3LOCA

Crystal structure of putative transcriptional regulator ycdc
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
201
Chain Sequence
RSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator rutR
publication title Crystal Structure of Hypothetical Transcriptional Regulator Ycdc from Escherichia Coli
rcsb
source organism Escherichia coli
total genus 74
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3locA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3locA02
5GPAA 5F27A 3BR1A 2WGBA 1PUFB 3K7AJ 2VUMJ 1JKRC 1HDPA 3MN2A 5FKKA 3BHQA 1QVTA 2DMPA 9ANTA 3NRGA 1P7IA 5F04A 1UI5A 2QCOA 3QKXA 4D7MA 1IC8A 4MIMA 1HCRA 2HYJA 5J1RA 3SDGA 2R92J 5DAJA 2X6OA 5EZHA 1P7JA 1FJLA 3QPSA 1F43A 3ZQIA 3KKDA 3EUPA 1ZTRA 5IP9J 2G7GA 2OERA 2ID3A 2XDNA 2MW8A 3NI7A 3BR6A 4Y52J 1TWHJ 3BR3A 3IH2A 4I6ZA 5FJ8J 3S1RJ 1DU0A 1RKTA 1MSEC 3NXCA 3VUQA 1MH4A 2CJJA 3MVPA 3AQSA 2NS7A 1Y1WJ 1QVUA 2X9DA 2DJNA 3A03A 5M5WJ 2DA6A 2R5ZB 1RR7A 1S7EA 2JA8J 1JT6A 2H8RA 1K83J 1MSFC 1RETA 1GDTA 2QWTA 4MO7A 3G1LA 1EF4A 5C4YA 3GZIA 5CXGA 3GTMJ 1ETVA 3LJLA 3GTJJ 3E7LA 2XRLA 3JRBA 4IHXA 3CJDA 2UXPA 1I3QJ 4S0HB 3PASA 1OJLA 3HKZN 2TCTA 1BA5A 2P81A 5FKNA 3KNWA 3EGQA 4GCLA 2LTPA 1QPIA 3BQZA 3BG3A 2RAEA 3PM1A 2ZCXA 2IU5A 3JRCA 1ETKA 2HOTA 2FBQA 1ENHA 1B72A 1HDDC 1TWFJ 2DG7A 3VW1A 1MBEA 3AQTA 1GUUA 2WV1A 1MNMC 3TP3A 3JR9A 2M0CA 3RD3A 4FE4A 4GFBA 2VKEA 3BTLA 2MSYA 2QOPA 3IUVA 1A5JA 3HOYJ 5IOYA 1IDYA 2EH3A 3O8GA 3Q0VA 2GENA 5FKMA 1JUMA 2JA5J 4ME9A 3JRHA 1POGA 3CRJA 3GTGJ 3ZQLA 5EGOB 1IV6A 5IYCJ 4BXXJ 2L9RA 4MK6A 1BL0A 2ZCMA 2PBXA 1JJ6C 3FISA 3HOXJ 4CGRA 5J3LA 1U9NA 4CYCA 2CU7A 3VOKA 2GFNA 3WHBA 4A3JJ 3NAUA 1F36A 4DZJA 3HOWJ 4ICHA 2EZKA 2DA2A 1ZGWA 2VPRA 3P9TA 2YUSA 3OIOA 4JP0A 2I10A 1TC3C 1MH3A 3MKLA 2K9NA 4IHWA 2GLOA 3ZQHA 1VFCA 3F0CA 3HEFA 2LR8A 1VNDA 2G0EA 1G2HA 2QTQA 1A6IA 4DZPA 1MBFA 2ME6A 4UUSA 3W6VA 1ETWA 4JX5A 1ETXA 2LY9A 5C4XJ 4XICA 2RHAA 5IP6A 2EZHA 5IPAA 2LP0A 3M3YJ 3HTIA 1JTYA 2Y0SN 3RKQA 4YZEA 1JKQC 3ON4A 2R93J 2HQ5A 2Y9ZA 5E3MA 3H3VK 4ACIA 5CXIA 3HBLA 2V57A 1JGGA 4BBRJ 4IHVA 5K58A 3QBMA 4B3AA 1Z0XA 1R9TJ 3LWJA 2Y31A 4G12A 1SGMA 4A69C 5FGLA 1MBGA 4JL3A 2XGEA 2GUHA 1LFBA 2NX4A 2HYTA 4XRSA 2EZIA 1GT0C 3VOXA 1UHSA 4MLOA 3ZQCA 4JX4A 1B72B 3LSGA 2ME0A 5EG0A 1FIAA 2G7LA 2IAIA 1JUPA 1CQTA 5IP7J 1RESA 1H88C 5IYBJ 2PZ9A 2CQQA 1MBHA 4GCKA 1Q1VA 3JRIA 1NK2P 4IHYA 1NTCA 4UDSA 1BJZA 2M8GX 2X48A 4BY7J 4XRMA 2FQ4A 4X1EA 2EZLA 2OI8A 2DMTA 1YRNA 2O8KA 4PXIA 1JKOC 4QTRA 4XRSG 2DA7A 2CQXA 1WCMJ 4UUTA 5IOZA 2JN6A 5FKLA 4M3EA 4B1RA 5DTDA 5FHPA 5M5XJ 1B8IA 2DN0A 2O7TA 4RBOA 3CQZJ 2ZB9A 1AKHA 2LLKA 2NVYJ 4V2FA 2O9LA 3S2HJ 4HNVA 2JJ7A 1HOMA 3I4MJ 2ZOZA 4GFLA 3B6CA 3BTCA 3CCYA 3S5RA 1WGXA 1GVDA 1ZR4A 3HTAA 4M3GA 4GFKA 1ETYA 1GV5A 2PMZN 4BBSJ 3GEUA 3ANGA 2D5VA 3S15J 2NP5A 5D1RA 2FD5A 3BG9A 3BRUA 3HE0A 3FK6A 3QQAA 4KWAA 2ID6A 4UUSB 3VP5A 2G3BA 2N8GA 3SFIA 3RZDJ 2JA6J 2Y2ZA 1XS9A 1DU6A 4DYQA 5EYRA 3HOVJ 1D5YA 2Y30A 3NNRA 3HGGA 2UXIA 2XPWA 1T33A 4JNNA 1ZK8A 2R5YA 3BR0A 2QIBA 3RH2A 4Y7NJ 1OFCX 3Q0UA 2YU9J 3G7RA 4IEJA 3V78A 2M34A 4M6VA 2NVTJ 2GBYA 5EF6A 1WH5A 3BT9A 2ECBA 2HKUA 4BKXA 1IDZA 2ZCNA 4NDLA 3BNIA 2NP3A 3RZOJ 3BTJA 4MFEA 3V6GA 4L5EA 3HDDA 2M9HA 1IGNA 4A3BJ 3S2DJ 3OOUA 5CW8A 3VVYA 2LD5A 4AC0A 3A01A 3UKGA 4C3JJ 3GTKJ 4A3CJ 5F0CA 4JYKA 1IRZA 4W97A 3L1PA 4AC6A 2HOAA 3VPRA 3ON2A 4A3GJ 5EG0B 5F0FA 2XGCA 4MFDA 3KZ9A 1U8BA 3GTPJ 2R0QC 4GCTA 3HTJA 4BY1J 2HI3A 4XK4A 2XGDA 4ABZA 2NS8A 5M3MJ 1K61A 2H1KA 2JMWA 2UXOA 3E7QA 3VW2A 2M2EA 3BR2A 1LE8A 1JUSA 3F1BA 2JWTA 3DEWA 3M4OJ 3Q0WA 2UXUA 3OSGA 5AQCA 1YRNB 2AO9A 2K9QA 1W0UA 2EQRA 3TEDA 3PO2J 1TWCJ 1TWGJ 4L62A 2W53A 2DMNA 4W1UA 2K40A 3HM5A 3TW6A 1ITYA 1ZKGA 2NVXJ 5HSZA 3GTQJ 4M3BA 1B8IB 1VF9A 1NK3P 3T6NA 3GBGA 1OCTC 3IV5A 4M3DA 1HLVA 4DW6A 3COLA 1ORKA 2UXHA 2Y9YA 3TP0A 1O4XA 4A3MJ 1TWAJ 3HOUJ 1UMQA 2EBIA 3FK7A 2MGQA 4A3KJ 3TW7A 2B63J 3PO3J 2D6YA 5EGOA 1IG7A 4XIDA 1RPWA 4AF5A 2DTZA 2WAQN 3GTOJ 1JJ8C 3LHQA 5C4JJ 2TRTA 3MNLA 3IH4A 2XPVA 2YS9A 4D7NA 4DYRA 5IYDJ 3BQYA 5DS9A 1BW6A 3BG5A 2QF7A 2HOSA 3JRAA 5M3FJ 5HBUA 1RKWA 3H0GJ 4J19A 4A3EJ 2R5YB 3ANPA 5M5YJ 3JSJA 1JKPC 1FEXA 1IUFA 3IH3A 3O8HA 4DYCA 2LKXA 5E3NA 3I4NJ 1APLC 1XG1A 5J1YA 4NN1A 2OPTA 3D1NI 2YVEA 3JREA 1SFOJ 2REKA 3G1MA 4QIWN 1H8AC 4NELA 2FJ1A 3GTLJ 3RQIA 1X2NA 3BCGA 5FKOA 1IJWC 3PPBA 2YVHA 4CYCB 4JKZA 4AYBN 5E3LA 3NPIA 3SJMA 3VVZA 3LSPA 2XPUA 5D19A 3A01B 5EDNA 1FTTA 5FMPA 2E2JJ 1QRYA 3OSFA 4JX6A 4C2MJ 2DA5A 4FTHA 5F1JA 4A3IJ 1U9OA 1UG2A 2E2IJ 3A02A 2CUEA 4A93J 3HTHA 2E19A 1U78A 4AUXA 2DA1A 1E3OC 2VKVA 1PUFA 2COBA 3HGYA 2LK2A 2HDDA 2FX0A 3S16J 2NOGA 1Y1VJ 1WPKA 4C3HJ 3LOCA 5C3EJ 3LNQA 2VI6A 5F0HA 3FRQA 1MBKA 1LE8B 5EEAA 3S1MJ 3G1OA 2CRGA 2L7ZA 5K7FA 2K9SA 3LSRA 5J1UA 4D5FA 5K7ZA 1OCPA 2ECCA 1MBJA 5FLVA 4HKUA 1X58A 2KT0A 3FKIJ 1GV2A 2W48A 4MXMA 2WB1N 2ELKA 1ZQ3P 2DA3A 3DCFA 2XSDC 2NVQJ 5JLWA 2AHQA 3JRDA 3O60A 1HF0A 2RASA 3LSJA 3G56A 3Q3SA 2DMQA 5HAWA 2E2HJ 4QSHA 4EEFG 2G7SA 1SANA 2L7MP 2IEKA 2HXIA 3S1NJ 2HXOA 3S17J 2DMUA 2ZOYA 3C2BA 4A3LJ 3B81A 3WHCA 2JA7J 1T56A 3HIMA 1W0TA 1BW5A 2R5ZA 4X6AJ 3VVXA 5GP9A 4FCYA 1XC5A 3ZQFA 3HOZJ 3DPJA 3K2AA 2GM4A 3CWRA 5E3OA 3S1QJ 4A3FJ 5FLMJ 3JRFA 2KDZA 2E1OA 2L0KA 2L7FP 2R7ZJ 5BNGA 2DA4A 2DG8A 1JTXA 3BJBA 5EFYA 2QKOA 3ZQGA 2F07A 3KKCA 3QPLA 4LOCA 1ETQA 2LVSA 1H89C 2CUFA 2MG4A 3CDLA 5JLXA 2XB5A 5C44J 2OF7A 1LFUP 2Q24A 2IBDA 2XB0X 1WI3A 2WUIA 4RDUA 2O7OA 4I76A 4B4CA 1VI0A 3VW0A 1FTZA 3S14J 4FISA 3CMYA 1UI6A 2LFBA 4A3DJ 5EZGA 1ZR2A 4V2GA 3NARA 5GPCA 1X2MA 1AHDP 5HODA 1AU7A 1I6HJ 3C07A 1JT0A 3FIWA 3ZOBA 3JRGA 1AKHB 2JK3A 1FIPA 3VIBA 5H9TA 4M3FA 5K7HA 1ETOA 5F08A 3B6AA 3BTIA 1WH7A 4FE7A 4C3IJ 1Z77A 1I50J 4D5CA 3HB9A 3BR5A 5D18A
chains in the Genus database with same CATH superfamily
3CESA 1NG7A 2OTLI 4L0ZB 3ZXSA 2HYGD 3PSIA 3K7AJ 1PUFB 3T8TA 1HDPA 1S6LA 2O8XA 3MN2A 4XLPF 1QVTA 1TP4A 2IA1A 5DD8A 2F5CA 2QCOA 1FOKA 2IS2A 1R58A 4CUGA 4F52A 4HF2A 1HCRA 3WG9A 3GEZA 4WXHA 4KUMA 5JHFA 1TQMA 1P7JA 2QKLB 3JW4A 4XKWA 1ONVA 4WX9A 2M7AA 4D1QA 4RGXA 4XMYA 2G7GA 2QKMB 3IKTA 5L3BA 4G7HF 4JOMA 1WJCA 4Y52J 1U3EM 3IH2A 2A05A 2PFVA 1DU0A 3MKYB 3VUQA 1ZG5A 2DW4A 3OY9A 2CJJA 2UZKA 1ULYA 2Z33A 1Y1WJ 1XDSA 2BW3B 5M5WJ 3KX2A 2FRHA 3H36A 3D5SC 2R7FA 3OOPA 2FBKA 2VT2A 1S7EA 1JT6A 2EFOA 3IWFA 1MSFC 2Z16A 4OOIA 2AQFA 3MZYA 4BYYA 4RGSA 5LHGA 1WFXA 1BR1A 1CF7A 3N97A 4I0BA 1YITI 1YQAA 1ACIA 3GTJJ 2OC6A 3CCQI 4IHXA 3HRSA 3PASA 1I3QJ 1OJLA 1BBYA 3HKZN 3GX4X 2E7WA 4MGRA 2E1MC 3OYDA 2DFHA 1QPIA 2GXAA 5DM7F 2EK5A 2JQ7A 5HLIA 4HF1A 4U9LA 2RAEA 2KL4A 3C7JA 3DLLF 2VQGA 2IU5A 2CMPA 3FWEA 2LF7A 2B9SA 3CCSI 2FQ3A 1ENHA 2K9MA 4ENJA 1SVOA 3FM5A 3UNGC 2IS6A 1Q1HA 2X85A 1MDMA 1O7LA 2JUCA 1Y8RB 4G6DA 2A68F 5CLSA 4B44A 3TDUC 4ZH4F 2MD0A 4FE4A 1BR4A 4BXUA 4XBFA 2QEXI 3QOEA 5EJCA 2FMYA 4K2EA 3IUVA 3KP2A 1XSVA 3GZNB 4HA8A 1YOVB 3F22A 3ZN1A 1IDYA 2EH3A 5DUIA 3O8GA 1Z9CA 4B43A 2GENA 3R0AA 4ME9A 1POGA 2B3WA 4HX7A 1MD0A 2HDWA 1MNEA 3HKZA 4O3MA 4BXXJ 3OS1A 5D8KB 4MK6A 2F5EA 1K6OA 2CH0A 1YJWI 1JJ6C 3OIPA 1KQ9A 4CGRA 5J3LA 3W6KB 4KIGA 4P9FA 4CYCA 2XKPA 3WHBA 3FXQA 2EV5A 3HXLA 1F36A 4AIJA 3E3VA 4DZJA 1VQLI 3HOWJ 5F64A 2EZKA 2DA2A 2P5KA 1ZGWA 5A2QK 1KA8A 3FZVA 1M1EB 3OIOA 3KE2A 2XAUA 1MH3A 3MKLA 2K9NA 5HNHA 1U6GA 2GLOA 4G9YA 4GXOA 5LHIA 1PP8F 1G2HA 4BNCA 4HLXA 2OJED 2XKOA 4UUSA 2V79A 1ON1A 2IXSA 3SXYA 2LY9A 2RHAA 2DYSH 2GA1A 1BN5A 5IPAA 4HDUA 2M8EA 2XF5A 2JUGA 2KP6A 5AIQA 1ON2A 3CUQB 4XLAA 3BCBA 3ON4A 1V55H 2PMUA 4N0BA 3RJPA 1YS7A 1X1CA 2PI0A 2XSJC 3FXLA 2P8TA 1YJNI 2V9PA 3TBIA 3T8RA 2OBPA 2VQLA 3MZ8A 4B3AA 2A07F 2KZVA 1YG2A 4H0EA 2MH2A 1G3TA 1UG0A 2JA2A 2GUHA 2LOOA 4OD4A 1HW2A 3CJQB 1U0JA 2PN6A 3PNYA 3AG4H 1B72B 3QYBA 1XGMA 1J59A 1NHAA 3C3WA 3RSNA 5J40A 2FSWA 5E8GA 1XMAA 1CQTA 5H2FC 4XL9A 3PQJA 1R71A 1H9TA 1H88C 4OAYA 4KT6A 5IYBJ 2CQQA 3DTEA 3IUOA 4AVZA 3D5LA 4GCVA 1O3QA 3T0YA 1RIOH 4EJOA 1Q1VA 4RGUA 4CZZA 2HPIA 1BI0A 5IT9K 4UDSA 3K2ZA 1R22A 1Z1DA 4BY7J 2R7RA 2FQ4A 1LDJA 1Z05A 4NC7A 2X51A 1AOYA 2OI8A 1YRNA 2H6BA 4IL6C 2HYFA 3CJNA 1WCMJ 2DDAA 2XRNA 3K70C 2JN6A 2VIXA 5FKLA 4E7ZA 2M4GA 4M3EA 2VJIA 4YEJA 1W36C 3HOSA 4PJLA 2A6HF 3U1DA 3A0HC 3W6JB 4EGZA 2OTJI 1JE8A 3I9V2 3DPTA 1UZCA 2R7TA 4XONA 1P4AA 2G9WA 2LLKA 2VC1A 2DQLA 2ZOZA 4GFLA 3CCYA 1G8XA 1K78A 3C1DA 3KCCA 1GVDA 1ZR4A 2XAGA 3HTAA 4M3GA 4R79A 3GUDA 2R7UA 5JVTA 2QSFX 6PAXA 2VODA 3ANGA 3KP6A 4XN3A 4FT8A 1A04A 1TT5B 4DJAA 5D1RA 3BG9A 3BRUA 3GO5A 4NQWB 3H3UA 1WJAA 2PFBA 4NB5A 4ZYDA 1K6YA 1XCBA 1T2KA 3Q9VA 4RAGA 3QWLA 3KZIC 1DU6A 2Q2EB 3HOVJ 1D5YA 2Y30A 1S29A 3OIQA 1G3SA 1QQIA 1UHWA 2R5YA 2QIBA 2UWMA 3C2HA 4M6VA 2HKUA 2L01A 2ECBA 4BKXA 3ML6A 4BQNA 1GXQA 2RQQA 3MWMA 1IN5A 4XKVA 1A31A 2EV6A 3TL4X 5ERIA 2WY7Q 3OOUA 3VVYA 1IXSB 2XAHA 3FXUA 3LA7A 4C3JJ 2IGKA 3L2QA 3PIOF 2E34A 4JYKA 2DOAA 3QYEA 4W97A 3CO7C 2XIGA 5K5OA 4FX4A 1SD7A 2DCEA 4EVIA 2CGPA 1WZ2A 4L5JA 4BH9A 2XHKA 5L3FA 4WK8F 2R0QC 1IF1A 4UHTA 4RM2A 3DF8A 1BI2A 4BAYA 2HFHA 2EA4A 5HLHA 2JMWA 5LEKA 2KRFA 2EFPA 5D4RA 1O3SA 3DKWA 2M2EA 4BQAA 1JUSA 1KU7A 3X2QH 1YI2I 3DU5A 3WTXC 4HX4A 3TOBA 1W0UA 3TEDA 3PO2J 3L2WA 2NOJB 4L62A 5JI6A 3KEOA 2W53A 2DFEA 4W1UA 1IV8A 2CUZA 4KIFA 5B1BH 1F4KA 1B1BA 4ZDLA 2W7NA 4LK1F 4Q47A 2V6EA 5DCMA 1NK3P 3T6NA 4IRHA 1BI1A 4FETA 2D45A 2YSRA 2LYCA 3HL2A 3WGGA 1J75A 2X0LA 5FD5A 1BJAA 3ZMUA 1D1BA 2GWRA 1ORKA 4DW6A 2EV0A 2VOPA 1VQKI 3CTAA 4M74A 1TWAJ 3KYCB 2EBIA 3FK7A 3TW7A 3JAMZ 3PO3J 3GFLA 4J01A 3KP5A 4BACA 1XN7A 1IG7A 1DQUA 2H1LA 1QBJA 4AF5A 1JJ8C 2EPFA 4DOZA 5C4JJ 5FB2A 5CVRA 4F3QA 2YS9A 3KP3A 4D7NA 1QO0D 4HOBA 3ASNH 2HOSA 2XUBA 3H5AA 5M3FJ 3KYLA 3CJTB 2DO7A 5TJJA 2H09A 4A3EJ 3ANPA 3MAJA 5LHHA 1IUFA 3I3LA 2LY2A 3O8HA 5CPRB 3CD6I 2PJRA 4NN1A 1XG1A 4BHCA 2E35A 5KAFC 1X1PA 5LLQA 1LDDA 2YVEA 1QGPA 3I56I 4QIWN 4OIRF 1ZRCA 3GTLJ 3BCGA 3HJEA 1V54H 2OD5A 1Y0NA 1IW7F 1R49A 2A3SA 3K70D 5ILSA 1W36D 4U7BA 2LC2A 1YYVA 3A01B 4OIOF 2E2JJ 3RKYA 2ZY9A 4C2MJ 2AS5F 1D8JA 1U9OA 2DU9A 3BROA 5KAIC 3HPHA 1U78A 2VT3A 4AUXA 2DA1A 3KETA 2COBA 2G7UA 3H5RA 3CCUI 3AL0B 1B9MA 2K7LA 1WPKA 4C3HJ 1I6XA 1REPC 3PQKA 3O6BB 2VI6A 3FRQA 1S9HA 4RAZA 1IRXA 5K7FA 2KJBA 1P92A 4M9ZA 1XPXA 4D5FA 2ECCA 3OYIA 2LBFA 2KHMA 2OCEA 1YX5A 4FASD 2WB1N 2NNYA 3I5UA 1ZQ3P 2NVQJ 1X19A 4RA2A 2YU3A 1ZARA 5BPIA 4WXCA 2Y0MA 2A61A 2WBMA 3QPHA 4BL0B 4QSHA 2L7MP 3ZGKA 2HXIA 3BJOA 1Z67A 3S17J 2DMUA 3BP8A 3BG6A 3I64A 4A3LJ 1T56A 1BW5A 4D9JA 2R5ZA 4LG0B 2Z9OA 5GP9A 4DBRA 3HOZJ 2EWNA 3I59B 2ZBKA 3CWRA 5BMZA 5E3OA 2X1CA 2V1UA 3ERMA 5HNFA 3S1QJ 5E8IA 2M3AA 3F6OA 4BEHA 2VC0A 1A36A 1XTAA 2DG8A 3WTUC 1XGNA 3QPLA 1ETQA 1VQOI 4HG2A 1ZELA 2CUFA 4CDGA 1L3LA 3J7ZI 2OF7A 3M8FA 2HNHA 2XB0X 2IBDA 1W7PA 1ZG3A 2KMUA 2W00A 4AIDA 4GYIA 2HKOA 4I76A 4B4CA 1FTZA 2XVCA 3LA2A 3D5RC 5AONA 5EEHA 2OQGA 1ZR2A 2CS3A 4M71A 2L02A 5CKTA 2FOWA 1D0ZA 3WTYC 3CMEI 1AU7A 3ZOBA 1AKHB 2O03A 3HHHA 3KLNA 1OCCH 3I71A 4ITVA 4ZDOA 4JQFA 4M3FA 2LSOA 3H9JA 3AAFA 4XKBA 1B4AA 2P6TA 3GW2A 3BTIA 4FE7A 4OMYA 1I50J 5DM6F 5D18A 3JCUC 3BR1A 4DNCA 4LK0F 4RAYA 1XB4A 2JPCA 2X6WA 1U5TC 2KFDA 3NRGA 2HVQA 5F04A 2BY1A 2R4GA 3QKXA 1IC8A 4MIMA 3VYTB 2HYJA 5J1RA 2RNJA 4P9UA 2R92J 3TOAA 5D5XB 2X6OA 5EZHA 3L2RA 3QPSA 5LRRA 3KKDA 4XOTA 3EUPA 4IPAA 4ESBA 1ZTRA 3IC7A 4CXFA 5FLXZ 3LA3A 3NI7A 4RAFA 4ZTJA 3BR6A 3ZR8X 2Q1ZB 1OYYA 2VJ5A 3CC7I 3NXCA 2JSCA 3IKVA 4KFCA 4KNYA 3RYPA 2NS7A 1SAXA 3VTIA 2DA6A 3A1YA 2M30A 2GQQA 1AWCA 4IHTA 1S7AA 2KLOA 5D5UB 1RETA 3RYRA 3L7WA 1EF4A 3WGIA 3GWZA 3GZIA 4HX8A 2PEXA 4MNUA 2B0LA 1Y0UA 4KIBA 3ECOA 4DIQA 3F23A 3R60A 4KDPA 1N25A 4Q5SF 2JVHA 2C6YA 1Z21A 2BXYA 1F9NA 2DAOA 2X6YA 3MFKA 2ZMEC 3CJDA 4S0HB 3ESWB 4DVYP 3RQ4A 1SVMA 2P81A 1R5GA 3KNWA 1FX7A 4BGDA 1ZLKA 2HQAA 2LTPA 1G59A 1IXRC 2A2FX 1KGSA 1IXCA 2NAZA 2ZCXA 2K02A 2IS4A 2DT7B 4YIIA 2CUJA 4N4OB 2Q8KA 2IRFG 2DT5A 3AQTA 2JRMA 1E3PA 2WV1A 3OYGA 2COMA 3JR9A 3RD3A 3M8JA 3HUGB 4HNTA 1PUEE 2P7VB 2VKEA 3BTLA 2QOPA 2YVXA 2GIZA 2QYOA 1X1DA 3S8PA 4EJUA 1VQ9I 1A5JA 4RLQA 3TMOA 5IOYA 3DEUA 1U2WA 4FX0A 3Q0VA 3ULQB 1K79A 1DUXC 2JA5J 2PLYA 3JRHA 1BOBA 4I02A 3GTGJ 1HXDA 2L9SA 2ZO4A 4RMNA 4WIBA 4XORA 3ZQLA 5EGOB 2KQRA 4I09A 1IV6A 1Y8QB 4Z6YA 3R0JA 3J7AY 3EYIA 1B59A 4XSZF 2UV1A 1YW7A 2BVMA 2GFNA 2QENA 2CV1A 3OYNA 4CCOA 1LEAA 3O3KA 3JTGA 3OMYA 2M87A 3L2UA 5AIPA 3QP6A 4U0WA 2GZWA 4JP0A 3FM3A 3WGHA 5LD2C 4B48A 3ZQHA 1VFCA 3I0TA 5FO5A 2ZJQF 1Y6IA 4CZCA 2VXZA 1MBFA 4HSRA 2ME6A 2NRAC 1XCVA 2VXDA 2W85A 3ELKA 4HZFA 4ZJZA 3IP4B 3R4KA 4UVAA 5IP6A 2EZHA 2VJJA 2HEOA 5HS7A 4U9NA 1MJAA 5HS9A 3RKQA 4IOAF 3DP7A 3F3XA 3BLYA 2HGCA 2E7XA 3S93A 2HQ5A 3IAM2 1CF7B 1Z6RA 4ACIA 3GZ6A 5H6RA 2V1NA 5A2QZ 3LL7A 3HSRA 1JGGA 4IHVA 3OYEA 3WTZA 4CHUA 5K58A 2F48A 1T6SA 1O7FA 3IHUA 2ZNZA 3LWJA 4KMUX 3RCOA 3F8CA 2QWWA 2Y31A 4IQ4A 5HDKA 2VONA 1PYVA 2NX4A 4UB6C 4XRSA 2HYTA 3DFGA 1WJBA 2CQNA 2LREA 1I1GA 1MKMA 4MLOA 3LSGA 2ME0A 1XGOA 3V7SA 5EG0A 1D0XA 4RB0A 1W4MA 1WI9A 1J2XA 3CUQC 1HQCA 3K8PC 5IP7J 3ERED 1XMKA 3SHFA 1QZZA 5L3CA 3W2WA 1IN4A 2JZYA 1NK2P 2WTEA 2X4HA 4IHYA 5BOXA 3OL3A 2M8GX 1KU3A 4XLHA 2P6SA 1D3YA 3HSEA 4PXIA 5DDGA 2LG4A 2DK8A 5CVUA 1I39A 1D1CA 4S05A 4QTRA 1U5TA 5IOZA 1R1VA 1TLHB 5FROA 5J6XA 2Z1DA 4B1RA 5FHPA 2VL8A 1JHHA 2O7TA 4EV0A 4RBOA 3CQZJ 1J9IA 2ZB9A 3BWGA 4M9SA 2O9LA 3GLLA 1HOMA 3M1CA 2VBWA 2ISZA 1ZREA 4BJ6C 2HVRA 1ETYA 2KPMA 2EFNA 4CCKA 4IO9F 4BBSJ 5IT9Z 3K10A 3GEUA 2DTRA 1BC7C 3BPXA 2I5UA 2D5VA 2NP5A 4RS8A 2FD5A 2ZXIA 4F7ZA 2ZSIB 5KNLA 3FK6A 1WJFA 3QQAA 4UUSB 1G3WA 3A4CA 2N8GA 3SFIA 2EIKH 3OR1C 2Y2ZA 4E7KA 1XS9A 5EYRA 2L9VA 4ENMA 2UXIA 4II2A 2XPWA 2B1EA 3MZHA 1T33A 2RNGA 1LJ9A 3RH2A 4BHBA 4MTEA 2YU9J 3CP2A 3V78A 2L4MA 4EM2A 2NVTJ 5HVQC 2WC2A 2ZCNA 2ZMEA 2DFIA 2IPQX 3U1KA 2DXIA 3BNIA 1OKRA 3RZOJ 1STZA 3MMYB 4G7OF 1V5EA 4N9HA 3BTJA 4MFEA 3SZGA 4L5EA 4ZZDA 2IGMA 2A6EF 4TV7A 2BW3A 3MQ0A 1IGNA 3S2DJ 3HRMA 1R5HA 3IRQA 3GTKJ 4A6EA 2X6XA 3OYKA 5F0CA 1SC7A 2GXBA 4GDFA 4AC6A 2HOAA 4L9VA 2VBXA 2HPMA 4A3GJ 3WE2A 5F0FA 2XGCA 4IRIA 2CO5A 4CO8A 1ZYRF 2VQCA 1U8BA 3DTKA 3PIPF 3GYHX 3HTJA 3E6CC 3BOQA 4OIQF 1F5TA 1K61A 1QHGA 2NS8A 4ABZA 2HU9A 4Z2YA 2UXOA 3E7QA 3CDIA 1R7JA 3DPUA 3RDIA 3VW2A 2A69F 1ZG1A 1LE8A 3F1BA 4FHTA 2UXUA 3W2VA 3OSGA 1YRNB 2AO9A 1IZ1A 3K1MA 1TWGJ 1UHMA 4U88A 2L54A 3BY6A 3KZYA 2DMNA 2K40A 3HM5A 1ZKGA 2NVXJ 1FMVA 3SEZA 2DK5A 3GBGA 3DKYA 3G2BA 4IRVA 3ABKH 1OCTC 3ZQ7A 3H35A 4MQVA 4OWRB 4A5NA 1TL8A 4E7JA 1FBSA 1YJ9I 1K78B 4BJ5C 2KRCA 2UXHA 3WG7H 3FXMA 1O4XA 4A3MJ 4L9TA 2LDUA 4II3A 1UMQA 3ZMTA 4A3KJ 2D6YA 2B63J 1NG6A 3DV8A 2WADA 2WAQN 2AXLA 1P2FA 3A2KA 3LHQA 3T1BA 3CO6C 2OCCH 4C2TA 4DYRA 3BQYA 1W5SA 2K86A 5DS9A 2W84A 4QWQA 3E97A 3HZJA 2K5CA 5GAEJ 1OQYA 1EV7A 1K4TA 1G6NA 3WTWC 4BDZA 4XLFA 1OYIA 2R5YB 2Y75A 3I55I 2DPUA 3KP4A 2ICWG 2KISA 1R23A 1XDUA 2W24A 1BM9A 2MYSA 3JREA 3ABTA 4NC8A 4AVPA 2E1MB 1I5ZA 4JKZA 4ZYEA 3G6EI 4AYBN 3VYRB 2ETHA 3VVZA 1KU2A 2DBBA 1XD7A 3LSPA 5D19A 3JTHA 1FTTA 3H0DA 1DGWY 5FMPA 1CGPA 3OSFA 4HV6A 1Z7LA 2JVGA 2R7XA 2DA5A 2QGUA 5F1JA 2NYXA 1FZPB 3CUQA 3A02A 2CUEA 2QLZA 2VN2A 4HQEA 2OAZA 4A93J 2PJPA 4DBQA 5LBQA 4V19K 3HTHA 4ENNA 1B6AA 2RREA 2HDDA 2K3FA 2NOGA 4IQJA 4BQQA 3LNQA 2ZJ2A 1P9QC 1BR2A 1T38A 3SFZA 1FYMA 3AFHA 4HBLA 3G1OA 2L7ZA 5FLVA 2K9SA 2QM3A 4CYDA 4ASNA 3O2PE 1OCPA 4NBQA 5K7ZA 3LSRA 2QSHX 3QYFA 4YRVA 2HTSA 4N9IA 2XV4S 4OU0A 1H0MA 4LLNA 2DA3A 4HV5A 4PDKA 2HR3A 3O60A 2RASA 4FQGA 5BS6A 3HC7A 5TISC 4E7LA 5DCMB 3G56A 4GGGA 2QZ8A 3FKJA 3SZTA 5HAWA 4LJZF 3K69A 2W25A 4OINF 4EJWA 1LUJB 5DV5A 2F5VA 2L4AA 2VJ4A 3V8JA 2FNAA 3NQOA 2FF4A 1OR7C 1MIJA 4FCYA 4C2MA 3HIFA 1XC5A 1FBQA 3ZCOA 3GVAA 2A5YB 2R7QA 3TO7A 4I98B 1KQ8A 2ZXWH 3HTSB 1OCZH 5DEQA 3JRFA 3LAJA 2Q0OA 4U7DA 2R7ZJ 5BNGA 1V4RA 2DA4A 3BJBA 2F07A 4M72A 1VQNI 1YW9A 1YFHA 1G4DA 1SD6A 1TNTA 4E7HA 2DOEA 4WF2A 4CCNA 4WWCA 2H6CA 3CDLA 4HDVA 1WJEA 5CVJA 4P96A 1MMDA 2E71A 4EMSA 1WI3A 1T0FA 2WUIA 3LSIA 2PJRB 2O7OA 4PFPA 3KPHA 1VI0A 3EUAA 3F8FA 3IL2A 1SD4A 2HS5A 1Z91A 3S14J 4FISA 4YELA 2CWEA 3NARA 4AIKA 5GPCA 3G73A 1Z3YA 1X2MA 3VSLA 1QZYA 1I6HJ 2OZUA 1LVKA 3JRGA 3VIBA 3BPVA 1O57A 4M6YA 3ZMVA 4CH7A 1Z7UA 2Q2EA 3ZRGA 4ESFA 3P7NA 4IKFA 5F08A 5ICFA 3LFUA 3DBLB 4ZYAA 2FE3A 4C3IJ 1Z77A 2LF8A 2VUMJ 3QPTA 1JKRC 5FKKA 3BHQA 1FLIA 3ZMDA 3S3MA 4GO1A 1P7IA 3BDDA 5CVIA 2FMLA 3TDZC 5JVGF 2O3FA 1IRGA 1UAAA 3WTVC 5DAJA 4U0VA 4O6JA 1FJLA 4F55A 2LBFB 3WODF 2ZCWA 1I3AA 3P9KA 4GYGA 1LKXA 5IP9J 3EUHC 4J00A 2ID3A 4C30A 4PJ0C 3J81Z 2QBYA 4UXNA 1TWHJ 3BR3A 4I99C 1MSEC 3CC2I 1MH4A 2R3SA 3ROUA 3MVPA 3AQSA 2IJLA 1WKMA 3A03A 3FF5A 3W2AA 1ZHFA 2STWA 3FX3A 2P4WA 2R5ZB 1J5YA 1RR7A 2JA8J 3GCMA 4BQOA 1K83J 5CJ9A 4PUSA 3EPZA 4MO7A 5C4YA 1IO2A 1ETVA 1EH8A 1IAWA 3M8EA 2GOMA 3RPUD 3OS2A 2QVOA 1YS6A 3E7LA 2XRLA 3JRBA 4BEHB 1VQ6I 4MTDA 4ON0A 4KMFA 4LGWA 3HRUA 2YPRA 5FKNA 1E3HA 1D0YA 3S3OA 5FFZA 3BG3A 4MQ9F 2BY0A 1EJ9A 1W7PB 3JRCA 2CFXA 1ODDA 3LQQA 4O5VA 2FBQA 3S3NA 1HDDC 1TWFJ 2R7SA 2DG7A 3VW1A 4YIFA 4L9NA 3OYJA 5D6FA 1GUUA 1RRJA 1MNMC 2M0MA 3TP3A 4Y13A 2E1CA 1SD5A 3BZKA 2M0CA 3RPUA 3L2CA 3PNVA 1MMAA 3REOA 5LGUA 1RNLA 2CW0F 2MSYA 5K1YA 4G8XA 5J4YA 4UUVA 2K3PA 2ZXHA 3VFZA 2LMDA 1VQMI 4HEA2 4LIUA 4IJAA 1V5GA 4H4KC 3SDBA 5FKMA 1JUMA 2CFOA 3CRJA 3CF5F 2DJIA 1VZ0A 4NC6A 4AU7A 2ELHA 5IYCJ 3SWHA 1Z6TA 2L9RA 1BL0A 3K4BA 3H9QA 3HOXJ 1YIJI 3B02A 1SFUA 4IF4A 3DBRB 3VOKA 1UJ8A 4C9YA 2V4JC 1T08B 2YX7A 5D5WB 2FXAA 4A3JJ 3RTRA 3NAUA 2WB1A 1WQ2A 5L3GA 2VPRA 4CCLA 2BE5F 1H9GA 2YUSA 1SEUA 2CQKA 2I10A 1TC3C 2PMHA 2F4IA 4XQFA 3DTIA 1QZEA 3MEXA 1WJDA 5DUKA 1RUNA 2H27A 2V1XA 2MA3A 2OZ6A 2ZSHB 3F0CA 1VNDA 2G0EA 3HEFA 3GFIA 3W6VA 3PUBA 1D1AA 4JX5A 4KT5C 1ETXA 2FJI1 1OR7A 3C18A 5CYVA 3EETA 2LP0A 1LVAA 1MW7A 3HTIA 5FD6A 3J81K 1JI8A 2M45A 1MGTA 1YX3A 3CP8A 1X1AA 1JKQC 2STTA 4P5OA 4EM1A 3MKWB 4HSTA 2Y9ZA 1YHQI 3ZMSA 3H3VK 5J8CA 4PK4A 2K4BA 1KONA 2MBFA 4M73A 3R6SA 1Z0XA 4HQMA 4L9JA 4CICA 3TO6A 1P4WA 1BOAA 1MBGA 3E5XA 2XGEA 1BIAA 2R7OA 2LNBA 2V6CA 3TGNA 3QODA 3E6BA 1GT0C 3GZ5A 1FSEA 3ZQCA 4JX4A 3VOXA 4QPQA 1OPCA 4KITB 2G7LA 1ZGAA 2IAIA 1RI7A 2L2OA 3KYDB 3LSTA 3OWTA 4CGZA 1MBHA 4CCJA 2VE8A 4P55A 4XLNF 4RM3A 2X48A 4X1EA 3GF2A 4PGGA 2EZLA 5TGTA 4YFNF 2DMTA 2EA2A 2ISYA 2O8KA 1HKQA 1JKOC 4XNFA 2CQXA 4UUTA 2O5RA 1X3ZB 1SMYF 4Q4ZF 5M5XJ 3JSPA 1B8IA 3C2GA 2DLLA 1LDKB 2V7FA 3TQNA 1AKHA 4RB2C 1FYLA 2NVYJ 4V2FA 2RV8A 5KHDA 3CCRI 5IY5H 4BUPA 5GTIC 1WGXA 4OIPF 1GHCA 3FBNB 3EUHA 4ZYGA 4U0YA 1UFMA 3OS0A 4KYWA 1USTA 1WJ5A 1USSA 2VKHA 1RUOA 5DCFA 4IXAA 3U9GA 3BZ6A 4KJZA 3OR2C 3S15J 4LMYA 2UXNA 3HE0A 2M4KA 2TDXA 3NWSA 1V3FA 3EYYA 2ID6A 4LITA 2WWYA 2G3BA 3RZDJ 5EEGA 2MLKA 1FP2A 2WAEA 2R7DA 3H5NA 2IA2A 2CSOA 4DYQA 3PSFA 1HSTA 2MC3A 3E5QA 2FBHA 3NNRA 5HDGA 2J5OA 2GAUA 4JNNA 1ZK8A 2DYRH 3BR0A 4I2OA 4Y7NJ 3OYCA 3G7RA 4IEJA 2M34A 4HPQA 2VPLA 3KEQA 2MH9A 2J5PA 1WH5A 3BT9A 2QQAA 1DP7P 4G94A 2KIUA 1X3WB 4F92B 3G4SI 3V6GA 2FBIA 1WVRA 5FGMA 3G71I 3IAS2 3HTUA 1RC9A 5CW8A 3KZZA 3HPGA 4AC0A 4L0YB 5GAHJ 3GFJA 3M07A 1R00A 3E0JB 3FXJA 2DODA 5B1AH 3L1PA 2XDVA 3VPRA 2XGXA 3BZCA 2NNNA 3L09A 5EG0B 4MFDA 3J7AO 1KYZA 3CZ6A 4XLCA 3L2VA 1IRFA 2RQPA 1HKSA 4XK4A 3DWLE 1FMWA 2GIVA 3FXRA 1SMTA 1X4OA 3DEEA 2K4JA 2RKHA 1MMNA 3ECHA 3M4OJ 3Q0WA 4XN0A 1FP1D 5DYMA 1BC8C 3HSFA 2KRHA 1U5TB 2BXZA 4IRGA 1YO5C 3TW6A 5B3SH 3VB2A 5HSZA 4M3BA 1S3JA 1VF9A 4RB1A 1PJRA 4MEYF 4BU2A 1IUYA 4ZDPA 2RN7A 4DQ2A 5B66C 3OV8A 3OYFA 1KQ0A 4M3DA 4AD9A 1P4XA 2ADUA 4JBAA 3QRFF 2F4MB 2Y9YA 3TP0A 1HW1A 3DQVC 1S5LC 3HOUJ 2IVMA 2LY1A 4BXFA 1KYWA 4BE0A 2V9VA 2IT0A 2UUZA 1KZHA 2LRDA 3ZQQA 4LLGF 4ENKA 5EGOA 1MDMB 3AG2H 4XIDA 1RPWA 1FC3A 1Z3XA 2DTZA 3GTOJ 1ERDA 2F5FA 2TRTA 2Y69H 4A6DA 1BW6A 2K9LA 2R7VA 2QF7A 3WU1B 3JRAA 4Y4RA 3RI4A 3LMMA 3PUFA 5E1XA 5HBUA 1RKWA 3H0GJ 5M5YJ 3JSJA 1JKPC 1FEXA 3IH3A 4DYCA 4P1WA 1HA8A 3I4NJ 1FY7A 3GFMA 5J1YA 1APLC 3P9CA 5J4VA 4PJMA 2ZMEB 4UVCA 3G1MA 2QQ9A 2FJ1A 3RQIA 3FXKA 3H3ZA 1FWZA 5FKOA 2W4SA 1IJWC 3M7GA 4G6TB 2YVHA 4CYCB 3J80K 2LH9A 1ZH5A 3ONQA 2FUG2 3CJRB 5E3LA 2VBZA 3SJMA 2HWVA 1WWXA 2IGOA 3LFKA 3I58A 5EDNA 3OYAA 1QRYA 3CCEI 2E5ZA 4NUBA 3KFWX 3VYUB 3RKWA 2JSPA 4FTHA 2I8DA 1XX5A 1UG2A 3QU3A 2E2IJ 3E5UA 3K9TA 3ZN0A 4IHSA 2E19A 1E3OC 2VKVA 1PUFA 1HSJA 3S16J 4UB8C 3F72A 2RVCA 4XKCA 5HS8A 3SEQA 1Y1VJ 2CV0A 1MMSA 5LEJA 2ZNYA 3LOCA 2P5VA 1MJBA 2W57A 3V7CA 1XSXA 3TO9A 4XOPA 5F0HA 2XC7A 1MBKA 2DOFA 1LE8B 5EEAA 2CRGA 1LFPA 1LNWA 2VBYA 5J1UA 4ETSA 2JPBA 1MBJA 2MLGA 4HKUA 2JT1A 1FNNA 3E6MA 3BJAA 2FNPA 1GV2A 4PSXA 2QSGX 4PSWA 1FSHA 1OYWA 2XSDC 5JLWA 1B9NA 3JRDA 3NRVA 1E17A 1T0FC 4D0PA 1SFXA 4ZTFA 1I27A 4EEFG 2G7SA 2L3DA 1SANA 4XLEA 1S72I 3PFIA 3DU6A 2BOLA 4B47A 3B81A 1FOYA 1RR8C 2EB7A 2CV2A 2JA7J 3HIMA 1GVJA 2E60A 4E4HA 4X6AJ 4LG3A 5HDNA 1YE9A 3ZQFA 1LPQA 5ICCA 2GM4A 4A12A 1SFEA 5K5RA 1VTNC 5GTHC 1TW3A 3H92A 2DFFA 4A3FJ 4F91B 1J09A 2HQRA 2M5WA 2E1OA 1T39A 5GAGJ 4CCMA 2F5DA 1UCRA 1W5CC 5DD4A 1TZLA 5EFYA 3ZQGA 1NH3A 1JGSA 1H89C 3KLOA 4A5MA 2MFZA 3E6DA 3BJ6A 1TW2A 1YLFA 2XB5A 4YFXF 4OAZA 5C44J 4X0GA 2Q24A 4BE2A 1EH6A 4E70A 4BDYA 3F8BA 3VSKA 1LB2A 3CMYA 1S7OA 4A3DJ 1UI6A 5EZGA 3ABLH 1SFKA 2KIFA 1R5ID 2RGVA 3NEUA 1AHDP 5HODA 2ZFWA 4IX7A 1JT0A 3CDHA 2JK3A 3GXOA 5LFAA 3CCMI 3VEPA 4I0AA 3ZP5A 1X3UA 2BVLA 5K7HA 3B6AA 4KICA 1P6RA 3WTTC 3EDPA 5FRNA 1N78A 3V42A 3FBIB 2D1VA 3VOEA 2OU2A 1EA3A 5GPAA 5F27A 1BIBA 2WGBA 3CCLI 1MJ9A 2D1HA 5ICGA 1C0WA 3OYHA 1ZRFA 2DMPA 1SAUA 2L9NA 9ANTA 2VKDA 2KIMA 1UI5A 2LKSA 4D7MA 3SQNA 5JR3A 3F8MA 3SDGA 2Z99A 1T98A 2EINH 2EIJH 2HQNA 1F43A 2GXGA 3GMEA 3ZQIA 3PNTA 4AWXB 4WCGA 2K85A 3TKYA 2WA0A 4LFUA 2OERA 2XDNA 2MW8A 3LSHA 2ZJRF 4I6ZA 3S1RJ 5FJ8J 3FMQA 1RKTA 3PFYA 3WU2C 2R7WA 3BG7A 3K4MA 2VOOA 1QVUA 2X9DA 3ZMZA 2DJNA 3FDYA 2WAFA 2O6GE 3UR3C 4PFOA 4GRIA 2H8RA 3G3ZA 2VLAA 2WAQA 1R36A 2VQHA 4ZZLA 1GDTA 2GA2A 2OA4A 2QWTA 3G1LA 3K1NA 4BHPA 5CXGA 1AA7A 1VQ5I 3GTMJ 3HOTA 2WV0A 3KEYA 2F6CA 3LJLA 3F6VA 3ISPA 3I54A 2A6TA 1OLTA 2UXPA 3VYSB 2Z3YA 1LEBA 1G3YA 2TCTA 1BA5A 2DQRA 1YW8A 3H1CA 3CMAI 3EGQA 4GCLA 3BQZA 1PVEA 2KJCA 5J8FA 3PM1A 4IOCF 3DXJF 3B73A 3M9AA 1ETKA 2HOTA 1B72A 1TNSA 2B7EA 4EJVA 5KCMA 3V8LA 4PJNA 5LGNA 1MBEA 5CQEA 3J7YJ 4AYBA 4AM3A 2WY8Q 4HNUA 4Y17A 3LWFA 4E7SA 3ZPLA 4GFBA 3W3CA 5E1WA 3HG9A 1FOXA 4ZC3A 5GADJ 3OYMA 4EM0B 4HRIA 4QPOA 4I01A 3AL0C 3HOYJ 2P0WA 5JFRA 3IRRA 3HRTA 4MEXF 5ILVA 3HYIA 1XSDA 2M7BA 1VQ7I 2ESHA 4QLCU 1E2XA 1Y39A 1DPRA 2QUFA 3MCZA 3CCVI 3DKXA 4Y33A 1EH7A 2OV7A 4BE1A 3QU6A 2BY3A 4XSXF 2ZCMA 2PBXA 1X1BA 3FISA 4PZJA 4DGWB 2DPDA 2NXNB 3V8KA 1U9NA 2E36A 2CU7A 4B3XA 5ED4A 5BQTA 4HW0A 4M6XA 4ICHA 2RDPA 2BHYA 1HKTA 3P9TA 4G7ZF 5L3DA 4XM3A 4IHWA 2QBYB 2HVSA 2EFQA 4NNJA 1DPUA 2LR8A 4NQWA 4F93B 2QTQA 1FBUA 1A6IA 2FEZA 4OMZA 4DZPA 3KIOA 1ETWA 3Q5FA 1TT0A 4HAMA 5J47A 1N75A 4XICA 5C4XJ 2BV6A 1DDNA 4EJTA 3M3YJ 4PJJA 4RGRA 1JTYA 2Y0SN 3FHNA 4PGHA 4Y15A 4YZEA 2KDOA 3VODA 1BI3A 1F1ZA 2V9KA 2FA5A 5CVVA 2R93J 1A35A 2M1BA 2X1EA 2VE9A 1QU3A 2CW8A 3F9KA 1PDNC 5E3MA 5CXIA 3HBLA 3VWBA 3V7RA 2V57A 4BBRJ 4ZYHA 3QBMA 3K4LA 1TQPA 4CSWA 5H20A 1R9TJ 1A6QA 4G12A 5E1ZB 1SGMA 4A69C 5FGLA 2AXTC 2QQ8A 2H8WA 3COAC 4JL3A 1XMXA 1LFBA 4ESJA 4I7HA 3CUOA 2EZIA 1GLNA 1OMIA 2A5WA 1UHSA 2DT6A 1OCOH 1FIAA 2YX4A 3F8NA 2KIQA 4BJTA 1JUPA 2ESNA 1RESA 2DI3A 5LGTA 1EKEA 4LLLA 1QHHD 5B5EC 3N4MA 1GXPA 2PZ9A 4A0XA 2Y0SA 4GCKA 3JRIA 4R8HA 1NTCA 2UXXA 3Q9SA 4WXDA 3GLXA 1ZRDA 1BJZA 1E0EA 1IN6A 4EATA 4XRMA 5E17F 1J0RA 2F2EA 2IGNA 4XRSG 2DA7A 2HKXA 2V1DA 2XF7A 2EILH 1LQ1A 1JXSA 1OCRH 2ZJPF 3L9FA 5IT3A 2BYVE 4CA0A 3DLAA 3LSKA 5DTDA 3ABMH 2HZTA 2HTJA 2PG4A 2DN0A 2V26A 3LQRA 3WE3A 3H9GA 2IW5A 1OISA 2BY2A 2EJRA 4IZZA 3S2HJ 3P5JA 2JJ7A 4HNVA 3I4MJ 3B6CA 3BTCA 4LD5A 2EFWA 3S5RA 1I1SA 3S2WA 4GFKA 2XAJA 1GV5A 2PMZN 4ANJA 4RLFA 4UVBA 2BZTA 4LB5A 4HF0A 3L00A 3E1SA 2FU4A 1K7AA 2CQ7A 3A0BC 4KWAA 4AIHA 2JRTA 3VP5A 3CMMA 3K4CA 3LSMA 2H94A 2JA6J 3MKZA 2GOXB 3QOPA 3PL8A 2O0YA 2CW7A 4S04A 5KVRA 5FRMA 3HGGA 3NS4A 3RIRA 3K1PA 4L5IA 4YFKF 2VASA 1OFCX 3RKXA 3Q0UA 1R1UA 4KN4X 3SZPA 4RB3C 2PQ8A 2GBYA 5EF6A 5H6QA 5HLGA 1DP3A 3WTSC 1IDZA 2AQEA 3U2RA 2F4OB 4BS9A 3FMRA 4NDLA 1N77A 2NP3A 1VQ8I 3HDDA 2XAQA 2DDBA 2M9HA 1SVLA 1QNTA 4A3BJ 1FT9A 5D8LB 2PMZA 1W7PD 2LD5A 3A01A 2OQRA 3ABUA 3JSOA 4B8XA 2BGCA 5TRDA 3UKGA 4A3CJ 2O61A 1R4MB 3P9IA 2FOKA 2RC4A 1IRZA 3IWZA 1V5FA 4HYEA 4C2UA 3ON2A 2MABA 3KZ9A 4HLYA 3K4KA 3F21A 3ASOH 1O3TA 3GTPJ 2BBYA 4GCTA 2Z2SB 4BY1J 1T95A 1ZN2A 2HI3A 4XRFA 5M3MJ 2XGDA 2XF6A 4EQQA 2H1KA 3DBHB 4LB6B 3K6GA 3BR2A 5D5VB 3AKZA 4YG2F 3V4GA 3JAMK 2JWTA 3DEWA 2P5LC 1IN7A 2NVUB 5HLTA 5AQCA 5JHUA 5L3EA 3FHZA 2K9QA 4KN7X 2EQRA 2XAFA 1TWCJ 1QPMA 5ILUA 2JTVA 2KKOA 1ITYA 1ZGJA 2Z5UA 1FOWA 2XROA 3GTQJ 3AG3H 3OL4A 1B8IB 1S8NA 3IV5A 2MD5A 5E20A 1HLVA 5E79C 3COLA 2IP2A 1MZBA 2W1OA 2CYYA 4LG0A 2YR2A 2MGQA 3I59A 3FMSA 4G6QA 2BEOA 1Y56A 1O3RA 1MMGA 5F1RA 3MNLA 3CF2A 2XPVA 3IH4A 4YIRX 5IYDJ 4KA4A 2PX9A 1FYKA 1ZLJA 3I53A 3DPLC 3BG5A 5BPDA 3S32A 2ELJA 3CC4I 3PJRA 4UNOA 4XR6A 4A0ZA 5E18F 4J19A 2QA4I 4A2UA 2EIMH 4LIVA 1TTYA 5FFXA 2LKPA 3AG1H 5E3NA 2LKXA 1KU9A 2OPTA 3D1NI 4L18B 1SFOJ 2REKA 4NELA 1H8AC 4Q48A 2HZDA 2NS0A 1X2NA 3R61A 4KISA 2ACJA 3PPBA 4IVNA 3VDXA 3NPIA 2X1DA 3MD2A 2XPUA 1T8IA 5D4SA 2BHZA 3CCJI 3QAHA 2HDCA 3N05A 4JX6A 2ZKZA 1MNDA 4R1HA 1L0OC 4A3IJ 4JK1X 3NWTA 3CLOA 5HOOA 2CG4A 2L5QA 3HGYA 2LK2A 2FX0A 3U21A 1R6RA 1YTYA 5C3EJ 4Y3OA 2HOEA 1R4NB 4A0YA 1WSUA 3S1MJ 2K27A 2ZC2A 1YIOA 4N4NB 1X58A 2KT0A 3J80Z 2G7HA 3K0LA 4EGYA 3HHGA 2IS1A 3BC8A 2P7CB 3FKIJ 2W48A 4MXMA 2E1NA 1FPQA 2ELKA 3OYLA 4U87A 1UELB 3DCFA 3QP5A 1VQ4I 2AHQA 1HF0A 1U8RA 3LSJA 5F6FA 2QQBA 3Q3SA 1UB9A 2DMQA 3KP7A 1PP7U 2E2HJ 1WHUA 2IEKA 1W5TA 2ZXJA 3K4NA 3S1NJ 1JHFA 1D8KA 4PCQA 2HXOA 2ZOYA 3C2BA 3M1EA 1DGRM 3WHCA 5LRSA 1X4PA 4M9XA 5K5QA 1W0TA 1W1WE 5D6EA 2Y48A 4E6KG 3VVXA 2L7KA 3T5XA 4NHJA 4E7IA 2E5NA 3DPJA 2IA0A 4MHGA 3K2AA 2PBIA 1R1TA 1WRJA 1D5VA 2OUMA 2W82A 3WU0A 5FLMJ 1ZAOA 4B09A 1HBXG 2KDZA 2MC4A 2L0KA 2L7FP 1JTXA 1TQIA 1RZ4A 3SYTA 2QKOA 3KKCA 4LOCA 2LVSA 2D2WA 2MG4A 5JLXA 4UV9A 1LFUP 3K4JA 1HW5A 3OYBA 4UY8I 4RDUA 1TBXA 5KK1A 3VW0A 4UV8A 3RPQA 3I4PA 3EQLF 3BCAA 2LFBA 4V2GA 1HC8A 1K4SA 3LAPA 5CQGA 1VQPI 3C07A 3FIWA 3HUGA 1FIPA 2KZGA 1QA6A 3D0SA 5H9TA 4OD5A 2XASA 1ETOA 3CLQA 1IN8A 3FXOA 5FLXK 2ZFUA 1J7KA 1XGSA 3EUKL 1WH7A 2VB6A 4D5CA 3HB9A 5ICEA 3BR5A
chains in the Genus database with same CATH topology
5GPAA 5F27A 3BR1A 2WGBA 1PUFB 3K7AJ 2VUMJ 1JKRC 1HDPA 3MN2A 5FKKA 3BHQA 1QVTA 2DMPA 9ANTA 3NRGA 1P7IA 5F04A 1UI5A 2QCOA 3QKXA 4D7MA 1IC8A 4MIMA 1HCRA 2HYJA 5J1RA 3SDGA 2R92J 5DAJA 2X6OA 5EZHA 1P7JA 1FJLA 3QPSA 1F43A 3ZQIA 3KKDA 3EUPA 1ZTRA 5IP9J 2G7GA 2OERA 2ID3A 2XDNA 2MW8A 3NI7A 3BR6A 4Y52J 1TWHJ 3BR3A 3IH2A 4I6ZA 5FJ8J 3S1RJ 1DU0A 1RKTA 1MSEC 3NXCA 3VUQA 1MH4A 2CJJA 3MVPA 3AQSA 2NS7A 1Y1WJ 1QVUA 2X9DA 2DJNA 3A03A 5M5WJ 2DA6A 2R5ZB 1RR7A 1S7EA 2JA8J 1JT6A 2H8RA 1K83J 1MSFC 1RETA 1GDTA 2QWTA 4MO7A 3G1LA 1EF4A 5C4YA 3GZIA 5CXGA 3GTMJ 1ETVA 3LJLA 3GTJJ 3E7LA 2XRLA 3JRBA 4IHXA 3CJDA 2UXPA 1I3QJ 4S0HB 3PASA 1OJLA 3HKZN 2TCTA 1BA5A 2P81A 5FKNA 3KNWA 3EGQA 4GCLA 2LTPA 1QPIA 3BQZA 3BG3A 2RAEA 3PM1A 2ZCXA 2IU5A 3JRCA 1ETKA 2HOTA 2FBQA 1ENHA 1B72A 1HDDC 1TWFJ 2DG7A 3VW1A 1MBEA 3AQTA 1GUUA 2WV1A 1MNMC 3TP3A 3JR9A 2M0CA 3RD3A 4FE4A 4GFBA 2VKEA 3BTLA 2MSYA 2QOPA 3IUVA 1A5JA 3HOYJ 5IOYA 1IDYA 2EH3A 3O8GA 3Q0VA 2GENA 5FKMA 1JUMA 2JA5J 4ME9A 3JRHA 1POGA 3CRJA 3GTGJ 3ZQLA 5EGOB 1IV6A 5IYCJ 4BXXJ 2L9RA 4MK6A 1BL0A 2ZCMA 2PBXA 1JJ6C 3FISA 3HOXJ 4CGRA 5J3LA 1U9NA 4CYCA 2CU7A 3VOKA 2GFNA 3WHBA 4A3JJ 3NAUA 1F36A 4DZJA 3HOWJ 4ICHA 2EZKA 2DA2A 1ZGWA 2VPRA 3P9TA 2YUSA 3OIOA 4JP0A 2I10A 1TC3C 1MH3A 3MKLA 2K9NA 4IHWA 2GLOA 3ZQHA 1VFCA 3F0CA 3HEFA 2LR8A 1VNDA 2G0EA 1G2HA 2QTQA 1A6IA 4DZPA 1MBFA 2ME6A 4UUSA 3W6VA 1ETWA 4JX5A 1ETXA 2LY9A 5C4XJ 4XICA 2RHAA 5IP6A 2EZHA 5IPAA 2LP0A 3M3YJ 3HTIA 1JTYA 2Y0SN 3RKQA 4YZEA 1JKQC 3ON4A 2R93J 2HQ5A 2Y9ZA 5E3MA 3H3VK 4ACIA 5CXIA 3HBLA 2V57A 1JGGA 4BBRJ 4IHVA 5K58A 3QBMA 4B3AA 1Z0XA 1R9TJ 3LWJA 2Y31A 4G12A 1SGMA 4A69C 5FGLA 1MBGA 4JL3A 2XGEA 2GUHA 1LFBA 2NX4A 2HYTA 4XRSA 2EZIA 1GT0C 3VOXA 1UHSA 4MLOA 3ZQCA 4JX4A 1B72B 3LSGA 2ME0A 5EG0A 1FIAA 2G7LA 2IAIA 1JUPA 1CQTA 5IP7J 1RESA 1H88C 5IYBJ 2PZ9A 2CQQA 1MBHA 4GCKA 1Q1VA 3JRIA 1NK2P 4IHYA 1NTCA 4UDSA 1BJZA 2M8GX 2X48A 4BY7J 4XRMA 2FQ4A 4X1EA 2EZLA 2OI8A 2DMTA 1YRNA 2O8KA 4PXIA 1JKOC 4QTRA 4XRSG 2DA7A 2CQXA 1WCMJ 4UUTA 5IOZA 2JN6A 5FKLA 4M3EA 4B1RA 5DTDA 5FHPA 5M5XJ 1B8IA 2DN0A 2O7TA 4RBOA 3CQZJ 2ZB9A 1AKHA 2LLKA 2NVYJ 4V2FA 2O9LA 3S2HJ 4HNVA 2JJ7A 1HOMA 3I4MJ 2ZOZA 4GFLA 3B6CA 3BTCA 3CCYA 3S5RA 1WGXA 1GVDA 1ZR4A 3HTAA 4M3GA 4GFKA 1ETYA 1GV5A 2PMZN 4BBSJ 3GEUA 3ANGA 2D5VA 3S15J 2NP5A 5D1RA 2FD5A 3BG9A 3BRUA 3HE0A 3FK6A 3QQAA 4KWAA 2ID6A 4UUSB 3VP5A 2G3BA 2N8GA 3SFIA 3RZDJ 2JA6J 2Y2ZA 1XS9A 1DU6A 4DYQA 5EYRA 3HOVJ 1D5YA 2Y30A 3NNRA 3HGGA 2UXIA 2XPWA 1T33A 4JNNA 1ZK8A 2R5YA 3BR0A 2QIBA 3RH2A 4Y7NJ 1OFCX 3Q0UA 2YU9J 3G7RA 4IEJA 3V78A 2M34A 4M6VA 2NVTJ 2GBYA 5EF6A 1WH5A 3BT9A 2ECBA 2HKUA 4BKXA 1IDZA 2ZCNA 4NDLA 3BNIA 2NP3A 3RZOJ 3BTJA 4MFEA 3V6GA 4L5EA 3HDDA 2M9HA 1IGNA 4A3BJ 3S2DJ 3OOUA 5CW8A 3VVYA 2LD5A 4AC0A 3A01A 3UKGA 4C3JJ 3GTKJ 4A3CJ 5F0CA 4JYKA 1IRZA 4W97A 3L1PA 4AC6A 2HOAA 3VPRA 3ON2A 4A3GJ 5EG0B 5F0FA 2XGCA 4MFDA 3KZ9A 1U8BA 3GTPJ 2R0QC 4GCTA 3HTJA 4BY1J 2HI3A 4XK4A 2XGDA 4ABZA 2NS8A 5M3MJ 1K61A 2H1KA 2JMWA 2UXOA 3E7QA 3VW2A 2M2EA 3BR2A 1LE8A 1JUSA 3F1BA 2JWTA 3DEWA 3M4OJ 3Q0WA 2UXUA 3OSGA 5AQCA 1YRNB 2AO9A 2K9QA 1W0UA 2EQRA 3TEDA 3PO2J 1TWCJ 1TWGJ 4L62A 2W53A 2DMNA 4W1UA 2K40A 3HM5A 3TW6A 1ITYA 1ZKGA 2NVXJ 5HSZA 3GTQJ 4M3BA 1B8IB 1VF9A 1NK3P 3T6NA 3GBGA 1OCTC 3IV5A 4M3DA 1HLVA 4DW6A 3COLA 1ORKA 2UXHA 2Y9YA 3TP0A 1O4XA 4A3MJ 1TWAJ 3HOUJ 1UMQA 2EBIA 3FK7A 2MGQA 4A3KJ 3TW7A 2B63J 3PO3J 2D6YA 5EGOA 1IG7A 4XIDA 1RPWA 4AF5A 2DTZA 2WAQN 3GTOJ 1JJ8C 3LHQA 5C4JJ 2TRTA 3MNLA 3IH4A 2XPVA 2YS9A 4D7NA 4DYRA 5IYDJ 3BQYA 5DS9A 1BW6A 3BG5A 2QF7A 2HOSA 3JRAA 5M3FJ 5HBUA 1RKWA 3H0GJ 4J19A 4A3EJ 2R5YB 3ANPA 5M5YJ 3JSJA 1JKPC 1FEXA 1IUFA 3IH3A 3O8HA 4DYCA 2LKXA 5E3NA 3I4NJ 1APLC 1XG1A 5J1YA 4NN1A 2OPTA 3D1NI 2YVEA 3JREA 1SFOJ 2REKA 3G1MA 4QIWN 1H8AC 4NELA 2FJ1A 3GTLJ 3RQIA 1X2NA 3BCGA 5FKOA 1IJWC 3PPBA 2YVHA 4CYCB 4JKZA 4AYBN 5E3LA 3NPIA 3SJMA 3VVZA 3LSPA 2XPUA 5D19A 3A01B 5EDNA 1FTTA 5FMPA 2E2JJ 1QRYA 3OSFA 4JX6A 4C2MJ 2DA5A 4FTHA 5F1JA 4A3IJ 1U9OA 1UG2A 2E2IJ 3A02A 2CUEA 4A93J 3HTHA 2E19A 1U78A 4AUXA 2DA1A 1E3OC 2VKVA 1PUFA 2COBA 3HGYA 2LK2A 2HDDA 2FX0A 3S16J 2NOGA 1Y1VJ 1WPKA 4C3HJ 3LOCA 5C3EJ 3LNQA 2VI6A 5F0HA 3FRQA 1MBKA 1LE8B 5EEAA 3S1MJ 3G1OA 2CRGA 2L7ZA 5K7FA 2K9SA 3LSRA 5J1UA 4D5FA 5K7ZA 1OCPA 2ECCA 1MBJA 5FLVA 4HKUA 1X58A 2KT0A 3FKIJ 1GV2A 2W48A 4MXMA 2WB1N 2ELKA 1ZQ3P 2DA3A 3DCFA 2XSDC 2NVQJ 5JLWA 2AHQA 3JRDA 3O60A 1HF0A 2RASA 3LSJA 3G56A 3Q3SA 2DMQA 5HAWA 2E2HJ 4QSHA 4EEFG 2G7SA 1SANA 2L7MP 2IEKA 2HXIA 3S1NJ 2HXOA 3S17J 2DMUA 2ZOYA 3C2BA 4A3LJ 3B81A 3WHCA 2JA7J 1T56A 3HIMA 1W0TA 1BW5A 2R5ZA 4X6AJ 3VVXA 5GP9A 4FCYA 1XC5A 3ZQFA 3HOZJ 3DPJA 3K2AA 2GM4A 3CWRA 5E3OA 3S1QJ 4A3FJ 5FLMJ 3JRFA 2KDZA 2E1OA 2L0KA 2L7FP 2R7ZJ 5BNGA 2DA4A 2DG8A 1JTXA 3BJBA 5EFYA 2QKOA 3ZQGA 2F07A 3KKCA 3QPLA 4LOCA 1ETQA 2LVSA 1H89C 2CUFA 2MG4A 3CDLA 5JLXA 2XB5A 5C44J 2OF7A 1LFUP 2Q24A 2IBDA 2XB0X 1WI3A 2WUIA 4RDUA 2O7OA 4I76A 4B4CA 1VI0A 3VW0A 1FTZA 3S14J 4FISA 3CMYA 1UI6A 2LFBA 4A3DJ 5EZGA 1ZR2A 4V2GA 3NARA 5GPCA 1X2MA 1AHDP 5HODA 1AU7A 1I6HJ 3C07A 1JT0A 3FIWA 3ZOBA 3JRGA 1AKHB 2JK3A 1FIPA 3VIBA 5H9TA 4M3FA 5K7HA 1ETOA 5F08A 3B6AA 3BTIA 1WH7A 4FE7A 4C3IJ 1Z77A 1I50J 4D5CA 3HB9A 3BR5A 5D18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPA A;  5F27 A;  3BR1 A;  2WGB A;  1PUF B;  3K7A J;  2VUM J;  1JKR C;  1HDP A;  3MN2 A;  5FKK A;  3BHQ A;  1QVT A;  2DMP A;  9ANT A;  3NRG A;  1P7I A;  5F04 A;  1UI5 A;  2QCO A;  3QKX A;  4D7M A;  1IC8 A;  4MIM A;  1HCR A;  2HYJ A;  5J1R A;  3SDG A;  2R92 J;  5DAJ A;  2X6O A;  5EZH A;  1P7J A;  1FJL A;  3QPS A;  1F43 A;  3ZQI A;  3KKD A;  3EUP A;  1ZTR A;  5IP9 J;  2G7G A;  2OER A;  2ID3 A;  2XDN A;  2MW8 A;  3NI7 A;  3BR6 A;  4Y52 J;  1TWH J;  3BR3 A;  3IH2 A;  4I6Z A;  5FJ8 J;  3S1R J;  1DU0 A;  1RKT A;  1MSE C;  3NXC A;  3VUQ A;  1MH4 A;  2CJJ A;  3MVP A;  3AQS A;  2NS7 A;  1Y1W J;  1QVU A;  2X9D A;  2DJN A;  3A03 A;  5M5W J;  2DA6 A;  2R5Z B;  1RR7 A;  1S7E A;  2JA8 J;  1JT6 A;  2H8R A;  1K83 J;  1MSF C;  1RET A;  1GDT A;  2QWT A;  4MO7 A;  3G1L A;  1EF4 A;  5C4Y A;  3GZI A;  5CXG A;  3GTM J;  1ETV A;  3LJL A;  3GTJ J;  3E7L A;  2XRL A;  3JRB A;  4IHX A;  3CJD A;  2UXP A;  1I3Q J;  4S0H B;  3PAS A;  1OJL A;  3HKZ N;  2TCT A;  1BA5 A;  2P81 A;  5FKN A;  3KNW A;  3EGQ A;  4GCL A;  2LTP A;  1QPI A;  3BQZ A;  3BG3 A;  2RAE A;  3PM1 A;  2ZCX A;  2IU5 A;  3JRC A;  1ETK A;  2HOT A;  2FBQ A;  1ENH A;  1B72 A;  1HDD C;  1TWF J;  2DG7 A;  3VW1 A;  1MBE A;  3AQT A;  1GUU A;  2WV1 A;  1MNM C;  3TP3 A;  3JR9 A;  2M0C A;  3RD3 A;  4FE4 A;  4GFB A;  2VKE A;  3BTL A;  2MSY A;  2QOP A;  3IUV A;  1A5J A;  3HOY J;  5IOY A;  1IDY A;  2EH3 A;  3O8G A;  3Q0V A;  2GEN A;  5FKM A;  1JUM A;  2JA5 J;  4ME9 A;  3JRH A;  1POG A;  3CRJ A;  3GTG J;  3ZQL A;  5EGO B;  1IV6 A;  5IYC J;  4BXX J;  2L9R A;  4MK6 A;  1BL0 A;  2ZCM A;  2PBX A;  1JJ6 C;  3FIS A;  3HOX J;  4CGR A;  5J3L A;  1U9N A;  4CYC A;  2CU7 A;  3VOK A;  2GFN A;  3WHB A;  4A3J J;  3NAU A;  1F36 A;  4DZJ A;  3HOW J;  4ICH A;  2EZK A;  2DA2 A;  1ZGW A;  2VPR A;  3P9T A;  2YUS A;  3OIO A;  4JP0 A;  2I10 A;  1TC3 C;  1MH3 A;  3MKL A;  2K9N A;  4IHW A;  2GLO A;  3ZQH A;  1VFC A;  3F0C A;  3HEF A;  2LR8 A;  1VND A;  2G0E A;  1G2H A;  2QTQ A;  1A6I A;  4DZP A;  1MBF A;  2ME6 A;  4UUS A;  3W6V A;  1ETW A;  4JX5 A;  1ETX A;  2LY9 A;  5C4X J;  4XIC A;  2RHA A;  5IP6 A;  2EZH A;  5IPA A;  2LP0 A;  3M3Y J;  3HTI A;  1JTY A;  2Y0S N;  3RKQ A;  4YZE A;  1JKQ C;  3ON4 A;  2R93 J;  2HQ5 A;  2Y9Z A;  5E3M A;  3H3V K;  4ACI A;  5CXI A;  3HBL A;  2V57 A;  1JGG A;  4BBR J;  4IHV A;  5K58 A;  3QBM A;  4B3A A;  1Z0X A;  1R9T J;  3LWJ A;  2Y31 A;  4G12 A;  1SGM A;  4A69 C;  5FGL A;  1MBG A;  4JL3 A;  2XGE A;  2GUH A;  1LFB A;  2NX4 A;  2HYT A;  4XRS A;  2EZI A;  1GT0 C;  3VOX A;  1UHS A;  4MLO A;  3ZQC A;  4JX4 A;  1B72 B;  3LSG A;  2ME0 A;  5EG0 A;  1FIA A;  2G7L A;  2IAI A;  1JUP A;  1CQT A;  5IP7 J;  1RES A;  1H88 C;  5IYB J;  2PZ9 A;  2CQQ A;  1MBH A;  4GCK A;  1Q1V A;  3JRI A;  1NK2 P;  4IHY A;  1NTC A;  4UDS A;  1BJZ A;  2M8G X;  2X48 A;  4BY7 J;  4XRM A;  2FQ4 A;  4X1E A;  2EZL A;  2OI8 A;  2DMT A;  1YRN A;  2O8K A;  4PXI A;  1JKO C;  4QTR A;  4XRS G;  2DA7 A;  2CQX A;  1WCM J;  4UUT A;  5IOZ A;  2JN6 A;  5FKL A;  4M3E A;  4B1R A;  5DTD A;  5FHP A;  5M5X J;  1B8I A;  2DN0 A;  2O7T A;  4RBO A;  3CQZ J;  2ZB9 A;  1AKH A;  2LLK A;  2NVY J;  4V2F A;  2O9L A;  3S2H J;  4HNV A;  2JJ7 A;  1HOM A;  3I4M J;  2ZOZ A;  4GFL A;  3B6C A;  3BTC A;  3CCY A;  3S5R A;  1WGX A;  1GVD A;  1ZR4 A;  3HTA A;  4M3G A;  4GFK A;  1ETY A;  1GV5 A;  2PMZ N;  4BBS J;  3GEU A;  3ANG A;  2D5V A;  3S15 J;  2NP5 A;  5D1R A;  2FD5 A;  3BG9 A;  3BRU A;  3HE0 A;  3FK6 A;  3QQA A;  4KWA A;  2ID6 A;  4UUS B;  3VP5 A;  2G3B A;  2N8G A;  3SFI A;  3RZD J;  2JA6 J;  2Y2Z A;  1XS9 A;  1DU6 A;  4DYQ A;  5EYR A;  3HOV J;  1D5Y A;  2Y30 A;  3NNR A;  3HGG A;  2UXI A;  2XPW A;  1T33 A;  4JNN A;  1ZK8 A;  2R5Y A;  3BR0 A;  2QIB A;  3RH2 A;  4Y7N J;  1OFC X;  3Q0U A;  2YU9 J;  3G7R A;  4IEJ A;  3V78 A;  2M34 A;  4M6V A;  2NVT J;  2GBY A;  5EF6 A;  1WH5 A;  3BT9 A;  2ECB A;  2HKU A;  4BKX A;  1IDZ A;  2ZCN A;  4NDL A;  3BNI A;  2NP3 A;  3RZO J;  3BTJ A;  4MFE A;  3V6G A;  4L5E A;  3HDD A;  2M9H A;  1IGN A;  4A3B J;  3S2D J;  3OOU A;  5CW8 A;  3VVY A;  2LD5 A;  4AC0 A;  3A01 A;  3UKG A;  4C3J J;  3GTK J;  4A3C J;  5F0C A;  4JYK A;  1IRZ A;  4W97 A;  3L1P A;  4AC6 A;  2HOA A;  3VPR A;  3ON2 A;  4A3G J;  5EG0 B;  5F0F A;  2XGC A;  4MFD A;  3KZ9 A;  1U8B A;  3GTP J;  2R0Q C;  4GCT A;  3HTJ A;  4BY1 J;  2HI3 A;  4XK4 A;  2XGD A;  4ABZ A;  2NS8 A;  5M3M J;  1K61 A;  2H1K A;  2JMW A;  2UXO A;  3E7Q A;  3VW2 A;  2M2E A;  3BR2 A;  1LE8 A;  1JUS A;  3F1B A;  2JWT A;  3DEW A;  3M4O J;  3Q0W A;  2UXU A;  3OSG A;  5AQC A;  1YRN B;  2AO9 A;  2K9Q A;  1W0U A;  2EQR A;  3TED A;  3PO2 J;  1TWC J;  1TWG J;  4L62 A;  2W53 A;  2DMN A;  4W1U A;  2K40 A;  3HM5 A;  3TW6 A;  1ITY A;  1ZKG A;  2NVX J;  5HSZ A;  3GTQ J;  4M3B A;  1B8I B;  1VF9 A;  1NK3 P;  3T6N A;  3GBG A;  1OCT C;  3IV5 A;  4M3D A;  1HLV A;  4DW6 A;  3COL A;  1ORK A;  2UXH A;  2Y9Y A;  3TP0 A;  1O4X A;  4A3M J;  1TWA J;  3HOU J;  1UMQ A;  2EBI A;  3FK7 A;  2MGQ A;  4A3K J;  3TW7 A;  2B63 J;  3PO3 J;  2D6Y A;  5EGO A;  1IG7 A;  4XID A;  1RPW A;  4AF5 A;  2DTZ A;  2WAQ N;  3GTO J;  1JJ8 C;  3LHQ A;  5C4J J;  2TRT A;  3MNL A;  3IH4 A;  2XPV A;  2YS9 A;  4D7N A;  4DYR A;  5IYD J;  3BQY A;  5DS9 A;  1BW6 A;  3BG5 A;  2QF7 A;  2HOS A;  3JRA A;  5M3F J;  5HBU A;  1RKW A;  3H0G J;  4J19 A;  4A3E J;  2R5Y B;  3ANP A;  5M5Y J;  3JSJ A;  1JKP C;  1FEX A;  1IUF A;  3IH3 A;  3O8H A;  4DYC A;  2LKX A;  5E3N A;  3I4N J;  1APL C;  1XG1 A;  5J1Y A;  4NN1 A;  2OPT A;  3D1N I;  2YVE A;  3JRE A;  1SFO J;  2REK A;  3G1M A;  4QIW N;  1H8A C;  4NEL A;  2FJ1 A;  3GTL J;  3RQI A;  1X2N A;  3BCG A;  5FKO A;  1IJW C;  3PPB A;  2YVH A;  4CYC B;  4JKZ A;  4AYB N;  5E3L A;  3NPI A;  3SJM A;  3VVZ A;  3LSP A;  2XPU A;  5D19 A;  3A01 B;  5EDN A;  1FTT A;  5FMP A;  2E2J J;  1QRY A;  3OSF A;  4JX6 A;  4C2M J;  2DA5 A;  4FTH A;  5F1J A;  4A3I J;  1U9O A;  1UG2 A;  2E2I J;  3A02 A;  2CUE A;  4A93 J;  3HTH A;  2E19 A;  1U78 A;  4AUX A;  2DA1 A;  1E3O C;  2VKV A;  1PUF A;  2COB A;  3HGY A;  2LK2 A;  2HDD A;  2FX0 A;  3S16 J;  2NOG A;  1Y1V J;  1WPK A;  4C3H J;  3LOC A;  5C3E J;  3LNQ A;  2VI6 A;  5F0H A;  3FRQ A;  1MBK A;  1LE8 B;  5EEA A;  3S1M J;  3G1O A;  2CRG A;  2L7Z A;  5K7F A;  2K9S A;  3LSR A;  5J1U A;  4D5F A;  5K7Z A;  1OCP A;  2ECC A;  1MBJ A;  5FLV A;  4HKU A;  1X58 A;  2KT0 A;  3FKI J;  1GV2 A;  2W48 A;  4MXM A;  2WB1 N;  2ELK A;  1ZQ3 P;  2DA3 A;  3DCF A;  2XSD C;  2NVQ J;  5JLW A;  2AHQ A;  3JRD A;  3O60 A;  1HF0 A;  2RAS A;  3LSJ A;  3G56 A;  3Q3S A;  2DMQ A;  5HAW A;  2E2H J;  4QSH A;  4EEF G;  2G7S A;  1SAN A;  2L7M P;  2IEK A;  2HXI A;  3S1N J;  2HXO A;  3S17 J;  2DMU A;  2ZOY A;  3C2B A;  4A3L J;  3B81 A;  3WHC A;  2JA7 J;  1T56 A;  3HIM A;  1W0T A;  1BW5 A;  2R5Z A;  4X6A J;  3VVX A;  5GP9 A;  4FCY A;  1XC5 A;  3ZQF A;  3HOZ J;  3DPJ A;  3K2A A;  2GM4 A;  3CWR A;  5E3O A;  3S1Q J;  4A3F J;  5FLM J;  3JRF A;  2KDZ A;  2E1O A;  2L0K A;  2L7F P;  2R7Z J;  5BNG A;  2DA4 A;  2DG8 A;  1JTX A;  3BJB A;  5EFY A;  2QKO A;  3ZQG A;  2F07 A;  3KKC A;  3QPL A;  4LOC A;  1ETQ A;  2LVS A;  1H89 C;  2CUF A;  2MG4 A;  3CDL A;  5JLX A;  2XB5 A;  5C44 J;  2OF7 A;  1LFU P;  2Q24 A;  2IBD A;  2XB0 X;  1WI3 A;  2WUI A;  4RDU A;  2O7O A;  4I76 A;  4B4C A;  1VI0 A;  3VW0 A;  1FTZ A;  3S14 J;  4FIS A;  3CMY A;  1UI6 A;  2LFB A;  4A3D J;  5EZG A;  1ZR2 A;  4V2G A;  3NAR A;  5GPC A;  1X2M A;  1AHD P;  5HOD A;  1AU7 A;  1I6H J;  3C07 A;  1JT0 A;  3FIW A;  3ZOB A;  3JRG A;  1AKH B;  2JK3 A;  1FIP A;  3VIB A;  5H9T A;  4M3F A;  5K7H A;  1ETO A;  5F08 A;  3B6A A;  3BTI A;  1WH7 A;  4FE7 A;  4C3I J;  1Z77 A;  1I50 J;  4D5C A;  3HB9 A;  3BR5 A;  5D18 A; 
#chains in the Genus database with same CATH topology
 3CES A;  1NG7 A;  2OTL I;  4L0Z B;  3ZXS A;  2HYG D;  3PSI A;  3K7A J;  1PUF B;  3T8T A;  1HDP A;  1S6L A;  2O8X A;  3MN2 A;  4XLP F;  1QVT A;  1TP4 A;  2IA1 A;  5DD8 A;  2F5C A;  2QCO A;  1FOK A;  2IS2 A;  1R58 A;  4CUG A;  4F52 A;  4HF2 A;  1HCR A;  3WG9 A;  3GEZ A;  4WXH A;  4KUM A;  5JHF A;  1TQM A;  1P7J A;  2QKL B;  3JW4 A;  4XKW A;  1ONV A;  4WX9 A;  2M7A A;  4D1Q A;  4RGX A;  4XMY A;  2G7G A;  2QKM B;  3IKT A;  5L3B A;  4G7H F;  4JOM A;  1WJC A;  4Y52 J;  1U3E M;  3IH2 A;  2A05 A;  2PFV A;  1DU0 A;  3MKY B;  3VUQ A;  1ZG5 A;  2DW4 A;  3OY9 A;  2CJJ A;  2UZK A;  1ULY A;  2Z33 A;  1Y1W J;  1XDS A;  2BW3 B;  5M5W J;  3KX2 A;  2FRH A;  3H36 A;  3D5S C;  2R7F A;  3OOP A;  2FBK A;  2VT2 A;  1S7E A;  1JT6 A;  2EFO A;  3IWF A;  1MSF C;  2Z16 A;  4OOI A;  2AQF A;  3MZY A;  4BYY A;  4RGS A;  5LHG A;  1WFX A;  1BR1 A;  1CF7 A;  3N97 A;  4I0B A;  1YIT I;  1YQA A;  1ACI A;  3GTJ J;  2OC6 A;  3CCQ I;  4IHX A;  3HRS A;  3PAS A;  1I3Q J;  1OJL A;  1BBY A;  3HKZ N;  3GX4 X;  2E7W A;  4MGR A;  2E1M C;  3OYD A;  2DFH A;  1QPI A;  2GXA A;  5DM7 F;  2EK5 A;  2JQ7 A;  5HLI A;  4HF1 A;  4U9L A;  2RAE A;  2KL4 A;  3C7J A;  3DLL F;  2VQG A;  2IU5 A;  2CMP A;  3FWE A;  2LF7 A;  2B9S A;  3CCS I;  2FQ3 A;  1ENH A;  2K9M A;  4ENJ A;  1SVO A;  3FM5 A;  3UNG C;  2IS6 A;  1Q1H A;  2X85 A;  1MDM A;  1O7L A;  2JUC A;  1Y8R B;  4G6D A;  2A68 F;  5CLS A;  4B44 A;  3TDU C;  4ZH4 F;  2MD0 A;  4FE4 A;  1BR4 A;  4BXU A;  4XBF A;  2QEX I;  3QOE A;  5EJC A;  2FMY A;  4K2E A;  3IUV A;  3KP2 A;  1XSV A;  3GZN B;  4HA8 A;  1YOV B;  3F22 A;  3ZN1 A;  1IDY A;  2EH3 A;  5DUI A;  3O8G A;  1Z9C A;  4B43 A;  2GEN A;  3R0A A;  4ME9 A;  1POG A;  2B3W A;  4HX7 A;  1MD0 A;  2HDW A;  1MNE A;  3HKZ A;  4O3M A;  4BXX J;  3OS1 A;  5D8K B;  4MK6 A;  2F5E A;  1K6O A;  2CH0 A;  1YJW I;  1JJ6 C;  3OIP A;  1KQ9 A;  4CGR A;  5J3L A;  3W6K B;  4KIG A;  4P9F A;  4CYC A;  2XKP A;  3WHB A;  3FXQ A;  2EV5 A;  3HXL A;  1F36 A;  4AIJ A;  3E3V A;  4DZJ A;  1VQL I;  3HOW J;  5F64 A;  2EZK A;  2DA2 A;  2P5K A;  1ZGW A;  5A2Q K;  1KA8 A;  3FZV A;  1M1E B;  3OIO A;  3KE2 A;  2XAU A;  1MH3 A;  3MKL A;  2K9N A;  5HNH A;  1U6G A;  2GLO A;  4G9Y A;  4GXO A;  5LHI A;  1PP8 F;  1G2H A;  4BNC A;  4HLX A;  2OJE D;  2XKO A;  4UUS A;  2V79 A;  1ON1 A;  2IXS A;  3SXY A;  2LY9 A;  2RHA A;  2DYS H;  2GA1 A;  1BN5 A;  5IPA A;  4HDU A;  2M8E A;  2XF5 A;  2JUG A;  2KP6 A;  5AIQ A;  1ON2 A;  3CUQ B;  4XLA A;  3BCB A;  3ON4 A;  1V55 H;  2PMU A;  4N0B A;  3RJP A;  1YS7 A;  1X1C A;  2PI0 A;  2XSJ C;  3FXL A;  2P8T A;  1YJN I;  2V9P A;  3TBI A;  3T8R A;  2OBP A;  2VQL A;  3MZ8 A;  4B3A A;  2A07 F;  2KZV A;  1YG2 A;  4H0E A;  2MH2 A;  1G3T A;  1UG0 A;  2JA2 A;  2GUH A;  2LOO A;  4OD4 A;  1HW2 A;  3CJQ B;  1U0J A;  2PN6 A;  3PNY A;  3AG4 H;  1B72 B;  3QYB A;  1XGM A;  1J59 A;  1NHA A;  3C3W A;  3RSN A;  5J40 A;  2FSW A;  5E8G A;  1XMA A;  1CQT A;  5H2F C;  4XL9 A;  3PQJ A;  1R71 A;  1H9T A;  1H88 C;  4OAY A;  4KT6 A;  5IYB J;  2CQQ A;  3DTE A;  3IUO A;  4AVZ A;  3D5L A;  4GCV A;  1O3Q A;  3T0Y A;  1RIO H;  4EJO A;  1Q1V A;  4RGU A;  4CZZ A;  2HPI A;  1BI0 A;  5IT9 K;  4UDS A;  3K2Z A;  1R22 A;  1Z1D A;  4BY7 J;  2R7R A;  2FQ4 A;  1LDJ A;  1Z05 A;  4NC7 A;  2X51 A;  1AOY A;  2OI8 A;  1YRN A;  2H6B A;  4IL6 C;  2HYF A;  3CJN A;  1WCM J;  2DDA A;  2XRN A;  3K70 C;  2JN6 A;  2VIX A;  5FKL A;  4E7Z A;  2M4G A;  4M3E A;  2VJI A;  4YEJ A;  1W36 C;  3HOS A;  4PJL A;  2A6H F;  3U1D A;  3A0H C;  3W6J B;  4EGZ A;  2OTJ I;  1JE8 A;  3I9V 2;  3DPT A;  1UZC A;  2R7T A;  4XON A;  1P4A A;  2G9W A;  2LLK A;  2VC1 A;  2DQL A;  2ZOZ A;  4GFL A;  3CCY A;  1G8X A;  1K78 A;  3C1D A;  3KCC A;  1GVD A;  1ZR4 A;  2XAG A;  3HTA A;  4M3G A;  4R79 A;  3GUD A;  2R7U A;  5JVT A;  2QSF X;  6PAX A;  2VOD A;  3ANG A;  3KP6 A;  4XN3 A;  4FT8 A;  1A04 A;  1TT5 B;  4DJA A;  5D1R A;  3BG9 A;  3BRU A;  3GO5 A;  4NQW B;  3H3U A;  1WJA A;  2PFB A;  4NB5 A;  4ZYD A;  1K6Y A;  1XCB A;  1T2K A;  3Q9V A;  4RAG A;  3QWL A;  3KZI C;  1DU6 A;  2Q2E B;  3HOV J;  1D5Y A;  2Y30 A;  1S29 A;  3OIQ A;  1G3S A;  1QQI A;  1UHW A;  2R5Y A;  2QIB A;  2UWM A;  3C2H A;  4M6V A;  2HKU A;  2L01 A;  2ECB A;  4BKX A;  3ML6 A;  4BQN A;  1GXQ A;  2RQQ A;  3MWM A;  1IN5 A;  4XKV A;  1A31 A;  2EV6 A;  3TL4 X;  5ERI A;  2WY7 Q;  3OOU A;  3VVY A;  1IXS B;  2XAH A;  3FXU A;  3LA7 A;  4C3J J;  2IGK A;  3L2Q A;  3PIO F;  2E34 A;  4JYK A;  2DOA A;  3QYE A;  4W97 A;  3CO7 C;  2XIG A;  5K5O A;  4FX4 A;  1SD7 A;  2DCE A;  4EVI A;  2CGP A;  1WZ2 A;  4L5J A;  4BH9 A;  2XHK A;  5L3F A;  4WK8 F;  2R0Q C;  1IF1 A;  4UHT A;  4RM2 A;  3DF8 A;  1BI2 A;  4BAY A;  2HFH A;  2EA4 A;  5HLH A;  2JMW A;  5LEK A;  2KRF A;  2EFP A;  5D4R A;  1O3S A;  3DKW A;  2M2E A;  4BQA A;  1JUS A;  1KU7 A;  3X2Q H;  1YI2 I;  3DU5 A;  3WTX C;  4HX4 A;  3TOB A;  1W0U A;  3TED A;  3PO2 J;  3L2W A;  2NOJ B;  4L62 A;  5JI6 A;  3KEO A;  2W53 A;  2DFE A;  4W1U A;  1IV8 A;  2CUZ A;  4KIF A;  5B1B H;  1F4K A;  1B1B A;  4ZDL A;  2W7N A;  4LK1 F;  4Q47 A;  2V6E A;  5DCM A;  1NK3 P;  3T6N A;  4IRH A;  1BI1 A;  4FET A;  2D45 A;  2YSR A;  2LYC A;  3HL2 A;  3WGG A;  1J75 A;  2X0L A;  5FD5 A;  1BJA A;  3ZMU A;  1D1B A;  2GWR A;  1ORK A;  4DW6 A;  2EV0 A;  2VOP A;  1VQK I;  3CTA A;  4M74 A;  1TWA J;  3KYC B;  2EBI A;  3FK7 A;  3TW7 A;  3JAM Z;  3PO3 J;  3GFL A;  4J01 A;  3KP5 A;  4BAC A;  1XN7 A;  1IG7 A;  1DQU A;  2H1L A;  1QBJ A;  4AF5 A;  1JJ8 C;  2EPF A;  4DOZ A;  5C4J J;  5FB2 A;  5CVR A;  4F3Q A;  2YS9 A;  3KP3 A;  4D7N A;  1QO0 D;  4HOB A;  3ASN H;  2HOS A;  2XUB A;  3H5A A;  5M3F J;  3KYL A;  3CJT B;  2DO7 A;  5TJJ A;  2H09 A;  4A3E J;  3ANP A;  3MAJ A;  5LHH A;  1IUF A;  3I3L A;  2LY2 A;  3O8H A;  5CPR B;  3CD6 I;  2PJR A;  4NN1 A;  1XG1 A;  4BHC A;  2E35 A;  5KAF C;  1X1P A;  5LLQ A;  1LDD A;  2YVE A;  1QGP A;  3I56 I;  4QIW N;  4OIR F;  1ZRC A;  3GTL J;  3BCG A;  3HJE A;  1V54 H;  2OD5 A;  1Y0N A;  1IW7 F;  1R49 A;  2A3S A;  3K70 D;  5ILS A;  1W36 D;  4U7B A;  2LC2 A;  1YYV A;  3A01 B;  4OIO F;  2E2J J;  3RKY A;  2ZY9 A;  4C2M J;  2AS5 F;  1D8J A;  1U9O A;  2DU9 A;  3BRO A;  5KAI C;  3HPH A;  1U78 A;  2VT3 A;  4AUX A;  2DA1 A;  3KET A;  2COB A;  2G7U A;  3H5R A;  3CCU I;  3AL0 B;  1B9M A;  2K7L A;  1WPK A;  4C3H J;  1I6X A;  1REP C;  3PQK A;  3O6B B;  2VI6 A;  3FRQ A;  1S9H A;  4RAZ A;  1IRX A;  5K7F A;  2KJB A;  1P92 A;  4M9Z A;  1XPX A;  4D5F A;  2ECC A;  3OYI A;  2LBF A;  2KHM A;  2OCE A;  1YX5 A;  4FAS D;  2WB1 N;  2NNY A;  3I5U A;  1ZQ3 P;  2NVQ J;  1X19 A;  4RA2 A;  2YU3 A;  1ZAR A;  5BPI A;  4WXC A;  2Y0M A;  2A61 A;  2WBM A;  3QPH A;  4BL0 B;  4QSH A;  2L7M P;  3ZGK A;  2HXI A;  3BJO A;  1Z67 A;  3S17 J;  2DMU A;  3BP8 A;  3BG6 A;  3I64 A;  4A3L J;  1T56 A;  1BW5 A;  4D9J A;  2R5Z A;  4LG0 B;  2Z9O A;  5GP9 A;  4DBR A;  3HOZ J;  2EWN A;  3I59 B;  2ZBK A;  3CWR A;  5BMZ A;  5E3O A;  2X1C A;  2V1U A;  3ERM A;  5HNF A;  3S1Q J;  5E8I A;  2M3A A;  3F6O A;  4BEH A;  2VC0 A;  1A36 A;  1XTA A;  2DG8 A;  3WTU C;  1XGN A;  3QPL A;  1ETQ A;  1VQO I;  4HG2 A;  1ZEL A;  2CUF A;  4CDG A;  1L3L A;  3J7Z I;  2OF7 A;  3M8F A;  2HNH A;  2XB0 X;  2IBD A;  1W7P A;  1ZG3 A;  2KMU A;  2W00 A;  4AID A;  4GYI A;  2HKO A;  4I76 A;  4B4C A;  1FTZ A;  2XVC A;  3LA2 A;  3D5R C;  5AON A;  5EEH A;  2OQG A;  1ZR2 A;  2CS3 A;  4M71 A;  2L02 A;  5CKT A;  2FOW A;  1D0Z A;  3WTY C;  3CME I;  1AU7 A;  3ZOB A;  1AKH B;  2O03 A;  3HHH A;  3KLN A;  1OCC H;  3I71 A;  4ITV A;  4ZDO A;  4JQF A;  4M3F A;  2LSO A;  3H9J A;  3AAF A;  4XKB A;  1B4A A;  2P6T A;  3GW2 A;  3BTI A;  4FE7 A;  4OMY A;  1I50 J;  5DM6 F;  5D18 A;  3JCU C;  3BR1 A;  4DNC A;  4LK0 F;  4RAY A;  1XB4 A;  2JPC A;  2X6W A;  1U5T C;  2KFD A;  3NRG A;  2HVQ A;  5F04 A;  2BY1 A;  2R4G A;  3QKX A;  1IC8 A;  4MIM A;  3VYT B;  2HYJ A;  5J1R A;  2RNJ A;  4P9U A;  2R92 J;  3TOA A;  5D5X B;  2X6O A;  5EZH A;  3L2R A;  3QPS A;  5LRR A;  3KKD A;  4XOT A;  3EUP A;  4IPA A;  4ESB A;  1ZTR A;  3IC7 A;  4CXF A;  5FLX Z;  3LA3 A;  3NI7 A;  4RAF A;  4ZTJ A;  3BR6 A;  3ZR8 X;  2Q1Z B;  1OYY A;  2VJ5 A;  3CC7 I;  3NXC A;  2JSC A;  3IKV A;  4KFC A;  4KNY A;  3RYP A;  2NS7 A;  1SAX A;  3VTI A;  2DA6 A;  3A1Y A;  2M30 A;  2GQQ A;  1AWC A;  4IHT A;  1S7A A;  2KLO A;  5D5U B;  1RET A;  3RYR A;  3L7W A;  1EF4 A;  3WGI A;  3GWZ A;  3GZI A;  4HX8 A;  2PEX A;  4MNU A;  2B0L A;  1Y0U A;  4KIB A;  3ECO A;  4DIQ A;  3F23 A;  3R60 A;  4KDP A;  1N25 A;  4Q5S F;  2JVH A;  2C6Y A;  1Z21 A;  2BXY A;  1F9N A;  2DAO A;  2X6Y A;  3MFK A;  2ZME C;  3CJD A;  4S0H B;  3ESW B;  4DVY P;  3RQ4 A;  1SVM A;  2P81 A;  1R5G A;  3KNW A;  1FX7 A;  4BGD A;  1ZLK A;  2HQA A;  2LTP A;  1G59 A;  1IXR C;  2A2F X;  1KGS A;  1IXC A;  2NAZ A;  2ZCX A;  2K02 A;  2IS4 A;  2DT7 B;  4YII A;  2CUJ A;  4N4O B;  2Q8K A;  2IRF G;  2DT5 A;  3AQT A;  2JRM A;  1E3P A;  2WV1 A;  3OYG A;  2COM A;  3JR9 A;  3RD3 A;  3M8J A;  3HUG B;  4HNT A;  1PUE E;  2P7V B;  2VKE A;  3BTL A;  2QOP A;  2YVX A;  2GIZ A;  2QYO A;  1X1D A;  3S8P A;  4EJU A;  1VQ9 I;  1A5J A;  4RLQ A;  3TMO A;  5IOY A;  3DEU A;  1U2W A;  4FX0 A;  3Q0V A;  3ULQ B;  1K79 A;  1DUX C;  2JA5 J;  2PLY A;  3JRH A;  1BOB A;  4I02 A;  3GTG J;  1HXD A;  2L9S A;  2ZO4 A;  4RMN A;  4WIB A;  4XOR A;  3ZQL A;  5EGO B;  2KQR A;  4I09 A;  1IV6 A;  1Y8Q B;  4Z6Y A;  3R0J A;  3J7A Y;  3EYI A;  1B59 A;  4XSZ F;  2UV1 A;  1YW7 A;  2BVM A;  2GFN A;  2QEN A;  2CV1 A;  3OYN A;  4CCO A;  1LEA A;  3O3K A;  3JTG A;  3OMY A;  2M87 A;  3L2U A;  5AIP A;  3QP6 A;  4U0W A;  2GZW A;  4JP0 A;  3FM3 A;  3WGH A;  5LD2 C;  4B48 A;  3ZQH A;  1VFC A;  3I0T A;  5FO5 A;  2ZJQ F;  1Y6I A;  4CZC A;  2VXZ A;  1MBF A;  4HSR A;  2ME6 A;  2NRA C;  1XCV A;  2VXD A;  2W85 A;  3ELK A;  4HZF A;  4ZJZ A;  3IP4 B;  3R4K A;  4UVA A;  5IP6 A;  2EZH A;  2VJJ A;  2HEO A;  5HS7 A;  4U9N A;  1MJA A;  5HS9 A;  3RKQ A;  4IOA F;  3DP7 A;  3F3X A;  3BLY A;  2HGC A;  2E7X A;  3S93 A;  2HQ5 A;  3IAM 2;  1CF7 B;  1Z6R A;  4ACI A;  3GZ6 A;  5H6R A;  2V1N A;  5A2Q Z;  3LL7 A;  3HSR A;  1JGG A;  4IHV A;  3OYE A;  3WTZ A;  4CHU A;  5K58 A;  2F48 A;  1T6S A;  1O7F A;  3IHU A;  2ZNZ A;  3LWJ A;  4KMU X;  3RCO A;  3F8C A;  2QWW A;  2Y31 A;  4IQ4 A;  5HDK A;  2VON A;  1PYV A;  2NX4 A;  4UB6 C;  4XRS A;  2HYT A;  3DFG A;  1WJB A;  2CQN A;  2LRE A;  1I1G A;  1MKM A;  4MLO A;  3LSG A;  2ME0 A;  1XGO A;  3V7S A;  5EG0 A;  1D0X A;  4RB0 A;  1W4M A;  1WI9 A;  1J2X A;  3CUQ C;  1HQC A;  3K8P C;  5IP7 J;  3ERE D;  1XMK A;  3SHF A;  1QZZ A;  5L3C A;  3W2W A;  1IN4 A;  2JZY A;  1NK2 P;  2WTE A;  2X4H A;  4IHY A;  5BOX A;  3OL3 A;  2M8G X;  1KU3 A;  4XLH A;  2P6S A;  1D3Y A;  3HSE A;  4PXI A;  5DDG A;  2LG4 A;  2DK8 A;  5CVU A;  1I39 A;  1D1C A;  4S05 A;  4QTR A;  1U5T A;  5IOZ A;  1R1V A;  1TLH B;  5FRO A;  5J6X A;  2Z1D A;  4B1R A;  5FHP A;  2VL8 A;  1JHH A;  2O7T A;  4EV0 A;  4RBO A;  3CQZ J;  1J9I A;  2ZB9 A;  3BWG A;  4M9S A;  2O9L A;  3GLL A;  1HOM A;  3M1C A;  2VBW A;  2ISZ A;  1ZRE A;  4BJ6 C;  2HVR A;  1ETY A;  2KPM A;  2EFN A;  4CCK A;  4IO9 F;  4BBS J;  5IT9 Z;  3K10 A;  3GEU A;  2DTR A;  1BC7 C;  3BPX A;  2I5U A;  2D5V A;  2NP5 A;  4RS8 A;  2FD5 A;  2ZXI A;  4F7Z A;  2ZSI B;  5KNL A;  3FK6 A;  1WJF A;  3QQA A;  4UUS B;  1G3W A;  3A4C A;  2N8G A;  3SFI A;  2EIK H;  3OR1 C;  2Y2Z A;  4E7K A;  1XS9 A;  5EYR A;  2L9V A;  4ENM A;  2UXI A;  4II2 A;  2XPW A;  2B1E A;  3MZH A;  1T33 A;  2RNG A;  1LJ9 A;  3RH2 A;  4BHB A;  4MTE A;  2YU9 J;  3CP2 A;  3V78 A;  2L4M A;  4EM2 A;  2NVT J;  5HVQ C;  2WC2 A;  2ZCN A;  2ZME A;  2DFI A;  2IPQ X;  3U1K A;  2DXI A;  3BNI A;  1OKR A;  3RZO J;  1STZ A;  3MMY B;  4G7O F;  1V5E A;  4N9H A;  3BTJ A;  4MFE A;  3SZG A;  4L5E A;  4ZZD A;  2IGM A;  2A6E F;  4TV7 A;  2BW3 A;  3MQ0 A;  1IGN A;  3S2D J;  3HRM A;  1R5H A;  3IRQ A;  3GTK J;  4A6E A;  2X6X A;  3OYK A;  5F0C A;  1SC7 A;  2GXB A;  4GDF A;  4AC6 A;  2HOA A;  4L9V A;  2VBX A;  2HPM A;  4A3G J;  3WE2 A;  5F0F A;  2XGC A;  4IRI A;  2CO5 A;  4CO8 A;  1ZYR F;  2VQC A;  1U8B A;  3DTK A;  3PIP F;  3GYH X;  3HTJ A;  3E6C C;  3BOQ A;  4OIQ F;  1F5T A;  1K61 A;  1QHG A;  2NS8 A;  4ABZ A;  2HU9 A;  4Z2Y A;  2UXO A;  3E7Q A;  3CDI A;  1R7J A;  3DPU A;  3RDI A;  3VW2 A;  2A69 F;  1ZG1 A;  1LE8 A;  3F1B A;  4FHT A;  2UXU A;  3W2V A;  3OSG A;  1YRN B;  2AO9 A;  1IZ1 A;  3K1M A;  1TWG J;  1UHM A;  4U88 A;  2L54 A;  3BY6 A;  3KZY A;  2DMN A;  2K40 A;  3HM5 A;  1ZKG A;  2NVX J;  1FMV A;  3SEZ A;  2DK5 A;  3GBG A;  3DKY A;  3G2B A;  4IRV A;  3ABK H;  1OCT C;  3ZQ7 A;  3H35 A;  4MQV A;  4OWR B;  4A5N A;  1TL8 A;  4E7J A;  1FBS A;  1YJ9 I;  1K78 B;  4BJ5 C;  2KRC A;  2UXH A;  3WG7 H;  3FXM A;  1O4X A;  4A3M J;  4L9T A;  2LDU A;  4II3 A;  1UMQ A;  3ZMT A;  4A3K J;  2D6Y A;  2B63 J;  1NG6 A;  3DV8 A;  2WAD A;  2WAQ N;  2AXL A;  1P2F A;  3A2K A;  3LHQ A;  3T1B A;  3CO6 C;  2OCC H;  4C2T A;  4DYR A;  3BQY A;  1W5S A;  2K86 A;  5DS9 A;  2W84 A;  4QWQ A;  3E97 A;  3HZJ A;  2K5C A;  5GAE J;  1OQY A;  1EV7 A;  1K4T A;  1G6N A;  3WTW C;  4BDZ A;  4XLF A;  1OYI A;  2R5Y B;  2Y75 A;  3I55 I;  2DPU A;  3KP4 A;  2ICW G;  2KIS A;  1R23 A;  1XDU A;  2W24 A;  1BM9 A;  2MYS A;  3JRE A;  3ABT A;  4NC8 A;  4AVP A;  2E1M B;  1I5Z A;  4JKZ A;  4ZYE A;  3G6E I;  4AYB N;  3VYR B;  2ETH A;  3VVZ A;  1KU2 A;  2DBB A;  1XD7 A;  3LSP A;  5D19 A;  3JTH A;  1FTT A;  3H0D A;  1DGW Y;  5FMP A;  1CGP A;  3OSF A;  4HV6 A;  1Z7L A;  2JVG A;  2R7X A;  2DA5 A;  2QGU A;  5F1J A;  2NYX A;  1FZP B;  3CUQ A;  3A02 A;  2CUE A;  2QLZ A;  2VN2 A;  4HQE A;  2OAZ A;  4A93 J;  2PJP A;  4DBQ A;  5LBQ A;  4V19 K;  3HTH A;  4ENN A;  1B6A A;  2RRE A;  2HDD A;  2K3F A;  2NOG A;  4IQJ A;  4BQQ A;  3LNQ A;  2ZJ2 A;  1P9Q C;  1BR2 A;  1T38 A;  3SFZ A;  1FYM A;  3AFH A;  4HBL A;  3G1O A;  2L7Z A;  5FLV A;  2K9S A;  2QM3 A;  4CYD A;  4ASN A;  3O2P E;  1OCP A;  4NBQ A;  5K7Z A;  3LSR A;  2QSH X;  3QYF A;  4YRV A;  2HTS A;  4N9I A;  2XV4 S;  4OU0 A;  1H0M A;  4LLN A;  2DA3 A;  4HV5 A;  4PDK A;  2HR3 A;  3O60 A;  2RAS A;  4FQG A;  5BS6 A;  3HC7 A;  5TIS C;  4E7L A;  5DCM B;  3G56 A;  4GGG A;  2QZ8 A;  3FKJ A;  3SZT A;  5HAW A;  4LJZ F;  3K69 A;  2W25 A;  4OIN F;  4EJW A;  1LUJ B;  5DV5 A;  2F5V A;  2L4A A;  2VJ4 A;  3V8J A;  2FNA A;  3NQO A;  2FF4 A;  1OR7 C;  1MIJ A;  4FCY A;  4C2M A;  3HIF A;  1XC5 A;  1FBQ A;  3ZCO A;  3GVA A;  2A5Y B;  2R7Q A;  3TO7 A;  4I98 B;  1KQ8 A;  2ZXW H;  3HTS B;  1OCZ H;  5DEQ A;  3JRF A;  3LAJ A;  2Q0O A;  4U7D A;  2R7Z J;  5BNG A;  1V4R A;  2DA4 A;  3BJB A;  2F07 A;  4M72 A;  1VQN I;  1YW9 A;  1YFH A;  1G4D A;  1SD6 A;  1TNT A;  4E7H A;  2DOE A;  4WF2 A;  4CCN A;  4WWC A;  2H6C A;  3CDL A;  4HDV A;  1WJE A;  5CVJ A;  4P96 A;  1MMD A;  2E71 A;  4EMS A;  1WI3 A;  1T0F A;  2WUI A;  3LSI A;  2PJR B;  2O7O A;  4PFP A;  3KPH A;  1VI0 A;  3EUA A;  3F8F A;  3IL2 A;  1SD4 A;  2HS5 A;  1Z91 A;  3S14 J;  4FIS A;  4YEL A;  2CWE A;  3NAR A;  4AIK A;  5GPC A;  3G73 A;  1Z3Y A;  1X2M A;  3VSL A;  1QZY A;  1I6H J;  2OZU A;  1LVK A;  3JRG A;  3VIB A;  3BPV A;  1O57 A;  4M6Y A;  3ZMV A;  4CH7 A;  1Z7U A;  2Q2E A;  3ZRG A;  4ESF A;  3P7N A;  4IKF A;  5F08 A;  5ICF A;  3LFU A;  3DBL B;  4ZYA A;  2FE3 A;  4C3I J;  1Z77 A;  2LF8 A;  2VUM J;  3QPT A;  1JKR C;  5FKK A;  3BHQ A;  1FLI A;  3ZMD A;  3S3M A;  4GO1 A;  1P7I A;  3BDD A;  5CVI A;  2FML A;  3TDZ C;  5JVG F;  2O3F A;  1IRG A;  1UAA A;  3WTV C;  5DAJ A;  4U0V A;  4O6J A;  1FJL A;  4F55 A;  2LBF B;  3WOD F;  2ZCW A;  1I3A A;  3P9K A;  4GYG A;  1LKX A;  5IP9 J;  3EUH C;  4J00 A;  2ID3 A;  4C30 A;  4PJ0 C;  3J81 Z;  2QBY A;  4UXN A;  1TWH J;  3BR3 A;  4I99 C;  1MSE C;  3CC2 I;  1MH4 A;  2R3S A;  3ROU A;  3MVP A;  3AQS A;  2IJL A;  1WKM A;  3A03 A;  3FF5 A;  3W2A A;  1ZHF A;  2STW A;  3FX3 A;  2P4W A;  2R5Z B;  1J5Y A;  1RR7 A;  2JA8 J;  3GCM A;  4BQO A;  1K83 J;  5CJ9 A;  4PUS A;  3EPZ A;  4MO7 A;  5C4Y A;  1IO2 A;  1ETV A;  1EH8 A;  1IAW A;  3M8E A;  2GOM A;  3RPU D;  3OS2 A;  2QVO A;  1YS6 A;  3E7L A;  2XRL A;  3JRB A;  4BEH B;  1VQ6 I;  4MTD A;  4ON0 A;  4KMF A;  4LGW A;  3HRU A;  2YPR A;  5FKN A;  1E3H A;  1D0Y A;  3S3O A;  5FFZ A;  3BG3 A;  4MQ9 F;  2BY0 A;  1EJ9 A;  1W7P B;  3JRC A;  2CFX A;  1ODD A;  3LQQ A;  4O5V A;  2FBQ A;  3S3N A;  1HDD C;  1TWF J;  2R7S A;  2DG7 A;  3VW1 A;  4YIF A;  4L9N A;  3OYJ A;  5D6F A;  1GUU A;  1RRJ A;  1MNM C;  2M0M A;  3TP3 A;  4Y13 A;  2E1C A;  1SD5 A;  3BZK A;  2M0C A;  3RPU A;  3L2C A;  3PNV A;  1MMA A;  3REO A;  5LGU A;  1RNL A;  2CW0 F;  2MSY A;  5K1Y A;  4G8X A;  5J4Y A;  4UUV A;  2K3P A;  2ZXH A;  3VFZ A;  2LMD A;  1VQM I;  4HEA 2;  4LIU A;  4IJA A;  1V5G A;  4H4K C;  3SDB A;  5FKM A;  1JUM A;  2CFO A;  3CRJ A;  3CF5 F;  2DJI A;  1VZ0 A;  4NC6 A;  4AU7 A;  2ELH A;  5IYC J;  3SWH A;  1Z6T A;  2L9R A;  1BL0 A;  3K4B A;  3H9Q A;  3HOX J;  1YIJ I;  3B02 A;  1SFU A;  4IF4 A;  3DBR B;  3VOK A;  1UJ8 A;  4C9Y A;  2V4J C;  1T08 B;  2YX7 A;  5D5W B;  2FXA A;  4A3J J;  3RTR A;  3NAU A;  2WB1 A;  1WQ2 A;  5L3G A;  2VPR A;  4CCL A;  2BE5 F;  1H9G A;  2YUS A;  1SEU A;  2CQK A;  2I10 A;  1TC3 C;  2PMH A;  2F4I A;  4XQF A;  3DTI A;  1QZE A;  3MEX A;  1WJD A;  5DUK A;  1RUN A;  2H27 A;  2V1X A;  2MA3 A;  2OZ6 A;  2ZSH B;  3F0C A;  1VND A;  2G0E A;  3HEF A;  3GFI A;  3W6V A;  3PUB A;  1D1A A;  4JX5 A;  4KT5 C;  1ETX A;  2FJI 1;  1OR7 A;  3C18 A;  5CYV A;  3EET A;  2LP0 A;  1LVA A;  1MW7 A;  3HTI A;  5FD6 A;  3J81 K;  1JI8 A;  2M45 A;  1MGT A;  1YX3 A;  3CP8 A;  1X1A A;  1JKQ C;  2STT A;  4P5O A;  4EM1 A;  3MKW B;  4HST A;  2Y9Z A;  1YHQ I;  3ZMS A;  3H3V K;  5J8C A;  4PK4 A;  2K4B A;  1KON A;  2MBF A;  4M73 A;  3R6S A;  1Z0X A;  4HQM A;  4L9J A;  4CIC A;  3TO6 A;  1P4W A;  1BOA A;  1MBG A;  3E5X A;  2XGE A;  1BIA A;  2R7O A;  2LNB A;  2V6C A;  3TGN A;  3QOD A;  3E6B A;  1GT0 C;  3GZ5 A;  1FSE A;  3ZQC A;  4JX4 A;  3VOX A;  4QPQ A;  1OPC A;  4KIT B;  2G7L A;  1ZGA A;  2IAI A;  1RI7 A;  2L2O A;  3KYD B;  3LST A;  3OWT A;  4CGZ A;  1MBH A;  4CCJ A;  2VE8 A;  4P55 A;  4XLN F;  4RM3 A;  2X48 A;  4X1E A;  3GF2 A;  4PGG A;  2EZL A;  5TGT A;  4YFN F;  2DMT A;  2EA2 A;  2ISY A;  2O8K A;  1HKQ A;  1JKO C;  4XNF A;  2CQX A;  4UUT A;  2O5R A;  1X3Z B;  1SMY F;  4Q4Z F;  5M5X J;  3JSP A;  1B8I A;  3C2G A;  2DLL A;  1LDK B;  2V7F A;  3TQN A;  1AKH A;  4RB2 C;  1FYL A;  2NVY J;  4V2F A;  2RV8 A;  5KHD A;  3CCR I;  5IY5 H;  4BUP A;  5GTI C;  1WGX A;  4OIP F;  1GHC A;  3FBN B;  3EUH A;  4ZYG A;  4U0Y A;  1UFM A;  3OS0 A;  4KYW A;  1UST A;  1WJ5 A;  1USS A;  2VKH A;  1RUO A;  5DCF A;  4IXA A;  3U9G A;  3BZ6 A;  4KJZ A;  3OR2 C;  3S15 J;  4LMY A;  2UXN A;  3HE0 A;  2M4K A;  2TDX A;  3NWS A;  1V3F A;  3EYY A;  2ID6 A;  4LIT A;  2WWY A;  2G3B A;  3RZD J;  5EEG A;  2MLK A;  1FP2 A;  2WAE A;  2R7D A;  3H5N A;  2IA2 A;  2CSO A;  4DYQ A;  3PSF A;  1HST A;  2MC3 A;  3E5Q A;  2FBH A;  3NNR A;  5HDG A;  2J5O A;  2GAU A;  4JNN A;  1ZK8 A;  2DYR H;  3BR0 A;  4I2O A;  4Y7N J;  3OYC A;  3G7R A;  4IEJ A;  2M34 A;  4HPQ A;  2VPL A;  3KEQ A;  2MH9 A;  2J5P A;  1WH5 A;  3BT9 A;  2QQA A;  1DP7 P;  4G94 A;  2KIU A;  1X3W B;  4F92 B;  3G4S I;  3V6G A;  2FBI A;  1WVR A;  5FGM A;  3G71 I;  3IAS 2;  3HTU A;  1RC9 A;  5CW8 A;  3KZZ A;  3HPG A;  4AC0 A;  4L0Y B;  5GAH J;  3GFJ A;  3M07 A;  1R00 A;  3E0J B;  3FXJ A;  2DOD A;  5B1A H;  3L1P A;  2XDV A;  3VPR A;  2XGX A;  3BZC A;  2NNN A;  3L09 A;  5EG0 B;  4MFD A;  3J7A O;  1KYZ A;  3CZ6 A;  4XLC A;  3L2V A;  1IRF A;  2RQP A;  1HKS A;  4XK4 A;  3DWL E;  1FMW A;  2GIV A;  3FXR A;  1SMT A;  1X4O A;  3DEE A;  2K4J A;  2RKH A;  1MMN A;  3ECH A;  3M4O J;  3Q0W A;  4XN0 A;  1FP1 D;  5DYM A;  1BC8 C;  3HSF A;  2KRH A;  1U5T B;  2BXZ A;  4IRG A;  1YO5 C;  3TW6 A;  5B3S H;  3VB2 A;  5HSZ A;  4M3B A;  1S3J A;  1VF9 A;  4RB1 A;  1PJR A;  4MEY F;  4BU2 A;  1IUY A;  4ZDP A;  2RN7 A;  4DQ2 A;  5B66 C;  3OV8 A;  3OYF A;  1KQ0 A;  4M3D A;  4AD9 A;  1P4X A;  2ADU A;  4JBA A;  3QRF F;  2F4M B;  2Y9Y A;  3TP0 A;  1HW1 A;  3DQV C;  1S5L C;  3HOU J;  2IVM A;  2LY1 A;  4BXF A;  1KYW A;  4BE0 A;  2V9V A;  2IT0 A;  2UUZ A;  1KZH A;  2LRD A;  3ZQQ A;  4LLG F;  4ENK A;  5EGO A;  1MDM B;  3AG2 H;  4XID A;  1RPW A;  1FC3 A;  1Z3X A;  2DTZ A;  3GTO J;  1ERD A;  2F5F A;  2TRT A;  2Y69 H;  4A6D A;  1BW6 A;  2K9L A;  2R7V A;  2QF7 A;  3WU1 B;  3JRA A;  4Y4R A;  3RI4 A;  3LMM A;  3PUF A;  5E1X A;  5HBU A;  1RKW A;  3H0G J;  5M5Y J;  3JSJ A;  1JKP C;  1FEX A;  3IH3 A;  4DYC A;  4P1W A;  1HA8 A;  3I4N J;  1FY7 A;  3GFM A;  5J1Y A;  1APL C;  3P9C A;  5J4V A;  4PJM A;  2ZME B;  4UVC A;  3G1M A;  2QQ9 A;  2FJ1 A;  3RQI A;  3FXK A;  3H3Z A;  1FWZ A;  5FKO A;  2W4S A;  1IJW C;  3M7G A;  4G6T B;  2YVH A;  4CYC B;  3J80 K;  2LH9 A;  1ZH5 A;  3ONQ A;  2FUG 2;  3CJR B;  5E3L A;  2VBZ A;  3SJM A;  2HWV A;  1WWX A;  2IGO A;  3LFK A;  3I58 A;  5EDN A;  3OYA A;  1QRY A;  3CCE I;  2E5Z A;  4NUB A;  3KFW X;  3VYU B;  3RKW A;  2JSP A;  4FTH A;  2I8D A;  1XX5 A;  1UG2 A;  3QU3 A;  2E2I J;  3E5U A;  3K9T A;  3ZN0 A;  4IHS A;  2E19 A;  1E3O C;  2VKV A;  1PUF A;  1HSJ A;  3S16 J;  4UB8 C;  3F72 A;  2RVC A;  4XKC A;  5HS8 A;  3SEQ A;  1Y1V J;  2CV0 A;  1MMS A;  5LEJ A;  2ZNY A;  3LOC A;  2P5V A;  1MJB A;  2W57 A;  3V7C A;  1XSX A;  3TO9 A;  4XOP A;  5F0H A;  2XC7 A;  1MBK A;  2DOF A;  1LE8 B;  5EEA A;  2CRG A;  1LFP A;  1LNW A;  2VBY A;  5J1U A;  4ETS A;  2JPB A;  1MBJ A;  2MLG A;  4HKU A;  2JT1 A;  1FNN A;  3E6M A;  3BJA A;  2FNP A;  1GV2 A;  4PSX A;  2QSG X;  4PSW A;  1FSH A;  1OYW A;  2XSD C;  5JLW A;  1B9N A;  3JRD A;  3NRV A;  1E17 A;  1T0F C;  4D0P A;  1SFX A;  4ZTF A;  1I27 A;  4EEF G;  2G7S A;  2L3D A;  1SAN A;  4XLE A;  1S72 I;  3PFI A;  3DU6 A;  2BOL A;  4B47 A;  3B81 A;  1FOY A;  1RR8 C;  2EB7 A;  2CV2 A;  2JA7 J;  3HIM A;  1GVJ A;  2E60 A;  4E4H A;  4X6A J;  4LG3 A;  5HDN A;  1YE9 A;  3ZQF A;  1LPQ A;  5ICC A;  2GM4 A;  4A12 A;  1SFE A;  5K5R A;  1VTN C;  5GTH C;  1TW3 A;  3H92 A;  2DFF A;  4A3F J;  4F91 B;  1J09 A;  2HQR A;  2M5W A;  2E1O A;  1T39 A;  5GAG J;  4CCM A;  2F5D A;  1UCR A;  1W5C C;  5DD4 A;  1TZL A;  5EFY A;  3ZQG A;  1NH3 A;  1JGS A;  1H89 C;  3KLO A;  4A5M A;  2MFZ A;  3E6D A;  3BJ6 A;  1TW2 A;  1YLF A;  2XB5 A;  4YFX F;  4OAZ A;  5C44 J;  4X0G A;  2Q24 A;  4BE2 A;  1EH6 A;  4E70 A;  4BDY A;  3F8B A;  3VSK A;  1LB2 A;  3CMY A;  1S7O A;  4A3D J;  1UI6 A;  5EZG A;  3ABL H;  1SFK A;  2KIF A;  1R5I D;  2RGV A;  3NEU A;  1AHD P;  5HOD A;  2ZFW A;  4IX7 A;  1JT0 A;  3CDH A;  2JK3 A;  3GXO A;  5LFA A;  3CCM I;  3VEP A;  4I0A A;  3ZP5 A;  1X3U A;  2BVL A;  5K7H A;  3B6A A;  4KIC A;  1P6R A;  3WTT C;  3EDP A;  5FRN A;  1N78 A;  3V42 A;  3FBI B;  2D1V A;  3VOE A;  2OU2 A;  1EA3 A;  5GPA A;  5F27 A;  1BIB A;  2WGB A;  3CCL I;  1MJ9 A;  2D1H A;  5ICG A;  1C0W A;  3OYH A;  1ZRF A;  2DMP A;  1SAU A;  2L9N A;  9ANT A;  2VKD A;  2KIM A;  1UI5 A;  2LKS A;  4D7M A;  3SQN A;  5JR3 A;  3F8M A;  3SDG A;  2Z99 A;  1T98 A;  2EIN H;  2EIJ H;  2HQN A;  1F43 A;  2GXG A;  3GME A;  3ZQI A;  3PNT A;  4AWX B;  4WCG A;  2K85 A;  3TKY A;  2WA0 A;  4LFU A;  2OER A;  2XDN A;  2MW8 A;  3LSH A;  2ZJR F;  4I6Z A;  3S1R J;  5FJ8 J;  3FMQ A;  1RKT A;  3PFY A;  3WU2 C;  2R7W A;  3BG7 A;  3K4M A;  2VOO A;  1QVU A;  2X9D A;  3ZMZ A;  2DJN A;  3FDY A;  2WAF A;  2O6G E;  3UR3 C;  4PFO A;  4GRI A;  2H8R A;  3G3Z A;  2VLA A;  2WAQ A;  1R36 A;  2VQH A;  4ZZL A;  1GDT A;  2GA2 A;  2OA4 A;  2QWT A;  3G1L A;  3K1N A;  4BHP A;  5CXG A;  1AA7 A;  1VQ5 I;  3GTM J;  3HOT A;  2WV0 A;  3KEY A;  2F6C A;  3LJL A;  3F6V A;  3ISP A;  3I54 A;  2A6T A;  1OLT A;  2UXP A;  3VYS B;  2Z3Y A;  1LEB A;  1G3Y A;  2TCT A;  1BA5 A;  2DQR A;  1YW8 A;  3H1C A;  3CMA I;  3EGQ A;  4GCL A;  3BQZ A;  1PVE A;  2KJC A;  5J8F A;  3PM1 A;  4IOC F;  3DXJ F;  3B73 A;  3M9A A;  1ETK A;  2HOT A;  1B72 A;  1TNS A;  2B7E A;  4EJV A;  5KCM A;  3V8L A;  4PJN A;  5LGN A;  1MBE A;  5CQE A;  3J7Y J;  4AYB A;  4AM3 A;  2WY8 Q;  4HNU A;  4Y17 A;  3LWF A;  4E7S A;  3ZPL A;  4GFB A;  3W3C A;  5E1W A;  3HG9 A;  1FOX A;  4ZC3 A;  5GAD J;  3OYM A;  4EM0 B;  4HRI A;  4QPO A;  4I01 A;  3AL0 C;  3HOY J;  2P0W A;  5JFR A;  3IRR A;  3HRT A;  4MEX F;  5ILV A;  3HYI A;  1XSD A;  2M7B A;  1VQ7 I;  2ESH A;  4QLC U;  1E2X A;  1Y39 A;  1DPR A;  2QUF A;  3MCZ A;  3CCV I;  3DKX A;  4Y33 A;  1EH7 A;  2OV7 A;  4BE1 A;  3QU6 A;  2BY3 A;  4XSX F;  2ZCM A;  2PBX A;  1X1B A;  3FIS A;  4PZJ A;  4DGW B;  2DPD A;  2NXN B;  3V8K A;  1U9N A;  2E36 A;  2CU7 A;  4B3X A;  5ED4 A;  5BQT A;  4HW0 A;  4M6X A;  4ICH A;  2RDP A;  2BHY A;  1HKT A;  3P9T A;  4G7Z F;  5L3D A;  4XM3 A;  4IHW A;  2QBY B;  2HVS A;  2EFQ A;  4NNJ A;  1DPU A;  2LR8 A;  4NQW A;  4F93 B;  2QTQ A;  1FBU A;  1A6I A;  2FEZ A;  4OMZ A;  4DZP A;  3KIO A;  1ETW A;  3Q5F A;  1TT0 A;  4HAM A;  5J47 A;  1N75 A;  4XIC A;  5C4X J;  2BV6 A;  1DDN A;  4EJT A;  3M3Y J;  4PJJ A;  4RGR A;  1JTY A;  2Y0S N;  3FHN A;  4PGH A;  4Y15 A;  4YZE A;  2KDO A;  3VOD A;  1BI3 A;  1F1Z A;  2V9K A;  2FA5 A;  5CVV A;  2R93 J;  1A35 A;  2M1B A;  2X1E A;  2VE9 A;  1QU3 A;  2CW8 A;  3F9K A;  1PDN C;  5E3M A;  5CXI A;  3HBL A;  3VWB A;  3V7R A;  2V57 A;  4BBR J;  4ZYH A;  3QBM A;  3K4L A;  1TQP A;  4CSW A;  5H20 A;  1R9T J;  1A6Q A;  4G12 A;  5E1Z B;  1SGM A;  4A69 C;  5FGL A;  2AXT C;  2QQ8 A;  2H8W A;  3COA C;  4JL3 A;  1XMX A;  1LFB A;  4ESJ A;  4I7H A;  3CUO A;  2EZI A;  1GLN A;  1OMI A;  2A5W A;  1UHS A;  2DT6 A;  1OCO H;  1FIA A;  2YX4 A;  3F8N A;  2KIQ A;  4BJT A;  1JUP A;  2ESN A;  1RES A;  2DI3 A;  5LGT A;  1EKE A;  4LLL A;  1QHH D;  5B5E C;  3N4M A;  1GXP A;  2PZ9 A;  4A0X A;  2Y0S A;  4GCK A;  3JRI A;  4R8H A;  1NTC A;  2UXX A;  3Q9S A;  4WXD A;  3GLX A;  1ZRD A;  1BJZ A;  1E0E A;  1IN6 A;  4EAT A;  4XRM A;  5E17 F;  1J0R A;  2F2E A;  2IGN A;  4XRS G;  2DA7 A;  2HKX A;  2V1D A;  2XF7 A;  2EIL H;  1LQ1 A;  1JXS A;  1OCR H;  2ZJP F;  3L9F A;  5IT3 A;  2BYV E;  4CA0 A;  3DLA A;  3LSK A;  5DTD A;  3ABM H;  2HZT A;  2HTJ A;  2PG4 A;  2DN0 A;  2V26 A;  3LQR A;  3WE3 A;  3H9G A;  2IW5 A;  1OIS A;  2BY2 A;  2EJR A;  4IZZ A;  3S2H J;  3P5J A;  2JJ7 A;  4HNV A;  3I4M J;  3B6C A;  3BTC A;  4LD5 A;  2EFW A;  3S5R A;  1I1S A;  3S2W A;  4GFK A;  2XAJ A;  1GV5 A;  2PMZ N;  4ANJ A;  4RLF A;  4UVB A;  2BZT A;  4LB5 A;  4HF0 A;  3L00 A;  3E1S A;  2FU4 A;  1K7A A;  2CQ7 A;  3A0B C;  4KWA A;  4AIH A;  2JRT A;  3VP5 A;  3CMM A;  3K4C A;  3LSM A;  2H94 A;  2JA6 J;  3MKZ A;  2GOX B;  3QOP A;  3PL8 A;  2O0Y A;  2CW7 A;  4S04 A;  5KVR A;  5FRM A;  3HGG A;  3NS4 A;  3RIR A;  3K1P A;  4L5I A;  4YFK F;  2VAS A;  1OFC X;  3RKX A;  3Q0U A;  1R1U A;  4KN4 X;  3SZP A;  4RB3 C;  2PQ8 A;  2GBY A;  5EF6 A;  5H6Q A;  5HLG A;  1DP3 A;  3WTS C;  1IDZ A;  2AQE A;  3U2R A;  2F4O B;  4BS9 A;  3FMR A;  4NDL A;  1N77 A;  2NP3 A;  1VQ8 I;  3HDD A;  2XAQ A;  2DDB A;  2M9H A;  1SVL A;  1QNT A;  4A3B J;  1FT9 A;  5D8L B;  2PMZ A;  1W7P D;  2LD5 A;  3A01 A;  2OQR A;  3ABU A;  3JSO A;  4B8X A;  2BGC A;  5TRD A;  3UKG A;  4A3C J;  2O61 A;  1R4M B;  3P9I A;  2FOK A;  2RC4 A;  1IRZ A;  3IWZ A;  1V5F A;  4HYE A;  4C2U A;  3ON2 A;  2MAB A;  3KZ9 A;  4HLY A;  3K4K A;  3F21 A;  3ASO H;  1O3T A;  3GTP J;  2BBY A;  4GCT A;  2Z2S B;  4BY1 J;  1T95 A;  1ZN2 A;  2HI3 A;  4XRF A;  5M3M J;  2XGD A;  2XF6 A;  4EQQ A;  2H1K A;  3DBH B;  4LB6 B;  3K6G A;  3BR2 A;  5D5V B;  3AKZ A;  4YG2 F;  3V4G A;  3JAM K;  2JWT A;  3DEW A;  2P5L C;  1IN7 A;  2NVU B;  5HLT A;  5AQC A;  5JHU A;  5L3E A;  3FHZ A;  2K9Q A;  4KN7 X;  2EQR A;  2XAF A;  1TWC J;  1QPM A;  5ILU A;  2JTV A;  2KKO A;  1ITY A;  1ZGJ A;  2Z5U A;  1FOW A;  2XRO A;  3GTQ J;  3AG3 H;  3OL4 A;  1B8I B;  1S8N A;  3IV5 A;  2MD5 A;  5E20 A;  1HLV A;  5E79 C;  3COL A;  2IP2 A;  1MZB A;  2W1O A;  2CYY A;  4LG0 A;  2YR2 A;  2MGQ A;  3I59 A;  3FMS A;  4G6Q A;  2BEO A;  1Y56 A;  1O3R A;  1MMG A;  5F1R A;  3MNL A;  3CF2 A;  2XPV A;  3IH4 A;  4YIR X;  5IYD J;  4KA4 A;  2PX9 A;  1FYK A;  1ZLJ A;  3I53 A;  3DPL C;  3BG5 A;  5BPD A;  3S32 A;  2ELJ A;  3CC4 I;  3PJR A;  4UNO A;  4XR6 A;  4A0Z A;  5E18 F;  4J19 A;  2QA4 I;  4A2U A;  2EIM H;  4LIV A;  1TTY A;  5FFX A;  2LKP A;  3AG1 H;  5E3N A;  2LKX A;  1KU9 A;  2OPT A;  3D1N I;  4L18 B;  1SFO J;  2REK A;  4NEL A;  1H8A C;  4Q48 A;  2HZD A;  2NS0 A;  1X2N A;  3R61 A;  4KIS A;  2ACJ A;  3PPB A;  4IVN A;  3VDX A;  3NPI A;  2X1D A;  3MD2 A;  2XPU A;  1T8I A;  5D4S A;  2BHZ A;  3CCJ I;  3QAH A;  2HDC A;  3N05 A;  4JX6 A;  2ZKZ A;  1MND A;  4R1H A;  1L0O C;  4A3I J;  4JK1 X;  3NWT A;  3CLO A;  5HOO A;  2CG4 A;  2L5Q A;  3HGY A;  2LK2 A;  2FX0 A;  3U21 A;  1R6R A;  1YTY A;  5C3E J;  4Y3O A;  2HOE A;  1R4N B;  4A0Y A;  1WSU A;  3S1M J;  2K27 A;  2ZC2 A;  1YIO A;  4N4N B;  1X58 A;  2KT0 A;  3J80 Z;  2G7H A;  3K0L A;  4EGY A;  3HHG A;  2IS1 A;  3BC8 A;  2P7C B;  3FKI J;  2W48 A;  4MXM A;  2E1N A;  1FPQ A;  2ELK A;  3OYL A;  4U87 A;  1UEL B;  3DCF A;  3QP5 A;  1VQ4 I;  2AHQ A;  1HF0 A;  1U8R A;  3LSJ A;  5F6F A;  2QQB A;  3Q3S A;  1UB9 A;  2DMQ A;  3KP7 A;  1PP7 U;  2E2H J;  1WHU A;  2IEK A;  1W5T A;  2ZXJ A;  3K4N A;  3S1N J;  1JHF A;  1D8K A;  4PCQ A;  2HXO A;  2ZOY A;  3C2B A;  3M1E A;  1DGR M;  3WHC A;  5LRS A;  1X4P A;  4M9X A;  5K5Q A;  1W0T A;  1W1W E;  5D6E A;  2Y48 A;  4E6K G;  3VVX A;  2L7K A;  3T5X A;  4NHJ A;  4E7I A;  2E5N A;  3DPJ A;  2IA0 A;  4MHG A;  3K2A A;  2PBI A;  1R1T A;  1WRJ A;  1D5V A;  2OUM A;  2W82 A;  3WU0 A;  5FLM J;  1ZAO A;  4B09 A;  1HBX G;  2KDZ A;  2MC4 A;  2L0K A;  2L7F P;  1JTX A;  1TQI A;  1RZ4 A;  3SYT A;  2QKO A;  3KKC A;  4LOC A;  2LVS A;  2D2W A;  2MG4 A;  5JLX A;  4UV9 A;  1LFU P;  3K4J A;  1HW5 A;  3OYB A;  4UY8 I;  4RDU A;  1TBX A;  5KK1 A;  3VW0 A;  4UV8 A;  3RPQ A;  3I4P A;  3EQL F;  3BCA A;  2LFB A;  4V2G A;  1HC8 A;  1K4S A;  3LAP A;  5CQG A;  1VQP I;  3C07 A;  3FIW A;  3HUG A;  1FIP A;  2KZG A;  1QA6 A;  3D0S A;  5H9T A;  4OD5 A;  2XAS A;  1ETO A;  3CLQ A;  1IN8 A;  3FXO A;  5FLX K;  2ZFU A;  1J7K A;  1XGS A;  3EUK L;  1WH7 A;  2VB6 A;  4D5C A;  3HB9 A;  5ICE A;  3BR5 A; 
#chains in the Genus database with same CATH homology
 5GPA A;  5F27 A;  3BR1 A;  2WGB A;  1PUF B;  3K7A J;  2VUM J;  1JKR C;  1HDP A;  3MN2 A;  5FKK A;  3BHQ A;  1QVT A;  2DMP A;  9ANT A;  3NRG A;  1P7I A;  5F04 A;  1UI5 A;  2QCO A;  3QKX A;  4D7M A;  1IC8 A;  4MIM A;  1HCR A;  2HYJ A;  5J1R A;  3SDG A;  2R92 J;  5DAJ A;  2X6O A;  5EZH A;  1P7J A;  1FJL A;  3QPS A;  1F43 A;  3ZQI A;  3KKD A;  3EUP A;  1ZTR A;  5IP9 J;  2G7G A;  2OER A;  2ID3 A;  2XDN A;  2MW8 A;  3NI7 A;  3BR6 A;  4Y52 J;  1TWH J;  3BR3 A;  3IH2 A;  4I6Z A;  5FJ8 J;  3S1R J;  1DU0 A;  1RKT A;  1MSE C;  3NXC A;  3VUQ A;  1MH4 A;  2CJJ A;  3MVP A;  3AQS A;  2NS7 A;  1Y1W J;  1QVU A;  2X9D A;  2DJN A;  3A03 A;  5M5W J;  2DA6 A;  2R5Z B;  1RR7 A;  1S7E A;  2JA8 J;  1JT6 A;  2H8R A;  1K83 J;  1MSF C;  1RET A;  1GDT A;  2QWT A;  4MO7 A;  3G1L A;  1EF4 A;  5C4Y A;  3GZI A;  5CXG A;  3GTM J;  1ETV A;  3LJL A;  3GTJ J;  3E7L A;  2XRL A;  3JRB A;  4IHX A;  3CJD A;  2UXP A;  1I3Q J;  4S0H B;  3PAS A;  1OJL A;  3HKZ N;  2TCT A;  1BA5 A;  2P81 A;  5FKN A;  3KNW A;  3EGQ A;  4GCL A;  2LTP A;  1QPI A;  3BQZ A;  3BG3 A;  2RAE A;  3PM1 A;  2ZCX A;  2IU5 A;  3JRC A;  1ETK A;  2HOT A;  2FBQ A;  1ENH A;  1B72 A;  1HDD C;  1TWF J;  2DG7 A;  3VW1 A;  1MBE A;  3AQT A;  1GUU A;  2WV1 A;  1MNM C;  3TP3 A;  3JR9 A;  2M0C A;  3RD3 A;  4FE4 A;  4GFB A;  2VKE A;  3BTL A;  2MSY A;  2QOP A;  3IUV A;  1A5J A;  3HOY J;  5IOY A;  1IDY A;  2EH3 A;  3O8G A;  3Q0V A;  2GEN A;  5FKM A;  1JUM A;  2JA5 J;  4ME9 A;  3JRH A;  1POG A;  3CRJ A;  3GTG J;  3ZQL A;  5EGO B;  1IV6 A;  5IYC J;  4BXX J;  2L9R A;  4MK6 A;  1BL0 A;  2ZCM A;  2PBX A;  1JJ6 C;  3FIS A;  3HOX J;  4CGR A;  5J3L A;  1U9N A;  4CYC A;  2CU7 A;  3VOK A;  2GFN A;  3WHB A;  4A3J J;  3NAU A;  1F36 A;  4DZJ A;  3HOW J;  4ICH A;  2EZK A;  2DA2 A;  1ZGW A;  2VPR A;  3P9T A;  2YUS A;  3OIO A;  4JP0 A;  2I10 A;  1TC3 C;  1MH3 A;  3MKL A;  2K9N A;  4IHW A;  2GLO A;  3ZQH A;  1VFC A;  3F0C A;  3HEF A;  2LR8 A;  1VND A;  2G0E A;  1G2H A;  2QTQ A;  1A6I A;  4DZP A;  1MBF A;  2ME6 A;  4UUS A;  3W6V A;  1ETW A;  4JX5 A;  1ETX A;  2LY9 A;  5C4X J;  4XIC A;  2RHA A;  5IP6 A;  2EZH A;  5IPA A;  2LP0 A;  3M3Y J;  3HTI A;  1JTY A;  2Y0S N;  3RKQ A;  4YZE A;  1JKQ C;  3ON4 A;  2R93 J;  2HQ5 A;  2Y9Z A;  5E3M A;  3H3V K;  4ACI A;  5CXI A;  3HBL A;  2V57 A;  1JGG A;  4BBR J;  4IHV A;  5K58 A;  3QBM A;  4B3A A;  1Z0X A;  1R9T J;  3LWJ A;  2Y31 A;  4G12 A;  1SGM A;  4A69 C;  5FGL A;  1MBG A;  4JL3 A;  2XGE A;  2GUH A;  1LFB A;  2NX4 A;  2HYT A;  4XRS A;  2EZI A;  1GT0 C;  3VOX A;  1UHS A;  4MLO A;  3ZQC A;  4JX4 A;  1B72 B;  3LSG A;  2ME0 A;  5EG0 A;  1FIA A;  2G7L A;  2IAI A;  1JUP A;  1CQT A;  5IP7 J;  1RES A;  1H88 C;  5IYB J;  2PZ9 A;  2CQQ A;  1MBH A;  4GCK A;  1Q1V A;  3JRI A;  1NK2 P;  4IHY A;  1NTC A;  4UDS A;  1BJZ A;  2M8G X;  2X48 A;  4BY7 J;  4XRM A;  2FQ4 A;  4X1E A;  2EZL A;  2OI8 A;  2DMT A;  1YRN A;  2O8K A;  4PXI A;  1JKO C;  4QTR A;  4XRS G;  2DA7 A;  2CQX A;  1WCM J;  4UUT A;  5IOZ A;  2JN6 A;  5FKL A;  4M3E A;  4B1R A;  5DTD A;  5FHP A;  5M5X J;  1B8I A;  2DN0 A;  2O7T A;  4RBO A;  3CQZ J;  2ZB9 A;  1AKH A;  2LLK A;  2NVY J;  4V2F A;  2O9L A;  3S2H J;  4HNV A;  2JJ7 A;  1HOM A;  3I4M J;  2ZOZ A;  4GFL A;  3B6C A;  3BTC A;  3CCY A;  3S5R A;  1WGX A;  1GVD A;  1ZR4 A;  3HTA A;  4M3G A;  4GFK A;  1ETY A;  1GV5 A;  2PMZ N;  4BBS J;  3GEU A;  3ANG A;  2D5V A;  3S15 J;  2NP5 A;  5D1R A;  2FD5 A;  3BG9 A;  3BRU A;  3HE0 A;  3FK6 A;  3QQA A;  4KWA A;  2ID6 A;  4UUS B;  3VP5 A;  2G3B A;  2N8G A;  3SFI A;  3RZD J;  2JA6 J;  2Y2Z A;  1XS9 A;  1DU6 A;  4DYQ A;  5EYR A;  3HOV J;  1D5Y A;  2Y30 A;  3NNR A;  3HGG A;  2UXI A;  2XPW A;  1T33 A;  4JNN A;  1ZK8 A;  2R5Y A;  3BR0 A;  2QIB A;  3RH2 A;  4Y7N J;  1OFC X;  3Q0U A;  2YU9 J;  3G7R A;  4IEJ A;  3V78 A;  2M34 A;  4M6V A;  2NVT J;  2GBY A;  5EF6 A;  1WH5 A;  3BT9 A;  2ECB A;  2HKU A;  4BKX A;  1IDZ A;  2ZCN A;  4NDL A;  3BNI A;  2NP3 A;  3RZO J;  3BTJ A;  4MFE A;  3V6G A;  4L5E A;  3HDD A;  2M9H A;  1IGN A;  4A3B J;  3S2D J;  3OOU A;  5CW8 A;  3VVY A;  2LD5 A;  4AC0 A;  3A01 A;  3UKG A;  4C3J J;  3GTK J;  4A3C J;  5F0C A;  4JYK A;  1IRZ A;  4W97 A;  3L1P A;  4AC6 A;  2HOA A;  3VPR A;  3ON2 A;  4A3G J;  5EG0 B;  5F0F A;  2XGC A;  4MFD A;  3KZ9 A;  1U8B A;  3GTP J;  2R0Q C;  4GCT A;  3HTJ A;  4BY1 J;  2HI3 A;  4XK4 A;  2XGD A;  4ABZ A;  2NS8 A;  5M3M J;  1K61 A;  2H1K A;  2JMW A;  2UXO A;  3E7Q A;  3VW2 A;  2M2E A;  3BR2 A;  1LE8 A;  1JUS A;  3F1B A;  2JWT A;  3DEW A;  3M4O J;  3Q0W A;  2UXU A;  3OSG A;  5AQC A;  1YRN B;  2AO9 A;  2K9Q A;  1W0U A;  2EQR A;  3TED A;  3PO2 J;  1TWC J;  1TWG J;  4L62 A;  2W53 A;  2DMN A;  4W1U A;  2K40 A;  3HM5 A;  3TW6 A;  1ITY A;  1ZKG A;  2NVX J;  5HSZ A;  3GTQ J;  4M3B A;  1B8I B;  1VF9 A;  1NK3 P;  3T6N A;  3GBG A;  1OCT C;  3IV5 A;  4M3D A;  1HLV A;  4DW6 A;  3COL A;  1ORK A;  2UXH A;  2Y9Y A;  3TP0 A;  1O4X A;  4A3M J;  1TWA J;  3HOU J;  1UMQ A;  2EBI A;  3FK7 A;  2MGQ A;  4A3K J;  3TW7 A;  2B63 J;  3PO3 J;  2D6Y A;  5EGO A;  1IG7 A;  4XID A;  1RPW A;  4AF5 A;  2DTZ A;  2WAQ N;  3GTO J;  1JJ8 C;  3LHQ A;  5C4J J;  2TRT A;  3MNL A;  3IH4 A;  2XPV A;  2YS9 A;  4D7N A;  4DYR A;  5IYD J;  3BQY A;  5DS9 A;  1BW6 A;  3BG5 A;  2QF7 A;  2HOS A;  3JRA A;  5M3F J;  5HBU A;  1RKW A;  3H0G J;  4J19 A;  4A3E J;  2R5Y B;  3ANP A;  5M5Y J;  3JSJ A;  1JKP C;  1FEX A;  1IUF A;  3IH3 A;  3O8H A;  4DYC A;  2LKX A;  5E3N A;  3I4N J;  1APL C;  1XG1 A;  5J1Y A;  4NN1 A;  2OPT A;  3D1N I;  2YVE A;  3JRE A;  1SFO J;  2REK A;  3G1M A;  4QIW N;  1H8A C;  4NEL A;  2FJ1 A;  3GTL J;  3RQI A;  1X2N A;  3BCG A;  5FKO A;  1IJW C;  3PPB A;  2YVH A;  4CYC B;  4JKZ A;  4AYB N;  5E3L A;  3NPI A;  3SJM A;  3VVZ A;  3LSP A;  2XPU A;  5D19 A;  3A01 B;  5EDN A;  1FTT A;  5FMP A;  2E2J J;  1QRY A;  3OSF A;  4JX6 A;  4C2M J;  2DA5 A;  4FTH A;  5F1J A;  4A3I J;  1U9O A;  1UG2 A;  2E2I J;  3A02 A;  2CUE A;  4A93 J;  3HTH A;  2E19 A;  1U78 A;  4AUX A;  2DA1 A;  1E3O C;  2VKV A;  1PUF A;  2COB A;  3HGY A;  2LK2 A;  2HDD A;  2FX0 A;  3S16 J;  2NOG A;  1Y1V J;  1WPK A;  4C3H J;  3LOC A;  5C3E J;  3LNQ A;  2VI6 A;  5F0H A;  3FRQ A;  1MBK A;  1LE8 B;  5EEA A;  3S1M J;  3G1O A;  2CRG A;  2L7Z A;  5K7F A;  2K9S A;  3LSR A;  5J1U A;  4D5F A;  5K7Z A;  1OCP A;  2ECC A;  1MBJ A;  5FLV A;  4HKU A;  1X58 A;  2KT0 A;  3FKI J;  1GV2 A;  2W48 A;  4MXM A;  2WB1 N;  2ELK A;  1ZQ3 P;  2DA3 A;  3DCF A;  2XSD C;  2NVQ J;  5JLW A;  2AHQ A;  3JRD A;  3O60 A;  1HF0 A;  2RAS A;  3LSJ A;  3G56 A;  3Q3S A;  2DMQ A;  5HAW A;  2E2H J;  4QSH A;  4EEF G;  2G7S A;  1SAN A;  2L7M P;  2IEK A;  2HXI A;  3S1N J;  2HXO A;  3S17 J;  2DMU A;  2ZOY A;  3C2B A;  4A3L J;  3B81 A;  3WHC A;  2JA7 J;  1T56 A;  3HIM A;  1W0T A;  1BW5 A;  2R5Z A;  4X6A J;  3VVX A;  5GP9 A;  4FCY A;  1XC5 A;  3ZQF A;  3HOZ J;  3DPJ A;  3K2A A;  2GM4 A;  3CWR A;  5E3O A;  3S1Q J;  4A3F J;  5FLM J;  3JRF A;  2KDZ A;  2E1O A;  2L0K A;  2L7F P;  2R7Z J;  5BNG A;  2DA4 A;  2DG8 A;  1JTX A;  3BJB A;  5EFY A;  2QKO A;  3ZQG A;  2F07 A;  3KKC A;  3QPL A;  4LOC A;  1ETQ A;  2LVS A;  1H89 C;  2CUF A;  2MG4 A;  3CDL A;  5JLX A;  2XB5 A;  5C44 J;  2OF7 A;  1LFU P;  2Q24 A;  2IBD A;  2XB0 X;  1WI3 A;  2WUI A;  4RDU A;  2O7O A;  4I76 A;  4B4C A;  1VI0 A;  3VW0 A;  1FTZ A;  3S14 J;  4FIS A;  3CMY A;  1UI6 A;  2LFB A;  4A3D J;  5EZG A;  1ZR2 A;  4V2G A;  3NAR A;  5GPC A;  1X2M A;  1AHD P;  5HOD A;  1AU7 A;  1I6H J;  3C07 A;  1JT0 A;  3FIW A;  3ZOB A;  3JRG A;  1AKH B;  2JK3 A;  1FIP A;  3VIB A;  5H9T A;  4M3F A;  5K7H A;  1ETO A;  5F08 A;  3B6A A;  3BTI A;  1WH7 A;  4FE7 A;  4C3I J;  1Z77 A;  1I50 J;  4D5C A;  3HB9 A;  3BR5 A;  5D18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...