2HQ5A

Crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Multidrug-Binding Transcription Factor QacR Binds the Bivalent Aromatic Diamidines DB75 and DB359 in Multiple Positions
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hq5A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hq5A02
2TCTA 4MIMA 3RH2A 3JRHA 3EUPA 3LSJA 3C2BA 2CUEA 2FJ1A 1JUPA 1VNDA 5D1RA 1MBHA 2OF7A 3WHBA 3DEWA 2LK2A 5F1JA 4ACIA 5EFYA 3QKXA 2Y31A 1AU7A 2QIBA 5CW8A 5F27A 2E2JJ 3I4MJ 4IEJA 3JRDA 3O8HA 2W53A 5CXGA 3OOUA 1WCMJ 2HI3A 4DYQA 1IG7A 1HF0A 1ZKGA 3Q3SA 1MBEA 3HGGA 2XPWA 2COBA 5E3MA 5M3MJ 3ZQFA 2EQRA 2L0KA 1LE8A 4FE7A 4Y7NJ 3LOCA 2NS7A 3H0GJ 2Y9YA 3BHQA 3G1MA 2ME6A 2GUHA 3VW1A 3VPRA 2CRGA 2LKXA 2EBIA 3HKZN 3CQZJ 2M9HA 4JL3A 4C3HJ 1FJLA 3HOUJ 1B8IA 3B81A 1TWFJ 3GTQJ 1DU6A 5J1UA 4ICHA 2H1KA 3Q0VA 2UXIA 2X48A 2E1OA 3ANPA 3EGQA 1BL0A 3T6NA 3HTJA 5HSZA 3BTJA 2PZ9A 2UXHA 3ZQHA 1AHDP 5HBUA 2HYTA 1PUFA 3VP5A 2DA6A 1DU0A 2LY9A 4UUSB 3E7QA 1MBGA 3BQYA 4JNNA 1IDYA 3BR5A 2DA2A 3HB9A 1JKQC 2HOTA 3KKDA 4NN1A 2JA6J 2ME0A 3S1NJ 5FHPA 1OJLA 4QTRA 3BR1A 5FKNA 2M2EA 2RAEA 4KWAA 3RKQA 3LSGA 1H8AC 3QBMA 4L5EA 1GUUA 1U9NA 2OI8A 1FIAA 1YRNB 4XICA 2DMTA 3NI7A 2EZIA 4MLOA 3Q0WA 4B1RA 2HDDA 1T56A 1OFCX 2M0CA 2NP3A 3LHQA 3BG5A 3HM5A 5IP6A 1Z0XA 2O7OA 2CQXA 4M6VA 5HAWA 2WB1N 2DG7A 3IH4A 3A01B 2HXIA 2UXPA 4BY1J 5M5YJ 3JRCA 1UI5A 5K58A 3B6CA 2R93J 3QPLA 3FIWA 3M4OJ 4CYCA 1IGNA 4A3BJ 1SFOJ 1IUFA 1MNMC 3NRGA 3FISA 3HGYA 2NVXJ 5H9TA 4M3BA 5E3NA 1HOMA 4AC0A 2VKEA 2R5YB 2WGBA 3GTOJ 4PXIA 1ZR4A 5EZHA 4XRSA 3ZQCA 4AYBN 3D1NI 5M5WJ 3IH2A 3F0CA 4MFEA 2HOSA 1HCRA 1X2NA 3S1MJ 3HOWJ 5FGLA 2IBDA 5EGOB 2CU7A 2K9NA 2NVYJ 1BA5A 2O9LA 2ZCNA 1ENHA 1JT6A 1GV5A 4FCYA 1GV2A 1QPIA 5EG0A 1FIPA 3VW2A 2JK3A 2TRTA 3HOVJ 2OPTA 3OIOA 4M3FA 1IC8A 2D5VA 3TP3A 1XC5A 2Y0SN 4A69C 3GTKJ 1MSEC 3S17J 4A3DJ 4MXMA 1GDTA 1JT0A 4RDUA 3ON2A 1MSFC 3HOXJ 1WH7A 4BBSJ 2VI6A 2EH3A 4FISA 1ZK8A 2L7FP 2F07A 5C4YA 5EYRA 1MBJA 2R5ZA 3ZOBA 2YUSA 4C3JJ 1IJWC 1IDZA 2CUFA 2GM4A 1ORKA 2IEKA 1B72B 2DMQA 3HEFA 2DA1A 3TEDA 2NP5A 2UXUA 1JUMA 2ZB9A 1P7JA 2ZOYA 3LSRA 3G1LA 1AKHB 5IP7J 1FTTA 2DA3A 1ITYA 3IUVA 1ETVA 2FX0A 5BNGA 2XPVA 2HOAA 3GTMJ 3BRUA 3K7AJ 2QKOA 1RKWA 3BTLA 1MBFA 4IHWA 4A3CJ 3PPBA 3ZQGA 2QWTA 3NNRA 2LTPA 3S5RA 2LLKA 2X6OA 3FRQA 1U9OA 2XB0X 5FLMJ 1FEXA 4UUTA 1IV6A 2MW8A 5C3EJ 1HLVA 1RPWA 2XSDC 4XK4A 4GCKA 1I50J 2XRLA 1U8BA 5F0CA 3V78A 3GTGJ 4W1UA 3TP0A 3JRGA 1LE8B 2AO9A 1WPKA 3IV5A 5F0HA 5EZGA 5GPAA 4JP0A 4L62A 2AHQA 3VVYA 2XGDA 5FJ8J 2M8GX 2MGQA 1POGA 1ZGWA 2XDNA 3K2AA 5IYCJ 4D7MA 1B8IB 3GTJJ 2MG4A 1F43A 1TWGJ 2EZHA 3CJDA 4GFLA 5JLXA 1Y1WJ 2YU9J 3VIBA 1T33A 5K7ZA 5D19A 4QSHA 3PO3J 3OSGA 1JTXA 3HDDA 2ZOZA 1PUFB 1ETQA 3I4NJ 4AC6A 1ZQ3P 4JX4A 1H89C 2JA8J 4HNVA 1G2HA 4DZJA 2HYJA 2FD5A 3GTPJ 3HOZJ 4MO7A 1JGGA 2XB5A 5AQCA 1SGMA 4AF5A 3DCFA 2L7ZA 2QTQA 2DG8A 4BBRJ 2L9RA 1Y1VJ 1TC3C 1VF9A 2G7LA 5IOZA 4J19A 4GFBA 1QVUA 4DYRA 2HXOA 5FKOA 4JX6A 5HODA 3AQSA 2ELKA 2DMNA 2NVQJ 2NS8A 1CQTA 3CMYA 3MVPA 4GFKA 1ZR2A 3O60A 3S1QJ 4Y52J 3E7LA 1UHSA 4A93J 5C44J 3PASA 3PM1A 4DZPA 3V6GA 3RQIA 1JJ6C 2LP0A 4ME9A 2O7TA 3WHCA 4CYCB 3HBLA 3S14J 1MH4A 2YVEA 3HE0A 2JN6A 5E3LA 2IU5A 3G56A 2HQ5A 5D18A 2Y2ZA 4GCLA 2REKA 2DA5A 4QIWN 2GBYA 1E3OC 1APLC 3ON4A 4M3GA 5E3OA 2H8RA 1I6HJ 2VPRA 4MK6A 2YS9A 2K9QA 3C07A 4YZEA 2N8GA 1BJZA 2R7ZJ 4FE4A 3HOYJ 1K61A 3BTIA 4W97A 2P81A 4FTHA 4IHYA 3CCYA 3JSJA 3TW6A 3G7RA 3CDLA 1Q1VA 2Y30A 5K7FA 4GCTA 2K9SA 2QCOA 4NDLA 5EG0B 3JR9A 1OCTC 3OSFA 4IHVA 3BR3A 3IH3A 4M3EA 5F08A 5EF6A 2I10A 4G12A 1Z77A 3JRAA 2IAIA 2OERA 3BQZA 2NX4A 1LFBA 2DJNA 3NXCA 1JUSA 1X58A 4V2GA 1TWHJ 2JA5J 2HKUA 5IPAA 4B4CA 4X1EA 3CRJA 3QPSA 2L7MP 2D6YA 3PO2J 2YVHA 4JX5A 3BJBA 2ECCA 3ZQLA 3LSPA 1ZTRA 3DPJA 1BW5A 3GBGA 2LVSA 1GT0C 1A5JA 3FK6A 3VUQA 5M5XJ 3KKCA 2R5ZB 2E19A 2UXOA 2ZCXA 2B63J 5K7HA 1ETXA 4UDSA 1I3QJ 3O8GA 3QQAA 4IHXA 1LFUP 1W0TA 1P7IA 2ID6A 3MKLA 1X2MA 3NARA 2V57A 4DW6A 4BXXJ 2GFNA 3FKIJ 1K83J 5IYDJ 2RASA 2W48A 4I6ZA 1EF4A 1H88C 1ETOA 3KZ9A 3BR2A 3HTHA 3MNLA 1NK3P 2PBXA 3COLA 4AUXA 2JA7J 1RR7A 2X9DA 4MFDA 3S2DJ 4A3EJ 3S2HJ 4A3KJ 3S1RJ 5FKKA 3VVZA 1UMQA 1HDDC 2LR8A 1XG1A 5IOYA 2Y9ZA 1FTZA 3VW0A 4C2MJ 1R9TJ 4X6AJ 1D5YA 2CQQA 4V2FA 1MBKA 2R92J 2VUMJ 3HIMA 4LOCA 1IRZA 2DMPA 5DAJA 3RZOJ 2NOGA 4D5CA 2G7SA 1ETKA 4DYCA 5J3LA 3S16J 2K40A 1VI0A 3SDGA 3RZDJ 2GENA 5GPCA 2LD5A 4CGRA 3JRBA 2WAQN 3B6AA 4RBOA 3VOKA 5F04A 1JKRC 5IP9J 3JRFA 4UUSA 3UKGA 1UI6A 1F36A 3BR6A 1WI3A 1JTYA 3LWJA 4S0HB 3P9TA 1RESA 2XGEA 2ZCMA 3MN2A 1OCPA 3CWRA 3Q0UA 1RKTA 1ETWA 2VKVA 4I76A 4NELA 3TW7A 4XRMA 2ECBA 3BG9A 5FKMA 2LFBA 3W6VA 3BT9A 3SFIA 3JRIA 3VOXA 5F0FA 5M3FJ 4A3MJ 4A3LJ 5C4JJ 1YRNA 3LJLA 3BCGA 1GVDA 2QF7A 3HTIA 3GZIA 1JKOC 1BW6A 5JLWA 3A01A 3S15J 3JREA 5FKLA 1MH3A 3BR0A 4M3DA 4D7NA 3SJMA 1NK2P 3RD3A 4A3IJ 4B3AA 4A3JJ 2M34A 5IYBJ 1O4XA 4A3GJ 5J1RA 4HKUA 1WH5A 1VFCA 2DTZA 2XGCA 3BG3A 2O8KA 1XS9A 2R5YA 9ANTA 2JWTA 1ETYA 3H3VK 1WGXA 4D5FA 2FQ4A 5DS9A 2ID3A 5EDNA 2G7GA 2EZLA 3G1OA 5FLVA 2QOPA 2DA7A 2Q24A 1U78A 5C4XJ 4BKXA 2WUIA 2DA4A 1HDPA 2R0QC 2WV1A 5EGOA 1NTCA 1A6IA 4EEFG 1QVTA 2KT0A 4JYKA 3AQTA 2PMZN 5J1YA 4XIDA 2CJJA 2G3BA 5FMPA 1JKPC 1S7EA 2G0EA 4C3IJ 1UG2A 4A3FJ 3NPIA 4BY7J 3M3YJ 4ABZA 2JJ7A 2GLOA 1W0UA 3A02A 2RHAA 4JKZA 1SANA 2JMWA 3GEUA 5EEAA 4XRSG 3KNWA 1TWAJ 1TWCJ 3A03A 2E2HJ 3NAUA 2E2IJ 3L1PA 3ANGA 2FBQA 3BTCA 1QRYA 3LNQA 1JJ8C 2MSYA 5CXIA 2XPUA 2KDZA 2DN0A 1B72A 3GTLJ 2NVTJ 3F1BA 2EZKA 3FK7A 5GP9A 5DTDA 2DMUA 3BNIA 1RETA 3VVXA 3HTAA 1AKHA 3ZQIA
chains in the Genus database with same CATH superfamily
2TCTA 4MIMA 3RH2A 3EUPA 4EVIA 3LSJA 2FJ1A 3DWLE 1FSEA 3KP7A 2QA4I 3E5UA 2OF7A 2RQPA 3LQQA 3DEWA 3WHBA 5EFYA 1QO0D 3QKXA 4A12A 2ZMEB 3BCAA 3KFWX 1ONVA 3I4MJ 2J5OA 4IEJA 4A5MA 3H92A 4F3QA 1WCMJ 3M8JA 2HGCA 2HI3A 3M1EA 4ENMA 5HDKA 3V8LA 1ZKGA 3Q3SA 5ICGA 4NB5A 4CYDA 1O3SA 3M8FA 2ISZA 4A2UA 4MTDA 4FE7A 4ENNA 1JHFA 3LOCA 4BQOA 3DKYA 5D5VB 3BHQA 2ME6A 3MEXA 3VPRA 3LSIA 4ZC3A 2DO7A 3PQJA 4AIDA 1HA8A 2XAUA 2CSOA 2ZCWA 2FOWA 2M9HA 4JL3A 3MKZA 3OYNA 1FJLA 4OMZA 5L3EA 3T0YA 2E1CA 3ECHA 1SD6A 3CMEI 3RI4A 4WXDA 3Q0VA 2FNPA 2HPIA 1T98A 4DJAA 3C7JA 3ANPA 2GAUA 4XRFA 1VTNC 2MYSA 4HBLA 2PZ9A 3NS4A 2HYTA 5HBUA 3VP5A 1YITI 4UUSB 4E7JA 2W57A 1MBGA 2HQAA 2ZFWA 1WFXA 2HS5A 3FKJA 5CVIA 2DJIA 3CD6I 1T0FA 4B8XA 1HSTA 2DA2A 3QU6A 1LNWA 3GZ6A 3HG9A 3RKWA 4NN1A 1HBXG 1S6LA 3AG3H 3BG7A 2DXIA 3H36A 1MIJA 3FBNB 1E3PA 2OTJI 4L5IA 3BR1A 4HW0A 2VOPA 2DT5A 2KDOA 2M2EA 2RAEA 3GF2A 3H0DA 4KWAA 1BOAA 1YW8A 4AVPA 5K58A 1FIAA 3NI7A 5HDNA 4B1RA 4IHSA 3BPVA 4BL0B 1TQPA 5E8IA 5KHDA 3WGGA 5HLTA 5IP6A 2L2OA 3CO7C 4QPQA 5HAWA 2DG7A 2UXPA 1FOYA 2HXIA 2K02A 4P55A 4ZDLA 3A01B 4U0VA 1P4WA 4BY1J 2VQHA 4BACA 4U0WA 3M4OJ 1BJAA 1MNMC 5B5EC 2NVXJ 2Z2SB 4M3BA 4RGSA 1HOMA 1OR7A 4PXIA 4B48A 1J2XA 3BZ6A 1WJDA 2E1MC 2M0MA 3C2HA 4RAFA 4BEHB 4XRSA 4CICA 1N75A 3J7YJ 3ZQCA 4UB6C 1IN7A 4Y4RA 1Y8RB 2HOSA 1HCRA 1A6QA 2AXLA 3S1MJ 1SAXA 4DNCA 4P96A 3DU5A 5FGLA 2CU7A 4RGXA 1WJFA 5JR3A 1XGOA 3BJ6A 2CW7A 1GV5A 4FCYA 2V4JC 3AG2H 3PUBA 2ESHA 1QPIA 2UUZA 2C6YA 2RC4A 1FIPA 4HV5A 2GM4A 4EMSA 3TDUC 4HF1A 3EQLF 4HQMA 4ZDOA 2K3FA 4M3FA 1YW7A 3TP3A 3M9AA 3BROA 4KN4X 1IN6A 2DFEA 4RS8A 2Y0SN 3WGIA 4IPAA 1MSEC 4MXMA 1IAWA 4IX7A 1LJ9A 4RDUA 3GFMA 5J47A 3I0TA 3C1DA 2DBBA 1Q1HA 2DDBA 1K4TA 3L2WA 3H3ZA 2IS1A 3CJNA 3IKVA 2A05A 1B59A 3K2ZA 5C4YA 5EYRA 2R5ZA 3K9TA 2YUSA 4C3JJ 1YIJI 2CQNA 3LWFA 2DMQA 3HEFA 4KYWA 2H6CA 2KIFA 4Y33A 1ON1A 4MGRA 1J7KA 1ZGJA 2YVXA 1P7JA 3M7GA 2A07F 2DA3A 6PAXA 5EEGA 1XGSA 4AWXB 3GTMJ 4MTEA 2QKOA 1RKWA 1RRJA 3BJOA 3BTLA 3HRTA 4IHWA 2NNYA 1K6OA 2CMPA 2ZJ2A 3CESA 2WAEA 2QSHX 3CCQI 2PMZA 5E18F 4XONA 4DOZA 2VB6A 4XN3A 2COMA 1I50J 2XRLA 1U8BA 1IRGA 3K4NA 3TBIA 3JRGA 3DPTA 2K86A 5F0HA 4JP0A 2VQCA 4YEJA 5FJ8J 1MDMB 2ICWG 3BPXA 3KZYA 2XUBA 4N9IA 3ZMVA 2CGPA 2XDNA 3K2AA 3HTUA 4D7MA 4KA4A 4L5JA 1UHMA 3D5RC 3GUDA 3PSFA 1TW3A 1F43A 3MZYA 2VODA 5DD8A 3W2VA 1X1DA 2YU9J 5LD2C 2RQQA 5DCFA 5BPIA 5K7ZA 1TW2A 2ZOZA 1PUFB 2K9LA 3SFZA 5HLIA 3HOTA 4HNVA 2Z99A 5FROA 4DZJA 1JGGA 3KP2A 5AQCA 1SGMA 3ZMZA 3DCFA 2L7ZA 1Y1VJ 1TC3C 2P0WA 4M9ZA 5ERIA 1ZARA 1FP1D 3HRMA 2K4BA 1SFUA 4EJOA 2G7LA 5IOZA 3ZXSA 2DYSH 4GFBA 1QVUA 4E4HA 2HXOA 4BE2A 1QA6A 2KFDA 2ELKA 5K1YA 3CF2A 2NVQJ 4K2EA 3ML6A 4I0BA 2XGXA 5FD6A 3U2RA 4F93B 1VQ6I 5J8CA 4GFKA 2EFPA 4NUBA 3O60A 2FNAA 2FBIA 3DEUA 2NNNA 2A69F 2OBPA 4U9LA 2R3SA 5E8GA 2GZWA 3W6KB 4GXOA 2O7TA 5HVQC 5FGMA 4WF2A 2KRFA 3CCEI 2YVEA 3G6EI 2HQ5A 2VBYA 2Y2ZA 2ZJPF 2REKA 4GCLA 5GTHC 1SVMA 2CQKA 1IZ1A 2QVOA 3PSIA 2RNJA 3SDBA 2ZXJA 3AG4H 5E1XA 4CHUA 2V6CA 2QGUA 2JUCA 4B09A 2QSGX 1K61A 3BTIA 4FTHA 5FRNA 3CCYA 4WCGA 1WZ2A 3BZKA 1S29A 1MD0A 4U9NA 4GCTA 2QCOA 3JR9A 2PFBA 1OCTC 3ABTA 3OSFA 3BR3A 4UVAA 4IHVA 1ON2A 1UFMA 3WG7H 1OLTA 5EF6A 4U0YA 1XN7A 3Q9SA 4G12A 3VWBA 3PFIA 3F21A 1Z77A 1VQ5I 2Y0MA 4R8HA 1X1PA 2QZ8A 4B4CA 4X1EA 2XAFA 4BE1A 5E17F 5CPRB 2L7MP 3E5QA 1LUJB 4IRIA 3O2PE 3PO2J 1HKTA 4JX5A 1J75A 2YVHA 3KCCA 2ECCA 3ZQQA 3QAHA 5AONA 1ZRFA 2LVSA 4G7ZF 2JPCA 3KKCA 4N4OB 3RQ4A 1W1WE 1YE9A 4UDSA 3QQAA 3H9GA 1E3HA 2WY7Q 1LFUP 1W0TA 2ZXWH 1TBXA 4NC6A 5HOOA 3GX4X 3M07A 4HSTA 4RGRA 2ZMEA 5D6FA 2W48A 1KQ0A 3F9KA 3FBIB 1HKQA 2QQAA 2CV0A 2D1HA 3ZR8X 1ZELA 2LG4A 1NK3P 3LA3A 4Y3OA 5KCMA 3I56I 4A3KJ 3S1RJ 1FOXA 1ZAOA 2NAZA 3WU0A 1FTZA 5IOYA 2Y9ZA 3VW0A 2LYCA 3ZN1A 3F8MA 4Q47A 1OYIA 3GWZA 4WIBA 1W5TA 3RZOJ 4PUSA 3K6GA 4DYCA 3EUHA 3GZ5A 1OQYA 3LSKA 5DYMA 2JRMA 3S16J 4Y13A 2JSCA 2Z3YA 4M71A 5GPCA 1XSVA 3KLOA 4B44A 4IQJA 2XHKA 3JRBA 3B6AA 1V55H 2NXNB 1D8KA 2GXGA 2JRTA 1FMWA 1YIOA 1R00A 4UUSA 3JRFA 3UKGA 1YW9A 2A61A 4YFXF 5HNHA 4UUVA 2H27A 3KEYA 1T2KA 4UY8I 2KJBA 2ZCMA 3MN2A 4O6JA 2R7UA 1OCPA 2QQBA 3CMAI 3CWRA 4RB1A 3Q0UA 5CVUA 3B02A 1YTYA 1I39A 2LF7A 5FKMA 2ELHA 3FXKA 3SFIA 2BOLA 3JRIA 4A3LJ 1IN8A 5C4JJ 1FYKA 1A04A 4E7HA 2WV0A 3L2UA 3OL3A 3CCLI 2A6TA 2XKPA 4HG2A 1F5TA 1F9NA 1D0XA 3HXLA 1FC3A 2EV5A 3A01A 3JREA 2H1LA 1RC9A 4D7NA 2JUGA 3RD3A 3OYAA 4UVCA 3HSEA 4A3IJ 2Z33A 2M34A 2VT2A 3H5NA 3CC4I 1WH5A 1VFCA 2DTZA 2L3DA 2XGCA 4MHGA 1XS9A 9ANTA 3I71A 4J00A 4F91B 3R0AA 4BEHA 3IWZA 1YX3A 2FXAA 2WWYA 2VN2A 3U1DA 2DA7A 2DA4A 1HDPA 2R0QC 1Z05A 4YIFA 1NTCA 1R1TA 2VL8A 1NG6A 2H6BA 2KT0A 5CJ9A 3K4MA 5J1YA 2NRAC 1JKPC 1S7EA 1LFPA 2QM3A 1BIBA 3Q5FA 2MA3A 2MLGA 2L9SA 2HFHA 4OOIA 4BXUA 1XMAA 1USTA 2X51A 3IKTA 1SMTA 4EM1A 2E36A 4JKZA 4CCKA 5HS8A 4U7BA 4GYGA 3W2AA 5EEAA 5FB2A 5DUKA 1BIAA 4NHJA 3GO5A 2OUMA 1D1BA 3A03A 1TWCJ 2M1BA 1MGTA 2HKOA 5B1BH 2E2IJ 2FBQA 1MNEA 2CW0F 2EV0A 3DU6A 2L7KA 2ZJRF 1QRYA 4KFCA 1YJ9I 2XPUA 1G3YA 1W5SA 2TDXA 2F5FA 3GTLJ 3F1BA 4IF4A 2OZUA 2H09A 4L9TA 5F1RA 4A0XA 2PJPA 1O7LA 2KJCA 2Q0OA 2Z16A 3DKWA 3I53A 4ACIA 4KDPA 2VLAA 5F64A 4IRHA 4LK0F 1ZGAA 4E7ZA 3JAMK 2E2JJ 3G4SI 5CW8A 4IQ4A 1OYWA 2G7HA 4PDKA 1JE8A 5CXGA 2HYGD 1G3WA 3FM3A 1X3UA 2CFXA 2DTRA 1LQ1A 2XPWA 2M3AA 4HOBA 3J7ZI 1SFEA 2DDAA 2EQRA 4DBRA 2L0KA 1IUYA 1S9HA 4E7LA 4MNUA 2YU3A 5D5UB 3G1MA 1MDMA 3D5SC 4NNJA 2RKHA 3L2VA 4IOCF 2PJRB 3HKZN 1Z3YA 1P6RA 2CQ7A 3CJQB 3JAMZ 3OMYA 2FMLA 4P1WA 4G7HF 5B1AH 5ICEA 1OCZH 2EB7A 4R79A 1QZYA 4ICHA 2H1KA 1R71A 3M1CA 1TNSA 2FBKA 1EH7A 2KIMA 2OTLI 1KONA 4TV7A 4GO1A 1OCRH 2BW3B 5IT3A 3HRSA 3J80K 2MC3A 1AHDP 1S72I 2ZNYA 1PUFA 4BJ6C 4HYEA 2EIKH 2E60A 2XKOA 2L02A 2KLOA 2X4HA 5CLSA 2P4WA 1MMSA 1IDYA 4MEYF 2E5ZA 2XSJC 4B47A 4DQ2A 2BGCA 2IGNA 1JKQC 4ZZLA 4ENKA 2HOTA 3KKDA 2JA6J 1X1BA 1CF7B 2EWNA 1Z6TA 2LBFB 2DYRH 3GW2A 3E5XA 1TTYA 4QTRA 2JA2A 2XF5A 3JTGA 5GAHJ 5FKNA 2KQRA 1SAUA 4LITA 5BPDA 3DXJF 1SD5A 3RKQA 1VZ0A 2OD5A 3LSGA 4L5EA 1JI8A 1U9NA 3DTKA 3QBMA 3MD2A 3QODA 2EZIA 2JZYA 4PSXA 3J80Z 2M0CA 2VQGA 4PFOA 2VE8A 1K78B 2BHYA 3CCMI 3FF5A 3KP6A 3HM5A 4ZJZA 3HSRA 3RPUA 3CCVI 1VQ4I 4L0YB 1XMKA 1OPCA 3B6CA 5FO5A 2UXNA 2X6WA 2JVHA 3NRGA 1VQMI 1R5GA 2QENA 3FISA 3HGYA 3KYLA 1KU2A 1MJ9A 2CO5A 4AC0A 3OYDA 2RVCA 3WU1B 3HPHA 4M73A 5EZHA 1I3AA 3RKXA 4AYBN 2CWEA 3SEQA 2VXZA 3F0CA 3UNGC 1UZCA 2R7FA 3K4BA 1X2NA 2GIVA 4NQWB 1H9TA 3CCJI 2NS0A 3QYFA 3V42A 2K4JA 3DTEA 2NVYJ 4RLQA 1OISA 4PJ0C 2OQGA 2P8TA 2ZCNA 2W84A 1SVLA 1DQUA 1JT6A 1TQMA 4YFKF 5H2FC 2M30A 2NOJB 1VQPI 2P7VB 1YO5C 1BI3A 1S8NA 3S93A 5K5RA 1LDDA 1A35A 1IC8A 5KNLA 4EGYA 2QUFA 2W00A 3MZHA 4DGWB 4DIQA 3V7SA 4EGZA 2DOFA 1JT0A 1QBJA 3LFUA 1OCOH 3ON2A 3B73A 3TOAA 1MSFC 1QHHD 4XQFA 1WH7A 3TDZC 4BBSJ 2VI6A 3HUGB 3I59A 1XCBA 2H8WA 4YELA 2AQEA 4FISA 2VJJA 1X19A 1KU3A 3ZOBA 2F6CA 1U2WA 2CUFA 4IVNA 4XORA 5AIPA 4D0PA 1WJAA 1TP4A 1YLFA 5L3BA 2MH9A 4C2UA 2ZKZA 4O3MA 2DT7B 4HQEA 2UXUA 2OV7A 1KQ9A 4ENJA 3BZCA 1G8XA 3RPUD 1ZH5A 1FPQA 4M74A 1AKHB 4OIQF 1FTTA 4RGUA 2VKHA 1J9IA 5E1ZB 3W3CA 4ZTFA 3I3LA 5BNGA 4ZH4F 3HRUA 4ON0A 3BRUA 3K7AJ 5GTIC 2PEXA 4E7KA 1UG0A 4I2OA 1GXPA 1MBFA 2HU9A 4OAZA 3GFIA 3ZQGA 2QWTA 4AIJA 3W2WA 2X6OA 3I58A 3O3KA 1IV6A 3FHNA 2PFVA 1HLVA 3GMEA 3ISPA 3FXUA 4LG0B 3V78A 2M45A 3OYLA 2L54A 3FM5A 4Q4ZF 5TRDA 2CV1A 4RAYA 4HRIA 4A6DA 4QWQA 4IO9F 1QGPA 3OIPA 2KIUA 3W6JB 1B4AA 3CZ6A 1ZGWA 4HDVA 1X3WB 4CO8A 1B8IB 5LRRA 2MG4A 3LAPA 2EZHA 4GGGA 2F5DA 2Y0SA 1QZZA 4GFLA 1Y1WJ 3I54A 3EPZA 4YRVA 4H0EA 3KLNA 5D19A 3G73A 3AAFA 1U5TC 3I4NJ 1ZQ3P 3DBHB 3I4PA 5ILVA 2HYJA 3HOZJ 5B66C 2LNBA 3CP2A 1O3QA 2L9RA 3K4LA 1LVAA 3CUQC 3RPQA 4YIIA 2E1MB 4J19A 3NQOA 4I01A 1KGSA 3ELKA 5LRSA 1LDJA 3PJRA 3KYCB 1D3YA 1U0JA 3F8FA 4KT6A 2DMNA 1ULYA 2DOEA 3EYYA 2NS8A 2KHMA 1CQTA 3IWFA 2BVMA 5D4SA 5GADJ 3CMYA 2FUG2 4RAGA 3IP4B 1OKRA 1UHSA 3OY9A 1T8IA 1E0EA 3QOEA 4HV6A 5DDGA 1QU3A 2QBYB 3RQIA 1BN5A 2IVMA 3DLLF 1JJ6C 1V5FA 1YYVA 3WHCA 3S14J 4A5NA 3TOBA 2A6EF 1S3JA 2CUJA 1WJBA 3IRRA 2E35A 4OWRB 3G56A 1HW1A 2DFHA 1BC7C 2XAHA 4FHTA 5E3OA 2H8RA 1DGRM 4CUGA 4IL6C 3AG1H 2N8GA 4CCLA 1BJZA 2R7ZJ 2B3WA 4IHYA 3OYMA 4BGDA 1KYWA 1FY7A 4ESBA 2OCCH 4PZJA 2QKMB 2HZDA 1Q1VA 2Y30A 5E20A 1XCVA 3I5UA 4XKVA 2K9SA 2LH9A 5EG0B 3WTTC 1WVRA 3EDPA 4XM3A 2W4SA 2I10A 2P5VA 4BDYA 2VONA 3QOPA 1GHCA 1SVOA 2OERA 2HPMA 1JUSA 4MQVA 1ODDA 1MJAA 1TWHJ 2HKUA 2JTVA 5JHFA 4XN0A 3QPSA 4S04A 2GXAA 4XLFA 3FZVA 3GLLA 4L9JA 2FRHA 1GT0C 2L4MA 1ZN2A 1Z6RA 3QYBA 2ZCXA 2B63J 4UB8C 2BVLA 1BI2A 4PJNA 1I3QJ 2R7XA 1BR2A 3MKYB 4IHXA 3A2KA 3VYUB 1F4KA 4CSWA 2HEOA 1YS6A 2OU2A 2VKDA 3KYDB 4BXXJ 1NH3A 3TL4X 4MEXF 1YOVB 2RASA 1K6YA 4BHBA 2LDUA 5GAGJ 1HC8A 4EM0B 2BYVE 3RJPA 4I6ZA 2A68F 4KT5C 3MNLA 2PBXA 4M72A 4AUXA 1RR7A 1TQIA 2OC6A 4MFDA 1ZLKA 2QQ8A 3VVZA 2ISYA 1HDDC 4BQAA 3K1MA 2IT0A 3SZPA 2CQQA 4V2FA 2XASA 1MBKA 2R92J 1P92A 2ZC2A 4ITVA 4RA2A 2VUMJ 3CC2I 1LEBA 1RIOH 1KQ8A 3GFJA 1D0ZA 2PJRA 5CVVA 1UCRA 2LRDA 3LFKA 2DMPA 2VE9A 4CCJA 3TGNA 2G7SA 3QPHA 1ETKA 1W7PB 5LLQA 2O6GE 1X1AA 5ILUA 3HHGA 4EJUA 1FP2A 4HNUA 4XSXF 3AKZA 3RZDJ 1FZPB 2GENA 3GFLA 2LSOA 2VC1A 4HX8A 1A31A 2BW3A 2D2WA 5D6EA 2J5PA 3E97A 5F04A 4F52A 2VJIA 3RYPA 2XDVA 1F36A 3LWJA 4S0HB 3P9TA 2HVRA 1XTAA 3K70C 4Z6YA 3H9QA 1Y0NA 4KNYA 2Q2EB 1BR4A 1RKTA 1CF7A 1W5CC 1ETWA 1X4PA 2LBFA 2VKVA 1FBUA 2WA0A 3VTIA 3ASNH 2ADUA 2ELJA 4LGWA 3W6VA 2ZXIA 2B9SA 4WX9A 3BP8A 1HSJA 3OIQA 5F0FA 5M3FJ 5HDGA 1ZLJA 4BUPA 1FT9A 2E7XA 1GVDA 1SFXA 3OR1C 3HTIA 2MH2A 4IRVA 2AS5F 2E1NA 3GZIA 4KMUX 4BNCA 1TNTA 3F23A 3MZ8A 1MH3A 3OR2C 4M3DA 4IKFA 3OWTA 1NK2P 3WU2C 4OMYA 2JPBA 4O5VA 4BQNA 3ZPLA 2XAGA 5H6RA 1K79A 2KZVA 2JWTA 3EYIA 1P9QC 5DS9A 1Y56A 1DUXC 1IV8A 2CS3A 1HW5A 2EZLA 1I6XA 5FLVA 5FFZA 2HVQA 2KPMA 5C4XJ 1AWCA 1Z1DA 2WV1A 4XR6A 1A6IA 4EEFG 2V9KA 3AQTA 3QP5A 2PMZN 5ILSA 3RDIA 5EEHA 1L3LA 1RNLA 2CJJA 3VFZA 3PIPF 2G0EA 4LIVA 4A3FJ 4E7IA 2EINH 3VSKA 1MMGA 5CKTA 2XAJA 4BU2A 2F5VA 2JJ7A 1YQAA 5J6XA 1W0UA 3SHFA 5HLHA 3A02A 2RHAA 5L3CA 1B6AA 1OMIA 2RV8A 2L4AA 1S5LC 3KNWA 1TWAJ 3I9V2 2IGKA 3ERMA 2DAOA 2M8EA 3KE2A 4L18B 3HUGA 4XOTA 3FXMA 2OJED 3BTCA 4XKCA 5LHIA 1G59A 4XOPA 1VQ7I 1OYYA 1JJ8C 2RNGA 3VSLA 2KDZA 2WADA 3AL0C 2DN0A 3R60A 3Q9VA 1YI2I 5JHUA 2NVTJ 2EZKA 3MCZA 3BNIA 1RETA 1VQ8I 3HTAA 1AKHA 2STTA 3CCRI 1I1GA 2HYFA 4CH7A 4CCMA 3TQNA 2CUEA 2W82A 4II3A 1JUPA 1VNDA 2R7QA 5D1RA 1MBHA 1FLIA 1FX7A 1EV7A 2LK2A 4GCVA 4HX7A 1MMDA 3RYRA 3G2BA 2VJ4A 2W53A 2VBWA 3OOUA 3RSNA 4DYQA 1E17A 4UNOA 1IG7A 4CCNA 1MNDA 2HQNA 2PN6A 3IAS2 4PGHA 4Z2YA 2COBA 5EJCA 3PIOF 2M7AA 5M3MJ 2PQ8A 4RMNA 2XROA 1T95A 1YS7A 1WWXA 2NS7A 4XKWA 3F6OA 3VW1A 1W36D 1VQKI 1T6SA 2CRGA 3MMYB 2JVGA 4P9UA 4HEA2 3CQZJ 3IUOA 5FFXA 4C3HJ 2K7LA 3B81A 3HOUJ 4G9YA 1Z67A 1TWFJ 1B8IA 3GTQJ 5D4RA 3SWHA 3PNTA 3KETA 2CW8A 3ZMDA 2UXIA 5L3GA 2Y69H 2X48A 3WTSC 3EGQA 2L9VA 2NVUB 1D5VA 3CJTB 3T6NA 5HSZA 4EM2A 1WKMA 5DCMB 4BHPA 4PJJA 4C9YA 1NHAA 2DA6A 1DU0A 2YX4A 1LDKB 2X0LA 5ED4A 4JNNA 1HXDA 2K85A 4HF2A 3FXOA 3E6BA 2DLLA 3BR5A 3WE2A 3HB9A 3R4KA 3GVAA 2QSFX 3S1NJ 5FHPA 1OJLA 3DPUA 5BS6A 1OCCH 4NC7A 1U3EM 3FDYA 3PQKA 3VEPA 3RTRA 1H8AC 2STWA 3HTSB 1YRNB 2RREA 4M9SA 3HHHA 4IRGA 4I99C 2FMYA 3Q0WA 1LPQA 1ERDA 1J59A 1UB9A 1OFCX 4BS9A 2NP3A 4V19K 1Z7LA 1Z0XA 2O7OA 2CQXA 4M6VA 2WB1N 2QBYA 1UI5A 3JRCA 3FXJA 3QPLA 5KAIC 3ESWB 1IGNA 4LB6B 4HF0A 3JSPA 3LA2A 3WTZA 1SFOJ 1T0FC 1HW2A 4Y15A 5LHGA 3QP6A 3PNVA 3ZCOA 1SFKA 4RLFA 2R5YB 2VKEA 2WGBA 3GTOJ 1R22A 4E6KG 2EJRA 4II2A 4RB2C 3ERED 1J09A 3RCOA 3HKZA 3BC8A 2WAQA 3JSOA 4HLYA 3DLAA 1IXCA 1ZRCA 2IBDA 2GQQA 1N77A 1Y39A 3TO9A 5IY5H 2LC2A 2O9LA 1ENHA 3S3OA 4M6YA 1GV2A 5EG0A 1GXQA 1UAAA 5KVRA 3VW2A 3OYEA 3LSTA 4I7HA 4KN7X 3HOSA 3QRFF 2OPTA 4G8XA 2ESNA 1QNTA 3A0HC 1XC5A 3OYJA 4BJTA 4ETSA 4HAMA 1Z7UA 1OR7C 2X1DA 4A69C 3GTKJ 2VBZA 4AIKA 1Y6IA 3QPTA 4P9FA 1FYLA 2FJI1 3OOPA 1SD4A 3BDDA 1EH8A 1MJBA 2F07A 2BV6A 1CGPA 5BQTA 2Q8KA 1ZREA 2DI3A 1IDZA 1IJWC 3ZP5A 1B72B 2NP5A 1JUMA 3LQRA 1V5EA 3MFKA 2DU9A 3GYHX 2X6YA 1TZLA 2M4GA 1ETVA 4D9JA 5LBQA 2FX0A 3E6MA 2HOAA 2FBHA 2UV1A 2IS6A 2R7DA 2ZBKA 3H3UA 3FMRA 4XL9A 4U88A 1FBQA 3PPBA 4L0ZB 3NNRA 2LTPA 3S3NA 1U8RA 1XPXA 3K69A 4UUTA 4BXFA 2V1XA 2MW8A 3TKYA 2XSDC 4GCKA 2IPQX 1DPUA 3PNYA 1Z91A 4HX4A 1LB2A 2HDCA 3GTGJ 3E1SA 3V4GA 1LE8B 3IV5A 2FSWA 2ZSIB 5EZGA 2CFOA 1W7PA 2W25A 3REOA 1R5HA 2KL4A 3E3VA 5HS9A 2L01A 2M8GX 2MGQA 2KRHA 2R7RA 1PDNC 3RKYA 2XC7A 3K4KA 4KJZA 3PL8A 5A2QK 3GTJJ 4Q48A 1LEAA 2PLYA 2DT6A 5GAEJ 2VBXA 3QWLA 3H9JA 5JLXA 2LREA 2BXZA 4NC8A 3VIBA 3ABMH 4EV0A 4EJTA 3VYTB 4BJ5C 4LFUA 3SYTA 2XF7A 2HQRA 3OSGA 2BY0A 5D8KB 2Q2EA 3HDDA 4AC6A 3ULQB 4Q5SF 5CVRA 3G3ZA 4FX4A 4BE0A 4JX4A 1H89C 2JA8J 4GRIA 3GTPJ 1WJ5A 2MLKA 3KEQA 4RM2A 1T08B 4AF5A 3EUKL 2DOAA 1M1EB 2DG8A 4BBRJ 4LB5A 3FXLA 1WJEA 4IOAF 1R1VA 5A2QZ 3LL7A 2IA1A 1ZG5A 2MC4A 4PCQA 3LSHA 2EA2A 1RUOA 1IRXA 1HKSA 2V26A 4EJWA 1I1SA 4L9NA 2DPDA 3S1QJ 4A93J 4Y52J 5C44J 4I09A 1BI0A 3PM1A 1PJRA 3L2RA 3OS0A 3U9GA 4ZDPA 4CYCB 3J81K 3HBLA 3DEEA 1H9GA 5HLGA 4ZYHA 5JVTA 3HE0A 2DW4A 2GOXB 2IJLA 3EETA 4B3XA 1Y0UA 1W7PD 3NWTA 2GBYA 3WTXC 1APLC 4M3GA 1I6HJ 3GZNB 1KZHA 3LAJA 2VPRA 2KRCA 2YS9A 3C07A 4YZEA 2I5UA 4FE4A 3HOYJ 2X1EA 4W97A 1R7JA 3TW6A 3G7RA 1R58A 3K10A 4DBQA 3IL2A 2B0LA 5K7FA 5J8FA 2V9PA 4NDLA 3J81Z 4G6DA 2FE3A 3IH3A 4M3EA 3OS1A 4F55A 1LKXA 1B1BA 4C30A 2VT3A 5FRMA 4CZCA 2IAIA 3JRAA 1XDSA 1YJNI 5LGNA 2DJNA 1X58A 3WODF 2R4GA 4V2GA 1K7AA 1NG7A 5IPAA 2BY2A 5J40A 3WTWC 1IF1A 3N05A 2V1UA 3BJBA 2F5EA 4BDZA 3LSPA 4C2TA 2W85A 2Z5UA 2A5YB 2PBIA 4LIUA 4EATA 1A5JA 5M5XJ 1XDUA 2E19A 4XBFA 2QKLB 1FMVA 1MMAA 2LY2A 2ACJA 5K7HA 4LJZF 1ETXA 3O8GA 2EIMH 2L5QA 4WK8F 1ZG1A 4WXCA 4HLXA 3S8PA 1P7IA 1U6GA 1WQ2A 2H94A 2WY8Q 2XAQA 3L09A 3NARA 2OAZA 1UELB 1X4OA 5IYDJ 1K83J 2BZTA 2DK5A 4ESFA 3HIFA 1ETOA 3I64A 4N9HA 1H88C 4LLNA 2VPLA 3KZ9A 4BYYA 2YPRA 3ZN0A 4HSRA 3S2HJ 4ZYAA 3GCMA 2EK5A 1UMQA 2LR8A 4XMYA 2IRFG 1RZ4A 1WRJA 4C2MJ 1D5YA 1Y8QB 2KKOA 1K4SA 2VXDA 3S32A 1U5TB 1P4XA 1QHGA 3DFGA 4LOCA 1IRZA 1TL8A 5DAJA 5J3LA 2K40A 2ZMEC 1IRFA 1QZEA 1BM9A 2CUZA 4I02A 3SDGA 3CUQB 3HPGA 1G3TA 2LD5A 4CGRA 2FQ3A 3KP5A 2DFIA 4PGGA 4JOMA 4RBOA 3JTHA 3VOKA 5DCMA 3IAM2 3CMMA 2HR3A 1JKRC 3VODA 3F6VA 2B1EA 1UI6A 3BR6A 2V79A 3FHZA 1RESA 2M4KA 2XGEA 1P2FA 4L9VA 2XV4S 3BOQA 4ZTJA 5DM6F 3KPHA 4XRMA 3J7AY 1R6RA 2DCEA 3BT9A 3EUHC 1BOBA 1IO2A 3MAJA 3VOXA 4XLAA 1YRNA 3KZZA 3T8RA 1RUNA 1AOYA 3BCGA 5JFRA 1FWZA 4LLGF 1IXRC 2FF4A 1V4RA 3MQ0A 1KA8A 5D5XB 2QYOA 3T5XA 3BJAA 1JKOC 1IW7F 3VOEA 1R1UA 1BW6A 2X1CA 3F8NA 5F6FA 5D8LB 5JLWA 3S15J 3BR0A 2MBFA 3TO6A 2G7UA 4B3AA 5IYBJ 1O4XA 2MABA 2ETHA 4PSWA 2P6TA 2O8KA 2EA4A 3KP4A 2KISA 3A0BC 4RB3C 2R5YA 1ETYA 4M9XA 4KISA 1PP8F 1WGXA 4D5FA 2FQ4A 3V8JA 1R4NB 3IHUA 3NWSA 2YX7A 4WWCA 2CYYA 3FWEA 3G1OA 1FYMA 4UXNA 2P6SA 4M6XA 2WAFA 2V7FA 4LMYA 1P4AA 2M7BA 5DUIA 5LGUA 4BKXA 2WUIA 5L3DA 2HNHA 3CUOA 3F72A 1IN4A 1XGNA 2X85A 4JYKA 2A3SA 4XIDA 4UHTA 1WI9A 1T39A 4QLCU 5FMPA 2BBYA 1UG2A 2JSPA 3NPIA 2EILH 3H35A 4BY7J 3CCUI 3L2CA 3M3YJ 2OQRA 4I98B 2OCEA 4ABZA 2GLOA 4AM3A 4XLCA 3HSFA 1QPMA 3ROUA 4PK4A 1ZG3A 2GA1A 2IW5A 4LLLA 1SANA 2JMWA 3L00A 1TT0A 4FETA 3OYKA 1JHHA 2E2HJ 3BLYA 3L1PA 3ANGA 1D1CA 2KZGA 3ZQ7A 2O8XA 3G71I 4JBAA 2O3FA 5TGTA 1B72A 4S05A 2GXBA 3FK7A 5GP9A 2DMUA 3ZMTA 4I0AA 2EV6A 3VVXA 2KMUA 3ZQIA 4D1QA 4HDUA 1R49A 3JRHA 4CZZA 3C2BA 1JXSA 2P5KA 1V3FA 4IXAA 2RN7A 1R36A 3P9KA 5F1JA 4FASD 2JT1A 3ZMSA 1GVJA 2Y31A 3C2GA 1AU7A 2QIBA 4DVYP 5F27A 1T38A 2BXYA 3JRDA 3O8HA 2RDPA 4Y17A 2XRNA 1XGMA 2FA5A 2K5CA 3VDXA 4LD5A 1HF0A 3ZMUA 1MBEA 2G9WA 3HGGA 2LOOA 5B3SH 4ESJA 1DP3A 3QU3A 5E3MA 3ZQFA 1A36A 3LSMA 1LE8A 1E2XA 4XKBA 4Y7NJ 1YJWI 1ZRDA 3H0GJ 2K3PA 3GEZA 2Y9YA 1X3ZB 2GUHA 3COAC 1XSDA 2DPUA 1L0OC 2LKXA 2EBIA 2RGVA 3DF8A 4XLNF 2DODA 2HKXA 2X6XA 1DU6A 3WTVC 4OD5A 2P5LC 2LMDA 3GLXA 5J1UA 5LGTA 2DQLA 2W7NA 3F22A 2E1OA 5H20A 5BOXA 1BL0A 3DQVC 5LFAA 3SQNA 2V9VA 3HTJA 3BTJA 3RIRA 2UXHA 2ZNZA 3ZQHA 3C18A 5ICCA 2LY9A 3E7QA 3BQYA 2K27A 3R61A 2V1DA 1O57A 3LMMA 4JQFA 1XSXA 4HNTA 3JCUC 4JK1X 1H0MA 1DPRA 3CLQA 4OIRF 3CDHA 4XLHA 2ME0A 2EFNA 3F3XA 1K78A 4PJLA 4XSZF 3DP7A 1YG2A 2E7WA 2R7TA 5K5OA 1O3TA 3K8PC 1UHWA 4UVBA 4ME9A 1GUUA 3DKXA 4LG3A 2OI8A 4XICA 2DMTA 3A1YA 3DPLC 3DBLB 1USSA 4MLOA 1B9NA 3NEUA 1C0WA 3HZJA 2HDDA 4G6TB 1T56A 4G7OF 3LHQA 1KU9A 4G94A 3BG5A 3FMSA 4H4KC 2YSRA 3IH4A 1R5ID 5M5YJ 1IXSB 2R93J 2ZJQF 2IA2A 3FIWA 4CYCA 4A3BJ 4MQ9F 1IUFA 1SMYF 5LEKA 5H9TA 5E3NA 4NQWA 3CC7I 4IHTA 1V5GA 2XVCA 4AIHA 3P9IA 1ZR4A 1MZBA 2GIZA 2A2FX 1AA7A 3D1NI 5M5WJ 3LA7A 3DV8A 2IGOA 3IH2A 4MFEA 1SD7A 3K4CA 2R7SA 2IXSA 3OYIA 3HOWJ 3BG6A 5IT9K 5EGOB 1FOWA 2K9NA 4KMFA 4G6QA 1BA5A 2QWWA 2Z1DA 2KIQA 1KYZA 4F7ZA 3AL0B 3T1BA 3V7RA 4ZYDA 2BY1A 2JK3A 2TRTA 5CVJA 2E5NA 2VOOA 1N78A 4E7SA 3HOVJ 3OIOA 3SZTA 2LKPA 2D5VA 2WBMA 2EIJH 1PP7U 5CQEA 3S17J 4N0BA 4A3DJ 4ANJA 2F4MB 3KX2A 5ICFA 1GDTA 1EKEA 1HQCA 4OIPF 1BI1A 4XLPF 3J7AO 3HOXJ 5IT9Z 4XLEA 1D8JA 2EH3A 1X1CA 1ZK8A 2L7FP 4B43A 1MBJA 5D5WB 1ORKA 2IEKA 5HNFA 3M8EA 1S7AA 2JQ7A 2DA1A 3TEDA 3TO7A 4U7DA 2PI0A 3I59B 2ZB9A 3HL2A 5LEJA 2QLZA 1J0RA 3FXRA 5FLXK 2ZOYA 3LSRA 3G1LA 2WB1A 5IP7J 5DM7F 2W1OA 1ITYA 3E6CC 3IUVA 2V1NA 3K0LA 1BR1A 4OD4A 2XPVA 2IA0A 3SEZA 4BAYA 4AU7A 5HS7A 2EFWA 1WHUA 1XMXA 1PYVA 4A3CJ 1S7OA 4LG0A 4KIFA 1RI7A 1XB4A 2VASA 1SEUA 2LLKA 3FRQA 3S5RA 1U9OA 3KEOA 2XB0X 3DTIA 5FLMJ 1FEXA 1N25A 3EUAA 2Y75A 3H5RA 3K1PA 5C3EJ 3V7CA 1V54H 1RPWA 4XK4A 5F0CA 2F4OB 1U5TA 4RB0A 4J01A 4W1UA 5FLXZ 3TP0A 1YFHA 2KP6A 2AO9A 1WPKA 3AFHA 3ONQA 3TMOA 3SXYA 2I8DA 3D5LA 5GPAA 1D0YA 3L7WA 4L62A 2AHQA 3F8CA 2R7WA 2XGDA 3VVYA 4EQQA 1QQIA 3OYCA 1TLHB 1POGA 2HWVA 3CUQA 3WGHA 5IYCJ 2XF6A 1MW7A 4RM3A 1TWGJ 3CJDA 2F2EA 4HZFA 1BBYA 4BHCA 3CDIA 4KICA 1T33A 4XNFA 3WTUC 4CGZA 3A4CA 1DGWY 4QSHA 3PO3J 1JTXA 1ETQA 2VIXA 3VYRB 5AIQA 3HYIA 3WTYC 3D0SA 4CA0A 4X0GA 1MKMA 2GA2A 1G2HA 2FD5A 2HDWA 2LF8A 4MO7A 1MMNA 2VC0A 2XB5A 3SZGA 3U21A 1WSUA 2L9NA 4F92B 1RR8C 3ABUA 2QTQA 3CLOA 3KP3A 3PFYA 4BQQA 1O7FA 1VF9A 1D1AA 2IS4A 4DYRA 2CG4A 4JX6A 3OL4A 1GLNA 4KIGA 5FKOA 5HODA 4OIOF 3AQSA 3P9CA 4CDGA 1STZA 2BY3A 3MVPA 3KZIC 1ZR2A 1VQLI 3GXOA 3E7LA 3K4JA 1VQOI 2O0YA 2EFQA 3PASA 3N4MA 2WC2A 4DZPA 2HVSA 3V6GA 2Q1ZB 2LP0A 3CP8A 4OU0A 5K5QA 1J5YA 2GWRA 3F8BA 1MH4A 3QYEA 3OYFA 2E34A 2JN6A 2HTJA 5E3LA 2IU5A 1SC7A 5D18A 4PFPA 4YG2F 3E6DA 3ABLH 2DA5A 4QIWN 5DV5A 2QQ9A 1E3OC 3ON4A 2LKSA 3NRVA 2EPFA 2HTSA 2ZO4A 1XX5A 4MK6A 2K9QA 2P81A 3JSJA 4A0YA 2PMUA 3CDLA 4R1HA 3I55I 2ZY9A 1G3SA 1Z21A 3DBRB 3L2QA 3ECOA 3OS2A 4ZYGA 3CO6C 2BE5F 1JGSA 3WE3A 3JW4A 5F08A 2Z9OA 4PJMA 1XD7A 1I5ZA 3S2WA 4EJVA 4IJAA 1TT5B 3BQZA 2NX4A 1LFBA 3ZRGA 4FT8A 3MWMA 3NXCA 1VQNI 2JA5J 2VJ5A 3OYGA 3CCSI 4CXFA 2VQLA 3CRJA 2F5CA 4LK1F 2D6YA 1LVKA 2HZTA 2W24A 3BY6A 4GDFA 3ZQLA 1ZTRA 3DPJA 1BW5A 3GBGA 1R23A 3VUQA 3FK6A 4YIRX 3C3WA 2R5ZB 2UXOA 2EFOA 3UR3C 5L3FA 2O5RA 1EJ9A 2PX9A 4YFNF 4ZZDA 5DEQA 3X2QH 3VB2A 2ID6A 3MKLA 1ZHFA 3OV8A 3PUFA 5CYVA 1X2MA 2V57A 5E79C 3H5AA 2OZ6A 4KIBA 4DW6A 2GFNA 3FKIJ 5TISC 4QPOA 1VQ9I 4AYBA 1EF4A 2PMHA 2DFFA 3BR2A 3HTHA 2BEOA 1R4MB 3V8KA 3COLA 2JA7J 2X9DA 3S2DJ 2R7OA 4A3EJ 1FNNA 5FKKA 2O61A 1XG1A 1EH6A 5H6QA 1R9TJ 2FEZA 4X6AJ 3T8TA 2ZSHB 3KIOA 2F48A 3HIMA 3R6SA 1YHQI 3L9FA 4RAZA 3VYSB 2NOGA 4D5CA 4N4NB 5TJJA 2QEXI 5JVGF 3OYHA 2A5WA 5DD4A 5KAFC 2LY1A 4BH9A 1VI0A 2M5WA 4OAYA 4ZYEA 2WAQN 5J4YA 2MD0A 3ABKH 5IP9J 3FX3A 2IS2A 1WI3A 2XIGA 1JTYA 2M87A 1PVEA 3ASOH 2UWMA 4UV8A 1FSHA 3CJRB 4A6EA 4I76A 4NELA 3TW7A 2ECBA 2IP2A 4KITB 1DDNA 3CTAA 3BG9A 2AXTC 2LFBA 2WTEA 4NBQA 4A0ZA 2MD5A 4A3MJ 3FMQA 3LJLA 2Y48A 4HPQA 1YX5A 2QF7A 1UJ8A 2AQFA 2FOKA 4P5OA 2UXXA 3H1CA 4FQGA 3S3MA 4UV9A 3MKWB 1REPC 3IC7A 5FKLA 4AD9A 2IGMA 1PUEE 2A6HF 3SJMA 5BMZA 2P7CB 3OYBA 5LHHA 1I27A 4KUMA 4A3JJ 2DK8A 4A3GJ 4HKUA 5J1RA 4ASNA 3FXQA 2PG4A 4IZZA 3BG3A 2D1VA 3K70D 3H3VK 2CV2A 2R7VA 2CH0A 2ID3A 4E70A 3U1KA 5EDNA 2G7GA 5JI6A 2D45A 2QOPA 3P7NA 2GOMA 2K9MA 1U78A 5J4VA 2Q24A 1B9MA 1G4DA 1DP7P 1G6NA 5EGOA 1ACIA 4WXHA 5FD5A 3BCBA 1QVTA 2FU4A 2NYXA 2MFZA 4HA8A 1W4MA 3HJEA 2G3BA 3P5JA 2F4IA 2OA4A 4C3IJ 4C2MA 2UZKA 1FOKA 3ZGKA 1Z3XA 1FBSA 3O6BB 3WG9A 3N97A 3IRQA 3CF5F 4U87A 2ZXHA 4OINF 3E0JB 1ZYRF 2ZFUA 4CCOA 3HC7A 3GEUA 3BWGA 1EA3A 4XRSG 1BC8C 1IN5A 2B7EA 3NAUA 2HOEA 3R0JA 2O03A 3LNQA 1KU7A 4AVZA 2MSYA 5KK1A 1O3RA 5CXIA 1Z9CA 1F1ZA 2YR2A 5E1WA 2E71A 4GYIA 4FX0A 3K1NA 2DQRA 2BHZA 1W36C 5DTDA 1WJCA 5CQGA 2V6EA
chains in the Genus database with same CATH topology
2TCTA 4MIMA 3RH2A 3JRHA 3EUPA 3LSJA 3C2BA 2CUEA 2FJ1A 1JUPA 1VNDA 5D1RA 1MBHA 2OF7A 3WHBA 3DEWA 2LK2A 5F1JA 4ACIA 5EFYA 3QKXA 2Y31A 1AU7A 2QIBA 5CW8A 5F27A 2E2JJ 3I4MJ 4IEJA 3JRDA 3O8HA 2W53A 5CXGA 3OOUA 1WCMJ 2HI3A 4DYQA 1IG7A 1HF0A 1ZKGA 3Q3SA 1MBEA 3HGGA 2XPWA 2COBA 5E3MA 5M3MJ 3ZQFA 2EQRA 2L0KA 1LE8A 4FE7A 4Y7NJ 3LOCA 2NS7A 3H0GJ 2Y9YA 3BHQA 3G1MA 2ME6A 2GUHA 3VW1A 3VPRA 2CRGA 2LKXA 2EBIA 3HKZN 3CQZJ 2M9HA 4JL3A 4C3HJ 1FJLA 3HOUJ 1B8IA 3B81A 1TWFJ 3GTQJ 1DU6A 5J1UA 4ICHA 2H1KA 3Q0VA 2UXIA 2X48A 2E1OA 3ANPA 3EGQA 1BL0A 3T6NA 3HTJA 5HSZA 3BTJA 2PZ9A 2UXHA 3ZQHA 1AHDP 5HBUA 2HYTA 1PUFA 3VP5A 2DA6A 1DU0A 2LY9A 4UUSB 3E7QA 1MBGA 3BQYA 4JNNA 1IDYA 3BR5A 2DA2A 3HB9A 1JKQC 2HOTA 3KKDA 4NN1A 2JA6J 2ME0A 3S1NJ 5FHPA 1OJLA 4QTRA 3BR1A 5FKNA 2M2EA 2RAEA 4KWAA 3RKQA 3LSGA 1H8AC 3QBMA 4L5EA 1GUUA 1U9NA 2OI8A 1FIAA 1YRNB 4XICA 2DMTA 3NI7A 2EZIA 4MLOA 3Q0WA 4B1RA 2HDDA 1T56A 1OFCX 2M0CA 2NP3A 3LHQA 3BG5A 3HM5A 5IP6A 1Z0XA 2O7OA 2CQXA 4M6VA 5HAWA 2WB1N 2DG7A 3IH4A 3A01B 2HXIA 2UXPA 4BY1J 5M5YJ 3JRCA 1UI5A 5K58A 3B6CA 2R93J 3QPLA 3FIWA 3M4OJ 4CYCA 1IGNA 4A3BJ 1SFOJ 1IUFA 1MNMC 3NRGA 3FISA 3HGYA 2NVXJ 5H9TA 4M3BA 5E3NA 1HOMA 4AC0A 2VKEA 2R5YB 2WGBA 3GTOJ 4PXIA 1ZR4A 5EZHA 4XRSA 3ZQCA 4AYBN 3D1NI 5M5WJ 3IH2A 3F0CA 4MFEA 2HOSA 1HCRA 1X2NA 3S1MJ 3HOWJ 5FGLA 2IBDA 5EGOB 2CU7A 2K9NA 2NVYJ 1BA5A 2O9LA 2ZCNA 1ENHA 1JT6A 1GV5A 4FCYA 1GV2A 1QPIA 5EG0A 1FIPA 3VW2A 2JK3A 2TRTA 3HOVJ 2OPTA 3OIOA 4M3FA 1IC8A 2D5VA 3TP3A 1XC5A 2Y0SN 4A69C 3GTKJ 1MSEC 3S17J 4A3DJ 4MXMA 1GDTA 1JT0A 4RDUA 3ON2A 1MSFC 3HOXJ 1WH7A 4BBSJ 2VI6A 2EH3A 4FISA 1ZK8A 2L7FP 2F07A 5C4YA 5EYRA 1MBJA 2R5ZA 3ZOBA 2YUSA 4C3JJ 1IJWC 1IDZA 2CUFA 2GM4A 1ORKA 2IEKA 1B72B 2DMQA 3HEFA 2DA1A 3TEDA 2NP5A 2UXUA 1JUMA 2ZB9A 1P7JA 2ZOYA 3LSRA 3G1LA 1AKHB 5IP7J 1FTTA 2DA3A 1ITYA 3IUVA 1ETVA 2FX0A 5BNGA 2XPVA 2HOAA 3GTMJ 3BRUA 3K7AJ 2QKOA 1RKWA 3BTLA 1MBFA 4IHWA 4A3CJ 3PPBA 3ZQGA 2QWTA 3NNRA 2LTPA 3S5RA 2LLKA 2X6OA 3FRQA 1U9OA 2XB0X 5FLMJ 1FEXA 4UUTA 1IV6A 2MW8A 5C3EJ 1HLVA 1RPWA 2XSDC 4XK4A 4GCKA 1I50J 2XRLA 1U8BA 5F0CA 3V78A 3GTGJ 4W1UA 3TP0A 3JRGA 1LE8B 2AO9A 1WPKA 3IV5A 5F0HA 5EZGA 5GPAA 4JP0A 4L62A 2AHQA 3VVYA 2XGDA 5FJ8J 2M8GX 2MGQA 1POGA 1ZGWA 2XDNA 3K2AA 5IYCJ 4D7MA 1B8IB 3GTJJ 2MG4A 1F43A 1TWGJ 2EZHA 3CJDA 4GFLA 5JLXA 1Y1WJ 2YU9J 3VIBA 1T33A 5K7ZA 5D19A 4QSHA 3PO3J 3OSGA 1JTXA 3HDDA 2ZOZA 1PUFB 1ETQA 3I4NJ 4AC6A 1ZQ3P 4JX4A 1H89C 2JA8J 4HNVA 1G2HA 4DZJA 2HYJA 2FD5A 3GTPJ 3HOZJ 4MO7A 1JGGA 2XB5A 5AQCA 1SGMA 4AF5A 3DCFA 2L7ZA 2QTQA 2DG8A 4BBRJ 2L9RA 1Y1VJ 1TC3C 1VF9A 2G7LA 5IOZA 4J19A 4GFBA 1QVUA 4DYRA 2HXOA 5FKOA 4JX6A 5HODA 3AQSA 2ELKA 2DMNA 2NVQJ 2NS8A 1CQTA 3CMYA 3MVPA 4GFKA 1ZR2A 3O60A 3S1QJ 4Y52J 3E7LA 1UHSA 4A93J 5C44J 3PASA 3PM1A 4DZPA 3V6GA 3RQIA 1JJ6C 2LP0A 4ME9A 2O7TA 3WHCA 4CYCB 3HBLA 3S14J 1MH4A 2YVEA 3HE0A 2JN6A 5E3LA 2IU5A 3G56A 2HQ5A 5D18A 2Y2ZA 4GCLA 2REKA 2DA5A 4QIWN 2GBYA 1E3OC 1APLC 3ON4A 4M3GA 5E3OA 2H8RA 1I6HJ 2VPRA 4MK6A 2YS9A 2K9QA 3C07A 4YZEA 2N8GA 1BJZA 2R7ZJ 4FE4A 3HOYJ 1K61A 3BTIA 4W97A 2P81A 4FTHA 4IHYA 3CCYA 3JSJA 3TW6A 3G7RA 3CDLA 1Q1VA 2Y30A 5K7FA 4GCTA 2K9SA 2QCOA 4NDLA 5EG0B 3JR9A 1OCTC 3OSFA 4IHVA 3BR3A 3IH3A 4M3EA 5F08A 5EF6A 2I10A 4G12A 1Z77A 3JRAA 2IAIA 2OERA 3BQZA 2NX4A 1LFBA 2DJNA 3NXCA 1JUSA 1X58A 4V2GA 1TWHJ 2JA5J 2HKUA 5IPAA 4B4CA 4X1EA 3CRJA 3QPSA 2L7MP 2D6YA 3PO2J 2YVHA 4JX5A 3BJBA 2ECCA 3ZQLA 3LSPA 1ZTRA 3DPJA 1BW5A 3GBGA 2LVSA 1GT0C 1A5JA 3FK6A 3VUQA 5M5XJ 3KKCA 2R5ZB 2E19A 2UXOA 2ZCXA 2B63J 5K7HA 1ETXA 4UDSA 1I3QJ 3O8GA 3QQAA 4IHXA 1LFUP 1W0TA 1P7IA 2ID6A 3MKLA 1X2MA 3NARA 2V57A 4DW6A 4BXXJ 2GFNA 3FKIJ 1K83J 5IYDJ 2RASA 2W48A 4I6ZA 1EF4A 1H88C 1ETOA 3KZ9A 3BR2A 3HTHA 3MNLA 1NK3P 2PBXA 3COLA 4AUXA 2JA7J 1RR7A 2X9DA 4MFDA 3S2DJ 4A3EJ 3S2HJ 4A3KJ 3S1RJ 5FKKA 3VVZA 1UMQA 1HDDC 2LR8A 1XG1A 5IOYA 2Y9ZA 1FTZA 3VW0A 4C2MJ 1R9TJ 4X6AJ 1D5YA 2CQQA 4V2FA 1MBKA 2R92J 2VUMJ 3HIMA 4LOCA 1IRZA 2DMPA 5DAJA 3RZOJ 2NOGA 4D5CA 2G7SA 1ETKA 4DYCA 5J3LA 3S16J 2K40A 1VI0A 3SDGA 3RZDJ 2GENA 5GPCA 2LD5A 4CGRA 3JRBA 2WAQN 3B6AA 4RBOA 3VOKA 5F04A 1JKRC 5IP9J 3JRFA 4UUSA 3UKGA 1UI6A 1F36A 3BR6A 1WI3A 1JTYA 3LWJA 4S0HB 3P9TA 1RESA 2XGEA 2ZCMA 3MN2A 1OCPA 3CWRA 3Q0UA 1RKTA 1ETWA 2VKVA 4I76A 4NELA 3TW7A 4XRMA 2ECBA 3BG9A 5FKMA 2LFBA 3W6VA 3BT9A 3SFIA 3JRIA 3VOXA 5F0FA 5M3FJ 4A3MJ 4A3LJ 5C4JJ 1YRNA 3LJLA 3BCGA 1GVDA 2QF7A 3HTIA 3GZIA 1JKOC 1BW6A 5JLWA 3A01A 3S15J 3JREA 5FKLA 1MH3A 3BR0A 4M3DA 4D7NA 3SJMA 1NK2P 3RD3A 4A3IJ 4B3AA 4A3JJ 2M34A 5IYBJ 1O4XA 4A3GJ 5J1RA 4HKUA 1WH5A 1VFCA 2DTZA 2XGCA 3BG3A 2O8KA 1XS9A 2R5YA 9ANTA 2JWTA 1ETYA 3H3VK 1WGXA 4D5FA 2FQ4A 5DS9A 2ID3A 5EDNA 2G7GA 2EZLA 3G1OA 5FLVA 2QOPA 2DA7A 2Q24A 1U78A 5C4XJ 4BKXA 2WUIA 2DA4A 1HDPA 2R0QC 2WV1A 5EGOA 1NTCA 1A6IA 4EEFG 1QVTA 2KT0A 4JYKA 3AQTA 2PMZN 5J1YA 4XIDA 2CJJA 2G3BA 5FMPA 1JKPC 1S7EA 2G0EA 4C3IJ 1UG2A 4A3FJ 3NPIA 4BY7J 3M3YJ 4ABZA 2JJ7A 2GLOA 1W0UA 3A02A 2RHAA 4JKZA 1SANA 2JMWA 3GEUA 5EEAA 4XRSG 3KNWA 1TWAJ 1TWCJ 3A03A 2E2HJ 3NAUA 2E2IJ 3L1PA 3ANGA 2FBQA 3BTCA 1QRYA 3LNQA 1JJ8C 2MSYA 5CXIA 2XPUA 2KDZA 2DN0A 1B72A 3GTLJ 2NVTJ 3F1BA 2EZKA 3FK7A 5GP9A 5DTDA 2DMUA 3BNIA 1RETA 3VVXA 3HTAA 1AKHA 3ZQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TCT A;  4MIM A;  3RH2 A;  3JRH A;  3EUP A;  3LSJ A;  3C2B A;  2CUE A;  2FJ1 A;  1JUP A;  1VND A;  5D1R A;  1MBH A;  2OF7 A;  3WHB A;  3DEW A;  2LK2 A;  5F1J A;  4ACI A;  5EFY A;  3QKX A;  2Y31 A;  1AU7 A;  2QIB A;  5CW8 A;  5F27 A;  2E2J J;  3I4M J;  4IEJ A;  3JRD A;  3O8H A;  2W53 A;  5CXG A;  3OOU A;  1WCM J;  2HI3 A;  4DYQ A;  1IG7 A;  1HF0 A;  1ZKG A;  3Q3S A;  1MBE A;  3HGG A;  2XPW A;  2COB A;  5E3M A;  5M3M J;  3ZQF A;  2EQR A;  2L0K A;  1LE8 A;  4FE7 A;  4Y7N J;  3LOC A;  2NS7 A;  3H0G J;  2Y9Y A;  3BHQ A;  3G1M A;  2ME6 A;  2GUH A;  3VW1 A;  3VPR A;  2CRG A;  2LKX A;  2EBI A;  3HKZ N;  3CQZ J;  2M9H A;  4JL3 A;  4C3H J;  1FJL A;  3HOU J;  1B8I A;  3B81 A;  1TWF J;  3GTQ J;  1DU6 A;  5J1U A;  4ICH A;  2H1K A;  3Q0V A;  2UXI A;  2X48 A;  2E1O A;  3ANP A;  3EGQ A;  1BL0 A;  3T6N A;  3HTJ A;  5HSZ A;  3BTJ A;  2PZ9 A;  2UXH A;  3ZQH A;  1AHD P;  5HBU A;  2HYT A;  1PUF A;  3VP5 A;  2DA6 A;  1DU0 A;  2LY9 A;  4UUS B;  3E7Q A;  1MBG A;  3BQY A;  4JNN A;  1IDY A;  3BR5 A;  2DA2 A;  3HB9 A;  1JKQ C;  2HOT A;  3KKD A;  4NN1 A;  2JA6 J;  2ME0 A;  3S1N J;  5FHP A;  1OJL A;  4QTR A;  3BR1 A;  5FKN A;  2M2E A;  2RAE A;  4KWA A;  3RKQ A;  3LSG A;  1H8A C;  3QBM A;  4L5E A;  1GUU A;  1U9N A;  2OI8 A;  1FIA A;  1YRN B;  4XIC A;  2DMT A;  3NI7 A;  2EZI A;  4MLO A;  3Q0W A;  4B1R A;  2HDD A;  1T56 A;  1OFC X;  2M0C A;  2NP3 A;  3LHQ A;  3BG5 A;  3HM5 A;  5IP6 A;  1Z0X A;  2O7O A;  2CQX A;  4M6V A;  5HAW A;  2WB1 N;  2DG7 A;  3IH4 A;  3A01 B;  2HXI A;  2UXP A;  4BY1 J;  5M5Y J;  3JRC A;  1UI5 A;  5K58 A;  3B6C A;  2R93 J;  3QPL A;  3FIW A;  3M4O J;  4CYC A;  1IGN A;  4A3B J;  1SFO J;  1IUF A;  1MNM C;  3NRG A;  3FIS A;  3HGY A;  2NVX J;  5H9T A;  4M3B A;  5E3N A;  1HOM A;  4AC0 A;  2VKE A;  2R5Y B;  2WGB A;  3GTO J;  4PXI A;  1ZR4 A;  5EZH A;  4XRS A;  3ZQC A;  4AYB N;  3D1N I;  5M5W J;  3IH2 A;  3F0C A;  4MFE A;  2HOS A;  1HCR A;  1X2N A;  3S1M J;  3HOW J;  5FGL A;  2IBD A;  5EGO B;  2CU7 A;  2K9N A;  2NVY J;  1BA5 A;  2O9L A;  2ZCN A;  1ENH A;  1JT6 A;  1GV5 A;  4FCY A;  1GV2 A;  1QPI A;  5EG0 A;  1FIP A;  3VW2 A;  2JK3 A;  2TRT A;  3HOV J;  2OPT A;  3OIO A;  4M3F A;  1IC8 A;  2D5V A;  3TP3 A;  1XC5 A;  2Y0S N;  4A69 C;  3GTK J;  1MSE C;  3S17 J;  4A3D J;  4MXM A;  1GDT A;  1JT0 A;  4RDU A;  3ON2 A;  1MSF C;  3HOX J;  1WH7 A;  4BBS J;  2VI6 A;  2EH3 A;  4FIS A;  1ZK8 A;  2L7F P;  2F07 A;  5C4Y A;  5EYR A;  1MBJ A;  2R5Z A;  3ZOB A;  2YUS A;  4C3J J;  1IJW C;  1IDZ A;  2CUF A;  2GM4 A;  1ORK A;  2IEK A;  1B72 B;  2DMQ A;  3HEF A;  2DA1 A;  3TED A;  2NP5 A;  2UXU A;  1JUM A;  2ZB9 A;  1P7J A;  2ZOY A;  3LSR A;  3G1L A;  1AKH B;  5IP7 J;  1FTT A;  2DA3 A;  1ITY A;  3IUV A;  1ETV A;  2FX0 A;  5BNG A;  2XPV A;  2HOA A;  3GTM J;  3BRU A;  3K7A J;  2QKO A;  1RKW A;  3BTL A;  1MBF A;  4IHW A;  4A3C J;  3PPB A;  3ZQG A;  2QWT A;  3NNR A;  2LTP A;  3S5R A;  2LLK A;  2X6O A;  3FRQ A;  1U9O A;  2XB0 X;  5FLM J;  1FEX A;  4UUT A;  1IV6 A;  2MW8 A;  5C3E J;  1HLV A;  1RPW A;  2XSD C;  4XK4 A;  4GCK A;  1I50 J;  2XRL A;  1U8B A;  5F0C A;  3V78 A;  3GTG J;  4W1U A;  3TP0 A;  3JRG A;  1LE8 B;  2AO9 A;  1WPK A;  3IV5 A;  5F0H A;  5EZG A;  5GPA A;  4JP0 A;  4L62 A;  2AHQ A;  3VVY A;  2XGD A;  5FJ8 J;  2M8G X;  2MGQ A;  1POG A;  1ZGW A;  2XDN A;  3K2A A;  5IYC J;  4D7M A;  1B8I B;  3GTJ J;  2MG4 A;  1F43 A;  1TWG J;  2EZH A;  3CJD A;  4GFL A;  5JLX A;  1Y1W J;  2YU9 J;  3VIB A;  1T33 A;  5K7Z A;  5D19 A;  4QSH A;  3PO3 J;  3OSG A;  1JTX A;  3HDD A;  2ZOZ A;  1PUF B;  1ETQ A;  3I4N J;  4AC6 A;  1ZQ3 P;  4JX4 A;  1H89 C;  2JA8 J;  4HNV A;  1G2H A;  4DZJ A;  2HYJ A;  2FD5 A;  3GTP J;  3HOZ J;  4MO7 A;  1JGG A;  2XB5 A;  5AQC A;  1SGM A;  4AF5 A;  3DCF A;  2L7Z A;  2QTQ A;  2DG8 A;  4BBR J;  2L9R A;  1Y1V J;  1TC3 C;  1VF9 A;  2G7L A;  5IOZ A;  4J19 A;  4GFB A;  1QVU A;  4DYR A;  2HXO A;  5FKO A;  4JX6 A;  5HOD A;  3AQS A;  2ELK A;  2DMN A;  2NVQ J;  2NS8 A;  1CQT A;  3CMY A;  3MVP A;  4GFK A;  1ZR2 A;  3O60 A;  3S1Q J;  4Y52 J;  3E7L A;  1UHS A;  4A93 J;  5C44 J;  3PAS A;  3PM1 A;  4DZP A;  3V6G A;  3RQI A;  1JJ6 C;  2LP0 A;  4ME9 A;  2O7T A;  3WHC A;  4CYC B;  3HBL A;  3S14 J;  1MH4 A;  2YVE A;  3HE0 A;  2JN6 A;  5E3L A;  2IU5 A;  3G56 A;  2HQ5 A;  5D18 A;  2Y2Z A;  4GCL A;  2REK A;  2DA5 A;  4QIW N;  2GBY A;  1E3O C;  1APL C;  3ON4 A;  4M3G A;  5E3O A;  2H8R A;  1I6H J;  2VPR A;  4MK6 A;  2YS9 A;  2K9Q A;  3C07 A;  4YZE A;  2N8G A;  1BJZ A;  2R7Z J;  4FE4 A;  3HOY J;  1K61 A;  3BTI A;  4W97 A;  2P81 A;  4FTH A;  4IHY A;  3CCY A;  3JSJ A;  3TW6 A;  3G7R A;  3CDL A;  1Q1V A;  2Y30 A;  5K7F A;  4GCT A;  2K9S A;  2QCO A;  4NDL A;  5EG0 B;  3JR9 A;  1OCT C;  3OSF A;  4IHV A;  3BR3 A;  3IH3 A;  4M3E A;  5F08 A;  5EF6 A;  2I10 A;  4G12 A;  1Z77 A;  3JRA A;  2IAI A;  2OER A;  3BQZ A;  2NX4 A;  1LFB A;  2DJN A;  3NXC A;  1JUS A;  1X58 A;  4V2G A;  1TWH J;  2JA5 J;  2HKU A;  5IPA A;  4B4C A;  4X1E A;  3CRJ A;  3QPS A;  2L7M P;  2D6Y A;  3PO2 J;  2YVH A;  4JX5 A;  3BJB A;  2ECC A;  3ZQL A;  3LSP A;  1ZTR A;  3DPJ A;  1BW5 A;  3GBG A;  2LVS A;  1GT0 C;  1A5J A;  3FK6 A;  3VUQ A;  5M5X J;  3KKC A;  2R5Z B;  2E19 A;  2UXO A;  2ZCX A;  2B63 J;  5K7H A;  1ETX A;  4UDS A;  1I3Q J;  3O8G A;  3QQA A;  4IHX A;  1LFU P;  1W0T A;  1P7I A;  2ID6 A;  3MKL A;  1X2M A;  3NAR A;  2V57 A;  4DW6 A;  4BXX J;  2GFN A;  3FKI J;  1K83 J;  5IYD J;  2RAS A;  2W48 A;  4I6Z A;  1EF4 A;  1H88 C;  1ETO A;  3KZ9 A;  3BR2 A;  3HTH A;  3MNL A;  1NK3 P;  2PBX A;  3COL A;  4AUX A;  2JA7 J;  1RR7 A;  2X9D A;  4MFD A;  3S2D J;  4A3E J;  3S2H J;  4A3K J;  3S1R J;  5FKK A;  3VVZ A;  1UMQ A;  1HDD C;  2LR8 A;  1XG1 A;  5IOY A;  2Y9Z A;  1FTZ A;  3VW0 A;  4C2M J;  1R9T J;  4X6A J;  1D5Y A;  2CQQ A;  4V2F A;  1MBK A;  2R92 J;  2VUM J;  3HIM A;  4LOC A;  1IRZ A;  2DMP A;  5DAJ A;  3RZO J;  2NOG A;  4D5C A;  2G7S A;  1ETK A;  4DYC A;  5J3L A;  3S16 J;  2K40 A;  1VI0 A;  3SDG A;  3RZD J;  2GEN A;  5GPC A;  2LD5 A;  4CGR A;  3JRB A;  2WAQ N;  3B6A A;  4RBO A;  3VOK A;  5F04 A;  1JKR C;  5IP9 J;  3JRF A;  4UUS A;  3UKG A;  1UI6 A;  1F36 A;  3BR6 A;  1WI3 A;  1JTY A;  3LWJ A;  4S0H B;  3P9T A;  1RES A;  2XGE A;  2ZCM A;  3MN2 A;  1OCP A;  3CWR A;  3Q0U A;  1RKT A;  1ETW A;  2VKV A;  4I76 A;  4NEL A;  3TW7 A;  4XRM A;  2ECB A;  3BG9 A;  5FKM A;  2LFB A;  3W6V A;  3BT9 A;  3SFI A;  3JRI A;  3VOX A;  5F0F A;  5M3F J;  4A3M J;  4A3L J;  5C4J J;  1YRN A;  3LJL A;  3BCG A;  1GVD A;  2QF7 A;  3HTI A;  3GZI A;  1JKO C;  1BW6 A;  5JLW A;  3A01 A;  3S15 J;  3JRE A;  5FKL A;  1MH3 A;  3BR0 A;  4M3D A;  4D7N A;  3SJM A;  1NK2 P;  3RD3 A;  4A3I J;  4B3A A;  4A3J J;  2M34 A;  5IYB J;  1O4X A;  4A3G J;  5J1R A;  4HKU A;  1WH5 A;  1VFC A;  2DTZ A;  2XGC A;  3BG3 A;  2O8K A;  1XS9 A;  2R5Y A;  9ANT A;  2JWT A;  1ETY A;  3H3V K;  1WGX A;  4D5F A;  2FQ4 A;  5DS9 A;  2ID3 A;  5EDN A;  2G7G A;  2EZL A;  3G1O A;  5FLV A;  2QOP A;  2DA7 A;  2Q24 A;  1U78 A;  5C4X J;  4BKX A;  2WUI A;  2DA4 A;  1HDP A;  2R0Q C;  2WV1 A;  5EGO A;  1NTC A;  1A6I A;  4EEF G;  1QVT A;  2KT0 A;  4JYK A;  3AQT A;  2PMZ N;  5J1Y A;  4XID A;  2CJJ A;  2G3B A;  5FMP A;  1JKP C;  1S7E A;  2G0E A;  4C3I J;  1UG2 A;  4A3F J;  3NPI A;  4BY7 J;  3M3Y J;  4ABZ A;  2JJ7 A;  2GLO A;  1W0U A;  3A02 A;  2RHA A;  4JKZ A;  1SAN A;  2JMW A;  3GEU A;  5EEA A;  4XRS G;  3KNW A;  1TWA J;  1TWC J;  3A03 A;  2E2H J;  3NAU A;  2E2I J;  3L1P A;  3ANG A;  2FBQ A;  3BTC A;  1QRY A;  3LNQ A;  1JJ8 C;  2MSY A;  5CXI A;  2XPU A;  2KDZ A;  2DN0 A;  1B72 A;  3GTL J;  2NVT J;  3F1B A;  2EZK A;  3FK7 A;  5GP9 A;  5DTD A;  2DMU A;  3BNI A;  1RET A;  3VVX A;  3HTA A;  1AKH A;  3ZQI A; 
#chains in the Genus database with same CATH topology
 2TCT A;  4MIM A;  3RH2 A;  3EUP A;  4EVI A;  3LSJ A;  2FJ1 A;  3DWL E;  1FSE A;  3KP7 A;  2QA4 I;  3E5U A;  2OF7 A;  2RQP A;  3LQQ A;  3DEW A;  3WHB A;  5EFY A;  1QO0 D;  3QKX A;  4A12 A;  2ZME B;  3BCA A;  3KFW X;  1ONV A;  3I4M J;  2J5O A;  4IEJ A;  4A5M A;  3H92 A;  4F3Q A;  1WCM J;  3M8J A;  2HGC A;  2HI3 A;  3M1E A;  4ENM A;  5HDK A;  3V8L A;  1ZKG A;  3Q3S A;  5ICG A;  4NB5 A;  4CYD A;  1O3S A;  3M8F A;  2ISZ A;  4A2U A;  4MTD A;  4FE7 A;  4ENN A;  1JHF A;  3LOC A;  4BQO A;  3DKY A;  5D5V B;  3BHQ A;  2ME6 A;  3MEX A;  3VPR A;  3LSI A;  4ZC3 A;  2DO7 A;  3PQJ A;  4AID A;  1HA8 A;  2XAU A;  2CSO A;  2ZCW A;  2FOW A;  2M9H A;  4JL3 A;  3MKZ A;  3OYN A;  1FJL A;  4OMZ A;  5L3E A;  3T0Y A;  2E1C A;  3ECH A;  1SD6 A;  3CME I;  3RI4 A;  4WXD A;  3Q0V A;  2FNP A;  2HPI A;  1T98 A;  4DJA A;  3C7J A;  3ANP A;  2GAU A;  4XRF A;  1VTN C;  2MYS A;  4HBL A;  2PZ9 A;  3NS4 A;  2HYT A;  5HBU A;  3VP5 A;  1YIT I;  4UUS B;  4E7J A;  2W57 A;  1MBG A;  2HQA A;  2ZFW A;  1WFX A;  2HS5 A;  3FKJ A;  5CVI A;  2DJI A;  3CD6 I;  1T0F A;  4B8X A;  1HST A;  2DA2 A;  3QU6 A;  1LNW A;  3GZ6 A;  3HG9 A;  3RKW A;  4NN1 A;  1HBX G;  1S6L A;  3AG3 H;  3BG7 A;  2DXI A;  3H36 A;  1MIJ A;  3FBN B;  1E3P A;  2OTJ I;  4L5I A;  3BR1 A;  4HW0 A;  2VOP A;  2DT5 A;  2KDO A;  2M2E A;  2RAE A;  3GF2 A;  3H0D A;  4KWA A;  1BOA A;  1YW8 A;  4AVP A;  5K58 A;  1FIA A;  3NI7 A;  5HDN A;  4B1R A;  4IHS A;  3BPV A;  4BL0 B;  1TQP A;  5E8I A;  5KHD A;  3WGG A;  5HLT A;  5IP6 A;  2L2O A;  3CO7 C;  4QPQ A;  5HAW A;  2DG7 A;  2UXP A;  1FOY A;  2HXI A;  2K02 A;  4P55 A;  4ZDL A;  3A01 B;  4U0V A;  1P4W A;  4BY1 J;  2VQH A;  4BAC A;  4U0W A;  3M4O J;  1BJA A;  1MNM C;  5B5E C;  2NVX J;  2Z2S B;  4M3B A;  4RGS A;  1HOM A;  1OR7 A;  4PXI A;  4B48 A;  1J2X A;  3BZ6 A;  1WJD A;  2E1M C;  2M0M A;  3C2H A;  4RAF A;  4BEH B;  4XRS A;  4CIC A;  1N75 A;  3J7Y J;  3ZQC A;  4UB6 C;  1IN7 A;  4Y4R A;  1Y8R B;  2HOS A;  1HCR A;  1A6Q A;  2AXL A;  3S1M J;  1SAX A;  4DNC A;  4P96 A;  3DU5 A;  5FGL A;  2CU7 A;  4RGX A;  1WJF A;  5JR3 A;  1XGO A;  3BJ6 A;  2CW7 A;  1GV5 A;  4FCY A;  2V4J C;  3AG2 H;  3PUB A;  2ESH A;  1QPI A;  2UUZ A;  2C6Y A;  2RC4 A;  1FIP A;  4HV5 A;  2GM4 A;  4EMS A;  3TDU C;  4HF1 A;  3EQL F;  4HQM A;  4ZDO A;  2K3F A;  4M3F A;  1YW7 A;  3TP3 A;  3M9A A;  3BRO A;  4KN4 X;  1IN6 A;  2DFE A;  4RS8 A;  2Y0S N;  3WGI A;  4IPA A;  1MSE C;  4MXM A;  1IAW A;  4IX7 A;  1LJ9 A;  4RDU A;  3GFM A;  5J47 A;  3I0T A;  3C1D A;  2DBB A;  1Q1H A;  2DDB A;  1K4T A;  3L2W A;  3H3Z A;  2IS1 A;  3CJN A;  3IKV A;  2A05 A;  1B59 A;  3K2Z A;  5C4Y A;  5EYR A;  2R5Z A;  3K9T A;  2YUS A;  4C3J J;  1YIJ I;  2CQN A;  3LWF A;  2DMQ A;  3HEF A;  4KYW A;  2H6C A;  2KIF A;  4Y33 A;  1ON1 A;  4MGR A;  1J7K A;  1ZGJ A;  2YVX A;  1P7J A;  3M7G A;  2A07 F;  2DA3 A;  6PAX A;  5EEG A;  1XGS A;  4AWX B;  3GTM J;  4MTE A;  2QKO A;  1RKW A;  1RRJ A;  3BJO A;  3BTL A;  3HRT A;  4IHW A;  2NNY A;  1K6O A;  2CMP A;  2ZJ2 A;  3CES A;  2WAE A;  2QSH X;  3CCQ I;  2PMZ A;  5E18 F;  4XON A;  4DOZ A;  2VB6 A;  4XN3 A;  2COM A;  1I50 J;  2XRL A;  1U8B A;  1IRG A;  3K4N A;  3TBI A;  3JRG A;  3DPT A;  2K86 A;  5F0H A;  4JP0 A;  2VQC A;  4YEJ A;  5FJ8 J;  1MDM B;  2ICW G;  3BPX A;  3KZY A;  2XUB A;  4N9I A;  3ZMV A;  2CGP A;  2XDN A;  3K2A A;  3HTU A;  4D7M A;  4KA4 A;  4L5J A;  1UHM A;  3D5R C;  3GUD A;  3PSF A;  1TW3 A;  1F43 A;  3MZY A;  2VOD A;  5DD8 A;  3W2V A;  1X1D A;  2YU9 J;  5LD2 C;  2RQQ A;  5DCF A;  5BPI A;  5K7Z A;  1TW2 A;  2ZOZ A;  1PUF B;  2K9L A;  3SFZ A;  5HLI A;  3HOT A;  4HNV A;  2Z99 A;  5FRO A;  4DZJ A;  1JGG A;  3KP2 A;  5AQC A;  1SGM A;  3ZMZ A;  3DCF A;  2L7Z A;  1Y1V J;  1TC3 C;  2P0W A;  4M9Z A;  5ERI A;  1ZAR A;  1FP1 D;  3HRM A;  2K4B A;  1SFU A;  4EJO A;  2G7L A;  5IOZ A;  3ZXS A;  2DYS H;  4GFB A;  1QVU A;  4E4H A;  2HXO A;  4BE2 A;  1QA6 A;  2KFD A;  2ELK A;  5K1Y A;  3CF2 A;  2NVQ J;  4K2E A;  3ML6 A;  4I0B A;  2XGX A;  5FD6 A;  3U2R A;  4F93 B;  1VQ6 I;  5J8C A;  4GFK A;  2EFP A;  4NUB A;  3O60 A;  2FNA A;  2FBI A;  3DEU A;  2NNN A;  2A69 F;  2OBP A;  4U9L A;  2R3S A;  5E8G A;  2GZW A;  3W6K B;  4GXO A;  2O7T A;  5HVQ C;  5FGM A;  4WF2 A;  2KRF A;  3CCE I;  2YVE A;  3G6E I;  2HQ5 A;  2VBY A;  2Y2Z A;  2ZJP F;  2REK A;  4GCL A;  5GTH C;  1SVM A;  2CQK A;  1IZ1 A;  2QVO A;  3PSI A;  2RNJ A;  3SDB A;  2ZXJ A;  3AG4 H;  5E1X A;  4CHU A;  2V6C A;  2QGU A;  2JUC A;  4B09 A;  2QSG X;  1K61 A;  3BTI A;  4FTH A;  5FRN A;  3CCY A;  4WCG A;  1WZ2 A;  3BZK A;  1S29 A;  1MD0 A;  4U9N A;  4GCT A;  2QCO A;  3JR9 A;  2PFB A;  1OCT C;  3ABT A;  3OSF A;  3BR3 A;  4UVA A;  4IHV A;  1ON2 A;  1UFM A;  3WG7 H;  1OLT A;  5EF6 A;  4U0Y A;  1XN7 A;  3Q9S A;  4G12 A;  3VWB A;  3PFI A;  3F21 A;  1Z77 A;  1VQ5 I;  2Y0M A;  4R8H A;  1X1P A;  2QZ8 A;  4B4C A;  4X1E A;  2XAF A;  4BE1 A;  5E17 F;  5CPR B;  2L7M P;  3E5Q A;  1LUJ B;  4IRI A;  3O2P E;  3PO2 J;  1HKT A;  4JX5 A;  1J75 A;  2YVH A;  3KCC A;  2ECC A;  3ZQQ A;  3QAH A;  5AON A;  1ZRF A;  2LVS A;  4G7Z F;  2JPC A;  3KKC A;  4N4O B;  3RQ4 A;  1W1W E;  1YE9 A;  4UDS A;  3QQA A;  3H9G A;  1E3H A;  2WY7 Q;  1LFU P;  1W0T A;  2ZXW H;  1TBX A;  4NC6 A;  5HOO A;  3GX4 X;  3M07 A;  4HST A;  4RGR A;  2ZME A;  5D6F A;  2W48 A;  1KQ0 A;  3F9K A;  3FBI B;  1HKQ A;  2QQA A;  2CV0 A;  2D1H A;  3ZR8 X;  1ZEL A;  2LG4 A;  1NK3 P;  3LA3 A;  4Y3O A;  5KCM A;  3I56 I;  4A3K J;  3S1R J;  1FOX A;  1ZAO A;  2NAZ A;  3WU0 A;  1FTZ A;  5IOY A;  2Y9Z A;  3VW0 A;  2LYC A;  3ZN1 A;  3F8M A;  4Q47 A;  1OYI A;  3GWZ A;  4WIB A;  1W5T A;  3RZO J;  4PUS A;  3K6G A;  4DYC A;  3EUH A;  3GZ5 A;  1OQY A;  3LSK A;  5DYM A;  2JRM A;  3S16 J;  4Y13 A;  2JSC A;  2Z3Y A;  4M71 A;  5GPC A;  1XSV A;  3KLO A;  4B44 A;  4IQJ A;  2XHK A;  3JRB A;  3B6A A;  1V55 H;  2NXN B;  1D8K A;  2GXG A;  2JRT A;  1FMW A;  1YIO A;  1R00 A;  4UUS A;  3JRF A;  3UKG A;  1YW9 A;  2A61 A;  4YFX F;  5HNH A;  4UUV A;  2H27 A;  3KEY A;  1T2K A;  4UY8 I;  2KJB A;  2ZCM A;  3MN2 A;  4O6J A;  2R7U A;  1OCP A;  2QQB A;  3CMA I;  3CWR A;  4RB1 A;  3Q0U A;  5CVU A;  3B02 A;  1YTY A;  1I39 A;  2LF7 A;  5FKM A;  2ELH A;  3FXK A;  3SFI A;  2BOL A;  3JRI A;  4A3L J;  1IN8 A;  5C4J J;  1FYK A;  1A04 A;  4E7H A;  2WV0 A;  3L2U A;  3OL3 A;  3CCL I;  2A6T A;  2XKP A;  4HG2 A;  1F5T A;  1F9N A;  1D0X A;  3HXL A;  1FC3 A;  2EV5 A;  3A01 A;  3JRE A;  2H1L A;  1RC9 A;  4D7N A;  2JUG A;  3RD3 A;  3OYA A;  4UVC A;  3HSE A;  4A3I J;  2Z33 A;  2M34 A;  2VT2 A;  3H5N A;  3CC4 I;  1WH5 A;  1VFC A;  2DTZ A;  2L3D A;  2XGC A;  4MHG A;  1XS9 A;  9ANT A;  3I71 A;  4J00 A;  4F91 B;  3R0A A;  4BEH A;  3IWZ A;  1YX3 A;  2FXA A;  2WWY A;  2VN2 A;  3U1D A;  2DA7 A;  2DA4 A;  1HDP A;  2R0Q C;  1Z05 A;  4YIF A;  1NTC A;  1R1T A;  2VL8 A;  1NG6 A;  2H6B A;  2KT0 A;  5CJ9 A;  3K4M A;  5J1Y A;  2NRA C;  1JKP C;  1S7E A;  1LFP A;  2QM3 A;  1BIB A;  3Q5F A;  2MA3 A;  2MLG A;  2L9S A;  2HFH A;  4OOI A;  4BXU A;  1XMA A;  1UST A;  2X51 A;  3IKT A;  1SMT A;  4EM1 A;  2E36 A;  4JKZ A;  4CCK A;  5HS8 A;  4U7B A;  4GYG A;  3W2A A;  5EEA A;  5FB2 A;  5DUK A;  1BIA A;  4NHJ A;  3GO5 A;  2OUM A;  1D1B A;  3A03 A;  1TWC J;  2M1B A;  1MGT A;  2HKO A;  5B1B H;  2E2I J;  2FBQ A;  1MNE A;  2CW0 F;  2EV0 A;  3DU6 A;  2L7K A;  2ZJR F;  1QRY A;  4KFC A;  1YJ9 I;  2XPU A;  1G3Y A;  1W5S A;  2TDX A;  2F5F A;  3GTL J;  3F1B A;  4IF4 A;  2OZU A;  2H09 A;  4L9T A;  5F1R A;  4A0X A;  2PJP A;  1O7L A;  2KJC A;  2Q0O A;  2Z16 A;  3DKW A;  3I53 A;  4ACI A;  4KDP A;  2VLA A;  5F64 A;  4IRH A;  4LK0 F;  1ZGA A;  4E7Z A;  3JAM K;  2E2J J;  3G4S I;  5CW8 A;  4IQ4 A;  1OYW A;  2G7H A;  4PDK A;  1JE8 A;  5CXG A;  2HYG D;  1G3W A;  3FM3 A;  1X3U A;  2CFX A;  2DTR A;  1LQ1 A;  2XPW A;  2M3A A;  4HOB A;  3J7Z I;  1SFE A;  2DDA A;  2EQR A;  4DBR A;  2L0K A;  1IUY A;  1S9H A;  4E7L A;  4MNU A;  2YU3 A;  5D5U B;  3G1M A;  1MDM A;  3D5S C;  4NNJ A;  2RKH A;  3L2V A;  4IOC F;  2PJR B;  3HKZ N;  1Z3Y A;  1P6R A;  2CQ7 A;  3CJQ B;  3JAM Z;  3OMY A;  2FML A;  4P1W A;  4G7H F;  5B1A H;  5ICE A;  1OCZ H;  2EB7 A;  4R79 A;  1QZY A;  4ICH A;  2H1K A;  1R71 A;  3M1C A;  1TNS A;  2FBK A;  1EH7 A;  2KIM A;  2OTL I;  1KON A;  4TV7 A;  4GO1 A;  1OCR H;  2BW3 B;  5IT3 A;  3HRS A;  3J80 K;  2MC3 A;  1AHD P;  1S72 I;  2ZNY A;  1PUF A;  4BJ6 C;  4HYE A;  2EIK H;  2E60 A;  2XKO A;  2L02 A;  2KLO A;  2X4H A;  5CLS A;  2P4W A;  1MMS A;  1IDY A;  4MEY F;  2E5Z A;  2XSJ C;  4B47 A;  4DQ2 A;  2BGC A;  2IGN A;  1JKQ C;  4ZZL A;  4ENK A;  2HOT A;  3KKD A;  2JA6 J;  1X1B A;  1CF7 B;  2EWN A;  1Z6T A;  2LBF B;  2DYR H;  3GW2 A;  3E5X A;  1TTY A;  4QTR A;  2JA2 A;  2XF5 A;  3JTG A;  5GAH J;  5FKN A;  2KQR A;  1SAU A;  4LIT A;  5BPD A;  3DXJ F;  1SD5 A;  3RKQ A;  1VZ0 A;  2OD5 A;  3LSG A;  4L5E A;  1JI8 A;  1U9N A;  3DTK A;  3QBM A;  3MD2 A;  3QOD A;  2EZI A;  2JZY A;  4PSX A;  3J80 Z;  2M0C A;  2VQG A;  4PFO A;  2VE8 A;  1K78 B;  2BHY A;  3CCM I;  3FF5 A;  3KP6 A;  3HM5 A;  4ZJZ A;  3HSR A;  3RPU A;  3CCV I;  1VQ4 I;  4L0Y B;  1XMK A;  1OPC A;  3B6C A;  5FO5 A;  2UXN A;  2X6W A;  2JVH A;  3NRG A;  1VQM I;  1R5G A;  2QEN A;  3FIS A;  3HGY A;  3KYL A;  1KU2 A;  1MJ9 A;  2CO5 A;  4AC0 A;  3OYD A;  2RVC A;  3WU1 B;  3HPH A;  4M73 A;  5EZH A;  1I3A A;  3RKX A;  4AYB N;  2CWE A;  3SEQ A;  2VXZ A;  3F0C A;  3UNG C;  1UZC A;  2R7F A;  3K4B A;  1X2N A;  2GIV A;  4NQW B;  1H9T A;  3CCJ I;  2NS0 A;  3QYF A;  3V42 A;  2K4J A;  3DTE A;  2NVY J;  4RLQ A;  1OIS A;  4PJ0 C;  2OQG A;  2P8T A;  2ZCN A;  2W84 A;  1SVL A;  1DQU A;  1JT6 A;  1TQM A;  4YFK F;  5H2F C;  2M30 A;  2NOJ B;  1VQP I;  2P7V B;  1YO5 C;  1BI3 A;  1S8N A;  3S93 A;  5K5R A;  1LDD A;  1A35 A;  1IC8 A;  5KNL A;  4EGY A;  2QUF A;  2W00 A;  3MZH A;  4DGW B;  4DIQ A;  3V7S A;  4EGZ A;  2DOF A;  1JT0 A;  1QBJ A;  3LFU A;  1OCO H;  3ON2 A;  3B73 A;  3TOA A;  1MSF C;  1QHH D;  4XQF A;  1WH7 A;  3TDZ C;  4BBS J;  2VI6 A;  3HUG B;  3I59 A;  1XCB A;  2H8W A;  4YEL A;  2AQE A;  4FIS A;  2VJJ A;  1X19 A;  1KU3 A;  3ZOB A;  2F6C A;  1U2W A;  2CUF A;  4IVN A;  4XOR A;  5AIP A;  4D0P A;  1WJA A;  1TP4 A;  1YLF A;  5L3B A;  2MH9 A;  4C2U A;  2ZKZ A;  4O3M A;  2DT7 B;  4HQE A;  2UXU A;  2OV7 A;  1KQ9 A;  4ENJ A;  3BZC A;  1G8X A;  3RPU D;  1ZH5 A;  1FPQ A;  4M74 A;  1AKH B;  4OIQ F;  1FTT A;  4RGU A;  2VKH A;  1J9I A;  5E1Z B;  3W3C A;  4ZTF A;  3I3L A;  5BNG A;  4ZH4 F;  3HRU A;  4ON0 A;  3BRU A;  3K7A J;  5GTI C;  2PEX A;  4E7K A;  1UG0 A;  4I2O A;  1GXP A;  1MBF A;  2HU9 A;  4OAZ A;  3GFI A;  3ZQG A;  2QWT A;  4AIJ A;  3W2W A;  2X6O A;  3I58 A;  3O3K A;  1IV6 A;  3FHN A;  2PFV A;  1HLV A;  3GME A;  3ISP A;  3FXU A;  4LG0 B;  3V78 A;  2M45 A;  3OYL A;  2L54 A;  3FM5 A;  4Q4Z F;  5TRD A;  2CV1 A;  4RAY A;  4HRI A;  4A6D A;  4QWQ A;  4IO9 F;  1QGP A;  3OIP A;  2KIU A;  3W6J B;  1B4A A;  3CZ6 A;  1ZGW A;  4HDV A;  1X3W B;  4CO8 A;  1B8I B;  5LRR A;  2MG4 A;  3LAP A;  2EZH A;  4GGG A;  2F5D A;  2Y0S A;  1QZZ A;  4GFL A;  1Y1W J;  3I54 A;  3EPZ A;  4YRV A;  4H0E A;  3KLN A;  5D19 A;  3G73 A;  3AAF A;  1U5T C;  3I4N J;  1ZQ3 P;  3DBH B;  3I4P A;  5ILV A;  2HYJ A;  3HOZ J;  5B66 C;  2LNB A;  3CP2 A;  1O3Q A;  2L9R A;  3K4L A;  1LVA A;  3CUQ C;  3RPQ A;  4YII A;  2E1M B;  4J19 A;  3NQO A;  4I01 A;  1KGS A;  3ELK A;  5LRS A;  1LDJ A;  3PJR A;  3KYC B;  1D3Y A;  1U0J A;  3F8F A;  4KT6 A;  2DMN A;  1ULY A;  2DOE A;  3EYY A;  2NS8 A;  2KHM A;  1CQT A;  3IWF A;  2BVM A;  5D4S A;  5GAD J;  3CMY A;  2FUG 2;  4RAG A;  3IP4 B;  1OKR A;  1UHS A;  3OY9 A;  1T8I A;  1E0E A;  3QOE A;  4HV6 A;  5DDG A;  1QU3 A;  2QBY B;  3RQI A;  1BN5 A;  2IVM A;  3DLL F;  1JJ6 C;  1V5F A;  1YYV A;  3WHC A;  3S14 J;  4A5N A;  3TOB A;  2A6E F;  1S3J A;  2CUJ A;  1WJB A;  3IRR A;  2E35 A;  4OWR B;  3G56 A;  1HW1 A;  2DFH A;  1BC7 C;  2XAH A;  4FHT A;  5E3O A;  2H8R A;  1DGR M;  4CUG A;  4IL6 C;  3AG1 H;  2N8G A;  4CCL A;  1BJZ A;  2R7Z J;  2B3W A;  4IHY A;  3OYM A;  4BGD A;  1KYW A;  1FY7 A;  4ESB A;  2OCC H;  4PZJ A;  2QKM B;  2HZD A;  1Q1V A;  2Y30 A;  5E20 A;  1XCV A;  3I5U A;  4XKV A;  2K9S A;  2LH9 A;  5EG0 B;  3WTT C;  1WVR A;  3EDP A;  4XM3 A;  2W4S A;  2I10 A;  2P5V A;  4BDY A;  2VON A;  3QOP A;  1GHC A;  1SVO A;  2OER A;  2HPM A;  1JUS A;  4MQV A;  1ODD A;  1MJA A;  1TWH J;  2HKU A;  2JTV A;  5JHF A;  4XN0 A;  3QPS A;  4S04 A;  2GXA A;  4XLF A;  3FZV A;  3GLL A;  4L9J A;  2FRH A;  1GT0 C;  2L4M A;  1ZN2 A;  1Z6R A;  3QYB A;  2ZCX A;  2B63 J;  4UB8 C;  2BVL A;  1BI2 A;  4PJN A;  1I3Q J;  2R7X A;  1BR2 A;  3MKY B;  4IHX A;  3A2K A;  3VYU B;  1F4K A;  4CSW A;  2HEO A;  1YS6 A;  2OU2 A;  2VKD A;  3KYD B;  4BXX J;  1NH3 A;  3TL4 X;  4MEX F;  1YOV B;  2RAS A;  1K6Y A;  4BHB A;  2LDU A;  5GAG J;  1HC8 A;  4EM0 B;  2BYV E;  3RJP A;  4I6Z A;  2A68 F;  4KT5 C;  3MNL A;  2PBX A;  4M72 A;  4AUX A;  1RR7 A;  1TQI A;  2OC6 A;  4MFD A;  1ZLK A;  2QQ8 A;  3VVZ A;  2ISY A;  1HDD C;  4BQA A;  3K1M A;  2IT0 A;  3SZP A;  2CQQ A;  4V2F A;  2XAS A;  1MBK A;  2R92 J;  1P92 A;  2ZC2 A;  4ITV A;  4RA2 A;  2VUM J;  3CC2 I;  1LEB A;  1RIO H;  1KQ8 A;  3GFJ A;  1D0Z A;  2PJR A;  5CVV A;  1UCR A;  2LRD A;  3LFK A;  2DMP A;  2VE9 A;  4CCJ A;  3TGN A;  2G7S A;  3QPH A;  1ETK A;  1W7P B;  5LLQ A;  2O6G E;  1X1A A;  5ILU A;  3HHG A;  4EJU A;  1FP2 A;  4HNU A;  4XSX F;  3AKZ A;  3RZD J;  1FZP B;  2GEN A;  3GFL A;  2LSO A;  2VC1 A;  4HX8 A;  1A31 A;  2BW3 A;  2D2W A;  5D6E A;  2J5P A;  3E97 A;  5F04 A;  4F52 A;  2VJI A;  3RYP A;  2XDV A;  1F36 A;  3LWJ A;  4S0H B;  3P9T A;  2HVR A;  1XTA A;  3K70 C;  4Z6Y A;  3H9Q A;  1Y0N A;  4KNY A;  2Q2E B;  1BR4 A;  1RKT A;  1CF7 A;  1W5C C;  1ETW A;  1X4P A;  2LBF A;  2VKV A;  1FBU A;  2WA0 A;  3VTI A;  3ASN H;  2ADU A;  2ELJ A;  4LGW A;  3W6V A;  2ZXI A;  2B9S A;  4WX9 A;  3BP8 A;  1HSJ A;  3OIQ A;  5F0F A;  5M3F J;  5HDG A;  1ZLJ A;  4BUP A;  1FT9 A;  2E7X A;  1GVD A;  1SFX A;  3OR1 C;  3HTI A;  2MH2 A;  4IRV A;  2AS5 F;  2E1N A;  3GZI A;  4KMU X;  4BNC A;  1TNT A;  3F23 A;  3MZ8 A;  1MH3 A;  3OR2 C;  4M3D A;  4IKF A;  3OWT A;  1NK2 P;  3WU2 C;  4OMY A;  2JPB A;  4O5V A;  4BQN A;  3ZPL A;  2XAG A;  5H6R A;  1K79 A;  2KZV A;  2JWT A;  3EYI A;  1P9Q C;  5DS9 A;  1Y56 A;  1DUX C;  1IV8 A;  2CS3 A;  1HW5 A;  2EZL A;  1I6X A;  5FLV A;  5FFZ A;  2HVQ A;  2KPM A;  5C4X J;  1AWC A;  1Z1D A;  2WV1 A;  4XR6 A;  1A6I A;  4EEF G;  2V9K A;  3AQT A;  3QP5 A;  2PMZ N;  5ILS A;  3RDI A;  5EEH A;  1L3L A;  1RNL A;  2CJJ A;  3VFZ A;  3PIP F;  2G0E A;  4LIV A;  4A3F J;  4E7I A;  2EIN H;  3VSK A;  1MMG A;  5CKT A;  2XAJ A;  4BU2 A;  2F5V A;  2JJ7 A;  1YQA A;  5J6X A;  1W0U A;  3SHF A;  5HLH A;  3A02 A;  2RHA A;  5L3C A;  1B6A A;  1OMI A;  2RV8 A;  2L4A A;  1S5L C;  3KNW A;  1TWA J;  3I9V 2;  2IGK A;  3ERM A;  2DAO A;  2M8E A;  3KE2 A;  4L18 B;  3HUG A;  4XOT A;  3FXM A;  2OJE D;  3BTC A;  4XKC A;  5LHI A;  1G59 A;  4XOP A;  1VQ7 I;  1OYY A;  1JJ8 C;  2RNG A;  3VSL A;  2KDZ A;  2WAD A;  3AL0 C;  2DN0 A;  3R60 A;  3Q9V A;  1YI2 I;  5JHU A;  2NVT J;  2EZK A;  3MCZ A;  3BNI A;  1RET A;  1VQ8 I;  3HTA A;  1AKH A;  2STT A;  3CCR I;  1I1G A;  2HYF A;  4CH7 A;  4CCM A;  3TQN A;  2CUE A;  2W82 A;  4II3 A;  1JUP A;  1VND A;  2R7Q A;  5D1R A;  1MBH A;  1FLI A;  1FX7 A;  1EV7 A;  2LK2 A;  4GCV A;  4HX7 A;  1MMD A;  3RYR A;  3G2B A;  2VJ4 A;  2W53 A;  2VBW A;  3OOU A;  3RSN A;  4DYQ A;  1E17 A;  4UNO A;  1IG7 A;  4CCN A;  1MND A;  2HQN A;  2PN6 A;  3IAS 2;  4PGH A;  4Z2Y A;  2COB A;  5EJC A;  3PIO F;  2M7A A;  5M3M J;  2PQ8 A;  4RMN A;  2XRO A;  1T95 A;  1YS7 A;  1WWX A;  2NS7 A;  4XKW A;  3F6O A;  3VW1 A;  1W36 D;  1VQK I;  1T6S A;  2CRG A;  3MMY B;  2JVG A;  4P9U A;  4HEA 2;  3CQZ J;  3IUO A;  5FFX A;  4C3H J;  2K7L A;  3B81 A;  3HOU J;  4G9Y A;  1Z67 A;  1TWF J;  1B8I A;  3GTQ J;  5D4R A;  3SWH A;  3PNT A;  3KET A;  2CW8 A;  3ZMD A;  2UXI A;  5L3G A;  2Y69 H;  2X48 A;  3WTS C;  3EGQ A;  2L9V A;  2NVU B;  1D5V A;  3CJT B;  3T6N A;  5HSZ A;  4EM2 A;  1WKM A;  5DCM B;  4BHP A;  4PJJ A;  4C9Y A;  1NHA A;  2DA6 A;  1DU0 A;  2YX4 A;  1LDK B;  2X0L A;  5ED4 A;  4JNN A;  1HXD A;  2K85 A;  4HF2 A;  3FXO A;  3E6B A;  2DLL A;  3BR5 A;  3WE2 A;  3HB9 A;  3R4K A;  3GVA A;  2QSF X;  3S1N J;  5FHP A;  1OJL A;  3DPU A;  5BS6 A;  1OCC H;  4NC7 A;  1U3E M;  3FDY A;  3PQK A;  3VEP A;  3RTR A;  1H8A C;  2STW A;  3HTS B;  1YRN B;  2RRE A;  4M9S A;  3HHH A;  4IRG A;  4I99 C;  2FMY A;  3Q0W A;  1LPQ A;  1ERD A;  1J59 A;  1UB9 A;  1OFC X;  4BS9 A;  2NP3 A;  4V19 K;  1Z7L A;  1Z0X A;  2O7O A;  2CQX A;  4M6V A;  2WB1 N;  2QBY A;  1UI5 A;  3JRC A;  3FXJ A;  3QPL A;  5KAI C;  3ESW B;  1IGN A;  4LB6 B;  4HF0 A;  3JSP A;  3LA2 A;  3WTZ A;  1SFO J;  1T0F C;  1HW2 A;  4Y15 A;  5LHG A;  3QP6 A;  3PNV A;  3ZCO A;  1SFK A;  4RLF A;  2R5Y B;  2VKE A;  2WGB A;  3GTO J;  1R22 A;  4E6K G;  2EJR A;  4II2 A;  4RB2 C;  3ERE D;  1J09 A;  3RCO A;  3HKZ A;  3BC8 A;  2WAQ A;  3JSO A;  4HLY A;  3DLA A;  1IXC A;  1ZRC A;  2IBD A;  2GQQ A;  1N77 A;  1Y39 A;  3TO9 A;  5IY5 H;  2LC2 A;  2O9L A;  1ENH A;  3S3O A;  4M6Y A;  1GV2 A;  5EG0 A;  1GXQ A;  1UAA A;  5KVR A;  3VW2 A;  3OYE A;  3LST A;  4I7H A;  4KN7 X;  3HOS A;  3QRF F;  2OPT A;  4G8X A;  2ESN A;  1QNT A;  3A0H C;  1XC5 A;  3OYJ A;  4BJT A;  4ETS A;  4HAM A;  1Z7U A;  1OR7 C;  2X1D A;  4A69 C;  3GTK J;  2VBZ A;  4AIK A;  1Y6I A;  3QPT A;  4P9F A;  1FYL A;  2FJI 1;  3OOP A;  1SD4 A;  3BDD A;  1EH8 A;  1MJB A;  2F07 A;  2BV6 A;  1CGP A;  5BQT A;  2Q8K A;  1ZRE A;  2DI3 A;  1IDZ A;  1IJW C;  3ZP5 A;  1B72 B;  2NP5 A;  1JUM A;  3LQR A;  1V5E A;  3MFK A;  2DU9 A;  3GYH X;  2X6Y A;  1TZL A;  2M4G A;  1ETV A;  4D9J A;  5LBQ A;  2FX0 A;  3E6M A;  2HOA A;  2FBH A;  2UV1 A;  2IS6 A;  2R7D A;  2ZBK A;  3H3U A;  3FMR A;  4XL9 A;  4U88 A;  1FBQ A;  3PPB A;  4L0Z B;  3NNR A;  2LTP A;  3S3N A;  1U8R A;  1XPX A;  3K69 A;  4UUT A;  4BXF A;  2V1X A;  2MW8 A;  3TKY A;  2XSD C;  4GCK A;  2IPQ X;  1DPU A;  3PNY A;  1Z91 A;  4HX4 A;  1LB2 A;  2HDC A;  3GTG J;  3E1S A;  3V4G A;  1LE8 B;  3IV5 A;  2FSW A;  2ZSI B;  5EZG A;  2CFO A;  1W7P A;  2W25 A;  3REO A;  1R5H A;  2KL4 A;  3E3V A;  5HS9 A;  2L01 A;  2M8G X;  2MGQ A;  2KRH A;  2R7R A;  1PDN C;  3RKY A;  2XC7 A;  3K4K A;  4KJZ A;  3PL8 A;  5A2Q K;  3GTJ J;  4Q48 A;  1LEA A;  2PLY A;  2DT6 A;  5GAE J;  2VBX A;  3QWL A;  3H9J A;  5JLX A;  2LRE A;  2BXZ A;  4NC8 A;  3VIB A;  3ABM H;  4EV0 A;  4EJT A;  3VYT B;  4BJ5 C;  4LFU A;  3SYT A;  2XF7 A;  2HQR A;  3OSG A;  2BY0 A;  5D8K B;  2Q2E A;  3HDD A;  4AC6 A;  3ULQ B;  4Q5S F;  5CVR A;  3G3Z A;  4FX4 A;  4BE0 A;  4JX4 A;  1H89 C;  2JA8 J;  4GRI A;  3GTP J;  1WJ5 A;  2MLK A;  3KEQ A;  4RM2 A;  1T08 B;  4AF5 A;  3EUK L;  2DOA A;  1M1E B;  2DG8 A;  4BBR J;  4LB5 A;  3FXL A;  1WJE A;  4IOA F;  1R1V A;  5A2Q Z;  3LL7 A;  2IA1 A;  1ZG5 A;  2MC4 A;  4PCQ A;  3LSH A;  2EA2 A;  1RUO A;  1IRX A;  1HKS A;  2V26 A;  4EJW A;  1I1S A;  4L9N A;  2DPD A;  3S1Q J;  4A93 J;  4Y52 J;  5C44 J;  4I09 A;  1BI0 A;  3PM1 A;  1PJR A;  3L2R A;  3OS0 A;  3U9G A;  4ZDP A;  4CYC B;  3J81 K;  3HBL A;  3DEE A;  1H9G A;  5HLG A;  4ZYH A;  5JVT A;  3HE0 A;  2DW4 A;  2GOX B;  2IJL A;  3EET A;  4B3X A;  1Y0U A;  1W7P D;  3NWT A;  2GBY A;  3WTX C;  1APL C;  4M3G A;  1I6H J;  3GZN B;  1KZH A;  3LAJ A;  2VPR A;  2KRC A;  2YS9 A;  3C07 A;  4YZE A;  2I5U A;  4FE4 A;  3HOY J;  2X1E A;  4W97 A;  1R7J A;  3TW6 A;  3G7R A;  1R58 A;  3K10 A;  4DBQ A;  3IL2 A;  2B0L A;  5K7F A;  5J8F A;  2V9P A;  4NDL A;  3J81 Z;  4G6D A;  2FE3 A;  3IH3 A;  4M3E A;  3OS1 A;  4F55 A;  1LKX A;  1B1B A;  4C30 A;  2VT3 A;  5FRM A;  4CZC A;  2IAI A;  3JRA A;  1XDS A;  1YJN I;  5LGN A;  2DJN A;  1X58 A;  3WOD F;  2R4G A;  4V2G A;  1K7A A;  1NG7 A;  5IPA A;  2BY2 A;  5J40 A;  3WTW C;  1IF1 A;  3N05 A;  2V1U A;  3BJB A;  2F5E A;  4BDZ A;  3LSP A;  4C2T A;  2W85 A;  2Z5U A;  2A5Y B;  2PBI A;  4LIU A;  4EAT A;  1A5J A;  5M5X J;  1XDU A;  2E19 A;  4XBF A;  2QKL B;  1FMV A;  1MMA A;  2LY2 A;  2ACJ A;  5K7H A;  4LJZ F;  1ETX A;  3O8G A;  2EIM H;  2L5Q A;  4WK8 F;  1ZG1 A;  4WXC A;  4HLX A;  3S8P A;  1P7I A;  1U6G A;  1WQ2 A;  2H94 A;  2WY8 Q;  2XAQ A;  3L09 A;  3NAR A;  2OAZ A;  1UEL B;  1X4O A;  5IYD J;  1K83 J;  2BZT A;  2DK5 A;  4ESF A;  3HIF A;  1ETO A;  3I64 A;  4N9H A;  1H88 C;  4LLN A;  2VPL A;  3KZ9 A;  4BYY A;  2YPR A;  3ZN0 A;  4HSR A;  3S2H J;  4ZYA A;  3GCM A;  2EK5 A;  1UMQ A;  2LR8 A;  4XMY A;  2IRF G;  1RZ4 A;  1WRJ A;  4C2M J;  1D5Y A;  1Y8Q B;  2KKO A;  1K4S A;  2VXD A;  3S32 A;  1U5T B;  1P4X A;  1QHG A;  3DFG A;  4LOC A;  1IRZ A;  1TL8 A;  5DAJ A;  5J3L A;  2K40 A;  2ZME C;  1IRF A;  1QZE A;  1BM9 A;  2CUZ A;  4I02 A;  3SDG A;  3CUQ B;  3HPG A;  1G3T A;  2LD5 A;  4CGR A;  2FQ3 A;  3KP5 A;  2DFI A;  4PGG A;  4JOM A;  4RBO A;  3JTH A;  3VOK A;  5DCM A;  3IAM 2;  3CMM A;  2HR3 A;  1JKR C;  3VOD A;  3F6V A;  2B1E A;  1UI6 A;  3BR6 A;  2V79 A;  3FHZ A;  1RES A;  2M4K A;  2XGE A;  1P2F A;  4L9V A;  2XV4 S;  3BOQ A;  4ZTJ A;  5DM6 F;  3KPH A;  4XRM A;  3J7A Y;  1R6R A;  2DCE A;  3BT9 A;  3EUH C;  1BOB A;  1IO2 A;  3MAJ A;  3VOX A;  4XLA A;  1YRN A;  3KZZ A;  3T8R A;  1RUN A;  1AOY A;  3BCG A;  5JFR A;  1FWZ A;  4LLG F;  1IXR C;  2FF4 A;  1V4R A;  3MQ0 A;  1KA8 A;  5D5X B;  2QYO A;  3T5X A;  3BJA A;  1JKO C;  1IW7 F;  3VOE A;  1R1U A;  1BW6 A;  2X1C A;  3F8N A;  5F6F A;  5D8L B;  5JLW A;  3S15 J;  3BR0 A;  2MBF A;  3TO6 A;  2G7U A;  4B3A A;  5IYB J;  1O4X A;  2MAB A;  2ETH A;  4PSW A;  2P6T A;  2O8K A;  2EA4 A;  3KP4 A;  2KIS A;  3A0B C;  4RB3 C;  2R5Y A;  1ETY A;  4M9X A;  4KIS A;  1PP8 F;  1WGX A;  4D5F A;  2FQ4 A;  3V8J A;  1R4N B;  3IHU A;  3NWS A;  2YX7 A;  4WWC A;  2CYY A;  3FWE A;  3G1O A;  1FYM A;  4UXN A;  2P6S A;  4M6X A;  2WAF A;  2V7F A;  4LMY A;  1P4A A;  2M7B A;  5DUI A;  5LGU A;  4BKX A;  2WUI A;  5L3D A;  2HNH A;  3CUO A;  3F72 A;  1IN4 A;  1XGN A;  2X85 A;  4JYK A;  2A3S A;  4XID A;  4UHT A;  1WI9 A;  1T39 A;  4QLC U;  5FMP A;  2BBY A;  1UG2 A;  2JSP A;  3NPI A;  2EIL H;  3H35 A;  4BY7 J;  3CCU I;  3L2C A;  3M3Y J;  2OQR A;  4I98 B;  2OCE A;  4ABZ A;  2GLO A;  4AM3 A;  4XLC A;  3HSF A;  1QPM A;  3ROU A;  4PK4 A;  1ZG3 A;  2GA1 A;  2IW5 A;  4LLL A;  1SAN A;  2JMW A;  3L00 A;  1TT0 A;  4FET A;  3OYK A;  1JHH A;  2E2H J;  3BLY A;  3L1P A;  3ANG A;  1D1C A;  2KZG A;  3ZQ7 A;  2O8X A;  3G71 I;  4JBA A;  2O3F A;  5TGT A;  1B72 A;  4S05 A;  2GXB A;  3FK7 A;  5GP9 A;  2DMU A;  3ZMT A;  4I0A A;  2EV6 A;  3VVX A;  2KMU A;  3ZQI A;  4D1Q A;  4HDU A;  1R49 A;  3JRH A;  4CZZ A;  3C2B A;  1JXS A;  2P5K A;  1V3F A;  4IXA A;  2RN7 A;  1R36 A;  3P9K A;  5F1J A;  4FAS D;  2JT1 A;  3ZMS A;  1GVJ A;  2Y31 A;  3C2G A;  1AU7 A;  2QIB A;  4DVY P;  5F27 A;  1T38 A;  2BXY A;  3JRD A;  3O8H A;  2RDP A;  4Y17 A;  2XRN A;  1XGM A;  2FA5 A;  2K5C A;  3VDX A;  4LD5 A;  1HF0 A;  3ZMU A;  1MBE A;  2G9W A;  3HGG A;  2LOO A;  5B3S H;  4ESJ A;  1DP3 A;  3QU3 A;  5E3M A;  3ZQF A;  1A36 A;  3LSM A;  1LE8 A;  1E2X A;  4XKB A;  4Y7N J;  1YJW I;  1ZRD A;  3H0G J;  2K3P A;  3GEZ A;  2Y9Y A;  1X3Z B;  2GUH A;  3COA C;  1XSD A;  2DPU A;  1L0O C;  2LKX A;  2EBI A;  2RGV A;  3DF8 A;  4XLN F;  2DOD A;  2HKX A;  2X6X A;  1DU6 A;  3WTV C;  4OD5 A;  2P5L C;  2LMD A;  3GLX A;  5J1U A;  5LGT A;  2DQL A;  2W7N A;  3F22 A;  2E1O A;  5H20 A;  5BOX A;  1BL0 A;  3DQV C;  5LFA A;  3SQN A;  2V9V A;  3HTJ A;  3BTJ A;  3RIR A;  2UXH A;  2ZNZ A;  3ZQH A;  3C18 A;  5ICC A;  2LY9 A;  3E7Q A;  3BQY A;  2K27 A;  3R61 A;  2V1D A;  1O57 A;  3LMM A;  4JQF A;  1XSX A;  4HNT A;  3JCU C;  4JK1 X;  1H0M A;  1DPR A;  3CLQ A;  4OIR F;  3CDH A;  4XLH A;  2ME0 A;  2EFN A;  3F3X A;  1K78 A;  4PJL A;  4XSZ F;  3DP7 A;  1YG2 A;  2E7W A;  2R7T A;  5K5O A;  1O3T A;  3K8P C;  1UHW A;  4UVB A;  4ME9 A;  1GUU A;  3DKX A;  4LG3 A;  2OI8 A;  4XIC A;  2DMT A;  3A1Y A;  3DPL C;  3DBL B;  1USS A;  4MLO A;  1B9N A;  3NEU A;  1C0W A;  3HZJ A;  2HDD A;  4G6T B;  1T56 A;  4G7O F;  3LHQ A;  1KU9 A;  4G94 A;  3BG5 A;  3FMS A;  4H4K C;  2YSR A;  3IH4 A;  1R5I D;  5M5Y J;  1IXS B;  2R93 J;  2ZJQ F;  2IA2 A;  3FIW A;  4CYC A;  4A3B J;  4MQ9 F;  1IUF A;  1SMY F;  5LEK A;  5H9T A;  5E3N A;  4NQW A;  3CC7 I;  4IHT A;  1V5G A;  2XVC A;  4AIH A;  3P9I A;  1ZR4 A;  1MZB A;  2GIZ A;  2A2F X;  1AA7 A;  3D1N I;  5M5W J;  3LA7 A;  3DV8 A;  2IGO A;  3IH2 A;  4MFE A;  1SD7 A;  3K4C A;  2R7S A;  2IXS A;  3OYI A;  3HOW J;  3BG6 A;  5IT9 K;  5EGO B;  1FOW A;  2K9N A;  4KMF A;  4G6Q A;  1BA5 A;  2QWW A;  2Z1D A;  2KIQ A;  1KYZ A;  4F7Z A;  3AL0 B;  3T1B A;  3V7R A;  4ZYD A;  2BY1 A;  2JK3 A;  2TRT A;  5CVJ A;  2E5N A;  2VOO A;  1N78 A;  4E7S A;  3HOV J;  3OIO A;  3SZT A;  2LKP A;  2D5V A;  2WBM A;  2EIJ H;  1PP7 U;  5CQE A;  3S17 J;  4N0B A;  4A3D J;  4ANJ A;  2F4M B;  3KX2 A;  5ICF A;  1GDT A;  1EKE A;  1HQC A;  4OIP F;  1BI1 A;  4XLP F;  3J7A O;  3HOX J;  5IT9 Z;  4XLE A;  1D8J A;  2EH3 A;  1X1C A;  1ZK8 A;  2L7F P;  4B43 A;  1MBJ A;  5D5W B;  1ORK A;  2IEK A;  5HNF A;  3M8E A;  1S7A A;  2JQ7 A;  2DA1 A;  3TED A;  3TO7 A;  4U7D A;  2PI0 A;  3I59 B;  2ZB9 A;  3HL2 A;  5LEJ A;  2QLZ A;  1J0R A;  3FXR A;  5FLX K;  2ZOY A;  3LSR A;  3G1L A;  2WB1 A;  5IP7 J;  5DM7 F;  2W1O A;  1ITY A;  3E6C C;  3IUV A;  2V1N A;  3K0L A;  1BR1 A;  4OD4 A;  2XPV A;  2IA0 A;  3SEZ A;  4BAY A;  4AU7 A;  5HS7 A;  2EFW A;  1WHU A;  1XMX A;  1PYV A;  4A3C J;  1S7O A;  4LG0 A;  4KIF A;  1RI7 A;  1XB4 A;  2VAS A;  1SEU A;  2LLK A;  3FRQ A;  3S5R A;  1U9O A;  3KEO A;  2XB0 X;  3DTI A;  5FLM J;  1FEX A;  1N25 A;  3EUA A;  2Y75 A;  3H5R A;  3K1P A;  5C3E J;  3V7C A;  1V54 H;  1RPW A;  4XK4 A;  5F0C A;  2F4O B;  1U5T A;  4RB0 A;  4J01 A;  4W1U A;  5FLX Z;  3TP0 A;  1YFH A;  2KP6 A;  2AO9 A;  1WPK A;  3AFH A;  3ONQ A;  3TMO A;  3SXY A;  2I8D A;  3D5L A;  5GPA A;  1D0Y A;  3L7W A;  4L62 A;  2AHQ A;  3F8C A;  2R7W A;  2XGD A;  3VVY A;  4EQQ A;  1QQI A;  3OYC A;  1TLH B;  1POG A;  2HWV A;  3CUQ A;  3WGH A;  5IYC J;  2XF6 A;  1MW7 A;  4RM3 A;  1TWG J;  3CJD A;  2F2E A;  4HZF A;  1BBY A;  4BHC A;  3CDI A;  4KIC A;  1T33 A;  4XNF A;  3WTU C;  4CGZ A;  3A4C A;  1DGW Y;  4QSH A;  3PO3 J;  1JTX A;  1ETQ A;  2VIX A;  3VYR B;  5AIQ A;  3HYI A;  3WTY C;  3D0S A;  4CA0 A;  4X0G A;  1MKM A;  2GA2 A;  1G2H A;  2FD5 A;  2HDW A;  2LF8 A;  4MO7 A;  1MMN A;  2VC0 A;  2XB5 A;  3SZG A;  3U21 A;  1WSU A;  2L9N A;  4F92 B;  1RR8 C;  3ABU A;  2QTQ A;  3CLO A;  3KP3 A;  3PFY A;  4BQQ A;  1O7F A;  1VF9 A;  1D1A A;  2IS4 A;  4DYR A;  2CG4 A;  4JX6 A;  3OL4 A;  1GLN A;  4KIG A;  5FKO A;  5HOD A;  4OIO F;  3AQS A;  3P9C A;  4CDG A;  1STZ A;  2BY3 A;  3MVP A;  3KZI C;  1ZR2 A;  1VQL I;  3GXO A;  3E7L A;  3K4J A;  1VQO I;  2O0Y A;  2EFQ A;  3PAS A;  3N4M A;  2WC2 A;  4DZP A;  2HVS A;  3V6G A;  2Q1Z B;  2LP0 A;  3CP8 A;  4OU0 A;  5K5Q A;  1J5Y A;  2GWR A;  3F8B A;  1MH4 A;  3QYE A;  3OYF A;  2E34 A;  2JN6 A;  2HTJ A;  5E3L A;  2IU5 A;  1SC7 A;  5D18 A;  4PFP A;  4YG2 F;  3E6D A;  3ABL H;  2DA5 A;  4QIW N;  5DV5 A;  2QQ9 A;  1E3O C;  3ON4 A;  2LKS A;  3NRV A;  2EPF A;  2HTS A;  2ZO4 A;  1XX5 A;  4MK6 A;  2K9Q A;  2P81 A;  3JSJ A;  4A0Y A;  2PMU A;  3CDL A;  4R1H A;  3I55 I;  2ZY9 A;  1G3S A;  1Z21 A;  3DBR B;  3L2Q A;  3ECO A;  3OS2 A;  4ZYG A;  3CO6 C;  2BE5 F;  1JGS A;  3WE3 A;  3JW4 A;  5F08 A;  2Z9O A;  4PJM A;  1XD7 A;  1I5Z A;  3S2W A;  4EJV A;  4IJA A;  1TT5 B;  3BQZ A;  2NX4 A;  1LFB A;  3ZRG A;  4FT8 A;  3MWM A;  3NXC A;  1VQN I;  2JA5 J;  2VJ5 A;  3OYG A;  3CCS I;  4CXF A;  2VQL A;  3CRJ A;  2F5C A;  4LK1 F;  2D6Y A;  1LVK A;  2HZT A;  2W24 A;  3BY6 A;  4GDF A;  3ZQL A;  1ZTR A;  3DPJ A;  1BW5 A;  3GBG A;  1R23 A;  3VUQ A;  3FK6 A;  4YIR X;  3C3W A;  2R5Z B;  2UXO A;  2EFO A;  3UR3 C;  5L3F A;  2O5R A;  1EJ9 A;  2PX9 A;  4YFN F;  4ZZD A;  5DEQ A;  3X2Q H;  3VB2 A;  2ID6 A;  3MKL A;  1ZHF A;  3OV8 A;  3PUF A;  5CYV A;  1X2M A;  2V57 A;  5E79 C;  3H5A A;  2OZ6 A;  4KIB A;  4DW6 A;  2GFN A;  3FKI J;  5TIS C;  4QPO A;  1VQ9 I;  4AYB A;  1EF4 A;  2PMH A;  2DFF A;  3BR2 A;  3HTH A;  2BEO A;  1R4M B;  3V8K A;  3COL A;  2JA7 J;  2X9D A;  3S2D J;  2R7O A;  4A3E J;  1FNN A;  5FKK A;  2O61 A;  1XG1 A;  1EH6 A;  5H6Q A;  1R9T J;  2FEZ A;  4X6A J;  3T8T A;  2ZSH B;  3KIO A;  2F48 A;  3HIM A;  3R6S A;  1YHQ I;  3L9F A;  4RAZ A;  3VYS B;  2NOG A;  4D5C A;  4N4N B;  5TJJ A;  2QEX I;  5JVG F;  3OYH A;  2A5W A;  5DD4 A;  5KAF C;  2LY1 A;  4BH9 A;  1VI0 A;  2M5W A;  4OAY A;  4ZYE A;  2WAQ N;  5J4Y A;  2MD0 A;  3ABK H;  5IP9 J;  3FX3 A;  2IS2 A;  1WI3 A;  2XIG A;  1JTY A;  2M87 A;  1PVE A;  3ASO H;  2UWM A;  4UV8 A;  1FSH A;  3CJR B;  4A6E A;  4I76 A;  4NEL A;  3TW7 A;  2ECB A;  2IP2 A;  4KIT B;  1DDN A;  3CTA A;  3BG9 A;  2AXT C;  2LFB A;  2WTE A;  4NBQ A;  4A0Z A;  2MD5 A;  4A3M J;  3FMQ A;  3LJL A;  2Y48 A;  4HPQ A;  1YX5 A;  2QF7 A;  1UJ8 A;  2AQF A;  2FOK A;  4P5O A;  2UXX A;  3H1C A;  4FQG A;  3S3M A;  4UV9 A;  3MKW B;  1REP C;  3IC7 A;  5FKL A;  4AD9 A;  2IGM A;  1PUE E;  2A6H F;  3SJM A;  5BMZ A;  2P7C B;  3OYB A;  5LHH A;  1I27 A;  4KUM A;  4A3J J;  2DK8 A;  4A3G J;  4HKU A;  5J1R A;  4ASN A;  3FXQ A;  2PG4 A;  4IZZ A;  3BG3 A;  2D1V A;  3K70 D;  3H3V K;  2CV2 A;  2R7V A;  2CH0 A;  2ID3 A;  4E70 A;  3U1K A;  5EDN A;  2G7G A;  5JI6 A;  2D45 A;  2QOP A;  3P7N A;  2GOM A;  2K9M A;  1U78 A;  5J4V A;  2Q24 A;  1B9M A;  1G4D A;  1DP7 P;  1G6N A;  5EGO A;  1ACI A;  4WXH A;  5FD5 A;  3BCB A;  1QVT A;  2FU4 A;  2NYX A;  2MFZ A;  4HA8 A;  1W4M A;  3HJE A;  2G3B A;  3P5J A;  2F4I A;  2OA4 A;  4C3I J;  4C2M A;  2UZK A;  1FOK A;  3ZGK A;  1Z3X A;  1FBS A;  3O6B B;  3WG9 A;  3N97 A;  3IRQ A;  3CF5 F;  4U87 A;  2ZXH A;  4OIN F;  3E0J B;  1ZYR F;  2ZFU A;  4CCO A;  3HC7 A;  3GEU A;  3BWG A;  1EA3 A;  4XRS G;  1BC8 C;  1IN5 A;  2B7E A;  3NAU A;  2HOE A;  3R0J A;  2O03 A;  3LNQ A;  1KU7 A;  4AVZ A;  2MSY A;  5KK1 A;  1O3R A;  5CXI A;  1Z9C A;  1F1Z A;  2YR2 A;  5E1W A;  2E71 A;  4GYI A;  4FX0 A;  3K1N A;  2DQR A;  2BHZ A;  1W36 C;  5DTD A;  1WJC A;  5CQG A;  2V6E A; 
#chains in the Genus database with same CATH homology
 2TCT A;  4MIM A;  3RH2 A;  3JRH A;  3EUP A;  3LSJ A;  3C2B A;  2CUE A;  2FJ1 A;  1JUP A;  1VND A;  5D1R A;  1MBH A;  2OF7 A;  3WHB A;  3DEW A;  2LK2 A;  5F1J A;  4ACI A;  5EFY A;  3QKX A;  2Y31 A;  1AU7 A;  2QIB A;  5CW8 A;  5F27 A;  2E2J J;  3I4M J;  4IEJ A;  3JRD A;  3O8H A;  2W53 A;  5CXG A;  3OOU A;  1WCM J;  2HI3 A;  4DYQ A;  1IG7 A;  1HF0 A;  1ZKG A;  3Q3S A;  1MBE A;  3HGG A;  2XPW A;  2COB A;  5E3M A;  5M3M J;  3ZQF A;  2EQR A;  2L0K A;  1LE8 A;  4FE7 A;  4Y7N J;  3LOC A;  2NS7 A;  3H0G J;  2Y9Y A;  3BHQ A;  3G1M A;  2ME6 A;  2GUH A;  3VW1 A;  3VPR A;  2CRG A;  2LKX A;  2EBI A;  3HKZ N;  3CQZ J;  2M9H A;  4JL3 A;  4C3H J;  1FJL A;  3HOU J;  1B8I A;  3B81 A;  1TWF J;  3GTQ J;  1DU6 A;  5J1U A;  4ICH A;  2H1K A;  3Q0V A;  2UXI A;  2X48 A;  2E1O A;  3ANP A;  3EGQ A;  1BL0 A;  3T6N A;  3HTJ A;  5HSZ A;  3BTJ A;  2PZ9 A;  2UXH A;  3ZQH A;  1AHD P;  5HBU A;  2HYT A;  1PUF A;  3VP5 A;  2DA6 A;  1DU0 A;  2LY9 A;  4UUS B;  3E7Q A;  1MBG A;  3BQY A;  4JNN A;  1IDY A;  3BR5 A;  2DA2 A;  3HB9 A;  1JKQ C;  2HOT A;  3KKD A;  4NN1 A;  2JA6 J;  2ME0 A;  3S1N J;  5FHP A;  1OJL A;  4QTR A;  3BR1 A;  5FKN A;  2M2E A;  2RAE A;  4KWA A;  3RKQ A;  3LSG A;  1H8A C;  3QBM A;  4L5E A;  1GUU A;  1U9N A;  2OI8 A;  1FIA A;  1YRN B;  4XIC A;  2DMT A;  3NI7 A;  2EZI A;  4MLO A;  3Q0W A;  4B1R A;  2HDD A;  1T56 A;  1OFC X;  2M0C A;  2NP3 A;  3LHQ A;  3BG5 A;  3HM5 A;  5IP6 A;  1Z0X A;  2O7O A;  2CQX A;  4M6V A;  5HAW A;  2WB1 N;  2DG7 A;  3IH4 A;  3A01 B;  2HXI A;  2UXP A;  4BY1 J;  5M5Y J;  3JRC A;  1UI5 A;  5K58 A;  3B6C A;  2R93 J;  3QPL A;  3FIW A;  3M4O J;  4CYC A;  1IGN A;  4A3B J;  1SFO J;  1IUF A;  1MNM C;  3NRG A;  3FIS A;  3HGY A;  2NVX J;  5H9T A;  4M3B A;  5E3N A;  1HOM A;  4AC0 A;  2VKE A;  2R5Y B;  2WGB A;  3GTO J;  4PXI A;  1ZR4 A;  5EZH A;  4XRS A;  3ZQC A;  4AYB N;  3D1N I;  5M5W J;  3IH2 A;  3F0C A;  4MFE A;  2HOS A;  1HCR A;  1X2N A;  3S1M J;  3HOW J;  5FGL A;  2IBD A;  5EGO B;  2CU7 A;  2K9N A;  2NVY J;  1BA5 A;  2O9L A;  2ZCN A;  1ENH A;  1JT6 A;  1GV5 A;  4FCY A;  1GV2 A;  1QPI A;  5EG0 A;  1FIP A;  3VW2 A;  2JK3 A;  2TRT A;  3HOV J;  2OPT A;  3OIO A;  4M3F A;  1IC8 A;  2D5V A;  3TP3 A;  1XC5 A;  2Y0S N;  4A69 C;  3GTK J;  1MSE C;  3S17 J;  4A3D J;  4MXM A;  1GDT A;  1JT0 A;  4RDU A;  3ON2 A;  1MSF C;  3HOX J;  1WH7 A;  4BBS J;  2VI6 A;  2EH3 A;  4FIS A;  1ZK8 A;  2L7F P;  2F07 A;  5C4Y A;  5EYR A;  1MBJ A;  2R5Z A;  3ZOB A;  2YUS A;  4C3J J;  1IJW C;  1IDZ A;  2CUF A;  2GM4 A;  1ORK A;  2IEK A;  1B72 B;  2DMQ A;  3HEF A;  2DA1 A;  3TED A;  2NP5 A;  2UXU A;  1JUM A;  2ZB9 A;  1P7J A;  2ZOY A;  3LSR A;  3G1L A;  1AKH B;  5IP7 J;  1FTT A;  2DA3 A;  1ITY A;  3IUV A;  1ETV A;  2FX0 A;  5BNG A;  2XPV A;  2HOA A;  3GTM J;  3BRU A;  3K7A J;  2QKO A;  1RKW A;  3BTL A;  1MBF A;  4IHW A;  4A3C J;  3PPB A;  3ZQG A;  2QWT A;  3NNR A;  2LTP A;  3S5R A;  2LLK A;  2X6O A;  3FRQ A;  1U9O A;  2XB0 X;  5FLM J;  1FEX A;  4UUT A;  1IV6 A;  2MW8 A;  5C3E J;  1HLV A;  1RPW A;  2XSD C;  4XK4 A;  4GCK A;  1I50 J;  2XRL A;  1U8B A;  5F0C A;  3V78 A;  3GTG J;  4W1U A;  3TP0 A;  3JRG A;  1LE8 B;  2AO9 A;  1WPK A;  3IV5 A;  5F0H A;  5EZG A;  5GPA A;  4JP0 A;  4L62 A;  2AHQ A;  3VVY A;  2XGD A;  5FJ8 J;  2M8G X;  2MGQ A;  1POG A;  1ZGW A;  2XDN A;  3K2A A;  5IYC J;  4D7M A;  1B8I B;  3GTJ J;  2MG4 A;  1F43 A;  1TWG J;  2EZH A;  3CJD A;  4GFL A;  5JLX A;  1Y1W J;  2YU9 J;  3VIB A;  1T33 A;  5K7Z A;  5D19 A;  4QSH A;  3PO3 J;  3OSG A;  1JTX A;  3HDD A;  2ZOZ A;  1PUF B;  1ETQ A;  3I4N J;  4AC6 A;  1ZQ3 P;  4JX4 A;  1H89 C;  2JA8 J;  4HNV A;  1G2H A;  4DZJ A;  2HYJ A;  2FD5 A;  3GTP J;  3HOZ J;  4MO7 A;  1JGG A;  2XB5 A;  5AQC A;  1SGM A;  4AF5 A;  3DCF A;  2L7Z A;  2QTQ A;  2DG8 A;  4BBR J;  2L9R A;  1Y1V J;  1TC3 C;  1VF9 A;  2G7L A;  5IOZ A;  4J19 A;  4GFB A;  1QVU A;  4DYR A;  2HXO A;  5FKO A;  4JX6 A;  5HOD A;  3AQS A;  2ELK A;  2DMN A;  2NVQ J;  2NS8 A;  1CQT A;  3CMY A;  3MVP A;  4GFK A;  1ZR2 A;  3O60 A;  3S1Q J;  4Y52 J;  3E7L A;  1UHS A;  4A93 J;  5C44 J;  3PAS A;  3PM1 A;  4DZP A;  3V6G A;  3RQI A;  1JJ6 C;  2LP0 A;  4ME9 A;  2O7T A;  3WHC A;  4CYC B;  3HBL A;  3S14 J;  1MH4 A;  2YVE A;  3HE0 A;  2JN6 A;  5E3L A;  2IU5 A;  3G56 A;  2HQ5 A;  5D18 A;  2Y2Z A;  4GCL A;  2REK A;  2DA5 A;  4QIW N;  2GBY A;  1E3O C;  1APL C;  3ON4 A;  4M3G A;  5E3O A;  2H8R A;  1I6H J;  2VPR A;  4MK6 A;  2YS9 A;  2K9Q A;  3C07 A;  4YZE A;  2N8G A;  1BJZ A;  2R7Z J;  4FE4 A;  3HOY J;  1K61 A;  3BTI A;  4W97 A;  2P81 A;  4FTH A;  4IHY A;  3CCY A;  3JSJ A;  3TW6 A;  3G7R A;  3CDL A;  1Q1V A;  2Y30 A;  5K7F A;  4GCT A;  2K9S A;  2QCO A;  4NDL A;  5EG0 B;  3JR9 A;  1OCT C;  3OSF A;  4IHV A;  3BR3 A;  3IH3 A;  4M3E A;  5F08 A;  5EF6 A;  2I10 A;  4G12 A;  1Z77 A;  3JRA A;  2IAI A;  2OER A;  3BQZ A;  2NX4 A;  1LFB A;  2DJN A;  3NXC A;  1JUS A;  1X58 A;  4V2G A;  1TWH J;  2JA5 J;  2HKU A;  5IPA A;  4B4C A;  4X1E A;  3CRJ A;  3QPS A;  2L7M P;  2D6Y A;  3PO2 J;  2YVH A;  4JX5 A;  3BJB A;  2ECC A;  3ZQL A;  3LSP A;  1ZTR A;  3DPJ A;  1BW5 A;  3GBG A;  2LVS A;  1GT0 C;  1A5J A;  3FK6 A;  3VUQ A;  5M5X J;  3KKC A;  2R5Z B;  2E19 A;  2UXO A;  2ZCX A;  2B63 J;  5K7H A;  1ETX A;  4UDS A;  1I3Q J;  3O8G A;  3QQA A;  4IHX A;  1LFU P;  1W0T A;  1P7I A;  2ID6 A;  3MKL A;  1X2M A;  3NAR A;  2V57 A;  4DW6 A;  4BXX J;  2GFN A;  3FKI J;  1K83 J;  5IYD J;  2RAS A;  2W48 A;  4I6Z A;  1EF4 A;  1H88 C;  1ETO A;  3KZ9 A;  3BR2 A;  3HTH A;  3MNL A;  1NK3 P;  2PBX A;  3COL A;  4AUX A;  2JA7 J;  1RR7 A;  2X9D A;  4MFD A;  3S2D J;  4A3E J;  3S2H J;  4A3K J;  3S1R J;  5FKK A;  3VVZ A;  1UMQ A;  1HDD C;  2LR8 A;  1XG1 A;  5IOY A;  2Y9Z A;  1FTZ A;  3VW0 A;  4C2M J;  1R9T J;  4X6A J;  1D5Y A;  2CQQ A;  4V2F A;  1MBK A;  2R92 J;  2VUM J;  3HIM A;  4LOC A;  1IRZ A;  2DMP A;  5DAJ A;  3RZO J;  2NOG A;  4D5C A;  2G7S A;  1ETK A;  4DYC A;  5J3L A;  3S16 J;  2K40 A;  1VI0 A;  3SDG A;  3RZD J;  2GEN A;  5GPC A;  2LD5 A;  4CGR A;  3JRB A;  2WAQ N;  3B6A A;  4RBO A;  3VOK A;  5F04 A;  1JKR C;  5IP9 J;  3JRF A;  4UUS A;  3UKG A;  1UI6 A;  1F36 A;  3BR6 A;  1WI3 A;  1JTY A;  3LWJ A;  4S0H B;  3P9T A;  1RES A;  2XGE A;  2ZCM A;  3MN2 A;  1OCP A;  3CWR A;  3Q0U A;  1RKT A;  1ETW A;  2VKV A;  4I76 A;  4NEL A;  3TW7 A;  4XRM A;  2ECB A;  3BG9 A;  5FKM A;  2LFB A;  3W6V A;  3BT9 A;  3SFI A;  3JRI A;  3VOX A;  5F0F A;  5M3F J;  4A3M J;  4A3L J;  5C4J J;  1YRN A;  3LJL A;  3BCG A;  1GVD A;  2QF7 A;  3HTI A;  3GZI A;  1JKO C;  1BW6 A;  5JLW A;  3A01 A;  3S15 J;  3JRE A;  5FKL A;  1MH3 A;  3BR0 A;  4M3D A;  4D7N A;  3SJM A;  1NK2 P;  3RD3 A;  4A3I J;  4B3A A;  4A3J J;  2M34 A;  5IYB J;  1O4X A;  4A3G J;  5J1R A;  4HKU A;  1WH5 A;  1VFC A;  2DTZ A;  2XGC A;  3BG3 A;  2O8K A;  1XS9 A;  2R5Y A;  9ANT A;  2JWT A;  1ETY A;  3H3V K;  1WGX A;  4D5F A;  2FQ4 A;  5DS9 A;  2ID3 A;  5EDN A;  2G7G A;  2EZL A;  3G1O A;  5FLV A;  2QOP A;  2DA7 A;  2Q24 A;  1U78 A;  5C4X J;  4BKX A;  2WUI A;  2DA4 A;  1HDP A;  2R0Q C;  2WV1 A;  5EGO A;  1NTC A;  1A6I A;  4EEF G;  1QVT A;  2KT0 A;  4JYK A;  3AQT A;  2PMZ N;  5J1Y A;  4XID A;  2CJJ A;  2G3B A;  5FMP A;  1JKP C;  1S7E A;  2G0E A;  4C3I J;  1UG2 A;  4A3F J;  3NPI A;  4BY7 J;  3M3Y J;  4ABZ A;  2JJ7 A;  2GLO A;  1W0U A;  3A02 A;  2RHA A;  4JKZ A;  1SAN A;  2JMW A;  3GEU A;  5EEA A;  4XRS G;  3KNW A;  1TWA J;  1TWC J;  3A03 A;  2E2H J;  3NAU A;  2E2I J;  3L1P A;  3ANG A;  2FBQ A;  3BTC A;  1QRY A;  3LNQ A;  1JJ8 C;  2MSY A;  5CXI A;  2XPU A;  2KDZ A;  2DN0 A;  1B72 A;  3GTL J;  2NVT J;  3F1B A;  2EZK A;  3FK7 A;  5GP9 A;  5DTD A;  2DMU A;  3BNI A;  1RET A;  3VVX A;  3HTA A;  1AKH A;  3ZQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...