3LOCA

Crystal structure of putative transcriptional regulator ycdc
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
201
Chain Sequence
RSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator rutR
publication title Crystal Structure of Hypothetical Transcriptional Regulator Ycdc from Escherichia Coli
rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 74
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3locA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3locA02
4A3GJ 2XPVA 4GFBA 2RASA 3G1LA 4J19A 4S0HB 1YRNB 2KT0A 1FTZA 2OERA 2K40A 1UMQA 3BR2A 3BTLA 3FK6A 4AC6A 5IOYA 4JX4A 4M3GA 1ZGWA 2E2HJ 3AQSA 1IRZA 2JWTA 1OFCX 5EGOA 2CQQA 2GENA 1WGXA 3DPJA 4DYCA 4YZEA 2XGEA 4W1UA 2G7LA 3GTLJ 3RZOJ 3C07A 4ICHA 2X9DA 1RR7A 1ZTRA 2MW8A 1HOMA 1UI5A 5F27A 1I3QJ 5GPCA 1U78A 4NDLA 5FKOA 2K9NA 2XGDA 2JA8J 4A3BJ 4M3FA 3IUVA 3S1QJ 5C4XJ 3TP3A 4GCLA 5E3NA 3GTPJ 4PXIA 2UXHA 3NRGA 1JKOC 3G1MA 2JK3A 5GPAA 3VUQA 4FISA 2Y9YA 2HQ5A 2ELKA 1IGNA 2JA5J 3ZQLA 3CJDA 1NK3P 2L7ZA 1ZKGA 2LP0A 1JJ8C 4QSHA 1W0UA 1AHDP 3JRIA 3UKGA 2M8GX 4A3JJ 2XSDC 1APLC 4XRSG 2R93J 3NARA 5E3OA 3GTQJ 4QTRA 1T33A 2NOGA 2R5ZA 3IV5A 2D5VA 3K2AA 1U9OA 3HOYJ 1GV5A 4IHWA 2OI8A 3E7LA 1D5YA 1VNDA 2ME6A 3FK7A 3NPIA 5IOZA 1X2MA 3IH4A 3I4MJ 2LLKA 2IBDA 1ITYA 3HTHA 2VUMJ 3QPSA 1PUFB 3JR9A 2ME0A 3RQIA 4BXXJ 2REKA 3ANGA 2PMZN 3FISA 4LOCA 5HSZA 2DMUA 2ZOYA 3RKQA 1QPIA 1WH7A 4A93J 2JJ7A 5IP9J 2OPTA 2R7ZJ 3ZQCA 2CUEA 1JTYA 2XB5A 3LSPA 3LNQA 1MBFA 4XRMA 3SDGA 1FJLA 1W0TA 3JREA 4MFEA 1SANA 4I6ZA 3WHBA 2KDZA 5D19A 4BBSJ 1QVUA 2L7FP 3KKDA 3TW6A 3K7AJ 1QRYA 2NS7A 3LWJA 2QKOA 1ZR2A 3JRCA 1FEXA 1RPWA 2RAEA 3BTIA 1LFUP 1G2HA 1LE8A 3MVPA 2ECBA 4DYRA 3PO2J 2M34A 5CXGA 2DN0A 4IHXA 1F36A 1JUMA 1HF0A 4NELA 4XICA 2JMWA 4XIDA 4A69C 4JX5A 4UUTA 3CMYA 3RH2A 3OSGA 2UXUA 3LJLA 1WCMJ 1AU7A 1AKHB 1MH4A 3CDLA 1I50J 3IH3A 2YS9A 1GDTA 3Q0WA 2LY9A 4JX6A 1P7JA 3BT9A 3EGQA 3HTJA 2EZKA 4GCKA 1GV2A 3JRAA 2IU5A 1JT0A 1RKTA 1GVDA 2I10A 5IYBJ 2DTZA 3A01B 2IEKA 4W97A 2COBA 3S1MJ 2HDDA 2YVHA 4JL3A 4HNVA 2DMPA 4CYCA 2K9QA 1UG2A 2FJ1A 2E2JJ 3O8HA 1ETXA 2VPRA 2D6YA 5DAJA 1IJWC 2DMNA 3SFIA 2DA6A 1XS9A 3QQAA 1IG7A 3BTCA 2LTPA 5F08A 1MNMC 3GTJJ 3I4NJ 5FLVA 3NI7A 1JT6A 2VI6A 3ZQGA 3B81A 4RBOA 4JNNA 4BY7J 2FX0A 5JLXA 5EGOB 1MSEC 3PM1A 1MBHA 3HBLA 1HLVA 2QCOA 2EZHA 2WGBA 2Y9ZA 5HAWA 1Y1WJ 3DEWA 4A3FJ 4NN1A 4AC0A 3BQYA 2R5YA 2LD5A 2L0KA 2DG7A 1ETKA 2L9RA 3BTJA 4IEJA 2GFNA 4ME9A 4MIMA 1IC8A 5CXIA 3NXCA 5H9TA 3QKXA 5EDNA 4AF5A 2LVSA 1VFCA 1YRNA 2ID6A 3G56A 1BW6A 5EZGA 1JKQC 2DJNA 2XDNA 2K9SA 4D5CA 4C3IJ 4C2MJ 3KZ9A 5HODA 3HTIA 2LK2A 2EBIA 1Q1VA 3HTAA 1UHSA 1K83J 3BCGA 1IDYA 5IPAA 1R9TJ 2MSYA 3F1BA 2HYTA 5F0HA 3GEUA 5FMPA 1JKPC 1WPKA 2E1OA 2CU7A 1H8AC 2HI3A 2Y2ZA 4M3EA 5IP6A 5J1RA 3BRUA 2DA5A 3B6CA 1ZK8A 2EZLA 5EG0B 1Z77A 5M5WJ 3S16J 3RD3A 4DYQA 4V2GA 2WAQN 1BW5A 1MBJA 1HDPA 2DMQA 1EF4A 2XPUA 4GFKA 2HOSA 2O8KA 3S2HJ 2M0CA 4DZJA 1OJLA 2VKVA 2Y0SN 2UXIA 2YUSA 5F1JA 5FJ8J 5E3LA 1QVTA 2FQ4A 4FE4A 4FCYA 4RDUA 5EZHA 5DS9A 5FKNA 2ZCNA 5JLWA 1DU0A 3GTOJ 3G7RA 2G0EA 3HOVJ 1ETWA 3LOCA 3CCYA 1GT0C 1ETVA 3BR1A 3M4OJ 2X6OA 2GUHA 2E2IJ 2YU9J 1XG1A 3VOKA 2E19A 1JJ6C 1PUFA 1MH3A 5C4JJ 2H1KA 4DW6A 2DA4A 4IHYA 3W6VA 2NVYJ 2CQXA 3M3YJ 1BJZA 4GFLA 3HEFA 1ORKA 1X58A 2G3BA 2RHAA 3PASA 1MBEA 1JKRC 2CRGA 1Z0XA 3GTKJ 3D1NI 1B72A 3HE0A 1JTXA 2DMTA 3VPRA 2UXOA 5FKLA 3PPBA 5EFYA 3VIBA 2FD5A 5BNGA 4KWAA 5FLMJ 4ABZA 2Y31A 2XGCA 4MFDA 1A5JA 4X6AJ 2PBXA 3G1OA 1B8IA 3VP5A 2JA7J 2H8RA 4DZPA 1OCTC 2EQRA 3E7QA 2LKXA 1DU6A 3QBMA 3HM5A 4C3HJ 2XRLA 3TP0A 2NS8A 4X1EA 3ON2A 5F0CA 2DG8A 2XB0X 3AQTA 4FTHA 1BA5A 3H3VK 2NVXJ 3VOXA 3ON4A 3BG9A 4HKUA 5J1YA 3WHCA 1SGMA 4MK6A 2HOAA 4MO7A 5K7ZA 1HDDC 2AHQA 3VVYA 4M3BA 5GP9A 2X48A 1K61A 3QPLA 2TCTA 4C3JJ 1TWFJ 2WUIA 3BG5A 4JYKA 3S2DJ 3CWRA 1WI3A 3V78A 5EEAA 3HDDA 1TWCJ 2ECCA 2G7SA 3A01A 2GM4A 1Y1VJ 3LSRA 2ZOZA 2EH3A 2ID3A 2YVEA 2W48A 1TC3C 3A02A 1FIAA 1RKWA 2R5YB 2CJJA 4UUSA 2FBQA 3ZQHA 4Y7NJ 5CW8A 3VW1A 5HBUA 3VW2A 4QIWN 5DTDA 1X2NA 3VVXA 3H0GJ 4D7MA 4XRSA 4Y52J 4MLOA 2JA6J 3S5RA 3OSFA 4ACIA 4M3DA 2DA7A 3GTGJ 3TW7A 3ZOBA 2NVTJ 5IYDJ 3HB9A 4A3MJ 3A03A 3FKIJ 3O60A 4A3EJ 2ZB9A 2LFBA 2ZCXA 1UI6A 1VF9A 3CQZJ 4JKZA 5EF6A 3T6NA 2WV1A 1IV6A 1E3OC 2QIBA 3JSJA 1FTTA 4FE7A 2NP5A 1IDZA 1JUPA 2N8GA 5C4YA 3S1NJ 1ETYA 2M2EA 3JRBA 4A3KJ 5D18A 1OCPA 3PO3J 2NP3A 2JN6A 3L1PA 4V2FA 3LHQA 5FKKA 1T56A 1F43A 2R5ZB 1MBGA 5M3FJ 5E3MA 3OOUA 1ETQA 3LSJA 2HOTA 3JRDA 3GTMJ 4A3CJ 4XK4A 1TWHJ 5K7FA 3CRJA 1MBKA 2DA1A 2B63J 3HKZN 5FGLA 1VI0A 2LR8A 3RZDJ 1RETA 4D5FA 4IHVA 2NVQJ 1U9NA 1JGGA 9ANTA 3MKLA 2QTQA 3Q0UA 3BNIA 3COLA 2Q24A 5AQCA 4A3DJ 1BL0A 3DCFA 3KNWA 3S14J 3BHQA 3VVZA 3HGYA 2NX4A 3C2BA 4BKXA 2QWTA 1I6HJ 1A6IA 5IP7J 5EG0A 1NTCA 1O4XA 1ETOA 5K58A 3S15J 3TEDA 3HOUJ 2QOPA 4A3IJ 3KKCA 1H89C 1ZQ3P 5J3LA 2QF7A 2UXPA 5M5YJ 1CQTA 4M6VA 3BG3A 3Q0VA 2GLOA 3P9TA 2W53A 2DA3A 2HKUA 3V6GA 3F0CA 1NK2P 1U8BA 4G12A 3HOXJ 1S7EA 1XC5A 5C3EJ 3ANPA 2G7GA 3BR0A 3HOZJ 3MNLA 3ZQIA 2HXIA 1TWGJ 3Q3SA 5J1UA 4B3AA 4EEFG 5K7HA 3BR5A 4MXMA 1LE8B 1MSFC 1HCRA 2EZIA 5F04A 1B72B 3EUPA 3HIMA 3BQZA 4I76A 2O9LA 5FHPA 4BBRJ 4B1RA 3JRFA 2MGQA 2L7MP 2IAIA 2GBYA 4GCTA 3BJBA 2O7OA 3JRGA 2HYJA 3FRQA 1P7IA 5F0FA 2PZ9A 3HGGA 1B8IB 2XPWA 3BR6A 2DA2A 1TWAJ 3NAUA 2R0QC 2Y30A 2MG4A 1RESA 1ZR4A 1WH5A 2AO9A 2O7TA 4L62A 1SFOJ 2F07A 4UDSA 4A3LJ 1H88C 5M5XJ 1JUSA 4CYCB 2VKEA 2TRTA 4BY1J 2P81A 3S17J 5FKMA 2V57A 1AKHA 4D7NA 1LFBA 5M3MJ 4AYBN 3LSGA 1GUUA 4L5EA 5D1RA 4B4CA 1FIPA 3OIOA 5EYRA 3ZQFA 3HOWJ 3GZIA 3MN2A 1POGA 1ENHA 2OF7A 4CGRA 2HXOA 3NNRA 4JP0A 3S1RJ 2ZCMA 2M9HA 3IH2A 5IYCJ 3VW0A 3BR3A 3FIWA 5C44J 2WB1N 3B6AA 2CUFA 3GBGA 4UUSB 3JRHA 4AUXA 2R92J 3SJMA 3O8GA 1IUFA
chains in the Genus database with same CATH superfamily
3ERED 4A3GJ 5IT9K 4IO9F 3K8PC 2KDOA 1YRNB 4JBAA 3DKYA 2OERA 2VXDA 1JGSA 1ON1A 1HW1A 3FK6A 4AC6A 4Y13A 1T8IA 3AQSA 1IRZA 1OFCX 1MD0A 2CQQA 4RA2A 1WGXA 3V4GA 4DYCA 1E3PA 4E6KG 4W1UA 4YZEA 3C07A 3RZOJ 4UVAA 5TGTA 3HJEA 1WHUA 4WF2A 2M1BA 4WXDA 3LAJA 3DPUA 1KYWA 4BEHB 4CDGA 1D8KA 3BCBA 2EIMH 2GWRA 3R0AA 1IUYA 3A1YA 3MZYA 5LGTA 3S8PA 3CCMI 4A3BJ 4LG3A 1NHAA 3S1QJ 1LUJB 5FD6A 1K78A 2M87A 5E3NA 3LA2A 4PXIA 4JK1X 3MKWB 1JKOC 3G1MA 2UXNA 4PSXA 2QQBA 5GPAA 5ERIA 3PQJA 3EPZA 4FISA 2Y9YA 2DT7B 2ELKA 3ZQLA 3KPHA 2NS0A 3C3WA 5GAHJ 1QPMA 4DNCA 2EK5A 1R22A 2XGXA 3DTIA 3IWFA 4YFXF 4F55A 3KEOA 1QBJA 4G7ZF 4XBFA 2M8GX 4YIFA 2X1DA 3V7RA 3BCAA 1T33A 2L54A 2Y69H 3WG7H 3OIQA 3HOYJ 1U9OA 4E7KA 1GV5A 4IHWA 3EYIA 2E1CA 2Q1ZB 1IN5A 1MJAA 2FQ3A 3SEZA 3U2RA 3EUKL 2ME6A 4KN7X 1X2MA 1VQ9I 3I4MJ 3LA3A 3AL0C 3JR9A 2ME0A 3U21A 3DP7A 3P7NA 3IC7A 3RQIA 4BXXJ 4B43A 2O3FA 4IQ4A 4BQAA 1J59A 4RGRA 2VASA 4IJAA 3OV8A 3RKQA 3W3CA 4LJZF 1WH7A 1QPIA 1ZGJA 4IKFA 5HDGA 2VQLA 2R7ZJ 3OYFA 2CUEA 1JTYA 3SZPA 2QQ8A 1Y8QB 1LKXA 2X6YA 4YEJA 4MFEA 4PJNA 2GXGA 3LMMA 4IQJA 2IVMA 3ZN0A 2WA0A 1Y8RB 3A4CA 4OIOF 2HOEA 4AIJA 3ZXSA 4C2UA 2LH9A 1OMIA 1ULYA 4BBSJ 1R49A 1X4OA 2L7FP 4ESJA 3KKDA 3K7AJ 1QRYA 1HQCA 2NS7A 1Z3XA 2KIMA 3OR1C 1ZR2A 4KIGA 1FEXA 1RPWA 1IRXA 2RAEA 5LEKA 2XAFA 1MNDA 1QQIA 3HIFA 4P5OA 5B1AH 1LE8A 3KX2A 1F5TA 1ZRDA 2M34A 2CUJA 1F36A 3CJRB 4R79A 2M0MA 3H3ZA 1SC7A 4JX5A 1PVEA 3ISPA 3LQQA 3CMYA 3OSGA 4LLLA 4HDVA 1MH4A 4PCQA 2F2EA 2FUG2 3BDDA 3CDLA 2ZJPF 1GDTA 1HKSA 3CP2A 1MW7A 2YPRA 4IOCF 4GCKA 1GV2A 4L9NA 5D5WB 4EGYA 1RKTA 2I10A 2NOJB 4IXAA 2IEKA 4W97A 2COBA 3FM3A 2DBBA 1PP7U 2HVSA 2O5RA 4RB2C 3DU5A 4E7HA 4JL3A 1K79A 2FJ1A 5D4SA 2LKPA 4AU7A 3HKZA 3LAPA 2D6YA 2DMNA 1ZREA 3PQKA 2DA6A 3EYYA 4KA4A 3QQAA 2QSFX 1IG7A 2LNBA 3BTCA 1MNMC 3M9AA 3GTJJ 4I99C 4LMYA 4E7ZA 5FLVA 3I0TA 1W4MA 1IN4A 5B1BH 1PJRA 2LC2A 2R7TA 1FYMA 3MKZA 5JLXA 5EGOB 1MSEC 1RZ4A 2DFIA 1MBHA 3HBLA 1IRGA 1OKRA 1OLTA 2W1OA 5D6FA 2QCOA 3L2QA 2Y9ZA 2Y75A 2O6GE 5HAWA 2CGPA 2KRHA 5ED4A 3DEWA 2IT0A 4CCMA 4AC0A 1SFUA 1KQ0A 2R5YA 4Z2YA 2LD5A 2M7BA 2L9RA 2R7QA 3BTJA 3ABKH 1XCVA 4KMFA 2LVSA 1EKEA 1FBSA 4V19K 1BBYA 1D5VA 1EH7A 1QNTA 5EZGA 2K3PA 2K9SA 4ENMA 4JOMA 3JSPA 2H27A 2PFVA 2ACJA 4YRVA 3PNTA 4HBLA 2XROA 3K70D 1R36A 5E1ZB 3WODF 2EBIA 1FZPB 3F1BA 2MSYA 2HYTA 5F0HA 4OMYA 4ZDOA 1X1AA 4RLQA 2E1OA 1BOBA 2VBZA 3MFKA 2Y2ZA 5LLQA 5J1RA 5DD4A 2XC7A 3LSTA 4OIQF 2DA5A 4BU2A 4Y4RA 2EFQA 1Z77A 3DPTA 3GFLA 5M5WJ 2AQFA 4DYQA 2HTJA 1HDPA 2W24A 3KEYA 3L00A 2MFZA 2XF5A 1BR1A 2XKPA 1OCOH 3FF5A 3M1EA 4ASNA 1Y39A 4DZJA 2Y0SN 2VIXA 2OZUA 4O3MA 1UZCA 3RYPA 2DCEA 3FDYA 3G73A 4FCYA 4ZZLA 1TW2A 5EZHA 2V9PA 5DS9A 5FKNA 2ZCNA 4GRIA 5JLWA 2NXNB 1TT0A 4G7OF 5E79C 1JE8A 3ONQA 3GTOJ 1A6QA 4BL0B 3E6MA 1ETWA 5HNHA 1J0RA 1GT0C 1ETVA 4EJWA 5J47A 2V1XA 2AQEA 2K4JA 1MDMB 2E2IJ 2ICWG 2M30A 2AXLA 1PUFA 3GFJA 1MH3A 4S05A 5ICCA 3TO7A 2DA4A 4IHYA 1C0WA 3W6VA 3BPVA 1XDUA 2X4HA 2CW0F 2V4JC 2PJRB 1HC8A 4E7LA 1ORKA 5DUKA 2RHAA 3E97A 4U0YA 3CC2I 3HRTA 1B72A 1FSEA 1S29A 2BY3A 1VQPI 2CQNA 1JTXA 3HOSA 3VPRA 1UG0A 2VN2A 1SD4A 2HKXA 2VOOA 2ZC2A 4D1QA 3VIBA 2V9KA 1HA8A 2LF7A 1N25A 3KP7A 2XDVA 4BXUA 4HOBA 2A61A 2KIFA 5E8GA 3CC4I 1ERDA 3SZTA 3OYIA 3TP0A 2NS8A 2HQNA 2VQGA 1A35A 1Y6IA 5DEQA 2DG8A 2XB0X 3AQTA 4FTHA 3K70C 2FOWA 3RI4A 4XM3A 3ON4A 3VOXA 3BG9A 1IO2A 1T6SA 2HYGD 4D9JA 3LFKA 1XMKA 3WHCA 2OQGA 1UFMA 4MO7A 5K7ZA 4MK6A 4GGGA 1SVMA 2X1CA 2DAOA 1RC9A 4DBRA 4EM2A 4C3JJ 4I09A 2LG4A 2WUIA 2HKOA 2KJBA 3BG5A 3QP6A 4GYGA 4KMUX 1UHMA 3V78A 4AWXB 1I39A 3ML6A 3A01A 3IHUA 5CVUA 4MEXF 2NVUB 3V8JA 5AIPA 2GM4A 2W48A 3D5SC 1FIAA 2ZKZA 2WAQA 5CVVA 2OD5A 3ZQHA 2LKSA 3ABLH 5AIQA 5FLXK 5HBUA 1LB2A 4HPQA 2GIZA 3L2WA 1X2NA 3VODA 3VVXA 5DM7F 4UUVA 4D7MA 4G6TB 4CCOA 2JA6J 2H94A 1OYIA 3OSFA 3S5RA 4ACIA 5L3EA 3E1SA 3ZOBA 1I27A 4KNYA 1TP4A 2CFOA 2L9SA 3HB9A 5IYDJ 2JSPA 1UCRA 2LFBA 4AD9A 2FE3A 5EF6A 3RKYA 3REOA 1IV6A 2VBYA 2KP6A 4AM3A 3S93A 4CCJA 3PNYA 1IDZA 3OS2A 3JRBA 1WSUA 1V5FA 2PMUA 5D18A 2ELHA 1SAUA 5DUIA 3RPUA 2JN6A 4RGUA 3L1PA 3ASNH 1GXQA 2JQ7A 4M72A 3NWSA 2E34A 2VONA 4EV0A 5E3MA 3OOUA 3FHZA 3H5NA 4EMSA 5JVGF 2DA1A 1OYYA 2B63J 5FGLA 3B73A 2LR8A 5DD8A 4L9TA 2GXBA 1YJWI 5LBQA 4PGGA 2VB6A 1O57A 2A6HF 1MMAA 3I59A 3P9KA 2PLYA 1UB9A 3F8MA 4A3DJ 5DCMA 1F9NA 1WJEA 4I0BA 1A6IA 1ETOA 4GYIA 2VODA 3S15J 3DU6A 1U2WA 3HOUJ 1EV7A 1H89C 1RUNA 1ZQ3P 1XSXA 3W6JB 5FRNA 3AFHA 5CLSA 2HVRA 2H8WA 1J9IA 2DA3A 3EUHA 3OL4A 3F0CA 1XGOA 3PUFA 1XC5A 5J8CA 2QBYB 5C3EJ 3ANPA 2Z1DA 4J00A 3GZ6A 3CCUI 2G7GA 2A5WA 3ZQIA 1FYLA 3R60A 2DI3A 1N75A 3ZQQA 2F5EA 5F04A 4ANJA 4HV6A 3HIMA 3VYRB 2Z9OA 4IVNA 2ZSIB 4FHTA 4B1RA 5DM6F 1VQNI 3H92A 3JRGA 3M8EA 4L0ZB 2L4MA 2PZ9A 5LHHA 1S3JA 3I4PA 3FMQA 1SFKA 1VQ6I 4CXFA 2GQQA 3NAUA 2R0QC 4OMZA 1H0MA 1D1BA 2MG4A 4XKVA 4ZC3A 3PNVA 1KU9A 1WH5A 2AO9A 2ETHA 3NWTA 4ZYGA 2WAFA 1HW2A 1RUOA 2F07A 4UDSA 4A3LJ 3FX3A 3GZ5A 1R1UA 1GXPA 5M5XJ 2ZMEB 3Q9VA 3TBIA 1DGRM 4IRIA 4BY1J 2E5NA 4WK8F 2P81A 2OZ6A 1IW7F 1H9GA 3SZGA 3S17J 5FKMA 2V57A 1AKHA 3GMEA 3F6OA 1SVLA 3ECHA 2H09A 2HZTA 3LSIA 4NQWA 2ZFUA 3HOWJ 3BG6A 2G7HA 4CGRA 2HXOA 2KPMA 4UNOA 4OD5A 1T95A 2MH2A 1U5TA 2L01A 5TISC 4HLXA 2WB1N 4PJLA 4PGHA 2K9LA 4EM0B 3B6AA 2YVXA 5ILUA 1HKTA 4IL6C 3TDZC 2CG4A 3O8GA 3I5UA 4F91B 4II2A 4FX4A 3CCEI 2QKLB 4HSTA 1W36D 2LMDA 3ZMUA 3BR2A 1E2XA 3K1MA 3OS1A 1LPQA 1PYVA 2WC2A 5IOYA 2IJLA 4RB3C 1KU7A 1T0FA 4G94A 2A68F 3GXOA 1Y56A 2GENA 3DPJA 1O3SA 1YO5C 4P55A 4LD5A 1FY7A 3E5QA 4OOIA 1OR7C 2MW8A 3LL7A 1UI5A 2Z99A 5F27A 1I3QJ 4NC6A 2IS6A 2RV8A 1E0EA 4NDLA 2XAJA 4GCLA 5C4XJ 5ICFA 3K10A 2ESNA 3VOEA 4AIDA 3CF5F 2BW3B 1WJCA 1FBUA 5KCMA 1DPRA 2F4OB 3L9FA 4HG2A 3OYDA 1YW9A 1DUXC 4IPAA 1IGNA 1WJ5A 3CJDA 1NK3P 1GHCA 1JJ8C 5IT9Z 2D2WA 3L7WA 1FC3A 2LSOA 2P4WA 3UKGA 3EUHC 2XSDC 2KQRA 1DPUA 1WVRA 1P4WA 3T5XA 1G3YA 1GLNA 5K1YA 2NOGA 2DYSH 3TDUC 5BS6A 5LRRA 3CMEI 2V26A 3GWZA 1ZG3A 4F3QA 2W7NA 4ZJZA 1BIBA 1IRFA 2OI8A 3KYLA 3RJPA 3I9V2 1VNDA 2G9WA 3FK7A 1F1ZA 5IOZA 1L0OC 2LLKA 3HTHA 2VL8A 4RAFA 2C6YA 3BJ6A 3FHNA 1V4RA 1U6GA 3ANGA 3ELKA 5LRSA 4LOCA 4DOZA 5HSZA 3BY6A 2DMUA 3J7AO 5L3BA 2PI0A 4AYBA 4G7HF 2FSWA 2JJ7A 5IP9J 4B44A 2MBFA 1QGPA 1ONVA 2WY8Q 2BV6A 4BE2A 4DGWB 4ZYEA 3LNQA 1MMNA 4PUSA 2R7SA 3OIPA 4MHGA 2MC4A 1SANA 1EH6A 4I6ZA 1K4TA 3OS0A 2DFFA 1CF7B 1W36C 1LFPA 3E0JB 3TW6A 2VJ4A 1Y0UA 3BTIA 3PJRA 1LFUP 1OISA 4AVZA 4I2OA 3V7CA 1G2HA 3I64A 3I56I 1P4XA 3MVPA 1NG7A 1ZG5A 2IXSA 2OA4A 2CV1A 1R4NB 1XGNA 1R5ID 3F8CA 3P5JA 5HLHA 1JUMA 1TQMA 4IHXA 3QPTA 4NELA 5J8FA 2EIKH 3E3VA 3KFWX 4RM3A 4BQQA 1WCMJ 4C2TA 1KQ8A 4II3A 2OAZA 3PIPF 5BOXA 4LB5A 3B02A 1KZHA 4WIBA 1SMYF 1MNEA 3E5UA 5ICGA 2QSGX 2E7WA 3EGQA 3HTJA 1NG6A 2EZKA 3CMAI 2LREA 3PIOF 3JRAA 1JT0A 1O3QA 2DTZA 3EQLF 3AG2H 4Y33A 2AXTC 4WXCA 3S1MJ 2FXAA 2HDDA 1A36A 3ZQ7A 1ZH5A 4IRVA 2DMPA 1T0FC 4KYWA 1TQIA 1OCRH 2QZ8A 2WADA 2VPRA 1IJWC 3KP3A 2VJ5A 1LNWA 3DEUA 2F5VA 2QYOA 4IHSA 3RDIA 5F08A 2JZYA 2ZNZA 5FB2A 4XKBA 3IL2A 3AG3H 2I5UA 5JVTA 2VI6A 4M6YA 5D5UB 4RBOA 4JNNA 1PUEE 1V3FA 2WY7Q 4MGRA 3BZ6A 2J5OA 2EZHA 2WGBA 2ZNYA 1Y1WJ 4AVPA 2D1VA 2HNHA 2BOLA 3P9IA 2L0KA 3KCCA 4NBQA 2DFHA 4ME9A 2KZVA 3O3KA 3WGHA 4PJ0C 1IC8A 3VYSB 3WGIA 4ZTFA 5HDNA 3QKXA 5EDNA 4AF5A 4CA0A 1YRNA 1K78B 3S3OA 3K4LA 4ZDLA 4CCKA 1R1TA 4D5CA 1SD6A 2W82A 3DQVC 5HODA 2VT3A 3KP4A 3R0JA 4WX9A 3HTAA 3K69A 1UHSA 4KDPA 5IPAA 2QUFA 4BEHA 4NB5A 2LBFB 3GEUA 4BJTA 1JKPC 1FP1D 1WJBA 2CU7A 4M9SA 4EQQA 4B3XA 1WI9A 5IP6A 2P5LC 4LIUA 5H20A 1K6OA 3BRUA 5EG0B 1ZK8A 1W7PD 1TLHB 2UZKA 1BI1A 5ILSA 3ROUA 2UV1A 4UHTA 2WAQN 1BW5A 2PG4A 1MBJA 3ABUA 2Y48A 4RB1A 2DU9A 2XPUA 4A0XA 3S2HJ 5K5QA 1VTNC 1JXSA 2OCEA 1OJLA 2VKVA 3CMMA 3KP5A 4BAYA 5A2QK 2YUSA 3DKXA 1NH3A 2NRAC 1G3SA 1IV8A 1QVTA 3HPGA 1OQYA 2CS3A 1BM9A 4ZDPA 4BXFA 2DXIA 1N78A 2JVGA 4CO8A 3I55I 1R71A 2HYFA 2G0EA 5JHUA 2O0YA 2VQCA 2BHYA 3LOCA 3PFYA 1PP8F 2X1EA 5D5XB 2GIVA 2GUHA 1I5ZA 2LRDA 1XG1A 4B48A 2CWEA 2RNGA 1YQAA 1X19A 2XAUA 4RGSA 1SVOA 2WB1A 3N4MA 5C4JJ 2H1KA 2JRTA 4DW6A 1G3WA 2YX7A 1TBXA 4EVIA 3WTWC 3IWZA 2CQXA 3FXOA 4MQ9F 2V6CA 3WU1B 5DV5A 2DQRA 3GEZA 2LY2A 2G3BA 1MBEA 2RN7A 1JKRC 2CRGA 2K7LA 1B9NA 3GTKJ 1CGPA 4LLNA 1R5HA 1X3UA 1RNLA 4FASD 2R7WA 2M45A 2OCCH 3OYGA 2JPCA 4F7ZA 4DQ2A 5FKLA 1D3YA 3PPBA 5EFYA 2K5CA 5DCFA 1SFEA 3LQRA 3C2GA 5CVIA 4PK4A 4CHUA 2W00A 5FLMJ 1BI0A 2Y31A 1A5JA 3WTUC 3G1OA 1B8IA 2CFXA 2QQ9A 2GOXB 3O6BB 2DT6A 1YOVB 2F48A 3CCVI 2DTRA 3DFGA 2LKXA 4C3HJ 3QRFF 2VE9A 3KIOA 2R7RA 2F5CA 4Q48A 1X3ZB 1P92A 3M1CA 2X0LA 2DPUA 4HKUA 1FNNA 3KE2A 3H9GA 3WTTC 2F6CA 1YI2I 1SGMA 3F3XA 2OC6A 1HDDC 2AHQA 3VVYA 4ZZDA 4M3BA 2X48A 1K61A 3QPLA 1X3WB 1TWFJ 3J7YJ 3GCMA 2V6EA 3CWRA 4JYKA 1WI3A 2RKHA 5EEAA 4Z6YA 1V55H 3F23A 2AS5F 2R3SA 4Y3OA 3TL4X 4N9HA 2DLLA 2EH3A 2ZJ2A 3VTIA 3TKYA 1IF1A 2R5YB 2CJJA 4UUSA 1YHQI 2FBQA 2VT2A 4Y7NJ 1XD7A 4U87A 5DTDA 4ENKA 2R7XA 1W5SA 2QENA 3L2CA 4MLOA 2KISA 3PSIA 2ZXIA 4U9LA 4M3DA 1ACIA 5H6QA 2NVTJ 2V1DA 2TDXA 1S7OA 4Y17A 4XOTA 1MMDA 4A3MJ 3O60A 2R7DA 2QGUA 3NRVA 2Z2SB 4LIVA 1UI6A 3COAC 3H1CA 2PJPA 2EB7A 4F92B 2QIBA 1DGWY 4RLFA 3JSJA 1FTTA 1X4PA 3JSOA 3KEQA 2M4GA 3S1NJ 5ICEA 4A3KJ 4WXHA 1OCPA 3PO3J 2DO7A 1W7PB 3OYAA 1XSVA 3MKYB 3VYTB 2NP3A 3LHQA 2VC0A 1T56A 2R5ZB 4J01A 3IUOA 5M3FJ 1QU3A 3M7GA 3Q5FA 2HOTA 3JRDA 5K7FA 1TWHJ 2Z16A 3SEQA 1MBKA 4C2MA 4H0EA 2FEZA 4KIBA 3A0HC 2MLKA 2XHKA 2STWA 5FLXZ 2E1MB 3H5AA 2NVQJ 3Q0UA 4YG2F 4F93B 2XF7A 3SQNA 1LEBA 3ZCOA 2EV5A 3CJQB 2GAUA 5JR3A 3BJOA 5AQCA 3KNWA 4E7IA 3ERMA 3WTZA 3VVZA 4D0PA 3FXKA 2VBXA 4HA8A 4ENNA 1I6HJ 1B59A 3FBNB 2YX4A 4I02A 4PZJA 3OWTA 5K58A 2KIUA 3HRUA 3JTHA 1U0JA 2GA2A 2PBIA 3FKJA 5E18F 5J3LA 3CESA 1D0ZA 3QAHA 4YELA 1CQTA 4M6VA 2GLOA 4N9IA 1LVAA 2W53A 1BOAA 2FNPA 4U7DA 3WU0A 1MZBA 1U8BA 1S7EA 4OIRF 1YW7A 4IF4A 1BN5A 2EILH 2WAEA 1Z9CA 2IRFG 3BR0A 3MNLA 1TTYA 3L2VA 4CSWA 4Q5SF 2M5WA 3FBIB 2B1EA 4O5VA 1TWGJ 5K7HA 4E7JA 4AIHA 4EJOA 1B72B 2JTVA 3EUPA 3ZMDA 3BQZA 1FX7A 4OINF 4PJMA 3JRFA 3RYRA 3OYNA 4GCTA 1HSTA 4U0VA 3MWMA 2HYJA 4XKWA 5L3GA 4GO1A 1HW5A 2X85A 3BR6A 3I71A 3R61A 5LGNA 2UXXA 5DYMA 1ZR4A 2HS5A 2CYYA 3SYTA 2O7TA 4M9ZA 2KL4A 3HUGA 3UNGC 2R7FA 5JI6A 5JHFA 1H88C 4G8XA 1JUSA 4CYCB 1ZAOA 4R8HA 1UHWA 2XIGA 4RGXA 2BXZA 2VOPA 3W2VA 2VQHA 5M3MJ 4AYBN 3LSGA 1GUUA 4OU0A 1KGSA 5HLTA 1VQMI 1JHHA 2FRHA 2MABA 5EYRA 3ZP5A 1POGA 3RCOA 4FX0A 4M9XA 1MKMA 5IT3A 4HF2A 1BC7C 3J80Z 2XV4S 4M74A 5HLIA 2ZCMA 2HDCA 2M9HA 2ZXWH 3NEUA 3IH2A 2X51A 3BC8A 3C2HA 2QWWA 2OTJI 4HEA2 1K6YA 2O8XA 2XPVA 2BY2A 3KETA 4OWRB 5KVRA 3KLNA 4S0HB 4HZFA 3H9JA 2KT0A 1FTZA 4G6QA 2K40A 2FBHA 3O2PE 1R5GA 5CYVA 2CV0A 5BQTA 3M8FA 4LLGF 1T08B 5AONA 1XB4A 2P0WA 1A04A 3AAFA 1ZG1A 5ILVA 2XGEA 2G7LA 1DDNA 3GF2A 1U3EM 3DTEA 4HX8A 1XX5A 4AIKA 2KZGA 4BHCA 4E7SA 1WFXA 4RAGA 2JVHA 3CTAA 1BI3A 5FKOA 2XGDA 4LB6B 4BHBA 1KU2A 3K6GA 2A07F 3QP5A 3TP3A 4F52A 1KONA 4FETA 4OAZA 1J5YA 3M8JA 2DJIA 3NRGA 2CW8A 3CF2A 3V8LA 5B66C 3OYHA 2HR3A 4XNFA 2STTA 1OR7A 4BJ6C 3VSLA 2KLOA 2LOOA 5FFZA 2I8DA 1V5GA 2L7ZA 5FO5A 3CUQB 3TQNA 2L9VA 2VBWA 4XONA 4L0YB 4BHPA 1SD5A 1AHDP 3JRIA 4WWCA 1APLC 2DDBA 5DCMB 2R4GA 2R93J 3J81K 3NARA 2KIQA 3GTQJ 4QTRA 1K4SA 3J7ZI 3BROA 3QU6A 2QQAA 2D5VA 3K2AA 5F6FA 3HXLA 3R6SA 1YE9A 4M73A 2BBYA 2X6WA 1R00A 2A5YB 3PFIA 5E1WA 2IBDA 2VE8A 3AG1H 3QPSA 1ZRCA 3S2WA 2CMPA 2RC4A 5LHGA 2JSCA 1JI8A 3QYBA 2REKA 1U8RA 2PMZN 4ZTJA 2EFOA 5CQEA 5E17F 2M7AA 4A93J 2OPTA 2DYRH 2XB5A 1K7AA 3LSPA 2XKOA 1MBFA 1W5TA 4XRMA 2EFWA 2RVCA 3SDGA 5IY5H 3J80K 2BZTA 2NNNA 2BY1A 3T8RA 4CCLA 1WJFA 4JQFA 3WHBA 5FD5A 1QZYA 2RDPA 4A5MA 5D19A 4N4OB 4B09A 3S32A 3LWJA 1E17A 3V8KA 2F5FA 3JRCA 5D4RA 5LGUA 4DIQA 3EDPA 1RR8C 3CP8A 3WTYC 3OYJA 1REPC 4DYRA 3PO2J 5CXGA 4XLFA 2H6BA 4Q47A 1HF0A 1ZLJA 1IXCA 3F8NA 3LSHA 2IS2A 3HRMA 2JMWA 1R1VA 4UUTA 5GAEJ 4HNUA 3CJNA 2P5VA 1AKHB 1FLIA 2IGKA 2A6EF 4MNUA 1I50J 1P6RA 2IA0A 3DBHB 3IH3A 3JCUC 1GVJA 4EJVA 3Q0WA 5CQGA 2LY9A 1XMAA 4JX6A 5FFXA 3BT9A 2L4AA 4NQWB 1X1DA 3TO9A 3L2UA 5HS8A 2IU5A 2XVCA 1GVDA 5IYBJ 5HLGA 1D8JA 2YVHA 5LHIA 1J75A 4BDZA 1U5TB 4HNVA 2K9QA 4XN3A 5KHDA 2B7EA 2E2JJ 4PSWA 5DAJA 2MLGA 3K1NA 3HPHA 3SFIA 2KJCA 1XS9A 4H4KC 4KICA 3I4NJ 1X1CA 3WE3A 1JT6A 4QPQA 3ZQGA 4BY7J 2FX0A 2L2OA 3KZYA 2A05A 4HF0A 2MC3A 5HDKA 4OD4A 3K4CA 2YU3A 1FP2A 1Z6RA 1TQPA 2E5ZA 3BG7A 4QPOA 4NN1A 3BQYA 5HOOA 2Z3YA 3JAMK 1DP7P 2GFNA 3RIRA 1T2KA 4I7HA 5CXIA 2ADUA 5H9TA 4A2UA 4NUBA 1YFHA 2G7UA 4P1WA 1DQUA 1VFCA 2ID6A 1BR2A 1TW3A 2EFNA 1YS6A 2DJNA 4YIRX 2PEXA 2EFPA 1I3AA 2K27A 1TNTA 4C2MJ 2GZWA 3HTIA 2L7KA 2LK2A 5E20A 4C30A 3BCGA 3CLQA 1R6RA 3QYEA 1KQ9A 1R9TJ 3IAS2 1S72I 3IKTA 3MZHA 4Y15A 1KU3A 5FMPA 4XQFA 4EGZA 4XLEA 3DEEA 1H8AC 4RAYA 5E1XA 4M3EA 3GYHX 3LA7A 3ZPLA 3B6CA 4PFPA 1Z05A 3IRRA 3GLLA 3E6DA 3RD3A 3FZVA 3U1KA 4S04A 1D0YA 3S3MA 1WZ2A 4KIFA 4GFKA 2V9VA 3BLYA 1S6LA 3I54A 3A2KA 2O8KA 5KNLA 2M0CA 2B9SA 3WTSC 2DT5A 5J6XA 3WE2A 2X6XA 4CICA 1VQOI 4NHJA 3CDHA 4I0AA 4RDUA 1ZRFA 3HG9A 1MMGA 3K2ZA 4XR6A 4LG0B 1SFXA 4ZYAA 3GLXA 4ON0A 1DU0A 5TRDA 2RQPA 1AWCA 2E7XA 3CCSI 1P9QC 5LD2C 3AL0B 2BE5F 5CKTA 5EJCA 3E5XA 1SEUA 3CCYA 3C7JA 3BR1A 3ZRGA 2X6OA 1XDSA 1IN7A 2YU9J 2ESHA 3VOKA 4A5NA 1EJ9A 2Q0OA 1TNSA 4ESFA 3TGNA 1X1BA 2VC1A 5GTIC 1IXSB 1HBXG 3LWFA 3M3YJ 1BJZA 3H35A 1XSDA 2HFHA 3HEFA 4LK0F 1FWZA 3LFUA 1YJ9I 2OTLI 2IGNA 2IPQX 2ZXJA 5BPDA 2F4IA 1XGSA 2DMTA 4BS9A 1OYWA 2EIJH 5A2QZ 2K3FA 2UXOA 4A6EA 1WWXA 4EJUA 1BR4A 2ZMEC 1R4MB 1CF7A 4MFDA 2PBXA 3HL2A 3VYUB 2CQ7A 4BUPA 3VP5A 2H8RA 4DZPA 1OCTC 4A0ZA 3BPXA 4MQVA 1UELB 3QBMA 1L3LA 2HTSA 3D5RC 1MMSA 1OPCA 1XCBA 4KITB 3N97A 3FXUA 1Z91A 2Q2EB 4ESBA 4HQEA 3DLLF 1BA5A 3DBRB 2NVXJ 6PAXA 4KN4X 2HDWA 3CJTB 4CCNA 2R7UA 3W2WA 4IRGA 2HOAA 1I1SA 4HRIA 1JHFA 2BEOA 4IZZA 1VQLI 5D8KB 3DKWA 4UB8C 1YLFA 3S2DJ 1FBQA 4ZYDA 3HDDA 1TWCJ 2ECCA 2ZSHB 1R58A 2JT1A 2RGVA 3BWGA 1B4AA 2ELJA 3MEXA 4CZCA 4QWQA 1KYZA 4FT8A 5DDGA 3MQ0A 5HVQC 1O3RA 4EATA 2M8EA 3CCLI 3A02A 4HLYA 1RKWA 4YIIA 1J7KA 3TO6A 1XTAA 3EETA 4QIWN 1W7PA 4BH9A 1WJAA 2BVMA 3H0GJ 2QEXI 2K85A 5CJ9A 3VWBA 2QLZA 2PMZA 3V42A 5J4VA 4YFNF 1YIJI 2GXAA 2IS4A 2DK5A 4I01A 4KFCA 1EA3A 3A03A 3OYCA 2ISYA 3RQ4A 3H5RA 4A3EJ 2NNYA 2ZCXA 5HS7A 1VF9A 3CQZJ 3T6NA 2WV1A 3QWLA 1E3OC 2MD0A 2NP5A 1JUPA 5C4YA 1LDDA 1BIAA 1ETYA 2M2EA 2XAQA 2FU4A 5D8LB 3OMYA 3V7SA 4A12A 1E3HA 4HW0A 4CZZA 4K2EA 5FKKA 4BQNA 1F43A 4B47A 4ETSA 2VJIA 4XOPA 2K9MA 3CCJI 1ETQA 4A3CJ 1Z7LA 2IA2A 4XK4A 2OQRA 1LVKA 2UWMA 2ZCWA 4L5IA 4ENJA 2BVLA 2P7CB 5K5RA 3RZDJ 1RETA 4D5FA 4IHVA 4HAMA 1U9NA 1JGGA 9ANTA 2QTQA 1TZLA 3K4KA 3BNIA 4XLPF 2LBFA 3HSRA 2RQQA 1VQ8I 3DCFA 3JTGA 3BHQA 4XLAA 3HGYA 2ZJQF 3C2BA 4BKXA 1HXDA 3JW4A 4L9JA 5IP7J 5EG0A 1N77A 2VKHA 3I3LA 2WWYA 3TEDA 2QOPA 3L09A 1YITI 4XMYA 3KKCA 2WTEA 3BG3A 3Q0VA 3P9TA 2W85A 3KP6A 2P6SA 2QM3A 4KJZA 4UV9A 1IXRC 3CDIA 3T1BA 2VLAA 2HEOA 3V6GA 3HOXJ 2DFEA 4DJAA 1XPXA 3DWLE 1M1EB 1Q1HA 2LY1A 1YS7A 4XLCA 2QKMB 2HXIA 4EEFG 4MXMA 5D6EA 1LE8B 1MSFC 4R1HA 1HCRA 1ZARA 3KZIC 2D1HA 2JUCA 3G3ZA 2MGQA 2L7MP 1HKQA 2EV6A 3F6VA 2GBYA 3ESWB 3K0LA 3BJBA 2D45A 3PSFA 3FRQA 1P7IA 4I98B 5F0FA 1WKMA 1O3TA 4KISA 3RPQA 1YG2A 3HGGA 1B8IB 4MEYF 1V5EA 5EEHA 2DA2A 1TWAJ 2HZDA 2BXYA 3DV8A 5F64A 4LITA 4E4HA 2Y30A 3H9QA 5B5EC 4QLCU 1X1PA 4L62A 2KHMA 5F1RA 3ZGKA 2K4BA 2VXZA 2GA1A 2P5KA 2HWVA 3FXJA 5J4YA 3IP4B 3D0SA 2GOMA 3VDXA 2P6TA 5H6RA 2MH9A 3CC7I 4L5EA 5GAGJ 5D1RA 4GCVA 4CH7A 4B4CA 2F4MB 1FIPA 2E36A 2FNAA 2OV7A 4TV7A 4XLNF 4P96A 2Y0MA 5GTHC 3GZIA 1HSJA 1P2FA 1ENHA 2EINH 3AG4H 3NNRA 2ZO4A 3S1RJ 3E6CC 3BR3A 3FIWA 5C44J 1W1WE 4BE0A 3SDBA 1MIJA 4UVBA 4UUSB 2CUFA 3GBGA 3JRHA 2CV2A 1FOWA 2QVOA 2OJED 2CH0A 4AUXA 3KP2A 3SJMA 1IUFA 4L5JA 2DK8A 3W2AA 4GFBA 2RASA 3DLAA 1T39A 3G1LA 3OOPA 4J19A 2DQLA 2NAZA 1UMQA 2FBKA 3BTLA 4UV8A 1WQ2A 4JX4A 4M3GA 5KAIC 1ZGWA 2E2HJ 2JWTA 4KUMA 5EGOA 2KRFA 3GTLJ 4WCGA 4BNCA 1WRJA 4ICHA 4RB0A 2X9DA 1RR7A 1ZTRA 3QPHA 5EEGA 4IOAF 3HYIA 3FM5A 1HOMA 3F9KA 3BZKA 3G2BA 3WGGA 5GPCA 3OYMA 1U78A 1QZZA 2K9NA 2LDUA 3RKWA 2JA8J 4M3FA 3IUVA 2XASA 3OL3A 3DPLC 3ZMSA 5J40A 3GTPJ 3BJAA 2UXHA 2HPIA 2RREA 2JK3A 3NQOA 3VUQA 2HQ5A 2JA5J 2FMLA 1VQ7I 2QSHX 1FT9A 3ZN1A 1ZKGA 2LP0A 4QSHA 1W0UA 1TL8A 2LYCA 4A3JJ 2CW7A 4XRSG 3K4JA 1ZYRF 5E3OA 4MTDA 4U7BA 2R5ZA 3MAJA 3IV5A 2W57A 1DP3A 3K4NA 3E7LA 1D5YA 4RMNA 4RM2A 2PFBA 3NPIA 1Z3YA 1ON2A 2MYSA 3IH4A 2V1NA 1Z21A 3K4BA 3F8BA 1ITYA 2VUMJ 1PUFB 1YIOA 4MTEA 1SD7A 1YX5A 3IKVA 4UVCA 3ECOA 3FXQA 2HVQA 3FISA 4BDYA 4HF1A 4PDKA 2ZOYA 4RS8A 3RKXA 1LDKB 3QU3A 1YYVA 3ZQCA 1IN8A 1QZEA 1QHHD 3C1DA 2WV0A 4N0BA 1FJLA 1W0TA 4OIPF 3T8TA 3JREA 3I53A 2IGOA 2DOAA 1MDMA 1XGMA 2H6CA 3TMOA 2KDZA 3J81Z 3GFIA 2Z5UA 1QVUA 3CO6C 1S9HA 4Q4ZF 1Z7UA 2QKOA 4N4NB 2PJRA 3FXRA 1Z1DA 5B3SH 3HUGB 4LGWA 2ECBA 2ZFWA 2B3WA 2K02A 3OR2C 2DN0A 1Z67A 1G3TA 4XICA 4IHTA 4XIDA 5FGMA 3Q9SA 2E60A 2BGCA 1V54H 4A69C 1PDNC 3RH2A 2ZBKA 2UXUA 1Z6TA 2NYXA 1AU7A 3LJLA 3NS4A 2YS9A 3X2QH 5FRMA 3FMRA 1P7JA 3F72A 2J5PA 3CD6I 4P9FA 4IX7A 2VPLA 5E8IA 3LSMA 5JFRA 2CQKA 2XAGA 4L9VA 3A01B 1H9TA 3W6KB 3G71I 1Y0NA 4BE1A 4CYCA 1I6XA 1UG2A 3ULQB 2M3AA 3O8HA 5TJJA 1ETXA 1VZ0A 4P9UA 1AOYA 3J7AY 3KLOA 1B6AA 5K5OA 2EJRA 5HS9A 2LTPA 4XORA 3QOEA 3NI7A 3CUOA 1IZ1A 1R7JA 2CSOA 3B81A 2FOKA 2HPMA 3PM1A 1HLVA 3G4SI 1T38A 1J09A 2DW4A 4IRHA 5H2FC 3GUDA 4X0GA 3U9GA 4A3FJ 4LK1F 4G9YA 3FXLA 3FMSA 2DG7A 4HX4A 1ETKA 4IEJA 3WU2C 4XKCA 4MIMA 4HNTA 3GW2A 4BYYA 3NXCA 2FJI1 4BJ5C 3CLOA 3G56A 2L9NA 3L2RA 1BW6A 3HHHA 4GDFA 1STZA 1JKQC 3SFZA 2XDNA 2E35A 4XSZF 2DOEA 4C3IJ 3KZ9A 5HNFA 2L5QA 1RIOH 3IAM2 2A3SA 4LFUA 2FF4A 2BY0A 1Q1VA 3FXMA 1K83J 2ZY9A 1BI2A 1IDYA 3OY9A 1W5CC 3DF8A 2PMHA 2E1NA 1OCZH 3F8FA 3I59B 4HQMA 3UR3C 4CGZA 2IS1A 2E1MC 3WTVC 4XL9A 1WPKA 2EA2A 2HI3A 1LJ9A 3H3UA 2RNJA 3SXYA 2EZLA 2EWNA 2W4SA 1LEAA 2JUGA 3S16J 3RSNA 3MD2A 2R7OA 4V2GA 4YFKF 4C9YA 3QYFA 2DMQA 1EF4A 2HOSA 3JAMZ 1TT5B 2L02A 2UXIA 3CUQA 4E70A 3HTUA 1VQKI 4DVYP 5F1JA 2B0LA 2R7VA 1LDJA 4OAYA 3VB2A 5FJ8J 2M4KA 5E3LA 2FQ4A 4FE4A 1FOKA 1G8XA 2Z33A 3HC7A 2O61A 2KRCA 2HGCA 2BYVE 3ABMH 5BMZA 2ZXHA 1YW8A 1IN6A 2COMA 3C18A 3G7RA 3RPUD 4XSXF 3HOVJ 3G6EI 2PQ8A 3M4OJ 1D0XA 2OUMA 1BJAA 2JRMA 1QA6A 4A0YA 3HTSB 1FPQA 2E19A 1JJ6C 5LEJA 4EJTA 2VKDA 4HSRA 5KAFC 3IRQA 3BP8A 4U88A 1QO0D 1J2XA 2QBYA 3DTKA 2NVYJ 3H36A 1QHGA 3GO5A 2EV0A 1G4DA 4GFLA 1FYKA 1X58A 3U1DA 3VFZA 3PASA 1T98A 4UXNA 5D5VB 1S5LC 3TOBA 1Z0XA 1XMXA 3D1NI 3HE0A 5CPRB 2ISZA 3K9TA 1OCCH 3HZJA 5GADJ 1R23A 2PX9A 3SHFA 1YX3A 4GXOA 2CO5A 2CUZA 3DBLB 3HRSA 1G6NA 2FD5A 4RAZA 1WJDA 5BNGA 4KWAA 4ABZA 2XGCA 2Q8KA 3ZMVA 4X6AJ 5L3DA 2KFDA 2JA7J 4BGDA 1KA8A 3E7QA 2EQRA 2IP2A 1AA7A 1DU6A 4PJJA 3HM5A 2XRLA 2JPBA 4X1EA 1FSHA 3ON2A 5F0CA 2ZMEA 4HX7A 3H3VK 1FMVA 2W84A 3S3NA 5J1YA 1FOYA 2IW5A 3GFMA 1ODDA 2YR2A 2QA4I 5GP9A 2TCTA 4HV5A 3VEPA 1O7LA 2A6TA 4BQOA 1RI7A 1YJNI 1F4KA 2HU9A 1VQ4I 1D1CA 2PN6A 1UAAA 2XAHA 2O03A 3MZ8A 4B8XA 2G7SA 1ZLKA 4ZH4F 1UJ8A 1Y1VJ 3LSRA 2ZOZA 1B1BA 4UB6C 2ID3A 2YVEA 1TC3C 1FOXA 3K4MA 5CW8A 3VW1A 3K1PA 3ZMZA 3VW2A 2FMYA 4G6DA 3GVAA 1MJBA 4M6XA 2Y0SA 4FQGA 3VSKA 4XRSA 1SAXA 4Y52J 3OYKA 2DA7A 3GTGJ 3TW7A 1BC8C 1ZHFA 2F5DA 1MJ9A 2P8TA 3H0DA 3D5LA 4CUGA 3MMYB 3FKIJ 2FA5A 2ZB9A 2W25A 4JKZA 2DDAA 5L3FA 2IA1A 4DBQA 2MA3A 1ZN2A 4FE7A 3PL8A 2K86A 2N8GA 1I1GA 3ZMTA 3KYCB 3WG9A 2L3DA 3CUQC 3DXJF 4V2FA 2EPFA 1MBGA 3T0YA 1FMWA 3LSJA 3GTMJ 3CRJA 2XUBA 3BZCA 4ITVA 2BW3A 4HDUA 2H1LA 2ZJRF 5KK1A 4U0WA 2DPDA 2XSJC 3HKZN 3SWHA 1VI0A 4M71A 1USTA 3KZZA 3ASOH 3OYBA 3MKLA 3OYLA 4CYDA 3FWEA 2JA2A 3COLA 3GZNB 2Q24A 4ZYHA 1P4AA 1VQ5I 2V7FA 1BL0A 3RTRA 2KMUA 3S14J 3M07A 2LF8A 2NX4A 3LSKA 4XLHA 3CCQI 2QWTA 5FROA 1O4XA 1NTCA 3F21A 4NNJA 1S8NA 3HSEA 3A0BC 4A3IJ 3MCZA 2QF7A 2UXPA 5M5YJ 3ABTA 4O6JA 5LFAA 1B9MA 2XRNA 3HSFA 4L18B 2HKUA 1XN7A 2DOFA 3CO7C 1NK2P 4G12A 1USSA 2A2FX 3EUAA 1LQ1A 3E6BA 3HOZJ 3CZ6A 1ZGAA 4KT6A 3Q3SA 2WBMA 5J1UA 4B3AA 3OYEA 3BR5A 3QODA 3CCRI 2HQAA 4LG0A 1EH8A 2EZIA 4NC7A 4EM1A 4XN0A 4I76A 5BPIA 2O9LA 5FHPA 4BBRJ 2IAIA 3I58A 3F22A 2O7OA 2EA4A 2MD5A 2P7VB 3TOAA 4BACA 1SMTA 3ZR8X 2XPWA 2E71A 2V1UA 3GX4X 1RESA 1S7AA 1RRJA 3N05A 4XRFA 1SFOJ 3AKZA 5CVJA 2VJJA 2YSRA 3R4KA 1ZELA 4U9NA 1D1AA 2VKEA 4UY8I 2TRTA 3KYDB 1U5TC 2OU2A 1YTYA 2A69F 4KT5C 1LFBA 4D7NA 2OBPA 5CVRA 5L3CA 1MGTA 4A6DA 4NC8A 3PUBA 2V79A 2UUZA 1O7FA 3QOPA 2FBIA 3OIOA 1A31A 3ZQFA 3HHGA 1G59A 3MN2A 2KKOA 2OF7A 3BOQA 2IGMA 4HYEA 4JP0A 2HQRA 2Q2EA 5IYCJ 3VW0A 3WTXC 4PFOA 3HOTA 1IAWA 2BHZA 2XF6A 3P9CA 2R92J 2DODA
chains in the Genus database with same CATH topology
4A3GJ 2XPVA 4GFBA 2RASA 3G1LA 4J19A 4S0HB 1YRNB 2KT0A 1FTZA 2OERA 2K40A 1UMQA 3BR2A 3BTLA 3FK6A 4AC6A 5IOYA 4JX4A 4M3GA 1ZGWA 2E2HJ 3AQSA 1IRZA 2JWTA 1OFCX 5EGOA 2CQQA 2GENA 1WGXA 3DPJA 4DYCA 4YZEA 2XGEA 4W1UA 2G7LA 3GTLJ 3RZOJ 3C07A 4ICHA 2X9DA 1RR7A 1ZTRA 2MW8A 1HOMA 1UI5A 5F27A 1I3QJ 5GPCA 1U78A 4NDLA 5FKOA 2K9NA 2XGDA 2JA8J 4A3BJ 4M3FA 3IUVA 3S1QJ 5C4XJ 3TP3A 4GCLA 5E3NA 3GTPJ 4PXIA 2UXHA 3NRGA 1JKOC 3G1MA 2JK3A 5GPAA 3VUQA 4FISA 2Y9YA 2HQ5A 2ELKA 1IGNA 2JA5J 3ZQLA 3CJDA 1NK3P 2L7ZA 1ZKGA 2LP0A 1JJ8C 4QSHA 1W0UA 1AHDP 3JRIA 3UKGA 2M8GX 4A3JJ 2XSDC 1APLC 4XRSG 2R93J 3NARA 5E3OA 3GTQJ 4QTRA 1T33A 2NOGA 2R5ZA 3IV5A 2D5VA 3K2AA 1U9OA 3HOYJ 1GV5A 4IHWA 2OI8A 3E7LA 1D5YA 1VNDA 2ME6A 3FK7A 3NPIA 5IOZA 1X2MA 3IH4A 3I4MJ 2LLKA 2IBDA 1ITYA 3HTHA 2VUMJ 3QPSA 1PUFB 3JR9A 2ME0A 3RQIA 4BXXJ 2REKA 3ANGA 2PMZN 3FISA 4LOCA 5HSZA 2DMUA 2ZOYA 3RKQA 1QPIA 1WH7A 4A93J 2JJ7A 5IP9J 2OPTA 2R7ZJ 3ZQCA 2CUEA 1JTYA 2XB5A 3LSPA 3LNQA 1MBFA 4XRMA 3SDGA 1FJLA 1W0TA 3JREA 4MFEA 1SANA 4I6ZA 3WHBA 2KDZA 5D19A 4BBSJ 1QVUA 2L7FP 3KKDA 3TW6A 3K7AJ 1QRYA 2NS7A 3LWJA 2QKOA 1ZR2A 3JRCA 1FEXA 1RPWA 2RAEA 3BTIA 1LFUP 1G2HA 1LE8A 3MVPA 2ECBA 4DYRA 3PO2J 2M34A 5CXGA 2DN0A 4IHXA 1F36A 1JUMA 1HF0A 4NELA 4XICA 2JMWA 4XIDA 4A69C 4JX5A 4UUTA 3CMYA 3RH2A 3OSGA 2UXUA 3LJLA 1WCMJ 1AU7A 1AKHB 1MH4A 3CDLA 1I50J 3IH3A 2YS9A 1GDTA 3Q0WA 2LY9A 4JX6A 1P7JA 3BT9A 3EGQA 3HTJA 2EZKA 4GCKA 1GV2A 3JRAA 2IU5A 1JT0A 1RKTA 1GVDA 2I10A 5IYBJ 2DTZA 3A01B 2IEKA 4W97A 2COBA 3S1MJ 2HDDA 2YVHA 4JL3A 4HNVA 2DMPA 4CYCA 2K9QA 1UG2A 2FJ1A 2E2JJ 3O8HA 1ETXA 2VPRA 2D6YA 5DAJA 1IJWC 2DMNA 3SFIA 2DA6A 1XS9A 3QQAA 1IG7A 3BTCA 2LTPA 5F08A 1MNMC 3GTJJ 3I4NJ 5FLVA 3NI7A 1JT6A 2VI6A 3ZQGA 3B81A 4RBOA 4JNNA 4BY7J 2FX0A 5JLXA 5EGOB 1MSEC 3PM1A 1MBHA 3HBLA 1HLVA 2QCOA 2EZHA 2WGBA 2Y9ZA 5HAWA 1Y1WJ 3DEWA 4A3FJ 4NN1A 4AC0A 3BQYA 2R5YA 2LD5A 2L0KA 2DG7A 1ETKA 2L9RA 3BTJA 4IEJA 2GFNA 4ME9A 4MIMA 1IC8A 5CXIA 3NXCA 5H9TA 3QKXA 5EDNA 4AF5A 2LVSA 1VFCA 1YRNA 2ID6A 3G56A 1BW6A 5EZGA 1JKQC 2DJNA 2XDNA 2K9SA 4D5CA 4C3IJ 4C2MJ 3KZ9A 5HODA 3HTIA 2LK2A 2EBIA 1Q1VA 3HTAA 1UHSA 1K83J 3BCGA 1IDYA 5IPAA 1R9TJ 2MSYA 3F1BA 2HYTA 5F0HA 3GEUA 5FMPA 1JKPC 1WPKA 2E1OA 2CU7A 1H8AC 2HI3A 2Y2ZA 4M3EA 5IP6A 5J1RA 3BRUA 2DA5A 3B6CA 1ZK8A 2EZLA 5EG0B 1Z77A 5M5WJ 3S16J 3RD3A 4DYQA 4V2GA 2WAQN 1BW5A 1MBJA 1HDPA 2DMQA 1EF4A 2XPUA 4GFKA 2HOSA 2O8KA 3S2HJ 2M0CA 4DZJA 1OJLA 2VKVA 2Y0SN 2UXIA 2YUSA 5F1JA 5FJ8J 5E3LA 1QVTA 2FQ4A 4FE4A 4FCYA 4RDUA 5EZHA 5DS9A 5FKNA 2ZCNA 5JLWA 1DU0A 3GTOJ 3G7RA 2G0EA 3HOVJ 1ETWA 3LOCA 3CCYA 1GT0C 1ETVA 3BR1A 3M4OJ 2X6OA 2GUHA 2E2IJ 2YU9J 1XG1A 3VOKA 2E19A 1JJ6C 1PUFA 1MH3A 5C4JJ 2H1KA 4DW6A 2DA4A 4IHYA 3W6VA 2NVYJ 2CQXA 3M3YJ 1BJZA 4GFLA 3HEFA 1ORKA 1X58A 2G3BA 2RHAA 3PASA 1MBEA 1JKRC 2CRGA 1Z0XA 3GTKJ 3D1NI 1B72A 3HE0A 1JTXA 2DMTA 3VPRA 2UXOA 5FKLA 3PPBA 5EFYA 3VIBA 2FD5A 5BNGA 4KWAA 5FLMJ 4ABZA 2Y31A 2XGCA 4MFDA 1A5JA 4X6AJ 2PBXA 3G1OA 1B8IA 3VP5A 2JA7J 2H8RA 4DZPA 1OCTC 2EQRA 3E7QA 2LKXA 1DU6A 3QBMA 3HM5A 4C3HJ 2XRLA 3TP0A 2NS8A 4X1EA 3ON2A 5F0CA 2DG8A 2XB0X 3AQTA 4FTHA 1BA5A 3H3VK 2NVXJ 3VOXA 3ON4A 3BG9A 4HKUA 5J1YA 3WHCA 1SGMA 4MK6A 2HOAA 4MO7A 5K7ZA 1HDDC 2AHQA 3VVYA 4M3BA 5GP9A 2X48A 1K61A 3QPLA 2TCTA 4C3JJ 1TWFJ 2WUIA 3BG5A 4JYKA 3S2DJ 3CWRA 1WI3A 3V78A 5EEAA 3HDDA 1TWCJ 2ECCA 2G7SA 3A01A 2GM4A 1Y1VJ 3LSRA 2ZOZA 2EH3A 2ID3A 2YVEA 2W48A 1TC3C 3A02A 1FIAA 1RKWA 2R5YB 2CJJA 4UUSA 2FBQA 3ZQHA 4Y7NJ 5CW8A 3VW1A 5HBUA 3VW2A 4QIWN 5DTDA 1X2NA 3VVXA 3H0GJ 4D7MA 4XRSA 4Y52J 4MLOA 2JA6J 3S5RA 3OSFA 4ACIA 4M3DA 2DA7A 3GTGJ 3TW7A 3ZOBA 2NVTJ 5IYDJ 3HB9A 4A3MJ 3A03A 3FKIJ 3O60A 4A3EJ 2ZB9A 2LFBA 2ZCXA 1UI6A 1VF9A 3CQZJ 4JKZA 5EF6A 3T6NA 2WV1A 1IV6A 1E3OC 2QIBA 3JSJA 1FTTA 4FE7A 2NP5A 1IDZA 1JUPA 2N8GA 5C4YA 3S1NJ 1ETYA 2M2EA 3JRBA 4A3KJ 5D18A 1OCPA 3PO3J 2NP3A 2JN6A 3L1PA 4V2FA 3LHQA 5FKKA 1T56A 1F43A 2R5ZB 1MBGA 5M3FJ 5E3MA 3OOUA 1ETQA 3LSJA 2HOTA 3JRDA 3GTMJ 4A3CJ 4XK4A 1TWHJ 5K7FA 3CRJA 1MBKA 2DA1A 2B63J 3HKZN 5FGLA 1VI0A 2LR8A 3RZDJ 1RETA 4D5FA 4IHVA 2NVQJ 1U9NA 1JGGA 9ANTA 3MKLA 2QTQA 3Q0UA 3BNIA 3COLA 2Q24A 5AQCA 4A3DJ 1BL0A 3DCFA 3KNWA 3S14J 3BHQA 3VVZA 3HGYA 2NX4A 3C2BA 4BKXA 2QWTA 1I6HJ 1A6IA 5IP7J 5EG0A 1NTCA 1O4XA 1ETOA 5K58A 3S15J 3TEDA 3HOUJ 2QOPA 4A3IJ 3KKCA 1H89C 1ZQ3P 5J3LA 2QF7A 2UXPA 5M5YJ 1CQTA 4M6VA 3BG3A 3Q0VA 2GLOA 3P9TA 2W53A 2DA3A 2HKUA 3V6GA 3F0CA 1NK2P 1U8BA 4G12A 3HOXJ 1S7EA 1XC5A 5C3EJ 3ANPA 2G7GA 3BR0A 3HOZJ 3MNLA 3ZQIA 2HXIA 1TWGJ 3Q3SA 5J1UA 4B3AA 4EEFG 5K7HA 3BR5A 4MXMA 1LE8B 1MSFC 1HCRA 2EZIA 5F04A 1B72B 3EUPA 3HIMA 3BQZA 4I76A 2O9LA 5FHPA 4BBRJ 4B1RA 3JRFA 2MGQA 2L7MP 2IAIA 2GBYA 4GCTA 3BJBA 2O7OA 3JRGA 2HYJA 3FRQA 1P7IA 5F0FA 2PZ9A 3HGGA 1B8IB 2XPWA 3BR6A 2DA2A 1TWAJ 3NAUA 2R0QC 2Y30A 2MG4A 1RESA 1ZR4A 1WH5A 2AO9A 2O7TA 4L62A 1SFOJ 2F07A 4UDSA 4A3LJ 1H88C 5M5XJ 1JUSA 4CYCB 2VKEA 2TRTA 4BY1J 2P81A 3S17J 5FKMA 2V57A 1AKHA 4D7NA 1LFBA 5M3MJ 4AYBN 3LSGA 1GUUA 4L5EA 5D1RA 4B4CA 1FIPA 3OIOA 5EYRA 3ZQFA 3HOWJ 3GZIA 3MN2A 1POGA 1ENHA 2OF7A 4CGRA 2HXOA 3NNRA 4JP0A 3S1RJ 2ZCMA 2M9HA 3IH2A 5IYCJ 3VW0A 3BR3A 3FIWA 5C44J 2WB1N 3B6AA 2CUFA 3GBGA 4UUSB 3JRHA 4AUXA 2R92J 3SJMA 3O8GA 1IUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G J;  2XPV A;  4GFB A;  2RAS A;  3G1L A;  4J19 A;  4S0H B;  1YRN B;  2KT0 A;  1FTZ A;  2OER A;  2K40 A;  1UMQ A;  3BR2 A;  3BTL A;  3FK6 A;  4AC6 A;  5IOY A;  4JX4 A;  4M3G A;  1ZGW A;  2E2H J;  3AQS A;  1IRZ A;  2JWT A;  1OFC X;  5EGO A;  2CQQ A;  2GEN A;  1WGX A;  3DPJ A;  4DYC A;  4YZE A;  2XGE A;  4W1U A;  2G7L A;  3GTL J;  3RZO J;  3C07 A;  4ICH A;  2X9D A;  1RR7 A;  1ZTR A;  2MW8 A;  1HOM A;  1UI5 A;  5F27 A;  1I3Q J;  5GPC A;  1U78 A;  4NDL A;  5FKO A;  2K9N A;  2XGD A;  2JA8 J;  4A3B J;  4M3F A;  3IUV A;  3S1Q J;  5C4X J;  3TP3 A;  4GCL A;  5E3N A;  3GTP J;  4PXI A;  2UXH A;  3NRG A;  1JKO C;  3G1M A;  2JK3 A;  5GPA A;  3VUQ A;  4FIS A;  2Y9Y A;  2HQ5 A;  2ELK A;  1IGN A;  2JA5 J;  3ZQL A;  3CJD A;  1NK3 P;  2L7Z A;  1ZKG A;  2LP0 A;  1JJ8 C;  4QSH A;  1W0U A;  1AHD P;  3JRI A;  3UKG A;  2M8G X;  4A3J J;  2XSD C;  1APL C;  4XRS G;  2R93 J;  3NAR A;  5E3O A;  3GTQ J;  4QTR A;  1T33 A;  2NOG A;  2R5Z A;  3IV5 A;  2D5V A;  3K2A A;  1U9O A;  3HOY J;  1GV5 A;  4IHW A;  2OI8 A;  3E7L A;  1D5Y A;  1VND A;  2ME6 A;  3FK7 A;  3NPI A;  5IOZ A;  1X2M A;  3IH4 A;  3I4M J;  2LLK A;  2IBD A;  1ITY A;  3HTH A;  2VUM J;  3QPS A;  1PUF B;  3JR9 A;  2ME0 A;  3RQI A;  4BXX J;  2REK A;  3ANG A;  2PMZ N;  3FIS A;  4LOC A;  5HSZ A;  2DMU A;  2ZOY A;  3RKQ A;  1QPI A;  1WH7 A;  4A93 J;  2JJ7 A;  5IP9 J;  2OPT A;  2R7Z J;  3ZQC A;  2CUE A;  1JTY A;  2XB5 A;  3LSP A;  3LNQ A;  1MBF A;  4XRM A;  3SDG A;  1FJL A;  1W0T A;  3JRE A;  4MFE A;  1SAN A;  4I6Z A;  3WHB A;  2KDZ A;  5D19 A;  4BBS J;  1QVU A;  2L7F P;  3KKD A;  3TW6 A;  3K7A J;  1QRY A;  2NS7 A;  3LWJ A;  2QKO A;  1ZR2 A;  3JRC A;  1FEX A;  1RPW A;  2RAE A;  3BTI A;  1LFU P;  1G2H A;  1LE8 A;  3MVP A;  2ECB A;  4DYR A;  3PO2 J;  2M34 A;  5CXG A;  2DN0 A;  4IHX A;  1F36 A;  1JUM A;  1HF0 A;  4NEL A;  4XIC A;  2JMW A;  4XID A;  4A69 C;  4JX5 A;  4UUT A;  3CMY A;  3RH2 A;  3OSG A;  2UXU A;  3LJL A;  1WCM J;  1AU7 A;  1AKH B;  1MH4 A;  3CDL A;  1I50 J;  3IH3 A;  2YS9 A;  1GDT A;  3Q0W A;  2LY9 A;  4JX6 A;  1P7J A;  3BT9 A;  3EGQ A;  3HTJ A;  2EZK A;  4GCK A;  1GV2 A;  3JRA A;  2IU5 A;  1JT0 A;  1RKT A;  1GVD A;  2I10 A;  5IYB J;  2DTZ A;  3A01 B;  2IEK A;  4W97 A;  2COB A;  3S1M J;  2HDD A;  2YVH A;  4JL3 A;  4HNV A;  2DMP A;  4CYC A;  2K9Q A;  1UG2 A;  2FJ1 A;  2E2J J;  3O8H A;  1ETX A;  2VPR A;  2D6Y A;  5DAJ A;  1IJW C;  2DMN A;  3SFI A;  2DA6 A;  1XS9 A;  3QQA A;  1IG7 A;  3BTC A;  2LTP A;  5F08 A;  1MNM C;  3GTJ J;  3I4N J;  5FLV A;  3NI7 A;  1JT6 A;  2VI6 A;  3ZQG A;  3B81 A;  4RBO A;  4JNN A;  4BY7 J;  2FX0 A;  5JLX A;  5EGO B;  1MSE C;  3PM1 A;  1MBH A;  3HBL A;  1HLV A;  2QCO A;  2EZH A;  2WGB A;  2Y9Z A;  5HAW A;  1Y1W J;  3DEW A;  4A3F J;  4NN1 A;  4AC0 A;  3BQY A;  2R5Y A;  2LD5 A;  2L0K A;  2DG7 A;  1ETK A;  2L9R A;  3BTJ A;  4IEJ A;  2GFN A;  4ME9 A;  4MIM A;  1IC8 A;  5CXI A;  3NXC A;  5H9T A;  3QKX A;  5EDN A;  4AF5 A;  2LVS A;  1VFC A;  1YRN A;  2ID6 A;  3G56 A;  1BW6 A;  5EZG A;  1JKQ C;  2DJN A;  2XDN A;  2K9S A;  4D5C A;  4C3I J;  4C2M J;  3KZ9 A;  5HOD A;  3HTI A;  2LK2 A;  2EBI A;  1Q1V A;  3HTA A;  1UHS A;  1K83 J;  3BCG A;  1IDY A;  5IPA A;  1R9T J;  2MSY A;  3F1B A;  2HYT A;  5F0H A;  3GEU A;  5FMP A;  1JKP C;  1WPK A;  2E1O A;  2CU7 A;  1H8A C;  2HI3 A;  2Y2Z A;  4M3E A;  5IP6 A;  5J1R A;  3BRU A;  2DA5 A;  3B6C A;  1ZK8 A;  2EZL A;  5EG0 B;  1Z77 A;  5M5W J;  3S16 J;  3RD3 A;  4DYQ A;  4V2G A;  2WAQ N;  1BW5 A;  1MBJ A;  1HDP A;  2DMQ A;  1EF4 A;  2XPU A;  4GFK A;  2HOS A;  2O8K A;  3S2H J;  2M0C A;  4DZJ A;  1OJL A;  2VKV A;  2Y0S N;  2UXI A;  2YUS A;  5F1J A;  5FJ8 J;  5E3L A;  1QVT A;  2FQ4 A;  4FE4 A;  4FCY A;  4RDU A;  5EZH A;  5DS9 A;  5FKN A;  2ZCN A;  5JLW A;  1DU0 A;  3GTO J;  3G7R A;  2G0E A;  3HOV J;  1ETW A;  3LOC A;  3CCY A;  1GT0 C;  1ETV A;  3BR1 A;  3M4O J;  2X6O A;  2GUH A;  2E2I J;  2YU9 J;  1XG1 A;  3VOK A;  2E19 A;  1JJ6 C;  1PUF A;  1MH3 A;  5C4J J;  2H1K A;  4DW6 A;  2DA4 A;  4IHY A;  3W6V A;  2NVY J;  2CQX A;  3M3Y J;  1BJZ A;  4GFL A;  3HEF A;  1ORK A;  1X58 A;  2G3B A;  2RHA A;  3PAS A;  1MBE A;  1JKR C;  2CRG A;  1Z0X A;  3GTK J;  3D1N I;  1B72 A;  3HE0 A;  1JTX A;  2DMT A;  3VPR A;  2UXO A;  5FKL A;  3PPB A;  5EFY A;  3VIB A;  2FD5 A;  5BNG A;  4KWA A;  5FLM J;  4ABZ A;  2Y31 A;  2XGC A;  4MFD A;  1A5J A;  4X6A J;  2PBX A;  3G1O A;  1B8I A;  3VP5 A;  2JA7 J;  2H8R A;  4DZP A;  1OCT C;  2EQR A;  3E7Q A;  2LKX A;  1DU6 A;  3QBM A;  3HM5 A;  4C3H J;  2XRL A;  3TP0 A;  2NS8 A;  4X1E A;  3ON2 A;  5F0C A;  2DG8 A;  2XB0 X;  3AQT A;  4FTH A;  1BA5 A;  3H3V K;  2NVX J;  3VOX A;  3ON4 A;  3BG9 A;  4HKU A;  5J1Y A;  3WHC A;  1SGM A;  4MK6 A;  2HOA A;  4MO7 A;  5K7Z A;  1HDD C;  2AHQ A;  3VVY A;  4M3B A;  5GP9 A;  2X48 A;  1K61 A;  3QPL A;  2TCT A;  4C3J J;  1TWF J;  2WUI A;  3BG5 A;  4JYK A;  3S2D J;  3CWR A;  1WI3 A;  3V78 A;  5EEA A;  3HDD A;  1TWC J;  2ECC A;  2G7S A;  3A01 A;  2GM4 A;  1Y1V J;  3LSR A;  2ZOZ A;  2EH3 A;  2ID3 A;  2YVE A;  2W48 A;  1TC3 C;  3A02 A;  1FIA A;  1RKW A;  2R5Y B;  2CJJ A;  4UUS A;  2FBQ A;  3ZQH A;  4Y7N J;  5CW8 A;  3VW1 A;  5HBU A;  3VW2 A;  4QIW N;  5DTD A;  1X2N A;  3VVX A;  3H0G J;  4D7M A;  4XRS A;  4Y52 J;  4MLO A;  2JA6 J;  3S5R A;  3OSF A;  4ACI A;  4M3D A;  2DA7 A;  3GTG J;  3TW7 A;  3ZOB A;  2NVT J;  5IYD J;  3HB9 A;  4A3M J;  3A03 A;  3FKI J;  3O60 A;  4A3E J;  2ZB9 A;  2LFB A;  2ZCX A;  1UI6 A;  1VF9 A;  3CQZ J;  4JKZ A;  5EF6 A;  3T6N A;  2WV1 A;  1IV6 A;  1E3O C;  2QIB A;  3JSJ A;  1FTT A;  4FE7 A;  2NP5 A;  1IDZ A;  1JUP A;  2N8G A;  5C4Y A;  3S1N J;  1ETY A;  2M2E A;  3JRB A;  4A3K J;  5D18 A;  1OCP A;  3PO3 J;  2NP3 A;  2JN6 A;  3L1P A;  4V2F A;  3LHQ A;  5FKK A;  1T56 A;  1F43 A;  2R5Z B;  1MBG A;  5M3F J;  5E3M A;  3OOU A;  1ETQ A;  3LSJ A;  2HOT A;  3JRD A;  3GTM J;  4A3C J;  4XK4 A;  1TWH J;  5K7F A;  3CRJ A;  1MBK A;  2DA1 A;  2B63 J;  3HKZ N;  5FGL A;  1VI0 A;  2LR8 A;  3RZD J;  1RET A;  4D5F A;  4IHV A;  2NVQ J;  1U9N A;  1JGG A;  9ANT A;  3MKL A;  2QTQ A;  3Q0U A;  3BNI A;  3COL A;  2Q24 A;  5AQC A;  4A3D J;  1BL0 A;  3DCF A;  3KNW A;  3S14 J;  3BHQ A;  3VVZ A;  3HGY A;  2NX4 A;  3C2B A;  4BKX A;  2QWT A;  1I6H J;  1A6I A;  5IP7 J;  5EG0 A;  1NTC A;  1O4X A;  1ETO A;  5K58 A;  3S15 J;  3TED A;  3HOU J;  2QOP A;  4A3I J;  3KKC A;  1H89 C;  1ZQ3 P;  5J3L A;  2QF7 A;  2UXP A;  5M5Y J;  1CQT A;  4M6V A;  3BG3 A;  3Q0V A;  2GLO A;  3P9T A;  2W53 A;  2DA3 A;  2HKU A;  3V6G A;  3F0C A;  1NK2 P;  1U8B A;  4G12 A;  3HOX J;  1S7E A;  1XC5 A;  5C3E J;  3ANP A;  2G7G A;  3BR0 A;  3HOZ J;  3MNL A;  3ZQI A;  2HXI A;  1TWG J;  3Q3S A;  5J1U A;  4B3A A;  4EEF G;  5K7H A;  3BR5 A;  4MXM A;  1LE8 B;  1MSF C;  1HCR A;  2EZI A;  5F04 A;  1B72 B;  3EUP A;  3HIM A;  3BQZ A;  4I76 A;  2O9L A;  5FHP A;  4BBR J;  4B1R A;  3JRF A;  2MGQ A;  2L7M P;  2IAI A;  2GBY A;  4GCT A;  3BJB A;  2O7O A;  3JRG A;  2HYJ A;  3FRQ A;  1P7I A;  5F0F A;  2PZ9 A;  3HGG A;  1B8I B;  2XPW A;  3BR6 A;  2DA2 A;  1TWA J;  3NAU A;  2R0Q C;  2Y30 A;  2MG4 A;  1RES A;  1ZR4 A;  1WH5 A;  2AO9 A;  2O7T A;  4L62 A;  1SFO J;  2F07 A;  4UDS A;  4A3L J;  1H88 C;  5M5X J;  1JUS A;  4CYC B;  2VKE A;  2TRT A;  4BY1 J;  2P81 A;  3S17 J;  5FKM A;  2V57 A;  1AKH A;  4D7N A;  1LFB A;  5M3M J;  4AYB N;  3LSG A;  1GUU A;  4L5E A;  5D1R A;  4B4C A;  1FIP A;  3OIO A;  5EYR A;  3ZQF A;  3HOW J;  3GZI A;  3MN2 A;  1POG A;  1ENH A;  2OF7 A;  4CGR A;  2HXO A;  3NNR A;  4JP0 A;  3S1R J;  2ZCM A;  2M9H A;  3IH2 A;  5IYC J;  3VW0 A;  3BR3 A;  3FIW A;  5C44 J;  2WB1 N;  3B6A A;  2CUF A;  3GBG A;  4UUS B;  3JRH A;  4AUX A;  2R92 J;  3SJM A;  3O8G A;  1IUF A; 
#chains in the Genus database with same CATH topology
 3ERE D;  4A3G J;  5IT9 K;  4IO9 F;  3K8P C;  2KDO A;  1YRN B;  4JBA A;  3DKY A;  2OER A;  2VXD A;  1JGS A;  1ON1 A;  1HW1 A;  3FK6 A;  4AC6 A;  4Y13 A;  1T8I A;  3AQS A;  1IRZ A;  1OFC X;  1MD0 A;  2CQQ A;  4RA2 A;  1WGX A;  3V4G A;  4DYC A;  1E3P A;  4E6K G;  4W1U A;  4YZE A;  3C07 A;  3RZO J;  4UVA A;  5TGT A;  3HJE A;  1WHU A;  4WF2 A;  2M1B A;  4WXD A;  3LAJ A;  3DPU A;  1KYW A;  4BEH B;  4CDG A;  1D8K A;  3BCB A;  2EIM H;  2GWR A;  3R0A A;  1IUY A;  3A1Y A;  3MZY A;  5LGT A;  3S8P A;  3CCM I;  4A3B J;  4LG3 A;  1NHA A;  3S1Q J;  1LUJ B;  5FD6 A;  1K78 A;  2M87 A;  5E3N A;  3LA2 A;  4PXI A;  4JK1 X;  3MKW B;  1JKO C;  3G1M A;  2UXN A;  4PSX A;  2QQB A;  5GPA A;  5ERI A;  3PQJ A;  3EPZ A;  4FIS A;  2Y9Y A;  2DT7 B;  2ELK A;  3ZQL A;  3KPH A;  2NS0 A;  3C3W A;  5GAH J;  1QPM A;  4DNC A;  2EK5 A;  1R22 A;  2XGX A;  3DTI A;  3IWF A;  4YFX F;  4F55 A;  3KEO A;  1QBJ A;  4G7Z F;  4XBF A;  2M8G X;  4YIF A;  2X1D A;  3V7R A;  3BCA A;  1T33 A;  2L54 A;  2Y69 H;  3WG7 H;  3OIQ A;  3HOY J;  1U9O A;  4E7K A;  1GV5 A;  4IHW A;  3EYI A;  2E1C A;  2Q1Z B;  1IN5 A;  1MJA A;  2FQ3 A;  3SEZ A;  3U2R A;  3EUK L;  2ME6 A;  4KN7 X;  1X2M A;  1VQ9 I;  3I4M J;  3LA3 A;  3AL0 C;  3JR9 A;  2ME0 A;  3U21 A;  3DP7 A;  3P7N A;  3IC7 A;  3RQI A;  4BXX J;  4B43 A;  2O3F A;  4IQ4 A;  4BQA A;  1J59 A;  4RGR A;  2VAS A;  4IJA A;  3OV8 A;  3RKQ A;  3W3C A;  4LJZ F;  1WH7 A;  1QPI A;  1ZGJ A;  4IKF A;  5HDG A;  2VQL A;  2R7Z J;  3OYF A;  2CUE A;  1JTY A;  3SZP A;  2QQ8 A;  1Y8Q B;  1LKX A;  2X6Y A;  4YEJ A;  4MFE A;  4PJN A;  2GXG A;  3LMM A;  4IQJ A;  2IVM A;  3ZN0 A;  2WA0 A;  1Y8R B;  3A4C A;  4OIO F;  2HOE A;  4AIJ A;  3ZXS A;  4C2U A;  2LH9 A;  1OMI A;  1ULY A;  4BBS J;  1R49 A;  1X4O A;  2L7F P;  4ESJ A;  3KKD A;  3K7A J;  1QRY A;  1HQC A;  2NS7 A;  1Z3X A;  2KIM A;  3OR1 C;  1ZR2 A;  4KIG A;  1FEX A;  1RPW A;  1IRX A;  2RAE A;  5LEK A;  2XAF A;  1MND A;  1QQI A;  3HIF A;  4P5O A;  5B1A H;  1LE8 A;  3KX2 A;  1F5T A;  1ZRD A;  2M34 A;  2CUJ A;  1F36 A;  3CJR B;  4R79 A;  2M0M A;  3H3Z A;  1SC7 A;  4JX5 A;  1PVE A;  3ISP A;  3LQQ A;  3CMY A;  3OSG A;  4LLL A;  4HDV A;  1MH4 A;  4PCQ A;  2F2E A;  2FUG 2;  3BDD A;  3CDL A;  2ZJP F;  1GDT A;  1HKS A;  3CP2 A;  1MW7 A;  2YPR A;  4IOC F;  4GCK A;  1GV2 A;  4L9N A;  5D5W B;  4EGY A;  1RKT A;  2I10 A;  2NOJ B;  4IXA A;  2IEK A;  4W97 A;  2COB A;  3FM3 A;  2DBB A;  1PP7 U;  2HVS A;  2O5R A;  4RB2 C;  3DU5 A;  4E7H A;  4JL3 A;  1K79 A;  2FJ1 A;  5D4S A;  2LKP A;  4AU7 A;  3HKZ A;  3LAP A;  2D6Y A;  2DMN A;  1ZRE A;  3PQK A;  2DA6 A;  3EYY A;  4KA4 A;  3QQA A;  2QSF X;  1IG7 A;  2LNB A;  3BTC A;  1MNM C;  3M9A A;  3GTJ J;  4I99 C;  4LMY A;  4E7Z A;  5FLV A;  3I0T A;  1W4M A;  1IN4 A;  5B1B H;  1PJR A;  2LC2 A;  2R7T A;  1FYM A;  3MKZ A;  5JLX A;  5EGO B;  1MSE C;  1RZ4 A;  2DFI A;  1MBH A;  3HBL A;  1IRG A;  1OKR A;  1OLT A;  2W1O A;  5D6F A;  2QCO A;  3L2Q A;  2Y9Z A;  2Y75 A;  2O6G E;  5HAW A;  2CGP A;  2KRH A;  5ED4 A;  3DEW A;  2IT0 A;  4CCM A;  4AC0 A;  1SFU A;  1KQ0 A;  2R5Y A;  4Z2Y A;  2LD5 A;  2M7B A;  2L9R A;  2R7Q A;  3BTJ A;  3ABK H;  1XCV A;  4KMF A;  2LVS A;  1EKE A;  1FBS A;  4V19 K;  1BBY A;  1D5V A;  1EH7 A;  1QNT A;  5EZG A;  2K3P A;  2K9S A;  4ENM A;  4JOM A;  3JSP A;  2H27 A;  2PFV A;  2ACJ A;  4YRV A;  3PNT A;  4HBL A;  2XRO A;  3K70 D;  1R36 A;  5E1Z B;  3WOD F;  2EBI A;  1FZP B;  3F1B A;  2MSY A;  2HYT A;  5F0H A;  4OMY A;  4ZDO A;  1X1A A;  4RLQ A;  2E1O A;  1BOB A;  2VBZ A;  3MFK A;  2Y2Z A;  5LLQ A;  5J1R A;  5DD4 A;  2XC7 A;  3LST A;  4OIQ F;  2DA5 A;  4BU2 A;  4Y4R A;  2EFQ A;  1Z77 A;  3DPT A;  3GFL A;  5M5W J;  2AQF A;  4DYQ A;  2HTJ A;  1HDP A;  2W24 A;  3KEY A;  3L00 A;  2MFZ A;  2XF5 A;  1BR1 A;  2XKP A;  1OCO H;  3FF5 A;  3M1E A;  4ASN A;  1Y39 A;  4DZJ A;  2Y0S N;  2VIX A;  2OZU A;  4O3M A;  1UZC A;  3RYP A;  2DCE A;  3FDY A;  3G73 A;  4FCY A;  4ZZL A;  1TW2 A;  5EZH A;  2V9P A;  5DS9 A;  5FKN A;  2ZCN A;  4GRI A;  5JLW A;  2NXN B;  1TT0 A;  4G7O F;  5E79 C;  1JE8 A;  3ONQ A;  3GTO J;  1A6Q A;  4BL0 B;  3E6M A;  1ETW A;  5HNH A;  1J0R A;  1GT0 C;  1ETV A;  4EJW A;  5J47 A;  2V1X A;  2AQE A;  2K4J A;  1MDM B;  2E2I J;  2ICW G;  2M30 A;  2AXL A;  1PUF A;  3GFJ A;  1MH3 A;  4S05 A;  5ICC A;  3TO7 A;  2DA4 A;  4IHY A;  1C0W A;  3W6V A;  3BPV A;  1XDU A;  2X4H A;  2CW0 F;  2V4J C;  2PJR B;  1HC8 A;  4E7L A;  1ORK A;  5DUK A;  2RHA A;  3E97 A;  4U0Y A;  3CC2 I;  3HRT A;  1B72 A;  1FSE A;  1S29 A;  2BY3 A;  1VQP I;  2CQN A;  1JTX A;  3HOS A;  3VPR A;  1UG0 A;  2VN2 A;  1SD4 A;  2HKX A;  2VOO A;  2ZC2 A;  4D1Q A;  3VIB A;  2V9K A;  1HA8 A;  2LF7 A;  1N25 A;  3KP7 A;  2XDV A;  4BXU A;  4HOB A;  2A61 A;  2KIF A;  5E8G A;  3CC4 I;  1ERD A;  3SZT A;  3OYI A;  3TP0 A;  2NS8 A;  2HQN A;  2VQG A;  1A35 A;  1Y6I A;  5DEQ A;  2DG8 A;  2XB0 X;  3AQT A;  4FTH A;  3K70 C;  2FOW A;  3RI4 A;  4XM3 A;  3ON4 A;  3VOX A;  3BG9 A;  1IO2 A;  1T6S A;  2HYG D;  4D9J A;  3LFK A;  1XMK A;  3WHC A;  2OQG A;  1UFM A;  4MO7 A;  5K7Z A;  4MK6 A;  4GGG A;  1SVM A;  2X1C A;  2DAO A;  1RC9 A;  4DBR A;  4EM2 A;  4C3J J;  4I09 A;  2LG4 A;  2WUI A;  2HKO A;  2KJB A;  3BG5 A;  3QP6 A;  4GYG A;  4KMU X;  1UHM A;  3V78 A;  4AWX B;  1I39 A;  3ML6 A;  3A01 A;  3IHU A;  5CVU A;  4MEX F;  2NVU B;  3V8J A;  5AIP A;  2GM4 A;  2W48 A;  3D5S C;  1FIA A;  2ZKZ A;  2WAQ A;  5CVV A;  2OD5 A;  3ZQH A;  2LKS A;  3ABL H;  5AIQ A;  5FLX K;  5HBU A;  1LB2 A;  4HPQ A;  2GIZ A;  3L2W A;  1X2N A;  3VOD A;  3VVX A;  5DM7 F;  4UUV A;  4D7M A;  4G6T B;  4CCO A;  2JA6 J;  2H94 A;  1OYI A;  3OSF A;  3S5R A;  4ACI A;  5L3E A;  3E1S A;  3ZOB A;  1I27 A;  4KNY A;  1TP4 A;  2CFO A;  2L9S A;  3HB9 A;  5IYD J;  2JSP A;  1UCR A;  2LFB A;  4AD9 A;  2FE3 A;  5EF6 A;  3RKY A;  3REO A;  1IV6 A;  2VBY A;  2KP6 A;  4AM3 A;  3S93 A;  4CCJ A;  3PNY A;  1IDZ A;  3OS2 A;  3JRB A;  1WSU A;  1V5F A;  2PMU A;  5D18 A;  2ELH A;  1SAU A;  5DUI A;  3RPU A;  2JN6 A;  4RGU A;  3L1P A;  3ASN H;  1GXQ A;  2JQ7 A;  4M72 A;  3NWS A;  2E34 A;  2VON A;  4EV0 A;  5E3M A;  3OOU A;  3FHZ A;  3H5N A;  4EMS A;  5JVG F;  2DA1 A;  1OYY A;  2B63 J;  5FGL A;  3B73 A;  2LR8 A;  5DD8 A;  4L9T A;  2GXB A;  1YJW I;  5LBQ A;  4PGG A;  2VB6 A;  1O57 A;  2A6H F;  1MMA A;  3I59 A;  3P9K A;  2PLY A;  1UB9 A;  3F8M A;  4A3D J;  5DCM A;  1F9N A;  1WJE A;  4I0B A;  1A6I A;  1ETO A;  4GYI A;  2VOD A;  3S15 J;  3DU6 A;  1U2W A;  3HOU J;  1EV7 A;  1H89 C;  1RUN A;  1ZQ3 P;  1XSX A;  3W6J B;  5FRN A;  3AFH A;  5CLS A;  2HVR A;  2H8W A;  1J9I A;  2DA3 A;  3EUH A;  3OL4 A;  3F0C A;  1XGO A;  3PUF A;  1XC5 A;  5J8C A;  2QBY B;  5C3E J;  3ANP A;  2Z1D A;  4J00 A;  3GZ6 A;  3CCU I;  2G7G A;  2A5W A;  3ZQI A;  1FYL A;  3R60 A;  2DI3 A;  1N75 A;  3ZQQ A;  2F5E A;  5F04 A;  4ANJ A;  4HV6 A;  3HIM A;  3VYR B;  2Z9O A;  4IVN A;  2ZSI B;  4FHT A;  4B1R A;  5DM6 F;  1VQN I;  3H92 A;  3JRG A;  3M8E A;  4L0Z B;  2L4M A;  2PZ9 A;  5LHH A;  1S3J A;  3I4P A;  3FMQ A;  1SFK A;  1VQ6 I;  4CXF A;  2GQQ A;  3NAU A;  2R0Q C;  4OMZ A;  1H0M A;  1D1B A;  2MG4 A;  4XKV A;  4ZC3 A;  3PNV A;  1KU9 A;  1WH5 A;  2AO9 A;  2ETH A;  3NWT A;  4ZYG A;  2WAF A;  1HW2 A;  1RUO A;  2F07 A;  4UDS A;  4A3L J;  3FX3 A;  3GZ5 A;  1R1U A;  1GXP A;  5M5X J;  2ZME B;  3Q9V A;  3TBI A;  1DGR M;  4IRI A;  4BY1 J;  2E5N A;  4WK8 F;  2P81 A;  2OZ6 A;  1IW7 F;  1H9G A;  3SZG A;  3S17 J;  5FKM A;  2V57 A;  1AKH A;  3GME A;  3F6O A;  1SVL A;  3ECH A;  2H09 A;  2HZT A;  3LSI A;  4NQW A;  2ZFU A;  3HOW J;  3BG6 A;  2G7H A;  4CGR A;  2HXO A;  2KPM A;  4UNO A;  4OD5 A;  1T95 A;  2MH2 A;  1U5T A;  2L01 A;  5TIS C;  4HLX A;  2WB1 N;  4PJL A;  4PGH A;  2K9L A;  4EM0 B;  3B6A A;  2YVX A;  5ILU A;  1HKT A;  4IL6 C;  3TDZ C;  2CG4 A;  3O8G A;  3I5U A;  4F91 B;  4II2 A;  4FX4 A;  3CCE I;  2QKL B;  4HST A;  1W36 D;  2LMD A;  3ZMU A;  3BR2 A;  1E2X A;  3K1M A;  3OS1 A;  1LPQ A;  1PYV A;  2WC2 A;  5IOY A;  2IJL A;  4RB3 C;  1KU7 A;  1T0F A;  4G94 A;  2A68 F;  3GXO A;  1Y56 A;  2GEN A;  3DPJ A;  1O3S A;  1YO5 C;  4P55 A;  4LD5 A;  1FY7 A;  3E5Q A;  4OOI A;  1OR7 C;  2MW8 A;  3LL7 A;  1UI5 A;  2Z99 A;  5F27 A;  1I3Q J;  4NC6 A;  2IS6 A;  2RV8 A;  1E0E A;  4NDL A;  2XAJ A;  4GCL A;  5C4X J;  5ICF A;  3K10 A;  2ESN A;  3VOE A;  4AID A;  3CF5 F;  2BW3 B;  1WJC A;  1FBU A;  5KCM A;  1DPR A;  2F4O B;  3L9F A;  4HG2 A;  3OYD A;  1YW9 A;  1DUX C;  4IPA A;  1IGN A;  1WJ5 A;  3CJD A;  1NK3 P;  1GHC A;  1JJ8 C;  5IT9 Z;  2D2W A;  3L7W A;  1FC3 A;  2LSO A;  2P4W A;  3UKG A;  3EUH C;  2XSD C;  2KQR A;  1DPU A;  1WVR A;  1P4W A;  3T5X A;  1G3Y A;  1GLN A;  5K1Y A;  2NOG A;  2DYS H;  3TDU C;  5BS6 A;  5LRR A;  3CME I;  2V26 A;  3GWZ A;  1ZG3 A;  4F3Q A;  2W7N A;  4ZJZ A;  1BIB A;  1IRF A;  2OI8 A;  3KYL A;  3RJP A;  3I9V 2;  1VND A;  2G9W A;  3FK7 A;  1F1Z A;  5IOZ A;  1L0O C;  2LLK A;  3HTH A;  2VL8 A;  4RAF A;  2C6Y A;  3BJ6 A;  3FHN A;  1V4R A;  1U6G A;  3ANG A;  3ELK A;  5LRS A;  4LOC A;  4DOZ A;  5HSZ A;  3BY6 A;  2DMU A;  3J7A O;  5L3B A;  2PI0 A;  4AYB A;  4G7H F;  2FSW A;  2JJ7 A;  5IP9 J;  4B44 A;  2MBF A;  1QGP A;  1ONV A;  2WY8 Q;  2BV6 A;  4BE2 A;  4DGW B;  4ZYE A;  3LNQ A;  1MMN A;  4PUS A;  2R7S A;  3OIP A;  4MHG A;  2MC4 A;  1SAN A;  1EH6 A;  4I6Z A;  1K4T A;  3OS0 A;  2DFF A;  1CF7 B;  1W36 C;  1LFP A;  3E0J B;  3TW6 A;  2VJ4 A;  1Y0U A;  3BTI A;  3PJR A;  1LFU P;  1OIS A;  4AVZ A;  4I2O A;  3V7C A;  1G2H A;  3I64 A;  3I56 I;  1P4X A;  3MVP A;  1NG7 A;  1ZG5 A;  2IXS A;  2OA4 A;  2CV1 A;  1R4N B;  1XGN A;  1R5I D;  3F8C A;  3P5J A;  5HLH A;  1JUM A;  1TQM A;  4IHX A;  3QPT A;  4NEL A;  5J8F A;  2EIK H;  3E3V A;  3KFW X;  4RM3 A;  4BQQ A;  1WCM J;  4C2T A;  1KQ8 A;  4II3 A;  2OAZ A;  3PIP F;  5BOX A;  4LB5 A;  3B02 A;  1KZH A;  4WIB A;  1SMY F;  1MNE A;  3E5U A;  5ICG A;  2QSG X;  2E7W A;  3EGQ A;  3HTJ A;  1NG6 A;  2EZK A;  3CMA I;  2LRE A;  3PIO F;  3JRA A;  1JT0 A;  1O3Q A;  2DTZ A;  3EQL F;  3AG2 H;  4Y33 A;  2AXT C;  4WXC A;  3S1M J;  2FXA A;  2HDD A;  1A36 A;  3ZQ7 A;  1ZH5 A;  4IRV A;  2DMP A;  1T0F C;  4KYW A;  1TQI A;  1OCR H;  2QZ8 A;  2WAD A;  2VPR A;  1IJW C;  3KP3 A;  2VJ5 A;  1LNW A;  3DEU A;  2F5V A;  2QYO A;  4IHS A;  3RDI A;  5F08 A;  2JZY A;  2ZNZ A;  5FB2 A;  4XKB A;  3IL2 A;  3AG3 H;  2I5U A;  5JVT A;  2VI6 A;  4M6Y A;  5D5U B;  4RBO A;  4JNN A;  1PUE E;  1V3F A;  2WY7 Q;  4MGR A;  3BZ6 A;  2J5O A;  2EZH A;  2WGB A;  2ZNY A;  1Y1W J;  4AVP A;  2D1V A;  2HNH A;  2BOL A;  3P9I A;  2L0K A;  3KCC A;  4NBQ A;  2DFH A;  4ME9 A;  2KZV A;  3O3K A;  3WGH A;  4PJ0 C;  1IC8 A;  3VYS B;  3WGI A;  4ZTF A;  5HDN A;  3QKX A;  5EDN A;  4AF5 A;  4CA0 A;  1YRN A;  1K78 B;  3S3O A;  3K4L A;  4ZDL A;  4CCK A;  1R1T A;  4D5C A;  1SD6 A;  2W82 A;  3DQV C;  5HOD A;  2VT3 A;  3KP4 A;  3R0J A;  4WX9 A;  3HTA A;  3K69 A;  1UHS A;  4KDP A;  5IPA A;  2QUF A;  4BEH A;  4NB5 A;  2LBF B;  3GEU A;  4BJT A;  1JKP C;  1FP1 D;  1WJB A;  2CU7 A;  4M9S A;  4EQQ A;  4B3X A;  1WI9 A;  5IP6 A;  2P5L C;  4LIU A;  5H20 A;  1K6O A;  3BRU A;  5EG0 B;  1ZK8 A;  1W7P D;  1TLH B;  2UZK A;  1BI1 A;  5ILS A;  3ROU A;  2UV1 A;  4UHT A;  2WAQ N;  1BW5 A;  2PG4 A;  1MBJ A;  3ABU A;  2Y48 A;  4RB1 A;  2DU9 A;  2XPU A;  4A0X A;  3S2H J;  5K5Q A;  1VTN C;  1JXS A;  2OCE A;  1OJL A;  2VKV A;  3CMM A;  3KP5 A;  4BAY A;  5A2Q K;  2YUS A;  3DKX A;  1NH3 A;  2NRA C;  1G3S A;  1IV8 A;  1QVT A;  3HPG A;  1OQY A;  2CS3 A;  1BM9 A;  4ZDP A;  4BXF A;  2DXI A;  1N78 A;  2JVG A;  4CO8 A;  3I55 I;  1R71 A;  2HYF A;  2G0E A;  5JHU A;  2O0Y A;  2VQC A;  2BHY A;  3LOC A;  3PFY A;  1PP8 F;  2X1E A;  5D5X B;  2GIV A;  2GUH A;  1I5Z A;  2LRD A;  1XG1 A;  4B48 A;  2CWE A;  2RNG A;  1YQA A;  1X19 A;  2XAU A;  4RGS A;  1SVO A;  2WB1 A;  3N4M A;  5C4J J;  2H1K A;  2JRT A;  4DW6 A;  1G3W A;  2YX7 A;  1TBX A;  4EVI A;  3WTW C;  3IWZ A;  2CQX A;  3FXO A;  4MQ9 F;  2V6C A;  3WU1 B;  5DV5 A;  2DQR A;  3GEZ A;  2LY2 A;  2G3B A;  1MBE A;  2RN7 A;  1JKR C;  2CRG A;  2K7L A;  1B9N A;  3GTK J;  1CGP A;  4LLN A;  1R5H A;  1X3U A;  1RNL A;  4FAS D;  2R7W A;  2M45 A;  2OCC H;  3OYG A;  2JPC A;  4F7Z A;  4DQ2 A;  5FKL A;  1D3Y A;  3PPB A;  5EFY A;  2K5C A;  5DCF A;  1SFE A;  3LQR A;  3C2G A;  5CVI A;  4PK4 A;  4CHU A;  2W00 A;  5FLM J;  1BI0 A;  2Y31 A;  1A5J A;  3WTU C;  3G1O A;  1B8I A;  2CFX A;  2QQ9 A;  2GOX B;  3O6B B;  2DT6 A;  1YOV B;  2F48 A;  3CCV I;  2DTR A;  3DFG A;  2LKX A;  4C3H J;  3QRF F;  2VE9 A;  3KIO A;  2R7R A;  2F5C A;  4Q48 A;  1X3Z B;  1P92 A;  3M1C A;  2X0L A;  2DPU A;  4HKU A;  1FNN A;  3KE2 A;  3H9G A;  3WTT C;  2F6C A;  1YI2 I;  1SGM A;  3F3X A;  2OC6 A;  1HDD C;  2AHQ A;  3VVY A;  4ZZD A;  4M3B A;  2X48 A;  1K61 A;  3QPL A;  1X3W B;  1TWF J;  3J7Y J;  3GCM A;  2V6E A;  3CWR A;  4JYK A;  1WI3 A;  2RKH A;  5EEA A;  4Z6Y A;  1V55 H;  3F23 A;  2AS5 F;  2R3S A;  4Y3O A;  3TL4 X;  4N9H A;  2DLL A;  2EH3 A;  2ZJ2 A;  3VTI A;  3TKY A;  1IF1 A;  2R5Y B;  2CJJ A;  4UUS A;  1YHQ I;  2FBQ A;  2VT2 A;  4Y7N J;  1XD7 A;  4U87 A;  5DTD A;  4ENK A;  2R7X A;  1W5S A;  2QEN A;  3L2C A;  4MLO A;  2KIS A;  3PSI A;  2ZXI A;  4U9L A;  4M3D A;  1ACI A;  5H6Q A;  2NVT J;  2V1D A;  2TDX A;  1S7O A;  4Y17 A;  4XOT A;  1MMD A;  4A3M J;  3O60 A;  2R7D A;  2QGU A;  3NRV A;  2Z2S B;  4LIV A;  1UI6 A;  3COA C;  3H1C A;  2PJP A;  2EB7 A;  4F92 B;  2QIB A;  1DGW Y;  4RLF A;  3JSJ A;  1FTT A;  1X4P A;  3JSO A;  3KEQ A;  2M4G A;  3S1N J;  5ICE A;  4A3K J;  4WXH A;  1OCP A;  3PO3 J;  2DO7 A;  1W7P B;  3OYA A;  1XSV A;  3MKY B;  3VYT B;  2NP3 A;  3LHQ A;  2VC0 A;  1T56 A;  2R5Z B;  4J01 A;  3IUO A;  5M3F J;  1QU3 A;  3M7G A;  3Q5F A;  2HOT A;  3JRD A;  5K7F A;  1TWH J;  2Z16 A;  3SEQ A;  1MBK A;  4C2M A;  4H0E A;  2FEZ A;  4KIB A;  3A0H C;  2MLK A;  2XHK A;  2STW A;  5FLX Z;  2E1M B;  3H5A A;  2NVQ J;  3Q0U A;  4YG2 F;  4F93 B;  2XF7 A;  3SQN A;  1LEB A;  3ZCO A;  2EV5 A;  3CJQ B;  2GAU A;  5JR3 A;  3BJO A;  5AQC A;  3KNW A;  4E7I A;  3ERM A;  3WTZ A;  3VVZ A;  4D0P A;  3FXK A;  2VBX A;  4HA8 A;  4ENN A;  1I6H J;  1B59 A;  3FBN B;  2YX4 A;  4I02 A;  4PZJ A;  3OWT A;  5K58 A;  2KIU A;  3HRU A;  3JTH A;  1U0J A;  2GA2 A;  2PBI A;  3FKJ A;  5E18 F;  5J3L A;  3CES A;  1D0Z A;  3QAH A;  4YEL A;  1CQT A;  4M6V A;  2GLO A;  4N9I A;  1LVA A;  2W53 A;  1BOA A;  2FNP A;  4U7D A;  3WU0 A;  1MZB A;  1U8B A;  1S7E A;  4OIR F;  1YW7 A;  4IF4 A;  1BN5 A;  2EIL H;  2WAE A;  1Z9C A;  2IRF G;  3BR0 A;  3MNL A;  1TTY A;  3L2V A;  4CSW A;  4Q5S F;  2M5W A;  3FBI B;  2B1E A;  4O5V A;  1TWG J;  5K7H A;  4E7J A;  4AIH A;  4EJO A;  1B72 B;  2JTV A;  3EUP A;  3ZMD A;  3BQZ A;  1FX7 A;  4OIN F;  4PJM A;  3JRF A;  3RYR A;  3OYN A;  4GCT A;  1HST A;  4U0V A;  3MWM A;  2HYJ A;  4XKW A;  5L3G A;  4GO1 A;  1HW5 A;  2X85 A;  3BR6 A;  3I71 A;  3R61 A;  5LGN A;  2UXX A;  5DYM A;  1ZR4 A;  2HS5 A;  2CYY A;  3SYT A;  2O7T A;  4M9Z A;  2KL4 A;  3HUG A;  3UNG C;  2R7F A;  5JI6 A;  5JHF A;  1H88 C;  4G8X A;  1JUS A;  4CYC B;  1ZAO A;  4R8H A;  1UHW A;  2XIG A;  4RGX A;  2BXZ A;  2VOP A;  3W2V A;  2VQH A;  5M3M J;  4AYB N;  3LSG A;  1GUU A;  4OU0 A;  1KGS A;  5HLT A;  1VQM I;  1JHH A;  2FRH A;  2MAB A;  5EYR A;  3ZP5 A;  1POG A;  3RCO A;  4FX0 A;  4M9X A;  1MKM A;  5IT3 A;  4HF2 A;  1BC7 C;  3J80 Z;  2XV4 S;  4M74 A;  5HLI A;  2ZCM A;  2HDC A;  2M9H A;  2ZXW H;  3NEU A;  3IH2 A;  2X51 A;  3BC8 A;  3C2H A;  2QWW A;  2OTJ I;  4HEA 2;  1K6Y A;  2O8X A;  2XPV A;  2BY2 A;  3KET A;  4OWR B;  5KVR A;  3KLN A;  4S0H B;  4HZF A;  3H9J A;  2KT0 A;  1FTZ A;  4G6Q A;  2K40 A;  2FBH A;  3O2P E;  1R5G A;  5CYV A;  2CV0 A;  5BQT A;  3M8F A;  4LLG F;  1T08 B;  5AON A;  1XB4 A;  2P0W A;  1A04 A;  3AAF A;  1ZG1 A;  5ILV A;  2XGE A;  2G7L A;  1DDN A;  3GF2 A;  1U3E M;  3DTE A;  4HX8 A;  1XX5 A;  4AIK A;  2KZG A;  4BHC A;  4E7S A;  1WFX A;  4RAG A;  2JVH A;  3CTA A;  1BI3 A;  5FKO A;  2XGD A;  4LB6 B;  4BHB A;  1KU2 A;  3K6G A;  2A07 F;  3QP5 A;  3TP3 A;  4F52 A;  1KON A;  4FET A;  4OAZ A;  1J5Y A;  3M8J A;  2DJI A;  3NRG A;  2CW8 A;  3CF2 A;  3V8L A;  5B66 C;  3OYH A;  2HR3 A;  4XNF A;  2STT A;  1OR7 A;  4BJ6 C;  3VSL A;  2KLO A;  2LOO A;  5FFZ A;  2I8D A;  1V5G A;  2L7Z A;  5FO5 A;  3CUQ B;  3TQN A;  2L9V A;  2VBW A;  4XON A;  4L0Y B;  4BHP A;  1SD5 A;  1AHD P;  3JRI A;  4WWC A;  1APL C;  2DDB A;  5DCM B;  2R4G A;  2R93 J;  3J81 K;  3NAR A;  2KIQ A;  3GTQ J;  4QTR A;  1K4S A;  3J7Z I;  3BRO A;  3QU6 A;  2QQA A;  2D5V A;  3K2A A;  5F6F A;  3HXL A;  3R6S A;  1YE9 A;  4M73 A;  2BBY A;  2X6W A;  1R00 A;  2A5Y B;  3PFI A;  5E1W A;  2IBD A;  2VE8 A;  3AG1 H;  3QPS A;  1ZRC A;  3S2W A;  2CMP A;  2RC4 A;  5LHG A;  2JSC A;  1JI8 A;  3QYB A;  2REK A;  1U8R A;  2PMZ N;  4ZTJ A;  2EFO A;  5CQE A;  5E17 F;  2M7A A;  4A93 J;  2OPT A;  2DYR H;  2XB5 A;  1K7A A;  3LSP A;  2XKO A;  1MBF A;  1W5T A;  4XRM A;  2EFW A;  2RVC A;  3SDG A;  5IY5 H;  3J80 K;  2BZT A;  2NNN A;  2BY1 A;  3T8R A;  4CCL A;  1WJF A;  4JQF A;  3WHB A;  5FD5 A;  1QZY A;  2RDP A;  4A5M A;  5D19 A;  4N4O B;  4B09 A;  3S32 A;  3LWJ A;  1E17 A;  3V8K A;  2F5F A;  3JRC A;  5D4R A;  5LGU A;  4DIQ A;  3EDP A;  1RR8 C;  3CP8 A;  3WTY C;  3OYJ A;  1REP C;  4DYR A;  3PO2 J;  5CXG A;  4XLF A;  2H6B A;  4Q47 A;  1HF0 A;  1ZLJ A;  1IXC A;  3F8N A;  3LSH A;  2IS2 A;  3HRM A;  2JMW A;  1R1V A;  4UUT A;  5GAE J;  4HNU A;  3CJN A;  2P5V A;  1AKH B;  1FLI A;  2IGK A;  2A6E F;  4MNU A;  1I50 J;  1P6R A;  2IA0 A;  3DBH B;  3IH3 A;  3JCU C;  1GVJ A;  4EJV A;  3Q0W A;  5CQG A;  2LY9 A;  1XMA A;  4JX6 A;  5FFX A;  3BT9 A;  2L4A A;  4NQW B;  1X1D A;  3TO9 A;  3L2U A;  5HS8 A;  2IU5 A;  2XVC A;  1GVD A;  5IYB J;  5HLG A;  1D8J A;  2YVH A;  5LHI A;  1J75 A;  4BDZ A;  1U5T B;  4HNV A;  2K9Q A;  4XN3 A;  5KHD A;  2B7E A;  2E2J J;  4PSW A;  5DAJ A;  2MLG A;  3K1N A;  3HPH A;  3SFI A;  2KJC A;  1XS9 A;  4H4K C;  4KIC A;  3I4N J;  1X1C A;  3WE3 A;  1JT6 A;  4QPQ A;  3ZQG A;  4BY7 J;  2FX0 A;  2L2O A;  3KZY A;  2A05 A;  4HF0 A;  2MC3 A;  5HDK A;  4OD4 A;  3K4C A;  2YU3 A;  1FP2 A;  1Z6R A;  1TQP A;  2E5Z A;  3BG7 A;  4QPO A;  4NN1 A;  3BQY A;  5HOO A;  2Z3Y A;  3JAM K;  1DP7 P;  2GFN A;  3RIR A;  1T2K A;  4I7H A;  5CXI A;  2ADU A;  5H9T A;  4A2U A;  4NUB A;  1YFH A;  2G7U A;  4P1W A;  1DQU A;  1VFC A;  2ID6 A;  1BR2 A;  1TW3 A;  2EFN A;  1YS6 A;  2DJN A;  4YIR X;  2PEX A;  2EFP A;  1I3A A;  2K27 A;  1TNT A;  4C2M J;  2GZW A;  3HTI A;  2L7K A;  2LK2 A;  5E20 A;  4C30 A;  3BCG A;  3CLQ A;  1R6R A;  3QYE A;  1KQ9 A;  1R9T J;  3IAS 2;  1S72 I;  3IKT A;  3MZH A;  4Y15 A;  1KU3 A;  5FMP A;  4XQF A;  4EGZ A;  4XLE A;  3DEE A;  1H8A C;  4RAY A;  5E1X A;  4M3E A;  3GYH X;  3LA7 A;  3ZPL A;  3B6C A;  4PFP A;  1Z05 A;  3IRR A;  3GLL A;  3E6D A;  3RD3 A;  3FZV A;  3U1K A;  4S04 A;  1D0Y A;  3S3M A;  1WZ2 A;  4KIF A;  4GFK A;  2V9V A;  3BLY A;  1S6L A;  3I54 A;  3A2K A;  2O8K A;  5KNL A;  2M0C A;  2B9S A;  3WTS C;  2DT5 A;  5J6X A;  3WE2 A;  2X6X A;  4CIC A;  1VQO I;  4NHJ A;  3CDH A;  4I0A A;  4RDU A;  1ZRF A;  3HG9 A;  1MMG A;  3K2Z A;  4XR6 A;  4LG0 B;  1SFX A;  4ZYA A;  3GLX A;  4ON0 A;  1DU0 A;  5TRD A;  2RQP A;  1AWC A;  2E7X A;  3CCS I;  1P9Q C;  5LD2 C;  3AL0 B;  2BE5 F;  5CKT A;  5EJC A;  3E5X A;  1SEU A;  3CCY A;  3C7J A;  3BR1 A;  3ZRG A;  2X6O A;  1XDS A;  1IN7 A;  2YU9 J;  2ESH A;  3VOK A;  4A5N A;  1EJ9 A;  2Q0O A;  1TNS A;  4ESF A;  3TGN A;  1X1B A;  2VC1 A;  5GTI C;  1IXS B;  1HBX G;  3LWF A;  3M3Y J;  1BJZ A;  3H35 A;  1XSD A;  2HFH A;  3HEF A;  4LK0 F;  1FWZ A;  3LFU A;  1YJ9 I;  2OTL I;  2IGN A;  2IPQ X;  2ZXJ A;  5BPD A;  2F4I A;  1XGS A;  2DMT A;  4BS9 A;  1OYW A;  2EIJ H;  5A2Q Z;  2K3F A;  2UXO A;  4A6E A;  1WWX A;  4EJU A;  1BR4 A;  2ZME C;  1R4M B;  1CF7 A;  4MFD A;  2PBX A;  3HL2 A;  3VYU B;  2CQ7 A;  4BUP A;  3VP5 A;  2H8R A;  4DZP A;  1OCT C;  4A0Z A;  3BPX A;  4MQV A;  1UEL B;  3QBM A;  1L3L A;  2HTS A;  3D5R C;  1MMS A;  1OPC A;  1XCB A;  4KIT B;  3N97 A;  3FXU A;  1Z91 A;  2Q2E B;  4ESB A;  4HQE A;  3DLL F;  1BA5 A;  3DBR B;  2NVX J;  6PAX A;  4KN4 X;  2HDW A;  3CJT B;  4CCN A;  2R7U A;  3W2W A;  4IRG A;  2HOA A;  1I1S A;  4HRI A;  1JHF A;  2BEO A;  4IZZ A;  1VQL I;  5D8K B;  3DKW A;  4UB8 C;  1YLF A;  3S2D J;  1FBQ A;  4ZYD A;  3HDD A;  1TWC J;  2ECC A;  2ZSH B;  1R58 A;  2JT1 A;  2RGV A;  3BWG A;  1B4A A;  2ELJ A;  3MEX A;  4CZC A;  4QWQ A;  1KYZ A;  4FT8 A;  5DDG A;  3MQ0 A;  5HVQ C;  1O3R A;  4EAT A;  2M8E A;  3CCL I;  3A02 A;  4HLY A;  1RKW A;  4YII A;  1J7K A;  3TO6 A;  1XTA A;  3EET A;  4QIW N;  1W7P A;  4BH9 A;  1WJA A;  2BVM A;  3H0G J;  2QEX I;  2K85 A;  5CJ9 A;  3VWB A;  2QLZ A;  2PMZ A;  3V42 A;  5J4V A;  4YFN F;  1YIJ I;  2GXA A;  2IS4 A;  2DK5 A;  4I01 A;  4KFC A;  1EA3 A;  3A03 A;  3OYC A;  2ISY A;  3RQ4 A;  3H5R A;  4A3E J;  2NNY A;  2ZCX A;  5HS7 A;  1VF9 A;  3CQZ J;  3T6N A;  2WV1 A;  3QWL A;  1E3O C;  2MD0 A;  2NP5 A;  1JUP A;  5C4Y A;  1LDD A;  1BIA A;  1ETY A;  2M2E A;  2XAQ A;  2FU4 A;  5D8L B;  3OMY A;  3V7S A;  4A12 A;  1E3H A;  4HW0 A;  4CZZ A;  4K2E A;  5FKK A;  4BQN A;  1F43 A;  4B47 A;  4ETS A;  2VJI A;  4XOP A;  2K9M A;  3CCJ I;  1ETQ A;  4A3C J;  1Z7L A;  2IA2 A;  4XK4 A;  2OQR A;  1LVK A;  2UWM A;  2ZCW A;  4L5I A;  4ENJ A;  2BVL A;  2P7C B;  5K5R A;  3RZD J;  1RET A;  4D5F A;  4IHV A;  4HAM A;  1U9N A;  1JGG A;  9ANT A;  2QTQ A;  1TZL A;  3K4K A;  3BNI A;  4XLP F;  2LBF A;  3HSR A;  2RQQ A;  1VQ8 I;  3DCF A;  3JTG A;  3BHQ A;  4XLA A;  3HGY A;  2ZJQ F;  3C2B A;  4BKX A;  1HXD A;  3JW4 A;  4L9J A;  5IP7 J;  5EG0 A;  1N77 A;  2VKH A;  3I3L A;  2WWY A;  3TED A;  2QOP A;  3L09 A;  1YIT I;  4XMY A;  3KKC A;  2WTE A;  3BG3 A;  3Q0V A;  3P9T A;  2W85 A;  3KP6 A;  2P6S A;  2QM3 A;  4KJZ A;  4UV9 A;  1IXR C;  3CDI A;  3T1B A;  2VLA A;  2HEO A;  3V6G A;  3HOX J;  2DFE A;  4DJA A;  1XPX A;  3DWL E;  1M1E B;  1Q1H A;  2LY1 A;  1YS7 A;  4XLC A;  2QKM B;  2HXI A;  4EEF G;  4MXM A;  5D6E A;  1LE8 B;  1MSF C;  4R1H A;  1HCR A;  1ZAR A;  3KZI C;  2D1H A;  2JUC A;  3G3Z A;  2MGQ A;  2L7M P;  1HKQ A;  2EV6 A;  3F6V A;  2GBY A;  3ESW B;  3K0L A;  3BJB A;  2D45 A;  3PSF A;  3FRQ A;  1P7I A;  4I98 B;  5F0F A;  1WKM A;  1O3T A;  4KIS A;  3RPQ A;  1YG2 A;  3HGG A;  1B8I B;  4MEY F;  1V5E A;  5EEH A;  2DA2 A;  1TWA J;  2HZD A;  2BXY A;  3DV8 A;  5F64 A;  4LIT A;  4E4H A;  2Y30 A;  3H9Q A;  5B5E C;  4QLC U;  1X1P A;  4L62 A;  2KHM A;  5F1R A;  3ZGK A;  2K4B A;  2VXZ A;  2GA1 A;  2P5K A;  2HWV A;  3FXJ A;  5J4Y A;  3IP4 B;  3D0S A;  2GOM A;  3VDX A;  2P6T A;  5H6R A;  2MH9 A;  3CC7 I;  4L5E A;  5GAG J;  5D1R A;  4GCV A;  4CH7 A;  4B4C A;  2F4M B;  1FIP A;  2E36 A;  2FNA A;  2OV7 A;  4TV7 A;  4XLN F;  4P96 A;  2Y0M A;  5GTH C;  3GZI A;  1HSJ A;  1P2F A;  1ENH A;  2EIN H;  3AG4 H;  3NNR A;  2ZO4 A;  3S1R J;  3E6C C;  3BR3 A;  3FIW A;  5C44 J;  1W1W E;  4BE0 A;  3SDB A;  1MIJ A;  4UVB A;  4UUS B;  2CUF A;  3GBG A;  3JRH A;  2CV2 A;  1FOW A;  2QVO A;  2OJE D;  2CH0 A;  4AUX A;  3KP2 A;  3SJM A;  1IUF A;  4L5J A;  2DK8 A;  3W2A A;  4GFB A;  2RAS A;  3DLA A;  1T39 A;  3G1L A;  3OOP A;  4J19 A;  2DQL A;  2NAZ A;  1UMQ A;  2FBK A;  3BTL A;  4UV8 A;  1WQ2 A;  4JX4 A;  4M3G A;  5KAI C;  1ZGW A;  2E2H J;  2JWT A;  4KUM A;  5EGO A;  2KRF A;  3GTL J;  4WCG A;  4BNC A;  1WRJ A;  4ICH A;  4RB0 A;  2X9D A;  1RR7 A;  1ZTR A;  3QPH A;  5EEG A;  4IOA F;  3HYI A;  3FM5 A;  1HOM A;  3F9K A;  3BZK A;  3G2B A;  3WGG A;  5GPC A;  3OYM A;  1U78 A;  1QZZ A;  2K9N A;  2LDU A;  3RKW A;  2JA8 J;  4M3F A;  3IUV A;  2XAS A;  3OL3 A;  3DPL C;  3ZMS A;  5J40 A;  3GTP J;  3BJA A;  2UXH A;  2HPI A;  2RRE A;  2JK3 A;  3NQO A;  3VUQ A;  2HQ5 A;  2JA5 J;  2FML A;  1VQ7 I;  2QSH X;  1FT9 A;  3ZN1 A;  1ZKG A;  2LP0 A;  4QSH A;  1W0U A;  1TL8 A;  2LYC A;  4A3J J;  2CW7 A;  4XRS G;  3K4J A;  1ZYR F;  5E3O A;  4MTD A;  4U7B A;  2R5Z A;  3MAJ A;  3IV5 A;  2W57 A;  1DP3 A;  3K4N A;  3E7L A;  1D5Y A;  4RMN A;  4RM2 A;  2PFB A;  3NPI A;  1Z3Y A;  1ON2 A;  2MYS A;  3IH4 A;  2V1N A;  1Z21 A;  3K4B A;  3F8B A;  1ITY A;  2VUM J;  1PUF B;  1YIO A;  4MTE A;  1SD7 A;  1YX5 A;  3IKV A;  4UVC A;  3ECO A;  3FXQ A;  2HVQ A;  3FIS A;  4BDY A;  4HF1 A;  4PDK A;  2ZOY A;  4RS8 A;  3RKX A;  1LDK B;  3QU3 A;  1YYV A;  3ZQC A;  1IN8 A;  1QZE A;  1QHH D;  3C1D A;  2WV0 A;  4N0B A;  1FJL A;  1W0T A;  4OIP F;  3T8T A;  3JRE A;  3I53 A;  2IGO A;  2DOA A;  1MDM A;  1XGM A;  2H6C A;  3TMO A;  2KDZ A;  3J81 Z;  3GFI A;  2Z5U A;  1QVU A;  3CO6 C;  1S9H A;  4Q4Z F;  1Z7U A;  2QKO A;  4N4N B;  2PJR A;  3FXR A;  1Z1D A;  5B3S H;  3HUG B;  4LGW A;  2ECB A;  2ZFW A;  2B3W A;  2K02 A;  3OR2 C;  2DN0 A;  1Z67 A;  1G3T A;  4XIC A;  4IHT A;  4XID A;  5FGM A;  3Q9S A;  2E60 A;  2BGC A;  1V54 H;  4A69 C;  1PDN C;  3RH2 A;  2ZBK A;  2UXU A;  1Z6T A;  2NYX A;  1AU7 A;  3LJL A;  3NS4 A;  2YS9 A;  3X2Q H;  5FRM A;  3FMR A;  1P7J A;  3F72 A;  2J5P A;  3CD6 I;  4P9F A;  4IX7 A;  2VPL A;  5E8I A;  3LSM A;  5JFR A;  2CQK A;  2XAG A;  4L9V A;  3A01 B;  1H9T A;  3W6K B;  3G71 I;  1Y0N A;  4BE1 A;  4CYC A;  1I6X A;  1UG2 A;  3ULQ B;  2M3A A;  3O8H A;  5TJJ A;  1ETX A;  1VZ0 A;  4P9U A;  1AOY A;  3J7A Y;  3KLO A;  1B6A A;  5K5O A;  2EJR A;  5HS9 A;  2LTP A;  4XOR A;  3QOE A;  3NI7 A;  3CUO A;  1IZ1 A;  1R7J A;  2CSO A;  3B81 A;  2FOK A;  2HPM A;  3PM1 A;  1HLV A;  3G4S I;  1T38 A;  1J09 A;  2DW4 A;  4IRH A;  5H2F C;  3GUD A;  4X0G A;  3U9G A;  4A3F J;  4LK1 F;  4G9Y A;  3FXL A;  3FMS A;  2DG7 A;  4HX4 A;  1ETK A;  4IEJ A;  3WU2 C;  4XKC A;  4MIM A;  4HNT A;  3GW2 A;  4BYY A;  3NXC A;  2FJI 1;  4BJ5 C;  3CLO A;  3G56 A;  2L9N A;  3L2R A;  1BW6 A;  3HHH A;  4GDF A;  1STZ A;  1JKQ C;  3SFZ A;  2XDN A;  2E35 A;  4XSZ F;  2DOE A;  4C3I J;  3KZ9 A;  5HNF A;  2L5Q A;  1RIO H;  3IAM 2;  2A3S A;  4LFU A;  2FF4 A;  2BY0 A;  1Q1V A;  3FXM A;  1K83 J;  2ZY9 A;  1BI2 A;  1IDY A;  3OY9 A;  1W5C C;  3DF8 A;  2PMH A;  2E1N A;  1OCZ H;  3F8F A;  3I59 B;  4HQM A;  3UR3 C;  4CGZ A;  2IS1 A;  2E1M C;  3WTV C;  4XL9 A;  1WPK A;  2EA2 A;  2HI3 A;  1LJ9 A;  3H3U A;  2RNJ A;  3SXY A;  2EZL A;  2EWN A;  2W4S A;  1LEA A;  2JUG A;  3S16 J;  3RSN A;  3MD2 A;  2R7O A;  4V2G A;  4YFK F;  4C9Y A;  3QYF A;  2DMQ A;  1EF4 A;  2HOS A;  3JAM Z;  1TT5 B;  2L02 A;  2UXI A;  3CUQ A;  4E70 A;  3HTU A;  1VQK I;  4DVY P;  5F1J A;  2B0L A;  2R7V A;  1LDJ A;  4OAY A;  3VB2 A;  5FJ8 J;  2M4K A;  5E3L A;  2FQ4 A;  4FE4 A;  1FOK A;  1G8X A;  2Z33 A;  3HC7 A;  2O61 A;  2KRC A;  2HGC A;  2BYV E;  3ABM H;  5BMZ A;  2ZXH A;  1YW8 A;  1IN6 A;  2COM A;  3C18 A;  3G7R A;  3RPU D;  4XSX F;  3HOV J;  3G6E I;  2PQ8 A;  3M4O J;  1D0X A;  2OUM A;  1BJA A;  2JRM A;  1QA6 A;  4A0Y A;  3HTS B;  1FPQ A;  2E19 A;  1JJ6 C;  5LEJ A;  4EJT A;  2VKD A;  4HSR A;  5KAF C;  3IRQ A;  3BP8 A;  4U88 A;  1QO0 D;  1J2X A;  2QBY A;  3DTK A;  2NVY J;  3H36 A;  1QHG A;  3GO5 A;  2EV0 A;  1G4D A;  4GFL A;  1FYK A;  1X58 A;  3U1D A;  3VFZ A;  3PAS A;  1T98 A;  4UXN A;  5D5V B;  1S5L C;  3TOB A;  1Z0X A;  1XMX A;  3D1N I;  3HE0 A;  5CPR B;  2ISZ A;  3K9T A;  1OCC H;  3HZJ A;  5GAD J;  1R23 A;  2PX9 A;  3SHF A;  1YX3 A;  4GXO A;  2CO5 A;  2CUZ A;  3DBL B;  3HRS A;  1G6N A;  2FD5 A;  4RAZ A;  1WJD A;  5BNG A;  4KWA A;  4ABZ A;  2XGC A;  2Q8K A;  3ZMV A;  4X6A J;  5L3D A;  2KFD A;  2JA7 J;  4BGD A;  1KA8 A;  3E7Q A;  2EQR A;  2IP2 A;  1AA7 A;  1DU6 A;  4PJJ A;  3HM5 A;  2XRL A;  2JPB A;  4X1E A;  1FSH A;  3ON2 A;  5F0C A;  2ZME A;  4HX7 A;  3H3V K;  1FMV A;  2W84 A;  3S3N A;  5J1Y A;  1FOY A;  2IW5 A;  3GFM A;  1ODD A;  2YR2 A;  2QA4 I;  5GP9 A;  2TCT A;  4HV5 A;  3VEP A;  1O7L A;  2A6T A;  4BQO A;  1RI7 A;  1YJN I;  1F4K A;  2HU9 A;  1VQ4 I;  1D1C A;  2PN6 A;  1UAA A;  2XAH A;  2O03 A;  3MZ8 A;  4B8X A;  2G7S A;  1ZLK A;  4ZH4 F;  1UJ8 A;  1Y1V J;  3LSR A;  2ZOZ A;  1B1B A;  4UB6 C;  2ID3 A;  2YVE A;  1TC3 C;  1FOX A;  3K4M A;  5CW8 A;  3VW1 A;  3K1P A;  3ZMZ A;  3VW2 A;  2FMY A;  4G6D A;  3GVA A;  1MJB A;  4M6X A;  2Y0S A;  4FQG A;  3VSK A;  4XRS A;  1SAX A;  4Y52 J;  3OYK A;  2DA7 A;  3GTG J;  3TW7 A;  1BC8 C;  1ZHF A;  2F5D A;  1MJ9 A;  2P8T A;  3H0D A;  3D5L A;  4CUG A;  3MMY B;  3FKI J;  2FA5 A;  2ZB9 A;  2W25 A;  4JKZ A;  2DDA A;  5L3F A;  2IA1 A;  4DBQ A;  2MA3 A;  1ZN2 A;  4FE7 A;  3PL8 A;  2K86 A;  2N8G A;  1I1G A;  3ZMT A;  3KYC B;  3WG9 A;  2L3D A;  3CUQ C;  3DXJ F;  4V2F A;  2EPF A;  1MBG A;  3T0Y A;  1FMW A;  3LSJ A;  3GTM J;  3CRJ A;  2XUB A;  3BZC A;  4ITV A;  2BW3 A;  4HDU A;  2H1L A;  2ZJR F;  5KK1 A;  4U0W A;  2DPD A;  2XSJ C;  3HKZ N;  3SWH A;  1VI0 A;  4M71 A;  1UST A;  3KZZ A;  3ASO H;  3OYB A;  3MKL A;  3OYL A;  4CYD A;  3FWE A;  2JA2 A;  3COL A;  3GZN B;  2Q24 A;  4ZYH A;  1P4A A;  1VQ5 I;  2V7F A;  1BL0 A;  3RTR A;  2KMU A;  3S14 J;  3M07 A;  2LF8 A;  2NX4 A;  3LSK A;  4XLH A;  3CCQ I;  2QWT A;  5FRO A;  1O4X A;  1NTC A;  3F21 A;  4NNJ A;  1S8N A;  3HSE A;  3A0B C;  4A3I J;  3MCZ A;  2QF7 A;  2UXP A;  5M5Y J;  3ABT A;  4O6J A;  5LFA A;  1B9M A;  2XRN A;  3HSF A;  4L18 B;  2HKU A;  1XN7 A;  2DOF A;  3CO7 C;  1NK2 P;  4G12 A;  1USS A;  2A2F X;  3EUA A;  1LQ1 A;  3E6B A;  3HOZ J;  3CZ6 A;  1ZGA A;  4KT6 A;  3Q3S A;  2WBM A;  5J1U A;  4B3A A;  3OYE A;  3BR5 A;  3QOD A;  3CCR I;  2HQA A;  4LG0 A;  1EH8 A;  2EZI A;  4NC7 A;  4EM1 A;  4XN0 A;  4I76 A;  5BPI A;  2O9L A;  5FHP A;  4BBR J;  2IAI A;  3I58 A;  3F22 A;  2O7O A;  2EA4 A;  2MD5 A;  2P7V B;  3TOA A;  4BAC A;  1SMT A;  3ZR8 X;  2XPW A;  2E71 A;  2V1U A;  3GX4 X;  1RES A;  1S7A A;  1RRJ A;  3N05 A;  4XRF A;  1SFO J;  3AKZ A;  5CVJ A;  2VJJ A;  2YSR A;  3R4K A;  1ZEL A;  4U9N A;  1D1A A;  2VKE A;  4UY8 I;  2TRT A;  3KYD B;  1U5T C;  2OU2 A;  1YTY A;  2A69 F;  4KT5 C;  1LFB A;  4D7N A;  2OBP A;  5CVR A;  5L3C A;  1MGT A;  4A6D A;  4NC8 A;  3PUB A;  2V79 A;  2UUZ A;  1O7F A;  3QOP A;  2FBI A;  3OIO A;  1A31 A;  3ZQF A;  3HHG A;  1G59 A;  3MN2 A;  2KKO A;  2OF7 A;  3BOQ A;  2IGM A;  4HYE A;  4JP0 A;  2HQR A;  2Q2E A;  5IYC J;  3VW0 A;  3WTX C;  4PFO A;  3HOT A;  1IAW A;  2BHZ A;  2XF6 A;  3P9C A;  2R92 J;  2DOD A; 
#chains in the Genus database with same CATH homology
 4A3G J;  2XPV A;  4GFB A;  2RAS A;  3G1L A;  4J19 A;  4S0H B;  1YRN B;  2KT0 A;  1FTZ A;  2OER A;  2K40 A;  1UMQ A;  3BR2 A;  3BTL A;  3FK6 A;  4AC6 A;  5IOY A;  4JX4 A;  4M3G A;  1ZGW A;  2E2H J;  3AQS A;  1IRZ A;  2JWT A;  1OFC X;  5EGO A;  2CQQ A;  2GEN A;  1WGX A;  3DPJ A;  4DYC A;  4YZE A;  2XGE A;  4W1U A;  2G7L A;  3GTL J;  3RZO J;  3C07 A;  4ICH A;  2X9D A;  1RR7 A;  1ZTR A;  2MW8 A;  1HOM A;  1UI5 A;  5F27 A;  1I3Q J;  5GPC A;  1U78 A;  4NDL A;  5FKO A;  2K9N A;  2XGD A;  2JA8 J;  4A3B J;  4M3F A;  3IUV A;  3S1Q J;  5C4X J;  3TP3 A;  4GCL A;  5E3N A;  3GTP J;  4PXI A;  2UXH A;  3NRG A;  1JKO C;  3G1M A;  2JK3 A;  5GPA A;  3VUQ A;  4FIS A;  2Y9Y A;  2HQ5 A;  2ELK A;  1IGN A;  2JA5 J;  3ZQL A;  3CJD A;  1NK3 P;  2L7Z A;  1ZKG A;  2LP0 A;  1JJ8 C;  4QSH A;  1W0U A;  1AHD P;  3JRI A;  3UKG A;  2M8G X;  4A3J J;  2XSD C;  1APL C;  4XRS G;  2R93 J;  3NAR A;  5E3O A;  3GTQ J;  4QTR A;  1T33 A;  2NOG A;  2R5Z A;  3IV5 A;  2D5V A;  3K2A A;  1U9O A;  3HOY J;  1GV5 A;  4IHW A;  2OI8 A;  3E7L A;  1D5Y A;  1VND A;  2ME6 A;  3FK7 A;  3NPI A;  5IOZ A;  1X2M A;  3IH4 A;  3I4M J;  2LLK A;  2IBD A;  1ITY A;  3HTH A;  2VUM J;  3QPS A;  1PUF B;  3JR9 A;  2ME0 A;  3RQI A;  4BXX J;  2REK A;  3ANG A;  2PMZ N;  3FIS A;  4LOC A;  5HSZ A;  2DMU A;  2ZOY A;  3RKQ A;  1QPI A;  1WH7 A;  4A93 J;  2JJ7 A;  5IP9 J;  2OPT A;  2R7Z J;  3ZQC A;  2CUE A;  1JTY A;  2XB5 A;  3LSP A;  3LNQ A;  1MBF A;  4XRM A;  3SDG A;  1FJL A;  1W0T A;  3JRE A;  4MFE A;  1SAN A;  4I6Z A;  3WHB A;  2KDZ A;  5D19 A;  4BBS J;  1QVU A;  2L7F P;  3KKD A;  3TW6 A;  3K7A J;  1QRY A;  2NS7 A;  3LWJ A;  2QKO A;  1ZR2 A;  3JRC A;  1FEX A;  1RPW A;  2RAE A;  3BTI A;  1LFU P;  1G2H A;  1LE8 A;  3MVP A;  2ECB A;  4DYR A;  3PO2 J;  2M34 A;  5CXG A;  2DN0 A;  4IHX A;  1F36 A;  1JUM A;  1HF0 A;  4NEL A;  4XIC A;  2JMW A;  4XID A;  4A69 C;  4JX5 A;  4UUT A;  3CMY A;  3RH2 A;  3OSG A;  2UXU A;  3LJL A;  1WCM J;  1AU7 A;  1AKH B;  1MH4 A;  3CDL A;  1I50 J;  3IH3 A;  2YS9 A;  1GDT A;  3Q0W A;  2LY9 A;  4JX6 A;  1P7J A;  3BT9 A;  3EGQ A;  3HTJ A;  2EZK A;  4GCK A;  1GV2 A;  3JRA A;  2IU5 A;  1JT0 A;  1RKT A;  1GVD A;  2I10 A;  5IYB J;  2DTZ A;  3A01 B;  2IEK A;  4W97 A;  2COB A;  3S1M J;  2HDD A;  2YVH A;  4JL3 A;  4HNV A;  2DMP A;  4CYC A;  2K9Q A;  1UG2 A;  2FJ1 A;  2E2J J;  3O8H A;  1ETX A;  2VPR A;  2D6Y A;  5DAJ A;  1IJW C;  2DMN A;  3SFI A;  2DA6 A;  1XS9 A;  3QQA A;  1IG7 A;  3BTC A;  2LTP A;  5F08 A;  1MNM C;  3GTJ J;  3I4N J;  5FLV A;  3NI7 A;  1JT6 A;  2VI6 A;  3ZQG A;  3B81 A;  4RBO A;  4JNN A;  4BY7 J;  2FX0 A;  5JLX A;  5EGO B;  1MSE C;  3PM1 A;  1MBH A;  3HBL A;  1HLV A;  2QCO A;  2EZH A;  2WGB A;  2Y9Z A;  5HAW A;  1Y1W J;  3DEW A;  4A3F J;  4NN1 A;  4AC0 A;  3BQY A;  2R5Y A;  2LD5 A;  2L0K A;  2DG7 A;  1ETK A;  2L9R A;  3BTJ A;  4IEJ A;  2GFN A;  4ME9 A;  4MIM A;  1IC8 A;  5CXI A;  3NXC A;  5H9T A;  3QKX A;  5EDN A;  4AF5 A;  2LVS A;  1VFC A;  1YRN A;  2ID6 A;  3G56 A;  1BW6 A;  5EZG A;  1JKQ C;  2DJN A;  2XDN A;  2K9S A;  4D5C A;  4C3I J;  4C2M J;  3KZ9 A;  5HOD A;  3HTI A;  2LK2 A;  2EBI A;  1Q1V A;  3HTA A;  1UHS A;  1K83 J;  3BCG A;  1IDY A;  5IPA A;  1R9T J;  2MSY A;  3F1B A;  2HYT A;  5F0H A;  3GEU A;  5FMP A;  1JKP C;  1WPK A;  2E1O A;  2CU7 A;  1H8A C;  2HI3 A;  2Y2Z A;  4M3E A;  5IP6 A;  5J1R A;  3BRU A;  2DA5 A;  3B6C A;  1ZK8 A;  2EZL A;  5EG0 B;  1Z77 A;  5M5W J;  3S16 J;  3RD3 A;  4DYQ A;  4V2G A;  2WAQ N;  1BW5 A;  1MBJ A;  1HDP A;  2DMQ A;  1EF4 A;  2XPU A;  4GFK A;  2HOS A;  2O8K A;  3S2H J;  2M0C A;  4DZJ A;  1OJL A;  2VKV A;  2Y0S N;  2UXI A;  2YUS A;  5F1J A;  5FJ8 J;  5E3L A;  1QVT A;  2FQ4 A;  4FE4 A;  4FCY A;  4RDU A;  5EZH A;  5DS9 A;  5FKN A;  2ZCN A;  5JLW A;  1DU0 A;  3GTO J;  3G7R A;  2G0E A;  3HOV J;  1ETW A;  3LOC A;  3CCY A;  1GT0 C;  1ETV A;  3BR1 A;  3M4O J;  2X6O A;  2GUH A;  2E2I J;  2YU9 J;  1XG1 A;  3VOK A;  2E19 A;  1JJ6 C;  1PUF A;  1MH3 A;  5C4J J;  2H1K A;  4DW6 A;  2DA4 A;  4IHY A;  3W6V A;  2NVY J;  2CQX A;  3M3Y J;  1BJZ A;  4GFL A;  3HEF A;  1ORK A;  1X58 A;  2G3B A;  2RHA A;  3PAS A;  1MBE A;  1JKR C;  2CRG A;  1Z0X A;  3GTK J;  3D1N I;  1B72 A;  3HE0 A;  1JTX A;  2DMT A;  3VPR A;  2UXO A;  5FKL A;  3PPB A;  5EFY A;  3VIB A;  2FD5 A;  5BNG A;  4KWA A;  5FLM J;  4ABZ A;  2Y31 A;  2XGC A;  4MFD A;  1A5J A;  4X6A J;  2PBX A;  3G1O A;  1B8I A;  3VP5 A;  2JA7 J;  2H8R A;  4DZP A;  1OCT C;  2EQR A;  3E7Q A;  2LKX A;  1DU6 A;  3QBM A;  3HM5 A;  4C3H J;  2XRL A;  3TP0 A;  2NS8 A;  4X1E A;  3ON2 A;  5F0C A;  2DG8 A;  2XB0 X;  3AQT A;  4FTH A;  1BA5 A;  3H3V K;  2NVX J;  3VOX A;  3ON4 A;  3BG9 A;  4HKU A;  5J1Y A;  3WHC A;  1SGM A;  4MK6 A;  2HOA A;  4MO7 A;  5K7Z A;  1HDD C;  2AHQ A;  3VVY A;  4M3B A;  5GP9 A;  2X48 A;  1K61 A;  3QPL A;  2TCT A;  4C3J J;  1TWF J;  2WUI A;  3BG5 A;  4JYK A;  3S2D J;  3CWR A;  1WI3 A;  3V78 A;  5EEA A;  3HDD A;  1TWC J;  2ECC A;  2G7S A;  3A01 A;  2GM4 A;  1Y1V J;  3LSR A;  2ZOZ A;  2EH3 A;  2ID3 A;  2YVE A;  2W48 A;  1TC3 C;  3A02 A;  1FIA A;  1RKW A;  2R5Y B;  2CJJ A;  4UUS A;  2FBQ A;  3ZQH A;  4Y7N J;  5CW8 A;  3VW1 A;  5HBU A;  3VW2 A;  4QIW N;  5DTD A;  1X2N A;  3VVX A;  3H0G J;  4D7M A;  4XRS A;  4Y52 J;  4MLO A;  2JA6 J;  3S5R A;  3OSF A;  4ACI A;  4M3D A;  2DA7 A;  3GTG J;  3TW7 A;  3ZOB A;  2NVT J;  5IYD J;  3HB9 A;  4A3M J;  3A03 A;  3FKI J;  3O60 A;  4A3E J;  2ZB9 A;  2LFB A;  2ZCX A;  1UI6 A;  1VF9 A;  3CQZ J;  4JKZ A;  5EF6 A;  3T6N A;  2WV1 A;  1IV6 A;  1E3O C;  2QIB A;  3JSJ A;  1FTT A;  4FE7 A;  2NP5 A;  1IDZ A;  1JUP A;  2N8G A;  5C4Y A;  3S1N J;  1ETY A;  2M2E A;  3JRB A;  4A3K J;  5D18 A;  1OCP A;  3PO3 J;  2NP3 A;  2JN6 A;  3L1P A;  4V2F A;  3LHQ A;  5FKK A;  1T56 A;  1F43 A;  2R5Z B;  1MBG A;  5M3F J;  5E3M A;  3OOU A;  1ETQ A;  3LSJ A;  2HOT A;  3JRD A;  3GTM J;  4A3C J;  4XK4 A;  1TWH J;  5K7F A;  3CRJ A;  1MBK A;  2DA1 A;  2B63 J;  3HKZ N;  5FGL A;  1VI0 A;  2LR8 A;  3RZD J;  1RET A;  4D5F A;  4IHV A;  2NVQ J;  1U9N A;  1JGG A;  9ANT A;  3MKL A;  2QTQ A;  3Q0U A;  3BNI A;  3COL A;  2Q24 A;  5AQC A;  4A3D J;  1BL0 A;  3DCF A;  3KNW A;  3S14 J;  3BHQ A;  3VVZ A;  3HGY A;  2NX4 A;  3C2B A;  4BKX A;  2QWT A;  1I6H J;  1A6I A;  5IP7 J;  5EG0 A;  1NTC A;  1O4X A;  1ETO A;  5K58 A;  3S15 J;  3TED A;  3HOU J;  2QOP A;  4A3I J;  3KKC A;  1H89 C;  1ZQ3 P;  5J3L A;  2QF7 A;  2UXP A;  5M5Y J;  1CQT A;  4M6V A;  3BG3 A;  3Q0V A;  2GLO A;  3P9T A;  2W53 A;  2DA3 A;  2HKU A;  3V6G A;  3F0C A;  1NK2 P;  1U8B A;  4G12 A;  3HOX J;  1S7E A;  1XC5 A;  5C3E J;  3ANP A;  2G7G A;  3BR0 A;  3HOZ J;  3MNL A;  3ZQI A;  2HXI A;  1TWG J;  3Q3S A;  5J1U A;  4B3A A;  4EEF G;  5K7H A;  3BR5 A;  4MXM A;  1LE8 B;  1MSF C;  1HCR A;  2EZI A;  5F04 A;  1B72 B;  3EUP A;  3HIM A;  3BQZ A;  4I76 A;  2O9L A;  5FHP A;  4BBR J;  4B1R A;  3JRF A;  2MGQ A;  2L7M P;  2IAI A;  2GBY A;  4GCT A;  3BJB A;  2O7O A;  3JRG A;  2HYJ A;  3FRQ A;  1P7I A;  5F0F A;  2PZ9 A;  3HGG A;  1B8I B;  2XPW A;  3BR6 A;  2DA2 A;  1TWA J;  3NAU A;  2R0Q C;  2Y30 A;  2MG4 A;  1RES A;  1ZR4 A;  1WH5 A;  2AO9 A;  2O7T A;  4L62 A;  1SFO J;  2F07 A;  4UDS A;  4A3L J;  1H88 C;  5M5X J;  1JUS A;  4CYC B;  2VKE A;  2TRT A;  4BY1 J;  2P81 A;  3S17 J;  5FKM A;  2V57 A;  1AKH A;  4D7N A;  1LFB A;  5M3M J;  4AYB N;  3LSG A;  1GUU A;  4L5E A;  5D1R A;  4B4C A;  1FIP A;  3OIO A;  5EYR A;  3ZQF A;  3HOW J;  3GZI A;  3MN2 A;  1POG A;  1ENH A;  2OF7 A;  4CGR A;  2HXO A;  3NNR A;  4JP0 A;  3S1R J;  2ZCM A;  2M9H A;  3IH2 A;  5IYC J;  3VW0 A;  3BR3 A;  3FIW A;  5C44 J;  2WB1 N;  3B6A A;  2CUF A;  3GBG A;  4UUS B;  3JRH A;  4AUX A;  2R92 J;  3SJM A;  3O8G A;  1IUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...