF2A 4MQ9F 1BW5A 4IZZA 4MK6A 4M3FA 3QODA 2ZB9A 1FMWA 1ETQA 2RKHA 5CVRA 5JLWA 3I71A 5HLTA 1R5HA 1KQ8A 2PJRB 1SVLA 1D0YA 2VB6A 5H9TA 2VL8A 4Y33A 1I27A 2KIUA 3FMSA 2EZIA 1ETWA 3F1BA 3DLLF 1F9NA 3G1OA 3BHQA 1U6GA 1R71A 4AD9A 1OKRA 1OR7A 2HOTA 4XRSG 2PLYA 3FKJA 4A3LJ 1MBEA 2MH9A 5GAEJ 2GM4A 3G4SI 1JI8A 2VQCA 4DZPA 4G8XA 2CWEA 2HDDA 2XF6A 3A01A 4WXCA 1VQOI 1YOVB 4BY1J 2E19A 4II3A 2VODA 1YIOA 5CXGA 3FMRA 4LIUA 4N0BA 3M4OJ 1FC3A 2P5LC 2CSOA 2XSDC 2A6EF 2L0KA 3H9QA 1PUFB 1FBUA 2UXIA 2RV8A 1MH4A 4FX0A 4P5OA 2DPUA 5DM6F 3J7AY 1LFUP 3M3YJ 1SANA 3H1CA 5ICCA 1ONVA 4LG0B 1RRJA 2W48A 2CQQA 4IQ4A 1NHAA 2E2JJ 2YU3A 3W2VA 3LSMA 5E3NA 4OWRB 2DYSH 2DMNA 3MQ0A 1HOMA 2P0WA 5KHDA 3I53A 3OS2A 4JBAA 4RBOA 2BVMA 2V1DA 2F6CA 1PYVA 2GLOA 4TV7A 3G6EI 3VEPA 2WY7Q 5CKTA 5M5XJ 3BJOA 2P81A 2HYFA 1ZH5A 1FP1D 1OJLA 4U0VA 2DW4A 4BE2A 1SFEA 4X6AJ 3HKZA 1X2MA 2KZVA 3K10A 3X2QH 3LA2A 4M3DA 2DYRH 2F07A 2G7HA 2CO5A 5ILUA 5DD8A 4HLYA 2P7CB 1ZTRA 4RGUA 3QOEA 4CYDA 3H5RA 3HOVJ 4AM3A 1J09A 2VE8A 1BI3A 4OIPF 2DQRA 3FXMA 5CYVA 2V6CA 4MO7A 1BM9A 5D6FA 3VFZA 4GCKA 4Q4ZF 3DTEA 2ZSIB 3MEXA 2QEXI 2P7VB 5J8FA 4UVCA 1WVRA 2X1EA 2IA0A 2LC2A 5K5RA 2CW7A 5TRDA 3FXOA 2AXLA 4L62A 2W1OA 3KEYA 2HYTA 2EWNA 3H9JA 2R7XA 3QPTA 2HXOA 1W36D 2VJ4A 1HSJA 1UHMA 3BQZA 4DBQA 4YZEA 3KEQA 3A01B 1F36A 2QYOA 4L0ZB 3F8BA 4QWQA 3E7QA 1S7OA 4F55A 4CO8A 1F5TA 4BNCA 1D8JA 2P5KA 5HAWA 1D1AA 1Z67A 4EM1A 5IYCJ 1QBJA 3CQZJ 3UNGC 2L01A 4Y52J 1P7JA 2ZXJA 5D4SA 1X1BA 4E6KG 5LRRA 1IN4A 4V2FA 5L3DA 2M0MA 1A31A 4IF4A 1W0UA 1X3WB 1V5FA 1YX5A 1K4TA 3PFIA 2VJIA 2XUBA 2XPVA 1O7LA 2K3FA 3ZQ7A 2DG7A 4HLXA 1H89C 1GVJA 4KMFA 2KRFA 2ECCA 3KPHA 1ON2A 3GVAA 3D0SA 3DV8A 4IVNA 2VKEA 3CTAA 4EGZA 5CQGA 4IRHA 2D45A 1HBXG 1RESA 2M87A 3BT9A 3JW4A 1BJAA 5CVVA 4NB5A 2VBZA 1Z3YA 2FD5A 2M8EA 1MMNA 5K7ZA 3T0YA 1BI0A 1SVMA 3I9V2 1S72I 3V8JA 2B1EA 2JUCA 5FB2A 4BQAA 3CUQC 4HZFA 3F8NA 5K1YA 5BOXA 3GWZA 3NRVA 4CZCA 3VSLA 5EFYA 2ICWG 2VKHA 3OYJA 2JVGA 1FOYA 4IXAA 1XGOA 2STWA 2FJI1 3RPUD 3ELKA 3HSEA 3R60A 2W85A 3OSFA 3VODA 3HL2A 3B02A 2XGEA 4GYGA 4PGGA 2GOMA 3G56A 1Y56A 1EV7A 1ZG3A 5C4JJ 4ZYDA 1ZARA 3TP3A 3MKWB 4J00A 5J8CA 1J7KA 3GTQJ 1JTYA 2JT1A 2CW0F 2JPBA 3DEEA 2HKUA 3HEFA 3LMMA 4IEJA 3OV8A 1OYWA 3PIPF 5DCMA 1ZN2A 1PDNC 3KYDB 4A3JJ 4LB5A 5E17F 2XAHA 3JREA 5GP9A 1QNTA 3FHZA 4QSHA 1BI2A 3JSJA 3LSHA 2K86A 4R79A 2ACJA 5CVUA 2CMPA 1JHFA 3GTOJ 3TEDA 5D19A 2PBXA 5FRMA 4ENNA 3NPIA 4XICA 1T08B 2NX4A 3OOUA 2CUFA 3OYFA 2BXYA 3MCZA 5DM7F 4KYWA 4KISA 3PQJA 1F4KA 3RZOJ 3FK6A 3VTIA 2OERA 4KA4A 1GUUA 5JLXA 5BPIA 3EUAA 3G2BA 5AQCA 4YIRX 2EINH 1PVEA 1R22A 3IRRA 2WB1A 3W3CA 4BU2A 5ED4A 2HVRA 4BS9A 1X1CA 4YIIA 1VQ8I 3ASNH 1IAWA 1QU3A 4IOAF 1V55H 3OYMA 3ZMSA 1I3QJ 2ESNA 3TW7A 3N97A 1YS7A 1KU7A 4WXHA 2HTJA 2MC3A 3SZGA 1LUJB 1R1TA 5F6FA 3G7RA 3KLOA 1K83J 3ZCOA 1MMGA 1T98A 2Y0SN 2AXTC 3VYTB 1EH7A 4EATA 3BG9A 2F5CA 3V42A 2M5WA 4AF5A 1IXCA 2P8TA 2LG4A 2J5OA 5F64A 3H9GA 1YJ9I 1XGSA 2MLKA 2AO9A 2FQ4A 3O2PE 4B09A 1S7AA 2NP5A 3BTJA 4CYCA 5AIQA 3K70C 1HW1A 5EZGA 1J9IA 2E60A 2FNAA 3W6KB 4B3AA 3UKGA 1RUNA 1LQ1A 1HQCA 2MYSA 3PO2J 3EUHA 4E7JA 1GHCA 3H5AA 1ZRCA 4ACIA 2PX9A 4UHTA 4HDVA 4JX6A 3VW2A 5DCMB 4ESFA 1V4RA 3FWEA 3BR2A 5HSZA 2X9DA 2Y9ZA 2JVHA 3EUPA 3GEZA 3WG7H 2FBIA 3DBHB 3DBLB 3G1LA 1LB2A 3TO7A 4G7HF 1USTA 2VXZA 3CMMA 2GXBA 3NI7A 4C2MA 1IXSB 1X1DA 3KYCB 2O5RA 3LFKA 1RC9A 3E5QA 1D1CA 3H3VK 4IHTA 1J75A 4BBSJ 4MGRA 4DYCA 2K5CA 4Y17A 1EF4A 1G8XA 3LQQA 1REPC 3HJEA 5GTIC 3CZ6A 3CCQI 3T5XA 5IYDJ 3K4CA 3ISPA 3HTUA 4CCJA 4XORA 4G6TB 2VBYA 3F23A 4D7NA 2ZJQF 3F8MA 1BC8C 2W24A 4I76A 4MTDA 3DPJA 4OU0A 3HSFA 4ICHA 2H94A 1QHHD 4S0HB 4I0AA 3COLA 1G6NA 2R7FA 1X4OA 1AHDP 4B47A 5ILVA 2IT0A 1MMSA 3JTHA 4DZJA 1OISA 3T8TA 4WX9A 1X3ZB 3LHQA 2QKMB 2HQ5A 3Q0UA 2G9WA 4BXFA 1X1PA 2M0CA 4D5CA 5BNGA 4C30A 2XRNA 1TNSA 2OUMA 5H20A 3ABKH 1I1SA 4FASD 3CCEI 2CQ7A 2R7QA 2FE3A 1S8NA 4XLHA 4BGDA 2JUGA 1XDSA 3A0BC 3EETA 3TOBA 3BG5A 4KIFA 3HGYA 2EFWA 3HUGA 2O03A 4U0WA 3HTIA 2F5VA 4BJ6C 1DGWY 1LE8A 1OMIA 1B8IA 1IGNA 2UXNA 4D7MA 5FLXK 5GPAA 2J5PA 1RIOH 1N77A 1MJBA 3RZDJ 2ZOZA 4G6QA 4CYCB 1K7AA 1O3QA 2OD5A 3BZ6A 2H8WA 2ZXWH 1Y8RB 1T39A 4LMYA 5L3FA 3CRJA 2M7AA 3JSOA 1ZRDA 3BOQA 5HDNA 1SMYF 5IPAA 1DU0A 3K1NA 1A35A 5B66C 3RKYA 3SZPA 3R0AA 5JVTA 3QQAA 2E7XA 4ZYGA 3PASA 1QPIA 5FLXZ 4N9IA 1S3JA 3QOPA 1O3SA 4C2MJ 4AYBA 1KU3A 2OQGA 4LD5A 2LNBA 3I5UA 4ANJA 1KYZA 3IWZA 2KT0A 3FK7A 3S15J 1Z21A 1YRNA 2G7LA 1LEBA 3KEOA 1XTAA 3DXJF 1U8BA 4B4CA 2VKDA 3E6BA 4WWCA 3VWBA 2X51A 5HODA 4XN3A 2IA2A 2UWMA 4I98B 2DA4A 3BR5A 3EYYA 4MHGA 1PP8F 2R0QC 2DG8A 3WODF 2IJLA 1ODDA 2M8GX 2DA7A 2XDVA 4ITVA 4M6XA 4RB1A 2Z5UA 3F8FA 1ZG1A 1SAXA 1DP7P 4I7HA 2A61A 2HOSA 2QOPA 2QA4I 1H88C 2PZ9A 2OF7A 3GFMA 1B9NA 1XN7A 2JK3A 3PFYA 2UZKA 2DFIA 1HKQA 3FDYA 3PIOF 2LD5A 1L0OC 5CXIA 3V6GA 5IP6A 3B73A 4MEXF 2V4JC 3H0GJ 2NXNB 2WAFA 5CPRB 1IDZA 1Z0XA 1IN6A 1STZA 2L54A 1BBYA 2CRGA 3ZGKA 1R4NB 2UXXA 3TL4X 3WTUC 3FZVA 1MJAA 4GDFA 2OU2A 3M07A 1Z3XA 2ETHA 3TOAA 1SEUA 3HUGB 3LOCA 1BOAA 3NAUA 1YG2A 4A0YA 1IN8A 2C6YA 2ME6A 2LDUA 1LE8B 2LY2A 2HU9A 5FD5A 1LVKA 1B8IB 2CV0A 1XSXA 4A3DJ 3BWGA 1WI3A 4M72A 1XGNA 2GIZA 2W25A 4IJAA 5K5OA 3GYHX 2AHQA 2DO7A 3FF5A 2X1DA 2DA3A 2BE5F 1Z6RA 4XOTA 1FLIA 2M4KA 5FFXA 2K9NA 3V8KA 2LKXA 1WWXA 5J4YA 2X6OA 1FT9A 1WJ5A 2XSJC 3WTYC 2KP6A 1P2FA 1KYWA 2MLGA 4F92B 3OR2C 3F21A 1MSFC 1ZG5A 1WJAA 2PMZN 4W97A 2K9LA 2QQ8A 3AAFA 1HF0A 2MA3A 1MBGA 2E1CA 4M9XA 4Q5SF 2BEOA 3IWFA 3E1SA 1GXPA 3AQSA 4EQQA 2DODA 3BCGA 2WAEA 3RPUA 2EZKA 1R5GA 2H6CA 3COAC 5LHIA 1YRNB 4PZJA 4WIBA 3F3XA 3HIMA 4Z6YA 4LITA 2YS9A 2LF7A 2BHYA 2QKLB 3K4JA 4HNUA 4IPAA 3OYDA 4Q47A 2Y30A 5FKNA 3S3MA 3BRUA 1IN7A 5IOZA 1UELB 5GTHC 1YIJI 2WWYA 5FMPA 3RCOA 3DQVC 3PSIA 3AG3H 3WGIA 2ID6A 4Y15A 3WGHA 2HEOA 2JQ7A 2QZ8A 2B3WA 2HYGD 3ECHA 4GCTA 3QU3A 2FBQA 3MZ8A 4UVBA 4M6YA 2O3FA 4A3IJ 3L09A 2EILH 3SFIA 2HKOA 2DMQA 2LF8A 4LLGF 4GCLA 4RGXA 4K2EA 3PJRA 4RM3A 3RYRA 3E5UA 4V2GA 3ON4A 3K9TA 4LB6B 2L4MA 3BQYA 2KMUA 4WK8F 2LREA 1T38A 3NRGA 5GAHJ 4HSRA 4A93J 2EZLA 2NS8A 1DU6A 2VJ5A 3E5XA 3BR1A 2M45A 2XPWA 1PUFA 4PJJA 3R61A 2ZKZA 2ZO4A 3CUOA 3A1YA 3GCMA 1XMXA 3D5RC 3DTKA 1YHQI 2HPIA 3NQOA 4HYEA 3K6GA 1PUEE 3P9TA 2XPUA 1BIBA 1WGXA 3QWLA 4CH7A 4Y4RA 4BHCA 1CQTA 2E2HJ 2VPLA 2DFEA 5CQEA 2IAIA 3GLLA 2RREA 2V79A 2D2WA 4FX4A 3JRCA 4CCLA 2EB7A 2V26A 1FIAA 3L7WA 4MIMA 1V5GA 4LLLA 3T1BA 1SAUA 4XLAA 4L0YB 4PJLA 2R93J 3PNVA 4BH9A 1YITI 1TNTA 4MQVA 1MJ9A 2WUIA 2PG4A 5KK1A 4QPQA 3FXUA 3S8PA 4UUSA 4U0YA 3SQNA 5FKMA 4BUPA 1S7EA 4PCQA 3SJMA 4NDLA 4N9HA 5J40A 1OCOH 4BDYA 3C07A 3VVYA 1VTNC 2YX7A 3N4MA 2VIXA 4ZZDA 2K4BA 5JI6A 1XPXA 1VQNI 3P5JA 1IV6A 1WJFA 4FISA 4IO9F 1YJWI 2KPMA 3VVXA 1P7IA 3ESWB 1U3EM 3MZYA 1W0TA 1FYLA 3AQTA 1Y1WJ 4UNOA 5C4XJ 4S04A 4P9UA 2VOOA 1ZYRF 2K4JA 2A2FX 3OYEA 3EYIA 3J7YJ 1IN5A 1J0RA 2WBMA 4BEHA 5BPDA 1KGSA 1VZ0A 3VVZA 4XK4A 1U8RA 3DF8A 1AKHA 1Q1HA 2QIBA 1YE9A 3WHCA 4FE7A 1UHSA 3E0JB 5IOYA 5EDNA 1KQ9A 4HV5A 2K9QA 4P1WA 4XRMA 3DEWA 2HVSA 1H9GA 3WU0A 3MN2A 1TWAJ 2XGCA 4RM2A 4RLQA 4M73A 1Y39A 1HA8A 2ZCMA 1KU9A 2LK2A 3QKXA 2PMUA 4HSTA 3C3WA 1FMVA 2FSWA 2L4AA 1FTZA 3CCUI 3K69A 2E1MB 3FMQA 2A6HF 2H1KA 1XD7A 2XV4S 5M5YJ 1ZAOA 5FGMA 2QQ9A 2OPTA 4E7KA 2L9SA 1U5TA 2CW8A 4MLOA 1DP3A 2I8DA 3KP3A 5F04A 2F4OB 5HBUA 3HRSA 1BR1A 2VOPA 3ERED 1G3WA 1Z05A 1V54H 4PFOA 4E7ZA 2YUSA 3JRFA 4MXMA 1XB4A 2GQQA 3EUKL 4Q48A 1R7JA 4B48A 1QA6A 3CO6C 2BYVE 2WAQA 1ZLKA 1UAAA 3CMEI 4E4HA 3O60A 1EA3A 2ZXIA 1PP7U 3IH2A 3QAHA 4B43A 3C1DA 4ASNA 1BL0A 3S1QJ 1LDDA 1LDKB 2LY1A 3BR0A 3V4GA 2CV2A 2AQFA 2M30A 4UUSB 1JGSA 1SC7A 3E3VA 4DVYP 1E3PA 4ZZLA 1G2HA 1D8KA 2ZY9A 1OCTC 2VONA 1D5VA 2L7KA 3F72A 3PNTA 4I0BA 1SFKA 1BR4A 2DA2A 3S32A 3MKLA 4XLFA 3CP2A 3IV5A 1AA7A 1ITYA 2TRTA 1VQ7I 1V5EA 2D1HA 2GA2A 3JRBA 2DA6A 2DN0A 4YRVA 4DNCA 1HCRA 1DPUA 2R7DA 4BEHB 3SYTA 3K8PC 3CJDA 4OAYA 1AKHB 3DPUA 1X58A 4HF1A 3BJBA 5J47A 1CF7A 4FTHA 2Y0SA 3QYEA 3S3OA 1TTYA 3CJNA 3E6DA 2Y75A 4XKBA 1O3TA 3P9CA 2OCEA 1O57A 4EJVA 2BY3A 2DTZA 3H92A 2BY1A 4FCYA 5FJ8J 4C3JJ 2OBPA 3LA3A 4NNJA 4YFKF 5DUKA 1HKTA 3C2GA 4LJZF 3TGNA 2F2EA 2CQXA 2V7FA 1ZKGA 4RB2C 3IC7A 1U5TB 2I10A 3ZOBA 4EVIA 3FXJA 3IUVA 2X4HA 3PSFA 2BXZA 2PFVA 1ZQ3P 1IUYA 1YLFA 5E8IA 2BW3A 2R4GA 3FXQA 2Y31A 1SFUA 2HPMA 4AIJA 3FXRA 4NBQA 2KISA 4RB3C 4UY8I 2BVLA 2MSYA 3ZXSA 5HS7A 2JA6J 4A3CJ 2UXPA 2YVEA 1RPWA 3C18A 2ZXHA 2O9LA 1S6LA 4RDUA 4DW6A 3FRQA 1X3UA 2I5UA 4HF0A 1A04A 2VT2A 1WCMJ 1NTCA 5F0HA 4H4KC 3PQKA 4W1UA 4IOCF 1IJWC 2P6SA 3E6MA 4NC6A 2ZJRF 3IP4B 5L3EA 2R7WA 4D1QA 5B1AH 4F93B 4AU7A 3WE3A 2XB0X 1IRXA 4LOCA 4DQ2A 5CVIA 3K4LA 1GDTA 3CJQB 4XM3A 3HOSA 2L7ZA 2K7LA 3M8FA 4L9NA 4XKCA 3QP6A 3ZMVA 3FXKA 2Y0MA 3OOPA 2FX0A 3S2HJ 5DTDA 1U2WA 2OTLI 5HNHA 3OYNA 4P9FA 1N78A 2X85A 1VQLI 4GFLA 2G0EA 3HG9A 2HDWA 4GXOA 4BACA 1TL8A 1FSHA 1A36A 1MDMA 3HRUA 1I5ZA 2L3DA 3OYHA 2F5FA 3TBIA 1JUPA 4ENMA 1FTTA 2XROA 2W84A 4ETSA 1CF7B 3Q3SA 4I02A 3EUHC 1JT0A 2MC4A 1JXSA 2HZDA 1WH7A 3ABTA 2Z1DA 9ANTA 4KN7X 3HIFA 1OYYA 5LBQA 2Z9OA 3OS0A 4YELA 4UXNA 5C44J 3BLYA 3K1MA 4QTRA 2DK5A 4EMSA 3Q0VA 5KVRA 2B9SA 5D18A 1IF1A 2TDXA 2FF4A 3KLNA 3ROUA 1D0ZA 1NK3P 1HLVA 2E2IJ 2XGXA 2ELJA 3RIRA 3GF2A 2B0LA 3PM1A 3RH2A 1GT0C 2L2OA 1VQ4I 3ABUA 1JTXA 3PPBA 2BW3B 1W5CC 2JSCA 4UV9A 3L2RA 1ERDA 4A3GJ 1SD7A 2KRHA 3LSRA 4A6EA 3OL4A 4OOIA 1IC8A 3ON2A 1XS9A 3IAM2 1P6RA 3HOZJ 4PXIA 3IUOA 2HFHA 1VNDA 4QIWN 2R3SA 5JHFA 1APLC 2IXSA 1BIAA 3OIQA 3HKZN 1IDYA 3ULQB 4AIDA 3P7NA 2GUHA 5FGLA 3HC7A 2IGOA 2N8GA 2L02A 4DJAA 4A3MJ 2XVCA 3HB9A 1VF9A 5DYMA 1HDPA 5FKKA 3PUFA 2MH2A 1X1AA 1QZEA 1FWZA 1FNNA 1XSVA 1KZHA 4CA0A 2NVQJ 3MWMA 1AU7A 1XDUA 1JT6A 4A12A 5JR3A 2HDCA 1Z77A 5LLQA 3LWFA 3CC7I 3AL0B 2CFXA 2FA5A 2YSRA 1S5LC 3JR9A 1T56A 2ZMEA 5LGTA 3BG6A 1U9NA 1Z91A 3S5RA 4BXUA 2IW5A 2ADUA 1MDMB 1WZ2A 4KT6A 2QSGX 1LPQA 3KP4A 4M71A 2DT7B 4OD4A 3ZN1A 5AIPA 3HTHA 4PJNA 3C2HA 5B3SH 1KU2A 3HM5A 5F1RA 3AFHA 4MEYF 2VC1A 3O6BB 4U88A 5DDGA 2DQLA 3CC2I 2W53A 1FBSA 2V9KA 3HGGA 4RAFA 1WI9A 2RHAA 1ZR4A 1R1VA 1VFCA 2DTRA 3I4PA 2EH3A 3ABLH 2KIMA 3RD3A 2DFHA 3CJTB 5KAFC 3LNQA 3U1KA 3W6JB 2QENA 5EZHA 1GV2A 1MBFA 2IPQX 4XLEA 4CXFA 1P9QC 2STTA 5F08A 4EEFG 2EV6A 3BCAA 4XQFA 1QGPA 4EJWA 3BC8A 1UZCA 3FIWA 3KZ9A 1UJ8A 3QYBA 1RNLA 1JJ6C 1T95A 5LRSA 1TLHB 1XG1A 2KHMA 3CCLI 3JRDA 3P9KA 1ENHA 1SD4A 1T0FA 2CUJA 3G1MA 3KP6A 2KL4A 3NEUA 1W36C 2DMUA 2NS7A 3DU5A 2F5EA 2IU5A 1LJ9A 1MW7A 4YFNF 1WKMA 3DLAA 4G12A 4OD5A 1YQAA 3K4BA 3LFUA 5HLIA 3CMAI 1P4XA 2ME0A 2R7OA 3PNYA 1E3HA 1VQ5I 2B7EA 1ON1A 2QLZA 3ANGA 2ZFUA 5K5QA 3Q5FA 4XKWA 4FETA 4HX8A 3RPQA 1TWFJ 1JJ8C 1ORKA 1FOWA 4ENJA 3RQ4A 1QQIA 1TZLA 3M8EA 2PI0A 2LP0A 3GX4X 3ZPLA 2YVHA 5J1RA 3SZTA 4EM0B 2OI8A 4F7ZA 1A5JA 4ZDLA 1NH3A 4PSXA 2ZMEB 2Y9YA 2LOOA 5FLVA 5J4VA 1FP2A 4GGGA 4ZC3A 1B59A 3RQIA 4PJ0C 1B9MA 2DDAA 3OYBA 1QPMA 2IEKA 4DBRA 5C4YA 4BKXA 1I6HJ 2Y48A 3ZMDA 1OLTA 1QVTA 4F3QA 5HNFA 3OYIA 3V8LA 2E34A 2FRHA 4CUGA 2O61A 3W6VA 5IP7J 3N05A 4OMYA 4AVZA 2FXAA 1RZ4A 2KIQA 2PFBA 2EK5A 4AVPA 2BZTA 5KCMA 2CUZA 3E6CC 2YR2A 4IHXA 5L3CA 3KKDA 4PJMA 1WFXA 4XR6A 4BXXJ 2A5YB 2GBYA 2MD0A 4I6ZA 1HC8A 5E3MA 4KJZA 3LSPA 1WRJA 2REKA 2LSOA 3K2AA 3LJLA 2K9MA 2ZJ2A 5JVGF 2KZGA 4JQFA 3LSJA 5IT3A 3NWTA 3HDDA 3BJ6A 3ZN0A 1TC3C 3VYUB 4XN0A 2XB5A 4A6DA 2WC2A 2DT6A 4B1RA 2O0YA 2QF7A 4L9TA 3S1RJ 1C0WA 3CJRB 3GTLJ 2GENA 3J7ZI 1W5TA 2QSFX 3LL7A 2WB1N 4AIHA 3GTKJ 2CGPA 1G4DA 4D0PA 3DBRB 3GZ5A 3TQNA 3DPTA 4F91B 4D9JA 5J6XA 2PBIA 1BJZA 4DYQA 1HW5A 2FMYA 2MBFA 3OIPA 2X6XA 2H8RA 2ZC2A 3G3ZA 2X48A 1FYKA 1YW9A 3MFKA 3KYLA 4A3BJ 1I6XA 4RAZA 4X1EA 2AS5F 1MMDA 1MBJA 4MFDA 3BZKA 3CLQA 4CGRA 4ENKA 3HTSB 1NK2P 1O7FA 1UMQA 2CH0A 1UI6A 2EV5A 1U9OA 2HOAA 2Q1ZB 5FFZA 3HOYJ 2HNHA 4C3HJ 4YFXF 2JN6A 3GZIA 3CESA 4FHTA 4IHVA 5F1JA 2E1MC 2EIMH 3BTLA 3BTCA 1QZZA 2PEXA 4ZDPA 2RNJA 2JA8J 2ISYA 2VI6A 5JFRA 2Z99A 2CU7A 2OZ6A 1E3OC 1TQIA 3RKQA 3BROA 4B8XA 3DFGA 1LDJA 2M34A 4AIKA 1ETKA 4RA2A 2RAEA 2HKXA 2D6YA 4J01A 1FSEA 5E8GA 4HKUA 3GBGA 1DUXC 3S17J 4QPOA 2F4IA 1YX3A 2E7WA 2V57A 4IL6C 2M9HA 2M2EA 2FQ3A 4R8HA 4IHYA 1SFOJ 1OCCH 3ZQHA 2DK8A 2LYCA 3A02A 5D5VB 3REOA 1POGA 3D5SC 2Q0OA 3O8GA 5LHGA 5HS9A 2LKPA 2FUG2 3R0JA 1S29A 1P92A 3G73A 3IH3A 2K40A 3OYLA 3LAJA 1T33A 3M1CA 1XMAA 1R5ID 4BQOA 4M3GA 1GVDA 1YJNI 3H0DA 4JL3A 1VI0A 1EKEA 1ZK8A 2G7GA 2LBFA 2NNNA 3IKVA 1WSUA 2JA2A 1MNEA 1RR7A 3ANPA 4NHJA 1Q1VA 2ZNYA 2RQQA 4PK4A 2IVMA 3S16J 4M3EA 5FRNA 3V7SA 1UG2A 2R7SA 3K1PA 1HW2A 1EH6A 4BE1A 2ECBA 1SD5A 2LH9A 3HHGA 2JWTA 5DUIA 5ICFA 2MABA 2DI3A 2MW8A 5M3MJ 2M4GA 1F1ZA 2XAJA 2R7RA 4UB8C 2M1BA 4BAYA 2A07F 5LHHA 2EFQA 4I01A 3T8RA 3ZQLA 2VQHA 2YVXA 2DLLA 3DP7A 3F9KA 4CCMA 5E3LA 1IG7A 2GZWA 3D5LA 3GFIA 1TT0A 1R58A 1SMTA 1ETYA 3VP5A 1IW7F 3KZZA 3L9FA 2A5WA 4A0ZA 4EM2A 3ERMA 4HRIA 3MMYB 2WADA 2X1CA 2DAOA 2XF5A 3WG9A 1U5TC 5K7FA 2R7UA 1G59A 5FO5A 3ZRGA 4DYRA 1IRGA 1UI5A 4NC8A 1BC7C 1ZLJA 3I3LA 3JRAA 3HOTA 1KONA 2UXOA 2V1XA 2WTEA 3VYRB 5F27A 3BPXA 1DQUA 4EV0A 3KKCA 4NELA 4ZDOA 3S2WA 3OR1C 2CV1A 2XGDA 4OIOF 2VQGA 3F22A 2OC6A 2OAZA 2ZNZA 4KITB 2BGCA 4AYBN 1T6SA 4O5VA 4KFCA 4CZZA 3I4NJ 1W7PD 1TW2A 5JHUA 1WJDA 2RDPA 3LA7A 3RJPA 4IX7A 4U7BA 1FPQA 5FROA 2GFNA 2JA7J 1MBKA 2IA1A 1YW7A 1Y6IA 5IP9J 3HHHA 4XRSA 5KNLA 1K6OA 2X6YA 2Q24A 1XGMA 4H0EA 2P5VA 1O4XA 3CDIA 3EPZA 1O3RA 3CF5F 4A3FJ 1BW6A 2E71A 4XSZF 2LBFB 4CSWA 3DTIA 2E35A 2HTSA 2A6TA 2COMA 1DGRM 3U9GA 2E5NA 2CUEA 3WGGA 3GTMJ 2BV6A 2JPCA 4QLCU 2CQNA 5D6EA 3IL2A 2CYYA 1SGMA 1X4PA 3U2RA 2O8KA 3WTVC 4UUVA 3S2DJ 4A0XA 3CCVI 1TWGJ 1QRYA 1YO5C 4RB0A 1K4SA 2HGCA 2WA0A 1YW8A 2CG4A 1YFHA 2XIGA 3CC4I 3S1MJ 2K85A 3LSIA 5HLHA 2NAZA 5EF6A 4CCNA 4F52A 4HDUA 3TMOA 1G3YA 3DU6A 4II2A 1MZBA 2LKSA 2CJJA 2DA1A 1TQPA 3WTTC 3JTGA 4E7LA 3ECOA 3NARA 4LK1F 1VQKI 4LFUA 5H2FC 1ZR2A 2DOEA 3TKYA 2W82A 4UUTA 3ZQGA 3A0HC 3O8HA 3CCSI 2DXIA 1XC5A 2Z16A 5E18F 1ZRFA 3LSKA 2BBYA 2GWRA 3I59B 1IZ1A 1EH8A 3S3NA 1RKWA 3PUBA 3O3KA 3TDUC 2QGUA 3WTXC 4XOPA 4KIGA 1FOKA 5F0CA 3HOXJ 4HG2A 5FKLA 4IHWA 2EQRA 3GFJA 2PQ8A 3QU6A 1FYMA 5ICEA 2CQKA 1TW3A 1H0MA 4L18B 1I3AA 2PJPA 4Y13A 3ZQQA 5D5UB 5BQTA 1Y8QB 4WXDA 3GFLA 4C9YA 1QO0D 1QHGA 5K58A 3QPLA 3KETA 5E1XA 4EGYA 3HPGA 5E3OA 2JRTA 4OIQF 3ONQA 3SDGA 3B6CA 4M3BA 1JKOC 1FX7A 3IRQA 5D1RA 3K70D 1RKTA 3AL0C 1SD6A 2OJED 1RR8C 3NS4A 1IRZA 2Z3YA 2XAQA 1R23A 5TGTA 3VOEA 1I39A 2LMDA 4XBFA 4AWXB 4ZYAA 1MIJA 3DKYA 4HX7A 2EA2A 1A6QA 1J5YA 2A69F 2FEZA 1NG7A 2NS0A 2DMPA 5DS9A 1IXRC 3OMYA 2XRLA 3CD6I 2KJBA 4AC6A 4U9NA 2GOXB 1IRFA 1H9TA 2GXAA 2NRAC 1K79A 4ZTFA 3RI4A 4MTEA 3I4MJ 2E5ZA 3FM5A 4Z2YA 1QVUA 3A4CA 3JCUC 3C7JA 5ICGA 1E2XA 3V7RA 4IKFA 2R5ZA 2IBDA 2FBKA 4EJTA 2O6GE 1YS6A 1FOXA 1Z7LA 3NWSA 4HX4A 2H09A 1TWHJ 4XRFA 3L1PA 3S14J 2L5QA 2XF7A 4BQNA 2HQRA 1LFPA 5EEGA 3I64A 3AKZA 5FD6A 1NG6A 3SEZA 2M3AA 2QSHX 3GTJJ 3GEUA 2QVOA 3B6AA 3L2WA 2VPRA 3ASOH 3PO3J 1IO2A 3M8JA 1ZGJA 2PMHA 1PJRA 3KZYA 1JE8A 4XONA 3B81A 2O7OA 2EPFA 4LIVA 1R4MB 3GTPJ 2EA4A 2KIFA 2P6TA 4DIQA 4RLFA 3OS1A 2Z33A 4KDPA 4G9YA 2P4WA 2ID3A 1BOBA 3FM3A 4ESBA 1OCPA 4MNUA 5GAGJ 1RUOA 2D5VA 1X2NA 4R1HA 5HOOA 2M7BA 2VT3A 2XAFA 5A2QK 2UV1A 3OSGA 4B44A 2G7SA 1AWCA 2K9SA 3HE0A 3M1EA 3S1NJ 1WJEA 1WH5A 3GLXA 4NQWA 4OAZA 1TWCJ 3FXLA 1YI2I 3GZNB 2IS2A 3VW0A 2R7TA 3SFZA 2IGNA 2V1NA 4KUMA 4V19K 1GV5A 3DPLC 4KT5C 5L3GA 2VKVA 4JX5A 4ZH4F 5EEAA 1W1WE 3OY9A 1LEAA 4N4OB 4GYIA 1Y0UA 2ZJPF 2JZYA 1Y0NA 5DV5A 3ZQFA 3J7AO 4G7OF 1U78A 2GXGA 4FT8A 3H3ZA 4HAMA 3OYCA 2WV1A 4G94A 2V9PA 2ZMEC 2TCTA 5A2QZ 2ISZA 1QZYA 4G6DA 1B72A 1Z6TA 3MKZA 1JKPC 2ZFWA 3LAPA 2NP3A 3HXLA 1VQ6I 4HW0A 5DEQA 5H6QA 5IY5H 4ME9A 4BYYA 3CMYA 3H35A 5KAIC 1LFBA 4JK1X 1A6IA 1P4WA 3VOXA 3DKWA 2ZCWA 3TO6A 4E7SA 4ZYHA 4CCKA 3JRIA 2HXIA 2Q2EA 3VW1A 5J1UA 2CS3A 4EJUA 1Z1DA 2WGBA 4UDSA 2R5ZB 3GXOA 4ZJZA 5LGNA 3QRFF 4NC7A 3KP7A 5HVQC 1WHUA 4XMYA 1D0XA 2YX4A 1YYVA 5BS6A 2A68F 3K4NA 4HQMA 1B1BA 1G3SA 2VQLA 4DGWB 2HR3A 4BY7J 4IRIA 1V3FA 2IRFG 1ZGWA 2RASA 1Z7UA 3KP2A 2GA1A 3CF2A 4LG3A 1LKXA 1TT5B 1I50J 3JRGA 5D8KB 2XHKA 2FMLA 2HS5A 1BI1A 1FZPB 3RKWA 2QBYA 1FBQA 4CHUA 3H5NA 4XL9A 4GO1A 5IT9K 1MNMC 4RGRA 1W4MA 1T0FC 2WAQN 3F6VA 3ML6A 4AUXA 4BJTA 4NN1A 3OWTA 1LNWA 3K2ZA 5K7HA 1YTYA 5GPCA 1K78A 4IQJA 5HDKA 5E79C 2XKPA 5E1ZB 5D4RA 1JUSA 1TP4A 3WU1B 1X19A 4NQWB 3I56I 4P55A 2HQNA 2NOGA 3HPHA 2VLAA 4PDKA 5IT9Z 3VSKA 3CWRA 3FBIB 3CLOA 1R00A 3BNIA 2VN2A 2W00A 3I55I 2EZHA 1R9TJ 3L2QA 1F43A 3AG1H 3KE2A 4CDGA 2FBHA 4XLPF 2IP2A 3KIOA 2VC0A 1XMKA 2L9RA 3VUQA 2HVQA 4U9LA 2FOKA 4OINF 4E7IA 2IS6A 1FEXA 4L5IA 1B72B 2UXUA 1K61A 1HSTA 1I1GA 1JHHA 3Q9SA 2EBIA 2EIJH 2KLOA 2RN7A 1W7PA 2H6BA 4A69C 2MD5A 1XCBA 1JKRC 1ETVA 5HLGA 4PUSA 3MAJA 3CUQA 1UCRA 2EFPA 2Q2EB 1XSDA 2FNPA 3BG7A 3MVPA 3VIBA 4M9SA 2GAUA 3BR3A 3IHUA 3DKXA 1JUMA 1M1EB 2XDNA 4XLNF 5LEKA 4I99C 3L2UA 3OYGA 5CLSA 3Q0WA 2LTPA 3I54A 4FQGA 4LLNA 5D8LB 2OCCH
chains in the Genus database with same CATH topology
2HI3A 3BTLA 3BTCA 2JA8J 2QKOA 3VVXA 2DJNA 2VI6A 1P7IA 2DG7A 1H89C 2CU7A 1W0TA 1D5YA 3AQTA 1Y1WJ 1E3OC 5C4XJ 2ECCA 3RKQA 3DCFA 2M34A 4HNVA 1ETKA 3HOUJ 2RAEA 3VVZA 4XK4A 2VKEA 1AKHA 2D6YA 2QIBA 3WHCA 4FE7A 1UHSA 5IOYA 1RESA 5EDNA 2K9QA 3BT9A 3WHBA 3GBGA 4XRMA 3DEWA 2QTQA 4HKUA 3S17J 1JGGA 2R7ZJ 3MN2A 2FD5A 1TWAJ 2XGCA 2V57A 2ZCMA 5K7ZA 1ETXA 2M9HA 2ELKA 2LK2A 2M2EA 3QKXA 3V78A 4IHYA 1SFOJ 3ZQHA 3A02A 1FTZA 1POGA 3O8GA 2H1KA 5EFYA 5M5YJ 1RETA 2OPTA 2MG4A 4ABZA 3IH3A 2K40A 5J1YA 3CDLA 2LLKA 3OSFA 1T33A 4MLOA 5IYBJ 2XGEA 4M3GA 1GVDA 5F04A 1HDDC 5HBUA 3G56A 4JL3A 2O7TA 1VI0A 1ZK8A 3D1NI 2G7GA 2R5YA 5C4JJ 3NNRA 3TP3A 2YUSA 2LR8A 3JRFA 5C3EJ 4MXMA 3GTQJ 1JTYA 1RR7A 3ANPA 1Q1VA 2HKUA 4JX4A 5M3FJ 3HEFA 3LSGA 4IEJA 4M3EA 3S16J 1UG2A 2UXHA 4A3JJ 3O60A 4C3IJ 3A03A 3IH2A 3S1QJ 1BL0A 2ECBA 3BR0A 2JWTA 4GFBA 5FHPA 3JREA 5GP9A 4UUSB 2MW8A 4QSHA 5M3MJ 2NVTJ 3GTGJ 3JSJA 2YU9J 3IH4A 1G2HA 4A3KJ 3GTOJ 3TEDA 3ZQLA 1OCTC 2PBXA 5D19A 4Y7NJ 3NPIA 4XICA 1MBHA 3ZQCA 4A3EJ 2NX4A 5CW8A 3OOUA 2CUFA 5E3LA 1IG7A 2DA2A 2MGQA 3MKLA 3MNLA 1ETYA 3VP5A 3RZOJ 3FK6A 3BTIA 3IV5A 1ITYA 2TRTA 2OERA 5M5WJ 1GUUA 5JLXA 3JRBA 5AQCA 2DA6A 2DN0A 4J19A 5K7FA 1HCRA 4MFEA 4DYRA 1UI5A 3CJDA 3JRAA 1AKHB 2UXOA 1X58A 5F27A 3BJBA 1I3QJ 3TW7A 4FTHA 3T6NA 3KKCA 2JMWA 4AC0A 2B63J 4NELA 3G7RA 1K83J 2XGDA 3BR6A 3BG3A 2NVXJ 3HOWJ 4AYBN 2Y0SN 3I4NJ 2ZCNA 3BG9A 4L5EA 2COBA 2DTZA 4FCYA 5FJ8J 4AF5A 5EG0A 4C3JJ 3NXCA 2GFNA 3VPRA 2CQXA 3VOKA 2JA7J 2AO9A 2FQ4A 1OFCX 1MBKA 1ZKGA 2JJ7A 2I10A 2NP5A 3BTJA 4CYCA 5IP9J 3ZOBA 4XRSA 3IUVA 3ZQIA 5EZGA 2Q24A 1O4XA 2Y2ZA 1ZQ3P 4B3AA 3UKGA 4A3FJ 2L7MP 1BW6A 2R5YB 2Y31A 3PO2J 1IUFA 2UXPA 4A3CJ 5F1JA 2MSYA 2JA6J 3KNWA 4ACIA 2YVEA 2CUEA 1RPWA 3GTMJ 2O9LA 3LWJA 3CCYA 4JX6A 4RDUA 3VW2A 4DW6A 3FRQA 3BR2A 1SGMA 1WCMJ 1NTCA 5F0HA 2X9DA 2Y9ZA 2O8KA 5HSZA 4W1UA 1IJWC 3S2DJ 4BBRJ 3EUPA 3G1LA 1TWGJ 1QRYA 3NI7A 2XB0X 4LOCA 3FISA 3H3VK 1GDTA 4BBSJ 3S1MJ 4DYCA 2L7ZA 5FLMJ 1EF4A 1H8AC 5EF6A 2LVSA 3EGQA 2FX0A 1FJLA 5IYDJ 2CJJA 2DA1A 3S2HJ 4GFKA 3NARA 5DTDA 3E7LA 5J3LA 1ZR2A 2QWTA 4GFLA 4D7NA 2G0EA 2NVYJ 5EGOA 3DPJA 4I76A 4UUTA 3ZQGA 3O8HA 1XC5A 4ICHA 4S0HB 3COLA 1JKQC 1JUPA 1AHDP 1FTTA 2DMTA 1RKWA 4DZJA 3Q3SA 1Y1VJ 1MH3A 1BA5A 3LHQA 1JT0A 3Q0UA 2HQ5A 5F0CA 3HOXJ 2M0CA 5FKLA 1WH7A 4D5CA 9ANTA 5BNGA 3JRHA 2EQRA 5F0FA 4IHWA 4JKZA 5C44J 4QTRA 2R92J 5D18A 3Q0VA 2FJ1A 4M6VA 3BG5A 5EG0B 3HGYA 5K58A 3QPLA 3HTIA 1NK3P 1HLVA 1LE8A 1B8IA 1IGNA 2E2IJ 4D7MA 3F0CA 5GPAA 4JP0A 5E3OA 3RZDJ 2ZOZA 4CYCB 3PM1A 3SDGA 3B6CA 4M3BA 1WPKA 1GT0C 1JKOC 3RH2A 2JA5J 5D1RA 3CRJA 5DAJA 2KDZA 1RKTA 3PPBA 1FIPA 1JTXA 1IRZA 3TP0A 4A3GJ 3LSRA 5IPAA 3K7AJ 1IC8A 1DU0A 2LFBA 1XS9A 3ON2A 4JYKA 3HOZJ 4PXIA 3QQAA 3HTJA 1VNDA 4QIWN 2DMPA 3PASA 5DS9A 1APLC 1QPIA 2XRLA 5EYRA 3HBLA 3HKZN 1IDYA 4AC6A 2G3BA 2GUHA 4C2MJ 5FGLA 3I4MJ 2N8GA 2KT0A 1QVUA 4A3MJ 3FK7A 3HB9A 3S15J 1VF9A 3QBMA 3FKIJ 1HDPA 5FKKA 1YRNA 3TW6A 2G7LA 4KWAA 2R5ZA 2IBDA 5FKOA 2NVQJ 4D5FA 4IHVA 4JNNA 1AU7A 3OIOA 4FE4A 1JT6A 1U8BA 4B4CA 5HODA 1TWHJ 3L1PA 3S14J 1Z77A 2L7FP 2DA4A 3BR5A 3C2BA 2ZOYA 3JR9A 1MSEC 2QCOA 1T56A 2R0QC 2DG8A 2E1OA 1U9NA 4XIDA 3B6AA 3GTJJ 2ZCXA 2LY9A 2M8GX 1ETOA 2VPRA 3GEUA 2DA7A 2VUMJ 5EGOB 3PO3J 3S5RA 2HYJA 3QPSA 3B81A 2HOSA 2QOPA 1H88C 2PZ9A 2O7OA 2OF7A 2JK3A 3GTPJ 2LD5A 5CXIA 3V6GA 5IP6A 3HTHA 2DA5A 3H0GJ 1IDZA 2ID3A 1Z0XA 3HM5A 1BW5A 2CRGA 4MK6A 1OCPA 4M3FA 2ZB9A 2D5VA 2W53A 1ETQA 1X2NA 5JLWA 3HGGA 2RHAA 1ZR4A 3OSGA 1VFCA 2G7SA 2K9SA 3HE0A 3S1NJ 1WH5A 2EH3A 5H9TA 1TWCJ 3LOCA 3NAUA 3RD3A 3VW0A 2ME6A 3LNQA 1LE8B 5EZHA 1B8IB 1GV5A 1GV2A 1MBFA 4A3DJ 1WI3A 2EZIA 1ETWA 3F1BA 2VKVA 5F08A 4JX5A 5EEAA 3G1OA 3BHQA 4EEFG 2AHQA 2DA3A 3FIWA 3ZQFA 3KZ9A 1U78A 2HOTA 4XRSG 2WV1A 1JJ6C 2K9NA 1XG1A 1MBEA 2TCTA 2LKXA 2GM4A 2X6OA 3JRDA 4A3LJ 1ENHA 3G1MA 2DMUA 1B72A 2NS7A 1JKPC 1MSFC 4DZPA 2NP3A 2IU5A 2PMZN 4W97A 4G12A 2HDDA 3A01A 1HF0A 4BY1J 4ME9A 1MBGA 2E19A 3CMYA 1LFBA 5CXGA 1A6IA 3HTAA 3VOXA 2ME0A 3JRIA 2HXIA 3M4OJ 3AQSA 3VW1A 3BCGA 3ANGA 5J1UA 2EZKA 2XSDC 2L0KA 1PUFB 1YRNB 2WGBA 1TWFJ 2R5ZB 2UXIA 4UDSA 1MH4A 1JJ8C 3HIMA 1ORKA 1LFUP 3M3YJ 2YS9A 1SANA 2LP0A 2Y30A 5FKNA 3BRUA 2YVHA 5J1RA 5IOZA 2W48A 2CQQA 4BY7J 2OI8A 1A5JA 2E2JJ 5FMPA 5E3NA 2ID6A 2Y9YA 2DMNA 5FLVA 1HOMA 1ZGWA 2RASA 4RBOA 4GCTA 3RQIA 2FBQA 2GLOA 1I50J 2IEKA 3JRGA 5C4YA 4BKXA 1I6HJ 5M5XJ 4A3IJ 2P81A 1QVTA 3SFIA 1OJLA 2DMQA 1MNMC 4GCLA 4X6AJ 1X2MA 2WAQN 4AUXA 4NN1A 3W6VA 5IP7J 4V2GA 4M3DA 3ON4A 2F07A 5K7HA 5GPCA 3BQYA 4IHXA 1JUSA 1ZTRA 3KKDA 4A93J 2EZLA 2NS8A 1DU6A 3HOVJ 2GBYA 4BXXJ 4I6ZA 5E3MA 3BR1A 2XPWA 1PUFA 3LSPA 2NOGA 2REKA 4MO7A 4GCKA 3K2AA 3LJLA 3CWRA 3BNIA 3LSJA 3HDDA 2EZHA 1TC3C 1R9TJ 1F43A 2XB5A 3P9TA 2XPUA 4B1RA 1WGXA 2L9RA 2QF7A 3S1RJ 3GTLJ 3VUQA 2GENA 1CQTA 2E2HJ 4L62A 2WB1N 3GTKJ 2IAIA 2HYTA 1FEXA 3NRGA 1B72B 2UXUA 1K61A 3JRCA 1BJZA 2HXOA 4DYQA 1FIAA 2EBIA 3BQZA 4MIMA 4YZEA 3A01B 1F36A 1JKRC 4A69C 2R93J 1ETVA 2H8RA 2WUIA 3E7QA 2X48A 5HAWA 5IYCJ 3MVPA 4UUSA 3CQZJ 4X1EA 4A3BJ 4Y52J 1P7JA 3VIBA 5FKMA 1MBJA 4MFDA 4CGRA 3BR3A 1S7EA 4V2FA 3SJMA 4NDLA 1NK2P 1JUMA 1UMQA 3C07A 3VVYA 1W0UA 2XDNA 1UI6A 1U9OA 2HOAA 3HOYJ 3Q0WA 4C3HJ 2JN6A 2LTPA 3GZIA 1IV6A 4FISA 2XPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HI3 A;  3BTL A;  3BTC A;  2JA8 J;  2QKO A;  3VVX A;  2DJN A;  2VI6 A;  1P7I A;  2DG7 A;  1H89 C;  2CU7 A;  1W0T A;  1D5Y A;  3AQT A;  1Y1W J;  1E3O C;  5C4X J;  2ECC A;  3RKQ A;  3DCF A;  2M34 A;  4HNV A;  1ETK A;  3HOU J;  2RAE A;  3VVZ A;  4XK4 A;  2VKE A;  1AKH A;  2D6Y A;  2QIB A;  3WHC A;  4FE7 A;  1UHS A;  5IOY A;  1RES A;  5EDN A;  2K9Q A;  3BT9 A;  3WHB A;  3GBG A;  4XRM A;  3DEW A;  2QTQ A;  4HKU A;  3S17 J;  1JGG A;  2R7Z J;  3MN2 A;  2FD5 A;  1TWA J;  2XGC A;  2V57 A;  2ZCM A;  5K7Z A;  1ETX A;  2M9H A;  2ELK A;  2LK2 A;  2M2E A;  3QKX A;  3V78 A;  4IHY A;  1SFO J;  3ZQH A;  3A02 A;  1FTZ A;  1POG A;  3O8G A;  2H1K A;  5EFY A;  5M5Y J;  1RET A;  2OPT A;  2MG4 A;  4ABZ A;  3IH3 A;  2K40 A;  5J1Y A;  3CDL A;  2LLK A;  3OSF A;  1T33 A;  4MLO A;  5IYB J;  2XGE A;  4M3G A;  1GVD A;  5F04 A;  1HDD C;  5HBU A;  3G56 A;  4JL3 A;  2O7T A;  1VI0 A;  1ZK8 A;  3D1N I;  2G7G A;  2R5Y A;  5C4J J;  3NNR A;  3TP3 A;  2YUS A;  2LR8 A;  3JRF A;  5C3E J;  4MXM A;  3GTQ J;  1JTY A;  1RR7 A;  3ANP A;  1Q1V A;  2HKU A;  4JX4 A;  5M3F J;  3HEF A;  3LSG A;  4IEJ A;  4M3E A;  3S16 J;  1UG2 A;  2UXH A;  4A3J J;  3O60 A;  4C3I J;  3A03 A;  3IH2 A;  3S1Q J;  1BL0 A;  2ECB A;  3BR0 A;  2JWT A;  4GFB A;  5FHP A;  3JRE A;  5GP9 A;  4UUS B;  2MW8 A;  4QSH A;  5M3M J;  2NVT J;  3GTG J;  3JSJ A;  2YU9 J;  3IH4 A;  1G2H A;  4A3K J;  3GTO J;  3TED A;  3ZQL A;  1OCT C;  2PBX A;  5D19 A;  4Y7N J;  3NPI A;  4XIC A;  1MBH A;  3ZQC A;  4A3E J;  2NX4 A;  5CW8 A;  3OOU A;  2CUF A;  5E3L A;  1IG7 A;  2DA2 A;  2MGQ A;  3MKL A;  3MNL A;  1ETY A;  3VP5 A;  3RZO J;  3FK6 A;  3BTI A;  3IV5 A;  1ITY A;  2TRT A;  2OER A;  5M5W J;  1GUU A;  5JLX A;  3JRB A;  5AQC A;  2DA6 A;  2DN0 A;  4J19 A;  5K7F A;  1HCR A;  4MFE A;  4DYR A;  1UI5 A;  3CJD A;  3JRA A;  1AKH B;  2UXO A;  1X58 A;  5F27 A;  3BJB A;  1I3Q J;  3TW7 A;  4FTH A;  3T6N A;  3KKC A;  2JMW A;  4AC0 A;  2B63 J;  4NEL A;  3G7R A;  1K83 J;  2XGD A;  3BR6 A;  3BG3 A;  2NVX J;  3HOW J;  4AYB N;  2Y0S N;  3I4N J;  2ZCN A;  3BG9 A;  4L5E A;  2COB A;  2DTZ A;  4FCY A;  5FJ8 J;  4AF5 A;  5EG0 A;  4C3J J;  3NXC A;  2GFN A;  3VPR A;  2CQX A;  3VOK A;  2JA7 J;  2AO9 A;  2FQ4 A;  1OFC X;  1MBK A;  1ZKG A;  2JJ7 A;  2I10 A;  2NP5 A;  3BTJ A;  4CYC A;  5IP9 J;  3ZOB A;  4XRS A;  3IUV A;  3ZQI A;  5EZG A;  2Q24 A;  1O4X A;  2Y2Z A;  1ZQ3 P;  4B3A A;  3UKG A;  4A3F J;  2L7M P;  1BW6 A;  2R5Y B;  2Y31 A;  3PO2 J;  1IUF A;  2UXP A;  4A3C J;  5F1J A;  2MSY A;  2JA6 J;  3KNW A;  4ACI A;  2YVE A;  2CUE A;  1RPW A;  3GTM J;  2O9L A;  3LWJ A;  3CCY A;  4JX6 A;  4RDU A;  3VW2 A;  4DW6 A;  3FRQ A;  3BR2 A;  1SGM A;  1WCM J;  1NTC A;  5F0H A;  2X9D A;  2Y9Z A;  2O8K A;  5HSZ A;  4W1U A;  1IJW C;  3S2D J;  4BBR J;  3EUP A;  3G1L A;  1TWG J;  1QRY A;  3NI7 A;  2XB0 X;  4LOC A;  3FIS A;  3H3V K;  1GDT A;  4BBS J;  3S1M J;  4DYC A;  2L7Z A;  5FLM J;  1EF4 A;  1H8A C;  5EF6 A;  2LVS A;  3EGQ A;  2FX0 A;  1FJL A;  5IYD J;  2CJJ A;  2DA1 A;  3S2H J;  4GFK A;  3NAR A;  5DTD A;  3E7L A;  5J3L A;  1ZR2 A;  2QWT A;  4GFL A;  4D7N A;  2G0E A;  2NVY J;  5EGO A;  3DPJ A;  4I76 A;  4UUT A;  3ZQG A;  3O8H A;  1XC5 A;  4ICH A;  4S0H B;  3COL A;  1JKQ C;  1JUP A;  1AHD P;  1FTT A;  2DMT A;  1RKW A;  4DZJ A;  3Q3S A;  1Y1V J;  1MH3 A;  1BA5 A;  3LHQ A;  1JT0 A;  3Q0U A;  2HQ5 A;  5F0C A;  3HOX J;  2M0C A;  5FKL A;  1WH7 A;  4D5C A;  9ANT A;  5BNG A;  3JRH A;  2EQR A;  5F0F A;  4IHW A;  4JKZ A;  5C44 J;  4QTR A;  2R92 J;  5D18 A;  3Q0V A;  2FJ1 A;  4M6V A;  3BG5 A;  5EG0 B;  3HGY A;  5K58 A;  3QPL A;  3HTI A;  1NK3 P;  1HLV A;  1LE8 A;  1B8I A;  1IGN A;  2E2I J;  4D7M A;  3F0C A;  5GPA A;  4JP0 A;  5E3O A;  3RZD J;  2ZOZ A;  4CYC B;  3PM1 A;  3SDG A;  3B6C A;  4M3B A;  1WPK A;  1GT0 C;  1JKO C;  3RH2 A;  2JA5 J;  5D1R A;  3CRJ A;  5DAJ A;  2KDZ A;  1RKT A;  3PPB A;  1FIP A;  1JTX A;  1IRZ A;  3TP0 A;  4A3G J;  3LSR A;  5IPA A;  3K7A J;  1IC8 A;  1DU0 A;  2LFB A;  1XS9 A;  3ON2 A;  4JYK A;  3HOZ J;  4PXI A;  3QQA A;  3HTJ A;  1VND A;  4QIW N;  2DMP A;  3PAS A;  5DS9 A;  1APL C;  1QPI A;  2XRL A;  5EYR A;  3HBL A;  3HKZ N;  1IDY A;  4AC6 A;  2G3B A;  2GUH A;  4C2M J;  5FGL A;  3I4M J;  2N8G A;  2KT0 A;  1QVU A;  4A3M J;  3FK7 A;  3HB9 A;  3S15 J;  1VF9 A;  3QBM A;  3FKI J;  1HDP A;  5FKK A;  1YRN A;  3TW6 A;  2G7L A;  4KWA A;  2R5Z A;  2IBD A;  5FKO A;  2NVQ J;  4D5F A;  4IHV A;  4JNN A;  1AU7 A;  3OIO A;  4FE4 A;  1JT6 A;  1U8B A;  4B4C A;  5HOD A;  1TWH J;  3L1P A;  3S14 J;  1Z77 A;  2L7F P;  2DA4 A;  3BR5 A;  3C2B A;  2ZOY A;  3JR9 A;  1MSE C;  2QCO A;  1T56 A;  2R0Q C;  2DG8 A;  2E1O A;  1U9N A;  4XID A;  3B6A A;  3GTJ J;  2ZCX A;  2LY9 A;  2M8G X;  1ETO A;  2VPR A;  3GEU A;  2DA7 A;  2VUM J;  5EGO B;  3PO3 J;  3S5R A;  2HYJ A;  3QPS A;  3B81 A;  2HOS A;  2QOP A;  1H88 C;  2PZ9 A;  2O7O A;  2OF7 A;  2JK3 A;  3GTP J;  2LD5 A;  5CXI A;  3V6G A;  5IP6 A;  3HTH A;  2DA5 A;  3H0G J;  1IDZ A;  2ID3 A;  1Z0X A;  3HM5 A;  1BW5 A;  2CRG A;  4MK6 A;  1OCP A;  4M3F A;  2ZB9 A;  2D5V A;  2W53 A;  1ETQ A;  1X2N A;  5JLW A;  3HGG A;  2RHA A;  1ZR4 A;  3OSG A;  1VFC A;  2G7S A;  2K9S A;  3HE0 A;  3S1N J;  1WH5 A;  2EH3 A;  5H9T A;  1TWC J;  3LOC A;  3NAU A;  3RD3 A;  3VW0 A;  2ME6 A;  3LNQ A;  1LE8 B;  5EZH A;  1B8I B;  1GV5 A;  1GV2 A;  1MBF A;  4A3D J;  1WI3 A;  2EZI A;  1ETW A;  3F1B A;  2VKV A;  5F08 A;  4JX5 A;  5EEA A;  3G1O A;  3BHQ A;  4EEF G;  2AHQ A;  2DA3 A;  3FIW A;  3ZQF A;  3KZ9 A;  1U78 A;  2HOT A;  4XRS G;  2WV1 A;  1JJ6 C;  2K9N A;  1XG1 A;  1MBE A;  2TCT A;  2LKX A;  2GM4 A;  2X6O A;  3JRD A;  4A3L J;  1ENH A;  3G1M A;  2DMU A;  1B72 A;  2NS7 A;  1JKP C;  1MSF C;  4DZP A;  2NP3 A;  2IU5 A;  2PMZ N;  4W97 A;  4G12 A;  2HDD A;  3A01 A;  1HF0 A;  4BY1 J;  4ME9 A;  1MBG A;  2E19 A;  3CMY A;  1LFB A;  5CXG A;  1A6I A;  3HTA A;  3VOX A;  2ME0 A;  3JRI A;  2HXI A;  3M4O J;  3AQS A;  3VW1 A;  3BCG A;  3ANG A;  5J1U A;  2EZK A;  2XSD C;  2L0K A;  1PUF B;  1YRN B;  2WGB A;  1TWF J;  2R5Z B;  2UXI A;  4UDS A;  1MH4 A;  1JJ8 C;  3HIM A;  1ORK A;  1LFU P;  3M3Y J;  2YS9 A;  1SAN A;  2LP0 A;  2Y30 A;  5FKN A;  3BRU A;  2YVH A;  5J1R A;  5IOZ A;  2W48 A;  2CQQ A;  4BY7 J;  2OI8 A;  1A5J A;  2E2J J;  5FMP A;  5E3N A;  2ID6 A;  2Y9Y A;  2DMN A;  5FLV A;  1HOM A;  1ZGW A;  2RAS A;  4RBO A;  4GCT A;  3RQI A;  2FBQ A;  2GLO A;  1I50 J;  2IEK A;  3JRG A;  5C4Y A;  4BKX A;  1I6H J;  5M5X J;  4A3I J;  2P81 A;  1QVT A;  3SFI A;  1OJL A;  2DMQ A;  1MNM C;  4GCL A;  4X6A J;  1X2M A;  2WAQ N;  4AUX A;  4NN1 A;  3W6V A;  5IP7 J;  4V2G A;  4M3D A;  3ON4 A;  2F07 A;  5K7H A;  5GPC A;  3BQY A;  4IHX A;  1JUS A;  1ZTR A;  3KKD A;  4A93 J;  2EZL A;  2NS8 A;  1DU6 A;  3HOV J;  2GBY A;  4BXX J;  4I6Z A;  5E3M A;  3BR1 A;  2XPW A;  1PUF A;  3LSP A;  2NOG A;  2REK A;  4MO7 A;  4GCK A;  3K2A A;  3LJL A;  3CWR A;  3BNI A;  3LSJ A;  3HDD A;  2EZH A;  1TC3 C;  1R9T J;  1F43 A;  2XB5 A;  3P9T A;  2XPU A;  4B1R A;  1WGX A;  2L9R A;  2QF7 A;  3S1R J;  3GTL J;  3VUQ A;  2GEN A;  1CQT A;  2E2H J;  4L62 A;  2WB1 N;  3GTK J;  2IAI A;  2HYT A;  1FEX A;  3NRG A;  1B72 B;  2UXU A;  1K61 A;  3JRC A;  1BJZ A;  2HXO A;  4DYQ A;  1FIA A;  2EBI A;  3BQZ A;  4MIM A;  4YZE A;  3A01 B;  1F36 A;  1JKR C;  4A69 C;  2R93 J;  1ETV A;  2H8R A;  2WUI A;  3E7Q A;  2X48 A;  5HAW A;  5IYC J;  3MVP A;  4UUS A;  3CQZ J;  4X1E A;  4A3B J;  4Y52 J;  1P7J A;  3VIB A;  5FKM A;  1MBJ A;  4MFD A;  4CGR A;  3BR3 A;  1S7E A;  4V2F A;  3SJM A;  4NDL A;  1NK2 P;  1JUM A;  1UMQ A;  3C07 A;  3VVY A;  1W0U A;  2XDN A;  1UI6 A;  1U9O A;  2HOA A;  3HOY J;  3Q0W A;  4C3H J;  2JN6 A;  2LTP A;  3GZI A;  1IV6 A;  4FIS A;  2XPV A; 
#chains in the Genus database with same CATH topology
 2HI3 A;  3VYS B;  1UB9 A;  2Y69 H;  2QKO A;  1R6R A;  2HOE A;  2DJN A;  2K02 A;  1AOY A;  2NVU B;  1D5Y A;  1HXD A;  4KIB A;  1LVA A;  1EJ9 A;  3DCF A;  5LFA A;  1MD0 A;  4HNV A;  2VBX A;  5L3B A;  1MKM A;  2QQB A;  4RMN A;  3HOU J;  4M74 A;  3ZP5 A;  2QUF A;  2QBY B;  1KQ0 A;  5D5W B;  2PMZ A;  3ZR8 X;  2F4M B;  4GCV A;  2OQR A;  5LGU A;  3WHB A;  2XC7 A;  2QTQ A;  3MD2 A;  2E36 A;  3FX3 A;  3TO9 A;  3DWL E;  1JGG A;  2DPD A;  2R7Z J;  4I2O A;  1BR2 A;  1ETX A;  3EQL F;  4HQE A;  2ELK A;  3JAM K;  1K78 B;  2NYX A;  3QPH A;  4CCO A;  3V78 A;  1BN5 A;  2EJR A;  2KQR A;  3AG4 H;  1WJC A;  3K4M A;  3TDZ C;  4O3M A;  3ABM H;  4PGH A;  1RET A;  1ZHF A;  2MG4 A;  4XLC A;  4ABZ A;  5J1Y A;  2X6W A;  3CDL A;  2LLK A;  1UG0 A;  3RYP A;  4E7H A;  2GIV A;  3KP5 A;  5IYB J;  3SDB A;  2HWV A;  5B5E C;  3WTS C;  5DD4 A;  1HDD C;  2L9V A;  4M9Z A;  2O7T A;  3KZI C;  2XAG A;  3JAM Z;  3D1N I;  4LK0 F;  2R5Y A;  4IHS A;  1CGP A;  2EFN A;  3NNR A;  2LR8 A;  5ILS A;  2DJI A;  4L5J A;  5C3E J;  2V1U A;  4A2U A;  1VQ9 I;  1DDN A;  4JX4 A;  5M3F J;  4CGZ A;  3LSG A;  3H3U A;  4ZYE A;  2PN6 A;  2XKO A;  3SEQ A;  1W7P B;  2Q8K A;  1GXQ A;  2UXH A;  1P4A A;  4BE0 A;  3V7C A;  4C3I J;  3A03 A;  3IAS 2;  3H36 A;  3CUQ B;  4RS8 A;  3L00 A;  1UFM A;  4GFB A;  5FHP A;  5EJC A;  2R7V A;  2NVT J;  3GTG J;  2VBW A;  3ZMZ A;  2YU9 J;  3OYK A;  1USS A;  3IH4 A;  4UVA A;  2DOF A;  4A3K J;  5BMZ A;  4Y7N J;  1MBH A;  3RDI A;  3ZQC A;  4A3E J;  2OTJ I;  3EDP A;  5CW8 A;  2DOA A;  4HF2 A;  1K6Y A;  1OQY A;  1MND A;  2MGQ A;  3MNL A;  5TIS C;  1ZGA A;  2L9N A;  4KN4 X;  1OPC A;  5GAD J;  3OL3 A;  3BTI A;  4N4N B;  5M5W J;  2H1L A;  2K3P A;  4HBL A;  2KJC A;  5EEH A;  1ACI A;  2BY0 A;  4J19 A;  4MFE A;  1E0E A;  3HRM A;  3WE2 A;  3HZJ A;  4DOZ A;  2QWW A;  5LEJ A;  1L3L A;  4XSX F;  2BY2 A;  2ESH A;  2RC4 A;  3T6N A;  1J59 A;  2JMW A;  3J81 K;  4AC0 A;  2B63 J;  3WTZ A;  1VQP I;  1D3Y A;  3BR6 A;  3BG3 A;  5DCF A;  4A5N A;  3WTW C;  4BL0 B;  2NVX J;  2DDB A;  3GO5 A;  4ESJ A;  3HOW J;  2KDO A;  2ZCN A;  3KCC A;  4L5E A;  2V9V A;  2COB A;  3P9I A;  1TQM A;  2G7U A;  3AG2 H;  2Z2S B;  1FY7 A;  3LQR A;  5EG0 A;  3M7G A;  5LD2 C;  2AQE A;  3NXC A;  1OCZ H;  1T2K A;  2MFZ A;  4IRV A;  1B6A A;  3WU2 C;  4OMZ A;  2NNY A;  2DBB A;  4CIC A;  2H27 A;  4EJO A;  3VPR A;  4E70 A;  3VOK A;  2JJ7 A;  1OFC X;  3J81 Z;  3GUD A;  4GRI A;  3ZQI A;  2K27 A;  1GLN A;  2Y2Z A;  2OA4 A;  1B4A A;  2W4S A;  2L7M P;  1WJB A;  2R5Y B;  3SHF A;  4HNT A;  5H6R A;  1IUF A;  3MZH A;  2IS1 A;  2V6E A;  3HRT A;  5CVJ A;  3KNW A;  2W7N A;  3U21 A;  3LWJ A;  3W2W A;  3CCY A;  2ZSH B;  4KIC A;  3ZMU A;  3KFW X;  4G7Z F;  4U7D A;  3UR3 C;  4HEA 2;  4JOM A;  5E1W A;  2QQA A;  3W2A A;  1R1U A;  1UHW A;  1N25 A;  4O6J A;  4BBR J;  2VE9 A;  2JSP A;  3LST A;  2XAU A;  1RI7 A;  3QP5 A;  1XCV A;  3BZC A;  2BHZ A;  2E1N A;  1MGT A;  3FIS A;  3ZMT A;  4PFP A;  2FU4 A;  3HSR A;  1ULY A;  3BCB A;  4OIR F;  4BDZ A;  3M9A A;  4I09 A;  4KMU X;  1ZRE A;  3CO7 C;  4WCG A;  4PSW A;  5FLM J;  3A2K A;  1IV8 A;  1Z9C A;  2RQP A;  1ZEL A;  1H8A C;  2LVS A;  3EGQ A;  3VB2 A;  1FJL A;  3BY6 A;  3U1D A;  2UUZ A;  4GFK A;  5HS8 A;  3E7L A;  5J3L A;  2QWT A;  2O8X A;  2NVY J;  3F8C A;  5EGO A;  3RKX A;  4BHB A;  4HA8 A;  3BP8 A;  4XNF A;  1SVO A;  2ZBK A;  2EFO A;  3FBN B;  4U87 A;  3R6S A;  1JKQ C;  3FHN A;  2DU9 A;  2KKO A;  2DMT A;  2FOW A;  4HV6 A;  5HDG A;  3RSN A;  5D5X B;  5TJJ A;  1Y1V J;  1MH3 A;  1BA5 A;  2BOL A;  4XKV A;  2RVC A;  4BHP A;  2QM3 A;  3K4K A;  3DEU A;  3HTA A;  1R36 A;  5CJ9 A;  4RAG A;  3JRH A;  4LGW A;  5F0F A;  4JKZ A;  1S9H A;  2VXD A;  3I58 A;  2HQA A;  2WY8 Q;  3SXY A;  3CCM I;  3I0T A;  2R92 J;  3OYA A;  2OZU A;  2FJ1 A;  3K0L A;  4YEJ A;  1VQM I;  4M6V A;  2PJR A;  6PAX A;  2VJJ A;  3R4K A;  2YPR A;  5EG0 B;  2NOJ B;  1MMA A;  2KFD A;  3L2C A;  1WQ2 A;  2KRC A;  3L2V A;  3JSP A;  4KNY A;  5ERI A;  3F0C A;  1OYI A;  4JP0 A;  2IGM A;  2OV7 A;  4X0G A;  3MKY B;  3CCR I;  4ON0 A;  1W5S A;  1WPK A;  4L9J A;  1U0J A;  2JA5 J;  5DAJ A;  2KDZ A;  1OR7 C;  2DT5 A;  4P96 A;  1FIP A;  1TBX A;  4YIF A;  4C2U A;  3TP0 A;  2X0L A;  3K7A J;  1J2X A;  2WV0 A;  2LFB A;  2HZT A;  4JYK A;  4BQQ A;  3G71 I;  1DPR A;  3HTJ A;  3J80 K;  1R49 A;  3I59 A;  5EYR A;  3HBL A;  4NUB A;  4B3X A;  2EV0 A;  5B1B H;  2G3B A;  3S93 A;  2DCE A;  4C2T A;  4BJ5 C;  2W57 A;  4YG2 F;  3KX2 A;  2RNG A;  4Y3O A;  2JRM A;  4IRG A;  3QBM A;  4KWA A;  4A5M A;  3FKI J;  2XAS A;  3Q9V A;  5E20 A;  1SFX A;  2A3S A;  3TW6 A;  3BPV A;  5FKO A;  4JNN A;  4D5F A;  2EIK H;  3VDX A;  3BJA A;  3OIO A;  3QYF A;  4FE4 A;  3GZ6 A;  3GME A;  3GW2 A;  4RAY A;  4LG0 A;  2L7F P;  4ZTJ A;  5AON A;  3J80 Z;  3F6O A;  2RGV A;  3C2B A;  2ZOY A;  2D1V A;  1E17 A;  1MSE C;  2QCO A;  2IGK A;  3E97 A;  1KA8 A;  1OCR H;  2CFO A;  2LRD A;  4L9V A;  2E1O A;  4XID A;  2IS4 A;  2ZCX A;  2LY9 A;  1T8I A;  1ETO A;  3CP8 A;  3RTR A;  4S05 A;  2VUM J;  5EGO B;  4HPQ A;  2HYJ A;  3CCJ I;  2JTV A;  3PL8 A;  3IKT A;  3QPS A;  4UB6 C;  2F5D A;  2A05 A;  3SWH A;  1HKS A;  1XX5 A;  4HOB A;  1D1B A;  4RGS A;  2F48 A;  3HYI A;  2VAS A;  3CDH A;  2DA5 A;  2DFF A;  1G3T A;  2ELH A;  1N75 A;  3BDD A;  4UV8 A;  4WF2 A;  4MQ9 F;  1BW5 A;  4IZZ A;  4MK6 A;  4M3F A;  3QOD A;  2ZB9 A;  1FMW A;  1ETQ A;  2RKH A;  5CVR A;  5JLW A;  3I71 A;  5HLT A;  1R5H A;  1KQ8 A;  2PJR B;  1SVL A;  1D0Y A;  2VB6 A;  5H9T A;  2VL8 A;  4Y33 A;  1I27 A;  2KIU A;  3FMS A;  2EZI A;  1ETW A;  3F1B A;  3DLL F;  1F9N A;  3G1O A;  3BHQ A;  1U6G A;  1R71 A;  4AD9 A;  1OKR A;  1OR7 A;  2HOT A;  4XRS G;  2PLY A;  3FKJ A;  4A3L J;  1MBE A;  2MH9 A;  5GAE J;  2GM4 A;  3G4S I;  1JI8 A;  2VQC A;  4DZP A;  4G8X A;  2CWE A;  2HDD A;  2XF6 A;  3A01 A;  4WXC A;  1VQO I;  1YOV B;  4BY1 J;  2E19 A;  4II3 A;  2VOD A;  1YIO A;  5CXG A;  3FMR A;  4LIU A;  4N0B A;  3M4O J;  1FC3 A;  2P5L C;  2CSO A;  2XSD C;  2A6E F;  2L0K A;  3H9Q A;  1PUF B;  1FBU A;  2UXI A;  2RV8 A;  1MH4 A;  4FX0 A;  4P5O A;  2DPU A;  5DM6 F;  3J7A Y;  1LFU P;  3M3Y J;  1SAN A;  3H1C A;  5ICC A;  1ONV A;  4LG0 B;  1RRJ A;  2W48 A;  2CQQ A;  4IQ4 A;  1NHA A;  2E2J J;  2YU3 A;  3W2V A;  3LSM A;  5E3N A;  4OWR B;  2DYS H;  2DMN A;  3MQ0 A;  1HOM A;  2P0W A;  5KHD A;  3I53 A;  3OS2 A;  4JBA A;  4RBO A;  2BVM A;  2V1D A;  2F6C A;  1PYV A;  2GLO A;  4TV7 A;  3G6E I;  3VEP A;  2WY7 Q;  5CKT A;  5M5X J;  3BJO A;  2P81 A;  2HYF A;  1ZH5 A;  1FP1 D;  1OJL A;  4U0V A;  2DW4 A;  4BE2 A;  1SFE A;  4X6A J;  3HKZ A;  1X2M A;  2KZV A;  3K10 A;  3X2Q H;  3LA2 A;  4M3D A;  2DYR H;  2F07 A;  2G7H A;  2CO5 A;  5ILU A;  5DD8 A;  4HLY A;  2P7C B;  1ZTR A;  4RGU A;  3QOE A;  4CYD A;  3H5R A;  3HOV J;  4AM3 A;  1J09 A;  2VE8 A;  1BI3 A;  4OIP F;  2DQR A;  3FXM A;  5CYV A;  2V6C A;  4MO7 A;  1BM9 A;  5D6F A;  3VFZ A;  4GCK A;  4Q4Z F;  3DTE A;  2ZSI B;  3MEX A;  2QEX I;  2P7V B;  5J8F A;  4UVC A;  1WVR A;  2X1E A;  2IA0 A;  2LC2 A;  5K5R A;  2CW7 A;  5TRD A;  3FXO A;  2AXL A;  4L62 A;  2W1O A;  3KEY A;  2HYT A;  2EWN A;  3H9J A;  2R7X A;  3QPT A;  2HXO A;  1W36 D;  2VJ4 A;  1HSJ A;  1UHM A;  3BQZ A;  4DBQ A;  4YZE A;  3KEQ A;  3A01 B;  1F36 A;  2QYO A;  4L0Z B;  3F8B A;  4QWQ A;  3E7Q A;  1S7O A;  4F55 A;  4CO8 A;  1F5T A;  4BNC A;  1D8J A;  2P5K A;  5HAW A;  1D1A A;  1Z67 A;  4EM1 A;  5IYC J;  1QBJ A;  3CQZ J;  3UNG C;  2L01 A;  4Y52 J;  1P7J A;  2ZXJ A;  5D4S A;  1X1B A;  4E6K G;  5LRR A;  1IN4 A;  4V2F A;  5L3D A;  2M0M A;  1A31 A;  4IF4 A;  1W0U A;  1X3W B;  1V5F A;  1YX5 A;  1K4T A;  3PFI A;  2VJI A;  2XUB A;  2XPV A;  1O7L A;  2K3F A;  3ZQ7 A;  2DG7 A;  4HLX A;  1H89 C;  1GVJ A;  4KMF A;  2KRF A;  2ECC A;  3KPH A;  1ON2 A;  3GVA A;  3D0S A;  3DV8 A;  4IVN A;  2VKE A;  3CTA A;  4EGZ A;  5CQG A;  4IRH A;  2D45 A;  1HBX G;  1RES A;  2M87 A;  3BT9 A;  3JW4 A;  1BJA A;  5CVV A;  4NB5 A;  2VBZ A;  1Z3Y A;  2FD5 A;  2M8E A;  1MMN A;  5K7Z A;  3T0Y A;  1BI0 A;  1SVM A;  3I9V 2;  1S72 I;  3V8J A;  2B1E A;  2JUC A;  5FB2 A;  4BQA A;  3CUQ C;  4HZF A;  3F8N A;  5K1Y A;  5BOX A;  3GWZ A;  3NRV A;  4CZC A;  3VSL A;  5EFY A;  2ICW G;  2VKH A;  3OYJ A;  2JVG A;  1FOY A;  4IXA A;  1XGO A;  2STW A;  2FJI 1;  3RPU D;  3ELK A;  3HSE A;  3R60 A;  2W85 A;  3OSF A;  3VOD A;  3HL2 A;  3B02 A;  2XGE A;  4GYG A;  4PGG A;  2GOM A;  3G56 A;  1Y56 A;  1EV7 A;  1ZG3 A;  5C4J J;  4ZYD A;  1ZAR A;  3TP3 A;  3MKW B;  4J00 A;  5J8C A;  1J7K A;  3GTQ J;  1JTY A;  2JT1 A;  2CW0 F;  2JPB A;  3DEE A;  2HKU A;  3HEF A;  3LMM A;  4IEJ A;  3OV8 A;  1OYW A;  3PIP F;  5DCM A;  1ZN2 A;  1PDN C;  3KYD B;  4A3J J;  4LB5 A;  5E17 F;  2XAH A;  3JRE A;  5GP9 A;  1QNT A;  3FHZ A;  4QSH A;  1BI2 A;  3JSJ A;  3LSH A;  2K86 A;  4R79 A;  2ACJ A;  5CVU A;  2CMP A;  1JHF A;  3GTO J;  3TED A;  5D19 A;  2PBX A;  5FRM A;  4ENN A;  3NPI A;  4XIC A;  1T08 B;  2NX4 A;  3OOU A;  2CUF A;  3OYF A;  2BXY A;  3MCZ A;  5DM7 F;  4KYW A;  4KIS A;  3PQJ A;  1F4K A;  3RZO J;  3FK6 A;  3VTI A;  2OER A;  4KA4 A;  1GUU A;  5JLX A;  5BPI A;  3EUA A;  3G2B A;  5AQC A;  4YIR X;  2EIN H;  1PVE A;  1R22 A;  3IRR A;  2WB1 A;  3W3C A;  4BU2 A;  5ED4 A;  2HVR A;  4BS9 A;  1X1C A;  4YII A;  1VQ8 I;  3ASN H;  1IAW A;  1QU3 A;  4IOA F;  1V55 H;  3OYM A;  3ZMS A;  1I3Q J;  2ESN A;  3TW7 A;  3N97 A;  1YS7 A;  1KU7 A;  4WXH A;  2HTJ A;  2MC3 A;  3SZG A;  1LUJ B;  1R1T A;  5F6F A;  3G7R A;  3KLO A;  1K83 J;  3ZCO A;  1MMG A;  1T98 A;  2Y0S N;  2AXT C;  3VYT B;  1EH7 A;  4EAT A;  3BG9 A;  2F5C A;  3V42 A;  2M5W A;  4AF5 A;  1IXC A;  2P8T A;  2LG4 A;  2J5O A;  5F64 A;  3H9G A;  1YJ9 I;  1XGS A;  2MLK A;  2AO9 A;  2FQ4 A;  3O2P E;  4B09 A;  1S7A A;  2NP5 A;  3BTJ A;  4CYC A;  5AIQ A;  3K70 C;  1HW1 A;  5EZG A;  1J9I A;  2E60 A;  2FNA A;  3W6K B;  4B3A A;  3UKG A;  1RUN A;  1LQ1 A;  1HQC A;  2MYS A;  3PO2 J;  3EUH A;  4E7J A;  1GHC A;  3H5A A;  1ZRC A;  4ACI A;  2PX9 A;  4UHT A;  4HDV A;  4JX6 A;  3VW2 A;  5DCM B;  4ESF A;  1V4R A;  3FWE A;  3BR2 A;  5HSZ A;  2X9D A;  2Y9Z A;  2JVH A;  3EUP A;  3GEZ A;  3WG7 H;  2FBI A;  3DBH B;  3DBL B;  3G1L A;  1LB2 A;  3TO7 A;  4G7H F;  1UST A;  2VXZ A;  3CMM A;  2GXB A;  3NI7 A;  4C2M A;  1IXS B;  1X1D A;  3KYC B;  2O5R A;  3LFK A;  1RC9 A;  3E5Q A;  1D1C A;  3H3V K;  4IHT A;  1J75 A;  4BBS J;  4MGR A;  4DYC A;  2K5C A;  4Y17 A;  1EF4 A;  1G8X A;  3LQQ A;  1REP C;  3HJE A;  5GTI C;  3CZ6 A;  3CCQ I;  3T5X A;  5IYD J;  3K4C A;  3ISP A;  3HTU A;  4CCJ A;  4XOR A;  4G6T B;  2VBY A;  3F23 A;  4D7N A;  2ZJQ F;  3F8M A;  1BC8 C;  2W24 A;  4I76 A;  4MTD A;  3DPJ A;  4OU0 A;  3HSF A;  4ICH A;  2H94 A;  1QHH D;  4S0H B;  4I0A A;  3COL A;  1G6N A;  2R7F A;  1X4O A;  1AHD P;  4B47 A;  5ILV A;  2IT0 A;  1MMS A;  3JTH A;  4DZJ A;  1OIS A;  3T8T A;  4WX9 A;  1X3Z B;  3LHQ A;  2QKM B;  2HQ5 A;  3Q0U A;  2G9W A;  4BXF A;  1X1P A;  2M0C A;  4D5C A;  5BNG A;  4C30 A;  2XRN A;  1TNS A;  2OUM A;  5H20 A;  3ABK H;  1I1S A;  4FAS D;  3CCE I;  2CQ7 A;  2R7Q A;  2FE3 A;  1S8N A;  4XLH A;  4BGD A;  2JUG A;  1XDS A;  3A0B C;  3EET A;  3TOB A;  3BG5 A;  4KIF A;  3HGY A;  2EFW A;  3HUG A;  2O03 A;  4U0W A;  3HTI A;  2F5V A;  4BJ6 C;  1DGW Y;  1LE8 A;  1OMI A;  1B8I A;  1IGN A;  2UXN A;  4D7M A;  5FLX K;  5GPA A;  2J5P A;  1RIO H;  1N77 A;  1MJB A;  3RZD J;  2ZOZ A;  4G6Q A;  4CYC B;  1K7A A;  1O3Q A;  2OD5 A;  3BZ6 A;  2H8W A;  2ZXW H;  1Y8R B;  1T39 A;  4LMY A;  5L3F A;  3CRJ A;  2M7A A;  3JSO A;  1ZRD A;  3BOQ A;  5HDN A;  1SMY F;  5IPA A;  1DU0 A;  3K1N A;  1A35 A;  5B66 C;  3RKY A;  3SZP A;  3R0A A;  5JVT A;  3QQA A;  2E7X A;  4ZYG A;  3PAS A;  1QPI A;  5FLX Z;  4N9I A;  1S3J A;  3QOP A;  1O3S A;  4C2M J;  4AYB A;  1KU3 A;  2OQG A;  4LD5 A;  2LNB A;  3I5U A;  4ANJ A;  1KYZ A;  3IWZ A;  2KT0 A;  3FK7 A;  3S15 J;  1Z21 A;  1YRN A;  2G7L A;  1LEB A;  3KEO A;  1XTA A;  3DXJ F;  1U8B A;  4B4C A;  2VKD A;  3E6B A;  4WWC A;  3VWB A;  2X51 A;  5HOD A;  4XN3 A;  2IA2 A;  2UWM A;  4I98 B;  2DA4 A;  3BR5 A;  3EYY A;  4MHG A;  1PP8 F;  2R0Q C;  2DG8 A;  3WOD F;  2IJL A;  1ODD A;  2M8G X;  2DA7 A;  2XDV A;  4ITV A;  4M6X A;  4RB1 A;  2Z5U A;  3F8F A;  1ZG1 A;  1SAX A;  1DP7 P;  4I7H A;  2A61 A;  2HOS A;  2QOP A;  2QA4 I;  1H88 C;  2PZ9 A;  2OF7 A;  3GFM A;  1B9N A;  1XN7 A;  2JK3 A;  3PFY A;  2UZK A;  2DFI A;  1HKQ A;  3FDY A;  3PIO F;  2LD5 A;  1L0O C;  5CXI A;  3V6G A;  5IP6 A;  3B73 A;  4MEX F;  2V4J C;  3H0G J;  2NXN B;  2WAF A;  5CPR B;  1IDZ A;  1Z0X A;  1IN6 A;  1STZ A;  2L54 A;  1BBY A;  2CRG A;  3ZGK A;  1R4N B;  2UXX A;  3TL4 X;  3WTU C;  3FZV A;  1MJA A;  4GDF A;  2OU2 A;  3M07 A;  1Z3X A;  2ETH A;  3TOA A;  1SEU A;  3HUG B;  3LOC A;  1BOA A;  3NAU A;  1YG2 A;  4A0Y A;  1IN8 A;  2C6Y A;  2ME6 A;  2LDU A;  1LE8 B;  2LY2 A;  2HU9 A;  5FD5 A;  1LVK A;  1B8I B;  2CV0 A;  1XSX A;  4A3D J;  3BWG A;  1WI3 A;  4M72 A;  1XGN A;  2GIZ A;  2W25 A;  4IJA A;  5K5O A;  3GYH X;  2AHQ A;  2DO7 A;  3FF5 A;  2X1D A;  2DA3 A;  2BE5 F;  1Z6R A;  4XOT A;  1FLI A;  2M4K A;  5FFX A;  2K9N A;  3V8K A;  2LKX A;  1WWX A;  5J4Y A;  2X6O A;  1FT9 A;  1WJ5 A;  2XSJ C;  3WTY C;  2KP6 A;  1P2F A;  1KYW A;  2MLG A;  4F92 B;  3OR2 C;  3F21 A;  1MSF C;  1ZG5 A;  1WJA A;  2PMZ N;  4W97 A;  2K9L A;  2QQ8 A;  3AAF A;  1HF0 A;  2MA3 A;  1MBG A;  2E1C A;  4M9X A;  4Q5S F;  2BEO A;  3IWF A;  3E1S A;  1GXP A;  3AQS A;  4EQQ A;  2DOD A;  3BCG A;  2WAE A;  3RPU A;  2EZK A;  1R5G A;  2H6C A;  3COA C;  5LHI A;  1YRN B;  4PZJ A;  4WIB A;  3F3X A;  3HIM A;  4Z6Y A;  4LIT A;  2YS9 A;  2LF7 A;  2BHY A;  2QKL B;  3K4J A;  4HNU A;  4IPA A;  3OYD A;  4Q47 A;  2Y30 A;  5FKN A;  3S3M A;  3BRU A;  1IN7 A;  5IOZ A;  1UEL B;  5GTH C;  1YIJ I;  2WWY A;  5FMP A;  3RCO A;  3DQV C;  3PSI A;  3AG3 H;  3WGI A;  2ID6 A;  4Y15 A;  3WGH A;  2HEO A;  2JQ7 A;  2QZ8 A;  2B3W A;  2HYG D;  3ECH A;  4GCT A;  3QU3 A;  2FBQ A;  3MZ8 A;  4UVB A;  4M6Y A;  2O3F A;  4A3I J;  3L09 A;  2EIL H;  3SFI A;  2HKO A;  2DMQ A;  2LF8 A;  4LLG F;  4GCL A;  4RGX A;  4K2E A;  3PJR A;  4RM3 A;  3RYR A;  3E5U A;  4V2G A;  3ON4 A;  3K9T A;  4LB6 B;  2L4M A;  3BQY A;  2KMU A;  4WK8 F;  2LRE A;  1T38 A;  3NRG A;  5GAH J;  4HSR A;  4A93 J;  2EZL A;  2NS8 A;  1DU6 A;  2VJ5 A;  3E5X A;  3BR1 A;  2M45 A;  2XPW A;  1PUF A;  4PJJ A;  3R61 A;  2ZKZ A;  2ZO4 A;  3CUO A;  3A1Y A;  3GCM A;  1XMX A;  3D5R C;  3DTK A;  1YHQ I;  2HPI A;  3NQO A;  4HYE A;  3K6G A;  1PUE E;  3P9T A;  2XPU A;  1BIB A;  1WGX A;  3QWL A;  4CH7 A;  4Y4R A;  4BHC A;  1CQT A;  2E2H J;  2VPL A;  2DFE A;  5CQE A;  2IAI A;  3GLL A;  2RRE A;  2V79 A;  2D2W A;  4FX4 A;  3JRC A;  4CCL A;  2EB7 A;  2V26 A;  1FIA A;  3L7W A;  4MIM A;  1V5G A;  4LLL A;  3T1B A;  1SAU A;  4XLA A;  4L0Y B;  4PJL A;  2R93 J;  3PNV A;  4BH9 A;  1YIT I;  1TNT A;  4MQV A;  1MJ9 A;  2WUI A;  2PG4 A;  5KK1 A;  4QPQ A;  3FXU A;  3S8P A;  4UUS A;  4U0Y A;  3SQN A;  5FKM A;  4BUP A;  1S7E A;  4PCQ A;  3SJM A;  4NDL A;  4N9H A;  5J40 A;  1OCO H;  4BDY A;  3C07 A;  3VVY A;  1VTN C;  2YX7 A;  3N4M A;  2VIX A;  4ZZD A;  2K4B A;  5JI6 A;  1XPX A;  1VQN I;  3P5J A;  1IV6 A;  1WJF A;  4FIS A;  4IO9 F;  1YJW I;  2KPM A;  3VVX A;  1P7I A;  3ESW B;  1U3E M;  3MZY A;  1W0T A;  1FYL A;  3AQT A;  1Y1W J;  4UNO A;  5C4X J;  4S04 A;  4P9U A;  2VOO A;  1ZYR F;  2K4J A;  2A2F X;  3OYE A;  3EYI A;  3J7Y J;  1IN5 A;  1J0R A;  2WBM A;  4BEH A;  5BPD A;  1KGS A;  1VZ0 A;  3VVZ A;  4XK4 A;  1U8R A;  3DF8 A;  1AKH A;  1Q1H A;  2QIB A;  1YE9 A;  3WHC A;  4FE7 A;  1UHS A;  3E0J B;  5IOY A;  5EDN A;  1KQ9 A;  4HV5 A;  2K9Q A;  4P1W A;  4XRM A;  3DEW A;  2HVS A;  1H9G A;  3WU0 A;  3MN2 A;  1TWA J;  2XGC A;  4RM2 A;  4RLQ A;  4M73 A;  1Y39 A;  1HA8 A;  2ZCM A;  1KU9 A;  2LK2 A;  3QKX A;  2PMU A;  4HST A;  3C3W A;  1FMV A;  2FSW A;  2L4A A;  1FTZ A;  3CCU I;  3K69 A;  2E1M B;  3FMQ A;  2A6H F;  2H1K A;  1XD7 A;  2XV4 S;  5M5Y J;  1ZAO A;  5FGM A;  2QQ9 A;  2OPT A;  4E7K A;  2L9S A;  1U5T A;  2CW8 A;  4MLO A;  1DP3 A;  2I8D A;  3KP3 A;  5F04 A;  2F4O B;  5HBU A;  3HRS A;  1BR1 A;  2VOP A;  3ERE D;  1G3W A;  1Z05 A;  1V54 H;  4PFO A;  4E7Z A;  2YUS A;  3JRF A;  4MXM A;  1XB4 A;  2GQQ A;  3EUK L;  4Q48 A;  1R7J A;  4B48 A;  1QA6 A;  3CO6 C;  2BYV E;  2WAQ A;  1ZLK A;  1UAA A;  3CME I;  4E4H A;  3O60 A;  1EA3 A;  2ZXI A;  1PP7 U;  3IH2 A;  3QAH A;  4B43 A;  3C1D A;  4ASN A;  1BL0 A;  3S1Q J;  1LDD A;  1LDK B;  2LY1 A;  3BR0 A;  3V4G A;  2CV2 A;  2AQF A;  2M30 A;  4UUS B;  1JGS A;  1SC7 A;  3E3V A;  4DVY P;  1E3P A;  4ZZL A;  1G2H A;  1D8K A;  2ZY9 A;  1OCT C;  2VON A;  1D5V A;  2L7K A;  3F72 A;  3PNT A;  4I0B A;  1SFK A;  1BR4 A;  2DA2 A;  3S32 A;  3MKL A;  4XLF A;  3CP2 A;  3IV5 A;  1AA7 A;  1ITY A;  2TRT A;  1VQ7 I;  1V5E A;  2D1H A;  2GA2 A;  3JRB A;  2DA6 A;  2DN0 A;  4YRV A;  4DNC A;  1HCR A;  1DPU A;  2R7D A;  4BEH B;  3SYT A;  3K8P C;  3CJD A;  4OAY A;  1AKH B;  3DPU A;  1X58 A;  4HF1 A;  3BJB A;  5J47 A;  1CF7 A;  4FTH A;  2Y0S A;  3QYE A;  3S3O A;  1TTY A;  3CJN A;  3E6D A;  2Y75 A;  4XKB A;  1O3T A;  3P9C A;  2OCE A;  1O57 A;  4EJV A;  2BY3 A;  2DTZ A;  3H92 A;  2BY1 A;  4FCY A;  5FJ8 J;  4C3J J;  2OBP A;  3LA3 A;  4NNJ A;  4YFK F;  5DUK A;  1HKT A;  3C2G A;  4LJZ F;  3TGN A;  2F2E A;  2CQX A;  2V7F A;  1ZKG A;  4RB2 C;  3IC7 A;  1U5T B;  2I10 A;  3ZOB A;  4EVI A;  3FXJ A;  3IUV A;  2X4H A;  3PSF A;  2BXZ A;  2PFV A;  1ZQ3 P;  1IUY A;  1YLF A;  5E8I A;  2BW3 A;  2R4G A;  3FXQ A;  2Y31 A;  1SFU A;  2HPM A;  4AIJ A;  3FXR A;  4NBQ A;  2KIS A;  4RB3 C;  4UY8 I;  2BVL A;  2MSY A;  3ZXS A;  5HS7 A;  2JA6 J;  4A3C J;  2UXP A;  2YVE A;  1RPW A;  3C18 A;  2ZXH A;  2O9L A;  1S6L A;  4RDU A;  4DW6 A;  3FRQ A;  1X3U A;  2I5U A;  4HF0 A;  1A04 A;  2VT2 A;  1WCM J;  1NTC A;  5F0H A;  4H4K C;  3PQK A;  4W1U A;  4IOC F;  1IJW C;  2P6S A;  3E6M A;  4NC6 A;  2ZJR F;  3IP4 B;  5L3E A;  2R7W A;  4D1Q A;  5B1A H;  4F93 B;  4AU7 A;  3WE3 A;  2XB0 X;  1IRX A;  4LOC A;  4DQ2 A;  5CVI A;  3K4L A;  1GDT A;  3CJQ B;  4XM3 A;  3HOS A;  2L7Z A;  2K7L A;  3M8F A;  4L9N A;  4XKC A;  3QP6 A;  3ZMV A;  3FXK A;  2Y0M A;  3OOP A;  2FX0 A;  3S2H J;  5DTD A;  1U2W A;  2OTL I;  5HNH A;  3OYN A;  4P9F A;  1N78 A;  2X85 A;  1VQL I;  4GFL A;  2G0E A;  3HG9 A;  2HDW A;  4GXO A;  4BAC A;  1TL8 A;  1FSH A;  1A36 A;  1MDM A;  3HRU A;  1I5Z A;  2L3D A;  3OYH A;  2F5F A;  3TBI A;  1JUP A;  4ENM A;  1FTT A;  2XRO A;  2W84 A;  4ETS A;  1CF7 B;  3Q3S A;  4I02 A;  3EUH C;  1JT0 A;  2MC4 A;  1JXS A;  2HZD A;  1WH7 A;  3ABT A;  2Z1D A;  9ANT A;  4KN7 X;  3HIF A;  1OYY A;  5LBQ A;  2Z9O A;  3OS0 A;  4YEL A;  4UXN A;  5C44 J;  3BLY A;  3K1M A;  4QTR A;  2DK5 A;  4EMS A;  3Q0V A;  5KVR A;  2B9S A;  5D18 A;  1IF1 A;  2TDX A;  2FF4 A;  3KLN A;  3ROU A;  1D0Z A;  1NK3 P;  1HLV A;  2E2I J;  2XGX A;  2ELJ A;  3RIR A;  3GF2 A;  2B0L A;  3PM1 A;  3RH2 A;  1GT0 C;  2L2O A;  1VQ4 I;  3ABU A;  1JTX A;  3PPB A;  2BW3 B;  1W5C C;  2JSC A;  4UV9 A;  3L2R A;  1ERD A;  4A3G J;  1SD7 A;  2KRH A;  3LSR A;  4A6E A;  3OL4 A;  4OOI A;  1IC8 A;  3ON2 A;  1XS9 A;  3IAM 2;  1P6R A;  3HOZ J;  4PXI A;  3IUO A;  2HFH A;  1VND A;  4QIW N;  2R3S A;  5JHF A;  1APL C;  2IXS A;  1BIA A;  3OIQ A;  3HKZ N;  1IDY A;  3ULQ B;  4AID A;  3P7N A;  2GUH A;  5FGL A;  3HC7 A;  2IGO A;  2N8G A;  2L02 A;  4DJA A;  4A3M J;  2XVC A;  3HB9 A;  1VF9 A;  5DYM A;  1HDP A;  5FKK A;  3PUF A;  2MH2 A;  1X1A A;  1QZE A;  1FWZ A;  1FNN A;  1XSV A;  1KZH A;  4CA0 A;  2NVQ J;  3MWM A;  1AU7 A;  1XDU A;  1JT6 A;  4A12 A;  5JR3 A;  2HDC A;  1Z77 A;  5LLQ A;  3LWF A;  3CC7 I;  3AL0 B;  2CFX A;  2FA5 A;  2YSR A;  1S5L C;  3JR9 A;  1T56 A;  2ZME A;  5LGT A;  3BG6 A;  1U9N A;  1Z91 A;  3S5R A;  4BXU A;  2IW5 A;  2ADU A;  1MDM B;  1WZ2 A;  4KT6 A;  2QSG X;  1LPQ A;  3KP4 A;  4M71 A;  2DT7 B;  4OD4 A;  3ZN1 A;  5AIP A;  3HTH A;  4PJN A;  3C2H A;  5B3S H;  1KU2 A;  3HM5 A;  5F1R A;  3AFH A;  4MEY F;  2VC1 A;  3O6B B;  4U88 A;  5DDG A;  2DQL A;  3CC2 I;  2W53 A;  1FBS A;  2V9K A;  3HGG A;  4RAF A;  1WI9 A;  2RHA A;  1ZR4 A;  1R1V A;  1VFC A;  2DTR A;  3I4P A;  2EH3 A;  3ABL H;  2KIM A;  3RD3 A;  2DFH A;  3CJT B;  5KAF C;  3LNQ A;  3U1K A;  3W6J B;  2QEN A;  5EZH A;  1GV2 A;  1MBF A;  2IPQ X;  4XLE A;  4CXF A;  1P9Q C;  2STT A;  5F08 A;  4EEF G;  2EV6 A;  3BCA A;  4XQF A;  1QGP A;  4EJW A;  3BC8 A;  1UZC A;  3FIW A;  3KZ9 A;  1UJ8 A;  3QYB A;  1RNL A;  1JJ6 C;  1T95 A;  5LRS A;  1TLH B;  1XG1 A;  2KHM A;  3CCL I;  3JRD A;  3P9K A;  1ENH A;  1SD4 A;  1T0F A;  2CUJ A;  3G1M A;  3KP6 A;  2KL4 A;  3NEU A;  1W36 C;  2DMU A;  2NS7 A;  3DU5 A;  2F5E A;  2IU5 A;  1LJ9 A;  1MW7 A;  4YFN F;  1WKM A;  3DLA A;  4G12 A;  4OD5 A;  1YQA A;  3K4B A;  3LFU A;  5HLI A;  3CMA I;  1P4X A;  2ME0 A;  2R7O A;  3PNY A;  1E3H A;  1VQ5 I;  2B7E A;  1ON1 A;  2QLZ A;  3ANG A;  2ZFU A;  5K5Q A;  3Q5F A;  4XKW A;  4FET A;  4HX8 A;  3RPQ A;  1TWF J;  1JJ8 C;  1ORK A;  1FOW A;  4ENJ A;  3RQ4 A;  1QQI A;  1TZL A;  3M8E A;  2PI0 A;  2LP0 A;  3GX4 X;  3ZPL A;  2YVH A;  5J1R A;  3SZT A;  4EM0 B;  2OI8 A;  4F7Z A;  1A5J A;  4ZDL A;  1NH3 A;  4PSX A;  2ZME B;  2Y9Y A;  2LOO A;  5FLV A;  5J4V A;  1FP2 A;  4GGG A;  4ZC3 A;  1B59 A;  3RQI A;  4PJ0 C;  1B9M A;  2DDA A;  3OYB A;  1QPM A;  2IEK A;  4DBR A;  5C4Y A;  4BKX A;  1I6H J;  2Y48 A;  3ZMD A;  1OLT A;  1QVT A;  4F3Q A;  5HNF A;  3OYI A;  3V8L A;  2E34 A;  2FRH A;  4CUG A;  2O61 A;  3W6V A;  5IP7 J;  3N05 A;  4OMY A;  4AVZ A;  2FXA A;  1RZ4 A;  2KIQ A;  2PFB A;  2EK5 A;  4AVP A;  2BZT A;  5KCM A;  2CUZ A;  3E6C C;  2YR2 A;  4IHX A;  5L3C A;  3KKD A;  4PJM A;  1WFX A;  4XR6 A;  4BXX J;  2A5Y B;  2GBY A;  2MD0 A;  4I6Z A;  1HC8 A;  5E3M A;  4KJZ A;  3LSP A;  1WRJ A;  2REK A;  2LSO A;  3K2A A;  3LJL A;  2K9M A;  2ZJ2 A;  5JVG F;  2KZG A;  4JQF A;  3LSJ A;  5IT3 A;  3NWT A;  3HDD A;  3BJ6 A;  3ZN0 A;  1TC3 C;  3VYU B;  4XN0 A;  2XB5 A;  4A6D A;  2WC2 A;  2DT6 A;  4B1R A;  2O0Y A;  2QF7 A;  4L9T A;  3S1R J;  1C0W A;  3CJR B;  3GTL J;  2GEN A;  3J7Z I;  1W5T A;  2QSF X;  3LL7 A;  2WB1 N;  4AIH A;  3GTK J;  2CGP A;  1G4D A;  4D0P A;  3DBR B;  3GZ5 A;  3TQN A;  3DPT A;  4F91 B;  4D9J A;  5J6X A;  2PBI A;  1BJZ A;  4DYQ A;  1HW5 A;  2FMY A;  2MBF A;  3OIP A;  2X6X A;  2H8R A;  2ZC2 A;  3G3Z A;  2X48 A;  1FYK A;  1YW9 A;  3MFK A;  3KYL A;  4A3B J;  1I6X A;  4RAZ A;  4X1E A;  2AS5 F;  1MMD A;  1MBJ A;  4MFD A;  3BZK A;  3CLQ A;  4CGR A;  4ENK A;  3HTS B;  1NK2 P;  1O7F A;  1UMQ A;  2CH0 A;  1UI6 A;  2EV5 A;  1U9O A;  2HOA A;  2Q1Z B;  5FFZ A;  3HOY J;  2HNH A;  4C3H J;  4YFX F;  2JN6 A;  3GZI A;  3CES A;  4FHT A;  4IHV A;  5F1J A;  2E1M C;  2EIM H;  3BTL A;  3BTC A;  1QZZ A;  2PEX A;  4ZDP A;  2RNJ A;  2JA8 J;  2ISY A;  2VI6 A;  5JFR A;  2Z99 A;  2CU7 A;  2OZ6 A;  1E3O C;  1TQI A;  3RKQ A;  3BRO A;  4B8X A;  3DFG A;  1LDJ A;  2M34 A;  4AIK A;  1ETK A;  4RA2 A;  2RAE A;  2HKX A;  2D6Y A;  4J01 A;  1FSE A;  5E8G A;  4HKU A;  3GBG A;  1DUX C;  3S17 J;  4QPO A;  2F4I A;  1YX3 A;  2E7W A;  2V57 A;  4IL6 C;  2M9H A;  2M2E A;  2FQ3 A;  4R8H A;  4IHY A;  1SFO J;  1OCC H;  3ZQH A;  2DK8 A;  2LYC A;  3A02 A;  5D5V B;  3REO A;  1POG A;  3D5S C;  2Q0O A;  3O8G A;  5LHG A;  5HS9 A;  2LKP A;  2FUG 2;  3R0J A;  1S29 A;  1P92 A;  3G73 A;  3IH3 A;  2K40 A;  3OYL A;  3LAJ A;  1T33 A;  3M1C A;  1XMA A;  1R5I D;  4BQO A;  4M3G A;  1GVD A;  1YJN I;  3H0D A;  4JL3 A;  1VI0 A;  1EKE A;  1ZK8 A;  2G7G A;  2LBF A;  2NNN A;  3IKV A;  1WSU A;  2JA2 A;  1MNE A;  1RR7 A;  3ANP A;  4NHJ A;  1Q1V A;  2ZNY A;  2RQQ A;  4PK4 A;  2IVM A;  3S16 J;  4M3E A;  5FRN A;  3V7S A;  1UG2 A;  2R7S A;  3K1P A;  1HW2 A;  1EH6 A;  4BE1 A;  2ECB A;  1SD5 A;  2LH9 A;  3HHG A;  2JWT A;  5DUI A;  5ICF A;  2MAB A;  2DI3 A;  2MW8 A;  5M3M J;  2M4G A;  1F1Z A;  2XAJ A;  2R7R A;  4UB8 C;  2M1B A;  4BAY A;  2A07 F;  5LHH A;  2EFQ A;  4I01 A;  3T8R A;  3ZQL A;  2VQH A;  2YVX A;  2DLL A;  3DP7 A;  3F9K A;  4CCM A;  5E3L A;  1IG7 A;  2GZW A;  3D5L A;  3GFI A;  1TT0 A;  1R58 A;  1SMT A;  1ETY A;  3VP5 A;  1IW7 F;  3KZZ A;  3L9F A;  2A5W A;  4A0Z A;  4EM2 A;  3ERM A;  4HRI A;  3MMY B;  2WAD A;  2X1C A;  2DAO A;  2XF5 A;  3WG9 A;  1U5T C;  5K7F A;  2R7U A;  1G59 A;  5FO5 A;  3ZRG A;  4DYR A;  1IRG A;  1UI5 A;  4NC8 A;  1BC7 C;  1ZLJ A;  3I3L A;  3JRA A;  3HOT A;  1KON A;  2UXO A;  2V1X A;  2WTE A;  3VYR B;  5F27 A;  3BPX A;  1DQU A;  4EV0 A;  3KKC A;  4NEL A;  4ZDO A;  3S2W A;  3OR1 C;  2CV1 A;  2XGD A;  4OIO F;  2VQG A;  3F22 A;  2OC6 A;  2OAZ A;  2ZNZ A;  4KIT B;  2BGC A;  4AYB N;  1T6S A;  4O5V A;  4KFC A;  4CZZ A;  3I4N J;  1W7P D;  1TW2 A;  5JHU A;  1WJD A;  2RDP A;  3LA7 A;  3RJP A;  4IX7 A;  4U7B A;  1FPQ A;  5FRO A;  2GFN A;  2JA7 J;  1MBK A;  2IA1 A;  1YW7 A;  1Y6I A;  5IP9 J;  3HHH A;  4XRS A;  5KNL A;  1K6O A;  2X6Y A;  2Q24 A;  1XGM A;  4H0E A;  2P5V A;  1O4X A;  3CDI A;  3EPZ A;  1O3R A;  3CF5 F;  4A3F J;  1BW6 A;  2E71 A;  4XSZ F;  2LBF B;  4CSW A;  3DTI A;  2E35 A;  2HTS A;  2A6T A;  2COM A;  1DGR M;  3U9G A;  2E5N A;  2CUE A;  3WGG A;  3GTM J;  2BV6 A;  2JPC A;  4QLC U;  2CQN A;  5D6E A;  3IL2 A;  2CYY A;  1SGM A;  1X4P A;  3U2R A;  2O8K A;  3WTV C;  4UUV A;  3S2D J;  4A0X A;  3CCV I;  1TWG J;  1QRY A;  1YO5 C;  4RB0 A;  1K4S A;  2HGC A;  2WA0 A;  1YW8 A;  2CG4 A;  1YFH A;  2XIG A;  3CC4 I;  3S1M J;  2K85 A;  3LSI A;  5HLH A;  2NAZ A;  5EF6 A;  4CCN A;  4F52 A;  4HDU A;  3TMO A;  1G3Y A;  3DU6 A;  4II2 A;  1MZB A;  2LKS A;  2CJJ A;  2DA1 A;  1TQP A;  3WTT C;  3JTG A;  4E7L A;  3ECO A;  3NAR A;  4LK1 F;  1VQK I;  4LFU A;  5H2F C;  1ZR2 A;  2DOE A;  3TKY A;  2W82 A;  4UUT A;  3ZQG A;  3A0H C;  3O8H A;  3CCS I;  2DXI A;  1XC5 A;  2Z16 A;  5E18 F;  1ZRF A;  3LSK A;  2BBY A;  2GWR A;  3I59 B;  1IZ1 A;  1EH8 A;  3S3N A;  1RKW A;  3PUB A;  3O3K A;  3TDU C;  2QGU A;  3WTX C;  4XOP A;  4KIG A;  1FOK A;  5F0C A;  3HOX J;  4HG2 A;  5FKL A;  4IHW A;  2EQR A;  3GFJ A;  2PQ8 A;  3QU6 A;  1FYM A;  5ICE A;  2CQK A;  1TW3 A;  1H0M A;  4L18 B;  1I3A A;  2PJP A;  4Y13 A;  3ZQQ A;  5D5U B;  5BQT A;  1Y8Q B;  4WXD A;  3GFL A;  4C9Y A;  1QO0 D;  1QHG A;  5K58 A;  3QPL A;  3KET A;  5E1X A;  4EGY A;  3HPG A;  5E3O A;  2JRT A;  4OIQ F;  3ONQ A;  3SDG A;  3B6C A;  4M3B A;  1JKO C;  1FX7 A;  3IRQ A;  5D1R A;  3K70 D;  1RKT A;  3AL0 C;  1SD6 A;  2OJE D;  1RR8 C;  3NS4 A;  1IRZ A;  2Z3Y A;  2XAQ A;  1R23 A;  5TGT A;  3VOE A;  1I39 A;  2LMD A;  4XBF A;  4AWX B;  4ZYA A;  1MIJ A;  3DKY A;  4HX7 A;  2EA2 A;  1A6Q A;  1J5Y A;  2A69 F;  2FEZ A;  1NG7 A;  2NS0 A;  2DMP A;  5DS9 A;  1IXR C;  3OMY A;  2XRL A;  3CD6 I;  2KJB A;  4AC6 A;  4U9N A;  2GOX B;  1IRF A;  1H9T A;  2GXA A;  2NRA C;  1K79 A;  4ZTF A;  3RI4 A;  4MTE A;  3I4M J;  2E5Z A;  3FM5 A;  4Z2Y A;  1QVU A;  3A4C A;  3JCU C;  3C7J A;  5ICG A;  1E2X A;  3V7R A;  4IKF A;  2R5Z A;  2IBD A;  2FBK A;  4EJT A;  2O6G E;  1YS6 A;  1FOX A;  1Z7L A;  3NWS A;  4HX4 A;  2H09 A;  1TWH J;  4XRF A;  3L1P A;  3S14 J;  2L5Q A;  2XF7 A;  4BQN A;  2HQR A;  1LFP A;  5EEG A;  3I64 A;  3AKZ A;  5FD6 A;  1NG6 A;  3SEZ A;  2M3A A;  2QSH X;  3GTJ J;  3GEU A;  2QVO A;  3B6A A;  3L2W A;  2VPR A;  3ASO H;  3PO3 J;  1IO2 A;  3M8J A;  1ZGJ A;  2PMH A;  1PJR A;  3KZY A;  1JE8 A;  4XON A;  3B81 A;  2O7O A;  2EPF A;  4LIV A;  1R4M B;  3GTP J;  2EA4 A;  2KIF A;  2P6T A;  4DIQ A;  4RLF A;  3OS1 A;  2Z33 A;  4KDP A;  4G9Y A;  2P4W A;  2ID3 A;  1BOB A;  3FM3 A;  4ESB A;  1OCP A;  4MNU A;  5GAG J;  1RUO A;  2D5V A;  1X2N A;  4R1H A;  5HOO A;  2M7B A;  2VT3 A;  2XAF A;  5A2Q K;  2UV1 A;  3OSG A;  4B44 A;  2G7S A;  1AWC A;  2K9S A;  3HE0 A;  3M1E A;  3S1N J;  1WJE A;  1WH5 A;  3GLX A;  4NQW A;  4OAZ A;  1TWC J;  3FXL A;  1YI2 I;  3GZN B;  2IS2 A;  3VW0 A;  2R7T A;  3SFZ A;  2IGN A;  2V1N A;  4KUM A;  4V19 K;  1GV5 A;  3DPL C;  4KT5 C;  5L3G A;  2VKV A;  4JX5 A;  4ZH4 F;  5EEA A;  1W1W E;  3OY9 A;  1LEA A;  4N4O B;  4GYI A;  1Y0U A;  2ZJP F;  2JZY A;  1Y0N A;  5DV5 A;  3ZQF A;  3J7A O;  4G7O F;  1U78 A;  2GXG A;  4FT8 A;  3H3Z A;  4HAM A;  3OYC A;  2WV1 A;  4G94 A;  2V9P A;  2ZME C;  2TCT A;  5A2Q Z;  2ISZ A;  1QZY A;  4G6D A;  1B72 A;  1Z6T A;  3MKZ A;  1JKP C;  2ZFW A;  3LAP A;  2NP3 A;  3HXL A;  1VQ6 I;  4HW0 A;  5DEQ A;  5H6Q A;  5IY5 H;  4ME9 A;  4BYY A;  3CMY A;  3H35 A;  5KAI C;  1LFB A;  4JK1 X;  1A6I A;  1P4W A;  3VOX A;  3DKW A;  2ZCW A;  3TO6 A;  4E7S A;  4ZYH A;  4CCK A;  3JRI A;  2HXI A;  2Q2E A;  3VW1 A;  5J1U A;  2CS3 A;  4EJU A;  1Z1D A;  2WGB A;  4UDS A;  2R5Z B;  3GXO A;  4ZJZ A;  5LGN A;  3QRF F;  4NC7 A;  3KP7 A;  5HVQ C;  1WHU A;  4XMY A;  1D0X A;  2YX4 A;  1YYV A;  5BS6 A;  2A68 F;  3K4N A;  4HQM A;  1B1B A;  1G3S A;  2VQL A;  4DGW B;  2HR3 A;  4BY7 J;  4IRI A;  1V3F A;  2IRF G;  1ZGW A;  2RAS A;  1Z7U A;  3KP2 A;  2GA1 A;  3CF2 A;  4LG3 A;  1LKX A;  1TT5 B;  1I50 J;  3JRG A;  5D8K B;  2XHK A;  2FML A;  2HS5 A;  1BI1 A;  1FZP B;  3RKW A;  2QBY A;  1FBQ A;  4CHU A;  3H5N A;  4XL9 A;  4GO1 A;  5IT9 K;  1MNM C;  4RGR A;  1W4M A;  1T0F C;  2WAQ N;  3F6V A;  3ML6 A;  4AUX A;  4BJT A;  4NN1 A;  3OWT A;  1LNW A;  3K2Z A;  5K7H A;  1YTY A;  5GPC A;  1K78 A;  4IQJ A;  5HDK A;  5E79 C;  2XKP A;  5E1Z B;  5D4R A;  1JUS A;  1TP4 A;  3WU1 B;  1X19 A;  4NQW B;  3I56 I;  4P55 A;  2HQN A;  2NOG A;  3HPH A;  2VLA A;  4PDK A;  5IT9 Z;  3VSK A;  3CWR A;  3FBI B;  3CLO A;  1R00 A;  3BNI A;  2VN2 A;  2W00 A;  3I55 I;  2EZH A;  1R9T J;  3L2Q A;  1F43 A;  3AG1 H;  3KE2 A;  4CDG A;  2FBH A;  4XLP F;  2IP2 A;  3KIO A;  2VC0 A;  1XMK A;  2L9R A;  3VUQ A;  2HVQ A;  4U9L A;  2FOK A;  4OIN F;  4E7I A;  2IS6 A;  1FEX A;  4L5I A;  1B72 B;  2UXU A;  1K61 A;  1HST A;  1I1G A;  1JHH A;  3Q9S A;  2EBI A;  2EIJ H;  2KLO A;  2RN7 A;  1W7P A;  2H6B A;  4A69 C;  2MD5 A;  1XCB A;  1JKR C;  1ETV A;  5HLG A;  4PUS A;  3MAJ A;  3CUQ A;  1UCR A;  2EFP A;  2Q2E B;  1XSD A;  2FNP A;  3BG7 A;  3MVP A;  3VIB A;  4M9S A;  2GAU A;  3BR3 A;  3IHU A;  3DKX A;  1JUM A;  1M1E B;  2XDN A;  4XLN F;  5LEK A;  4I99 C;  3L2U A;  3OYG A;  5CLS A;  3Q0W A;  2LTP A;  3I54 A;  4FQG A;  4LLN A;  5D8L B;  2OCC H; 
#chains in the Genus database with same CATH homology
 2HI3 A;  3BTL A;  3BTC A;  2JA8 J;  2QKO A;  3VVX A;  2DJN A;  2VI6 A;  1P7I A;  2DG7 A;  1H89 C;  2CU7 A;  1W0T A;  1D5Y A;  3AQT A;  1Y1W J;  1E3O C;  5C4X J;  2ECC A;  3RKQ A;  3DCF A;  2M34 A;  4HNV A;  1ETK A;  3HOU J;  2RAE A;  3VVZ A;  4XK4 A;  2VKE A;  1AKH A;  2D6Y A;  2QIB A;  3WHC A;  4FE7 A;  1UHS A;  5IOY A;  1RES A;  5EDN A;  2K9Q A;  3BT9 A;  3WHB A;  3GBG A;  4XRM A;  3DEW A;  2QTQ A;  4HKU A;  3S17 J;  1JGG A;  2R7Z J;  3MN2 A;  2FD5 A;  1TWA J;  2XGC A;  2V57 A;  2ZCM A;  5K7Z A;  1ETX A;  2M9H A;  2ELK A;  2LK2 A;  2M2E A;  3QKX A;  3V78 A;  4IHY A;  1SFO J;  3ZQH A;  3A02 A;  1FTZ A;  1POG A;  3O8G A;  2H1K A;  5EFY A;  5M5Y J;  1RET A;  2OPT A;  2MG4 A;  4ABZ A;  3IH3 A;  2K40 A;  5J1Y A;  3CDL A;  2LLK A;  3OSF A;  1T33 A;  4MLO A;  5IYB J;  2XGE A;  4M3G A;  1GVD A;  5F04 A;  1HDD C;  5HBU A;  3G56 A;  4JL3 A;  2O7T A;  1VI0 A;  1ZK8 A;  3D1N I;  2G7G A;  2R5Y A;  5C4J J;  3NNR A;  3TP3 A;  2YUS A;  2LR8 A;  3JRF A;  5C3E J;  4MXM A;  3GTQ J;  1JTY A;  1RR7 A;  3ANP A;  1Q1V A;  2HKU A;  4JX4 A;  5M3F J;  3HEF A;  3LSG A;  4IEJ A;  4M3E A;  3S16 J;  1UG2 A;  2UXH A;  4A3J J;  3O60 A;  4C3I J;  3A03 A;  3IH2 A;  3S1Q J;  1BL0 A;  2ECB A;  3BR0 A;  2JWT A;  4GFB A;  5FHP A;  3JRE A;  5GP9 A;  4UUS B;  2MW8 A;  4QSH A;  5M3M J;  2NVT J;  3GTG J;  3JSJ A;  2YU9 J;  3IH4 A;  1G2H A;  4A3K J;  3GTO J;  3TED A;  3ZQL A;  1OCT C;  2PBX A;  5D19 A;  4Y7N J;  3NPI A;  4XIC A;  1MBH A;  3ZQC A;  4A3E J;  2NX4 A;  5CW8 A;  3OOU A;  2CUF A;  5E3L A;  1IG7 A;  2DA2 A;  2MGQ A;  3MKL A;  3MNL A;  1ETY A;  3VP5 A;  3RZO J;  3FK6 A;  3BTI A;  3IV5 A;  1ITY A;  2TRT A;  2OER A;  5M5W J;  1GUU A;  5JLX A;  3JRB A;  5AQC A;  2DA6 A;  2DN0 A;  4J19 A;  5K7F A;  1HCR A;  4MFE A;  4DYR A;  1UI5 A;  3CJD A;  3JRA A;  1AKH B;  2UXO A;  1X58 A;  5F27 A;  3BJB A;  1I3Q J;  3TW7 A;  4FTH A;  3T6N A;  3KKC A;  2JMW A;  4AC0 A;  2B63 J;  4NEL A;  3G7R A;  1K83 J;  2XGD A;  3BR6 A;  3BG3 A;  2NVX J;  3HOW J;  4AYB N;  2Y0S N;  3I4N J;  2ZCN A;  3BG9 A;  4L5E A;  2COB A;  2DTZ A;  4FCY A;  5FJ8 J;  4AF5 A;  5EG0 A;  4C3J J;  3NXC A;  2GFN A;  3VPR A;  2CQX A;  3VOK A;  2JA7 J;  2AO9 A;  2FQ4 A;  1OFC X;  1MBK A;  1ZKG A;  2JJ7 A;  2I10 A;  2NP5 A;  3BTJ A;  4CYC A;  5IP9 J;  3ZOB A;  4XRS A;  3IUV A;  3ZQI A;  5EZG A;  2Q24 A;  1O4X A;  2Y2Z A;  1ZQ3 P;  4B3A A;  3UKG A;  4A3F J;  2L7M P;  1BW6 A;  2R5Y B;  2Y31 A;  3PO2 J;  1IUF A;  2UXP A;  4A3C J;  5F1J A;  2MSY A;  2JA6 J;  3KNW A;  4ACI A;  2YVE A;  2CUE A;  1RPW A;  3GTM J;  2O9L A;  3LWJ A;  3CCY A;  4JX6 A;  4RDU A;  3VW2 A;  4DW6 A;  3FRQ A;  3BR2 A;  1SGM A;  1WCM J;  1NTC A;  5F0H A;  2X9D A;  2Y9Z A;  2O8K A;  5HSZ A;  4W1U A;  1IJW C;  3S2D J;  4BBR J;  3EUP A;  3G1L A;  1TWG J;  1QRY A;  3NI7 A;  2XB0 X;  4LOC A;  3FIS A;  3H3V K;  1GDT A;  4BBS J;  3S1M J;  4DYC A;  2L7Z A;  5FLM J;  1EF4 A;  1H8A C;  5EF6 A;  2LVS A;  3EGQ A;  2FX0 A;  1FJL A;  5IYD J;  2CJJ A;  2DA1 A;  3S2H J;  4GFK A;  3NAR A;  5DTD A;  3E7L A;  5J3L A;  1ZR2 A;  2QWT A;  4GFL A;  4D7N A;  2G0E A;  2NVY J;  5EGO A;  3DPJ A;  4I76 A;  4UUT A;  3ZQG A;  3O8H A;  1XC5 A;  4ICH A;  4S0H B;  3COL A;  1JKQ C;  1JUP A;  1AHD P;  1FTT A;  2DMT A;  1RKW A;  4DZJ A;  3Q3S A;  1Y1V J;  1MH3 A;  1BA5 A;  3LHQ A;  1JT0 A;  3Q0U A;  2HQ5 A;  5F0C A;  3HOX J;  2M0C A;  5FKL A;  1WH7 A;  4D5C A;  9ANT A;  5BNG A;  3JRH A;  2EQR A;  5F0F A;  4IHW A;  4JKZ A;  5C44 J;  4QTR A;  2R92 J;  5D18 A;  3Q0V A;  2FJ1 A;  4M6V A;  3BG5 A;  5EG0 B;  3HGY A;  5K58 A;  3QPL A;  3HTI A;  1NK3 P;  1HLV A;  1LE8 A;  1B8I A;  1IGN A;  2E2I J;  4D7M A;  3F0C A;  5GPA A;  4JP0 A;  5E3O A;  3RZD J;  2ZOZ A;  4CYC B;  3PM1 A;  3SDG A;  3B6C A;  4M3B A;  1WPK A;  1GT0 C;  1JKO C;  3RH2 A;  2JA5 J;  5D1R A;  3CRJ A;  5DAJ A;  2KDZ A;  1RKT A;  3PPB A;  1FIP A;  1JTX A;  1IRZ A;  3TP0 A;  4A3G J;  3LSR A;  5IPA A;  3K7A J;  1IC8 A;  1DU0 A;  2LFB A;  1XS9 A;  3ON2 A;  4JYK A;  3HOZ J;  4PXI A;  3QQA A;  3HTJ A;  1VND A;  4QIW N;  2DMP A;  3PAS A;  5DS9 A;  1APL C;  1QPI A;  2XRL A;  5EYR A;  3HBL A;  3HKZ N;  1IDY A;  4AC6 A;  2G3B A;  2GUH A;  4C2M J;  5FGL A;  3I4M J;  2N8G A;  2KT0 A;  1QVU A;  4A3M J;  3FK7 A;  3HB9 A;  3S15 J;  1VF9 A;  3QBM A;  3FKI J;  1HDP A;  5FKK A;  1YRN A;  3TW6 A;  2G7L A;  4KWA A;  2R5Z A;  2IBD A;  5FKO A;  2NVQ J;  4D5F A;  4IHV A;  4JNN A;  1AU7 A;  3OIO A;  4FE4 A;  1JT6 A;  1U8B A;  4B4C A;  5HOD A;  1TWH J;  3L1P A;  3S14 J;  1Z77 A;  2L7F P;  2DA4 A;  3BR5 A;  3C2B A;  2ZOY A;  3JR9 A;  1MSE C;  2QCO A;  1T56 A;  2R0Q C;  2DG8 A;  2E1O A;  1U9N A;  4XID A;  3B6A A;  3GTJ J;  2ZCX A;  2LY9 A;  2M8G X;  1ETO A;  2VPR A;  3GEU A;  2DA7 A;  2VUM J;  5EGO B;  3PO3 J;  3S5R A;  2HYJ A;  3QPS A;  3B81 A;  2HOS A;  2QOP A;  1H88 C;  2PZ9 A;  2O7O A;  2OF7 A;  2JK3 A;  3GTP J;  2LD5 A;  5CXI A;  3V6G A;  5IP6 A;  3HTH A;  2DA5 A;  3H0G J;  1IDZ A;  2ID3 A;  1Z0X A;  3HM5 A;  1BW5 A;  2CRG A;  4MK6 A;  1OCP A;  4M3F A;  2ZB9 A;  2D5V A;  2W53 A;  1ETQ A;  1X2N A;  5JLW A;  3HGG A;  2RHA A;  1ZR4 A;  3OSG A;  1VFC A;  2G7S A;  2K9S A;  3HE0 A;  3S1N J;  1WH5 A;  2EH3 A;  5H9T A;  1TWC J;  3LOC A;  3NAU A;  3RD3 A;  3VW0 A;  2ME6 A;  3LNQ A;  1LE8 B;  5EZH A;  1B8I B;  1GV5 A;  1GV2 A;  1MBF A;  4A3D J;  1WI3 A;  2EZI A;  1ETW A;  3F1B A;  2VKV A;  5F08 A;  4JX5 A;  5EEA A;  3G1O A;  3BHQ A;  4EEF G;  2AHQ A;  2DA3 A;  3FIW A;  3ZQF A;  3KZ9 A;  1U78 A;  2HOT A;  4XRS G;  2WV1 A;  1JJ6 C;  2K9N A;  1XG1 A;  1MBE A;  2TCT A;  2LKX A;  2GM4 A;  2X6O A;  3JRD A;  4A3L J;  1ENH A;  3G1M A;  2DMU A;  1B72 A;  2NS7 A;  1JKP C;  1MSF C;  4DZP A;  2NP3 A;  2IU5 A;  2PMZ N;  4W97 A;  4G12 A;  2HDD A;  3A01 A;  1HF0 A;  4BY1 J;  4ME9 A;  1MBG A;  2E19 A;  3CMY A;  1LFB A;  5CXG A;  1A6I A;  3HTA A;  3VOX A;  2ME0 A;  3JRI A;  2HXI A;  3M4O J;  3AQS A;  3VW1 A;  3BCG A;  3ANG A;  5J1U A;  2EZK A;  2XSD C;  2L0K A;  1PUF B;  1YRN B;  2WGB A;  1TWF J;  2R5Z B;  2UXI A;  4UDS A;  1MH4 A;  1JJ8 C;  3HIM A;  1ORK A;  1LFU P;  3M3Y J;  2YS9 A;  1SAN A;  2LP0 A;  2Y30 A;  5FKN A;  3BRU A;  2YVH A;  5J1R A;  5IOZ A;  2W48 A;  2CQQ A;  4BY7 J;  2OI8 A;  1A5J A;  2E2J J;  5FMP A;  5E3N A;  2ID6 A;  2Y9Y A;  2DMN A;  5FLV A;  1HOM A;  1ZGW A;  2RAS A;  4RBO A;  4GCT A;  3RQI A;  2FBQ A;  2GLO A;  1I50 J;  2IEK A;  3JRG A;  5C4Y A;  4BKX A;  1I6H J;  5M5X J;  4A3I J;  2P81 A;  1QVT A;  3SFI A;  1OJL A;  2DMQ A;  1MNM C;  4GCL A;  4X6A J;  1X2M A;  2WAQ N;  4AUX A;  4NN1 A;  3W6V A;  5IP7 J;  4V2G A;  4M3D A;  3ON4 A;  2F07 A;  5K7H A;  5GPC A;  3BQY A;  4IHX A;  1JUS A;  1ZTR A;  3KKD A;  4A93 J;  2EZL A;  2NS8 A;  1DU6 A;  3HOV J;  2GBY A;  4BXX J;  4I6Z A;  5E3M A;  3BR1 A;  2XPW A;  1PUF A;  3LSP A;  2NOG A;  2REK A;  4MO7 A;  4GCK A;  3K2A A;  3LJL A;  3CWR A;  3BNI A;  3LSJ A;  3HDD A;  2EZH A;  1TC3 C;  1R9T J;  1F43 A;  2XB5 A;  3P9T A;  2XPU A;  4B1R A;  1WGX A;  2L9R A;  2QF7 A;  3S1R J;  3GTL J;  3VUQ A;  2GEN A;  1CQT A;  2E2H J;  4L62 A;  2WB1 N;  3GTK J;  2IAI A;  2HYT A;  1FEX A;  3NRG A;  1B72 B;  2UXU A;  1K61 A;  3JRC A;  1BJZ A;  2HXO A;  4DYQ A;  1FIA A;  2EBI A;  3BQZ A;  4MIM A;  4YZE A;  3A01 B;  1F36 A;  1JKR C;  4A69 C;  2R93 J;  1ETV A;  2H8R A;  2WUI A;  3E7Q A;  2X48 A;  5HAW A;  5IYC J;  3MVP A;  4UUS A;  3CQZ J;  4X1E A;  4A3B J;  4Y52 J;  1P7J A;  3VIB A;  5FKM A;  1MBJ A;  4MFD A;  4CGR A;  3BR3 A;  1S7E A;  4V2F A;  3SJM A;  4NDL A;  1NK2 P;  1JUM A;  1UMQ A;  3C07 A;  3VVY A;  1W0U A;  2XDN A;  1UI6 A;  1U9O A;  2HOA A;  3HOY J;  3Q0W A;  4C3H J;  2JN6 A;  2LTP A;  3GZI A;  1IV6 A;  4FIS A;  2XPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...