3LOCA

Crystal structure of putative transcriptional regulator ycdc
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
201
Chain Sequence
RSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Hypothetical Transcriptional Regulator Ycdc from Escherichia Coli
rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator rutR
total genus 74
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3locA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3locA02
5DTDA 3BR1A 3WHBA 5IYDJ 3CCYA 3JR9A 1XS9A 3HGGA 3ON4A 4NN1A 2EZHA 3BT9A 3HOVJ 5FKOA 1JKOC 3H3VK 3RH2A 1K83J 5CXIA 1ORKA 4XRMA 2G3BA 2XSDC 2OERA 3B6AA 2HOSA 2WUIA 5D19A 2G7GA 1TC3C 1UI6A 1NK2P 3FK6A 2GM4A 2W53A 3KKCA 4Y52J 3VW1A 2L0KA 5M5XJ 4CYCA 1NK3P 4JYKA 3L1PA 2ZB9A 4MFEA 3BQYA 3BR5A 1DU6A 1VNDA 2XB0X 3SJMA 4UUTA 2R5YA 4A3IJ 2JJ7A 1IGNA 3S15J 3VVXA 1ZKGA 1EF4A 3LSGA 4BBRJ 4C3IJ 4G12A 4FE4A 3I4NJ 1G2HA 4UDSA 2YVEA 4M3EA 3BHQA 1ZR4A 4NELA 2ME0A 4AUXA 1JUSA 2WV1A 4BY1J 4DYQA 3NI7A 5H9TA 1RPWA 4C2MJ 3MKLA 1B72A 3NPIA 3BR0A 1NTCA 1YRNB 3OOUA 4A3KJ 1HF0A 2IU5A 2M34A 3BQZA 2DA6A 4UUSA 4A93J 4QTRA 1X2NA 2D6YA 1HDDC 2ME6A 1P7IA 3QBMA 2Q24A 3W6VA 3NNRA 1Z77A 5F27A 3TP3A 2JN6A 2EH3A 5HSZA 1WI3A 2DN0A 1GV2A 3GBGA 4DW6A 1ZQ3P 4DZJA 2JA8J 1SGMA 5EDNA 1UMQA 4ABZA 2JA7J 5J1UA 1JKQC 3S2HJ 2COBA 2O7TA 4A3BJ 4CGRA 2JA6J 4W1UA 5JLXA 3S16J 4B4CA 2N8GA 2HDDA 3AQSA 4GCTA 4JX6A 3TP0A 2K40A 3JRGA 2D5VA 2DA3A 3ON2A 3DCFA 2EBIA 1IRZA 3CJDA 3FKIJ 2XPUA 3LSRA 4A3CJ 4D5FA 1OJLA 1X2MA 2WAQN 3HB9A 9ANTA 1F36A 2ZOYA 1FIPA 2O7OA 1U8BA 2EZLA 2NVYJ 4IHXA 5EG0B 5F08A 1GT0C 5EEAA 2LFBA 1Y1WJ 1MBHA 3EGQA 3GTGJ 2HXIA 2TRTA 3A03A 4X1EA 3B6CA 4GCKA 1UHSA 3BNIA 2EZIA 5FKKA 5IOYA 4B1RA 4AC6A 4IHVA 2HXOA 3G56A 2LP0A 3ZQFA 4ICHA 1ZK8A 2R5ZA 5AQCA 3CMYA 4BXXJ 2XPVA 3VW2A 2M8GX 2YVHA 2R5ZB 2HYJA 2LR8A 4Y7NJ 3K7AJ 1H89C 2PMZN 3PM1A 3MN2A 3GEUA 3E7LA 3IH4A 4A3FJ 1DU0A 2JA5J 3Q0UA 3A01B 1AHDP 1LE8B 2DA1A 4MFDA 4C3HJ 2WGBA 3CRJA 1SANA 2ZCXA 1T33A 2E19A 4FISA 5HODA 4KWAA 5GP9A 3JRFA 3KZ9A 1FTTA 4JP0A 4YZEA 1BW5A 5BNGA 3A02A 5IOZA 3HTJA 3O60A 3LJLA 3B81A 5E3LA 1TWCJ 1ETWA 4CYCB 3HIMA 2X48A 2XGDA 5EZHA 3BG3A 1HOMA 2FD5A 3ZOBA 1VI0A 2ECBA 1MBKA 3TW7A 4RDUA 3RZDJ 3GTQJ 5IP6A 2R0QC 2G7LA 5M3MJ 2NP3A 1BL0A 2HOTA 2CUEA 5CXGA 1E3OC 3C2BA 3HM5A 4IHYA 4DYCA 1B8IB 3VVYA 5EF6A 3TEDA 5C4YA 3LSPA 1IC8A 1OFCX 5GPCA 1MBFA 2RAEA 2RASA 5EGOA 1MBGA 1WGXA 2DTZA 5M5WJ 2Y2ZA 5DAJA 2E2IJ 2K9NA 3HKZN 3O8HA 3QQAA 3ZQCA 3ZQHA 1B72B 3Q0VA 2ZCMA 3F1BA 1QRYA 1A5JA 2ELKA 1HLVA 1MSFC 4BBSJ 1RESA 2EZKA 2VKVA 4C3JJ 2DMNA 3HOXJ 2DMQA 3IH2A 3G1MA 3GTLJ 3LHQA 4A3EJ 2YU9J 2CQXA 1O4XA 1A6IA 1GVDA 5IP7J 4IHWA 2FBQA 3A01A 1WCMJ 2G7SA 2I10A 5FKLA 4GFBA 5D1RA 4RBOA 2XDNA 2DG8A 3BRUA 2JK3A 2JWTA 1F43A 2M0CA 2R93J 1UG2A 2UXUA 2CJJA 1ETKA 4BKXA 2UXPA 3RD3A 1JT6A 2TCTA 1PUFA 5EGOB 2CRGA 2M2EA 5FKNA 4X6AJ 2OPTA 2DG7A 1OCPA 2AHQA 2GUHA 2GBYA 5C3EJ 2DMTA 2NS8A 3NAUA 4XICA 1K61A 3PASA 1RR7A 3VPRA 3HOUJ 3VW0A 3F0CA 3S2DJ 3FK7A 3HOYJ 1H8AC 1ETYA 2FQ4A 2K9SA 3VIBA 1D5YA 3BTJA 2UXOA 1MBJA 2HKUA 1BW6A 1ETXA 2ID6A 3CDLA 1I3QJ 3ZQLA 1BA5A 3FRQA 2QCOA 2NS7A 2MSYA 3LOCA 5J1YA 1MH4A 5IYBJ 3BG9A 3MVPA 1ETQA 1AKHA 2ZCNA 1PUFB 3PO2J 1ETVA 3GTMJ 3BTLA 2GLOA 2R5YB 1XG1A 4XRSG 3M4OJ 4MK6A 1ETOA 3BG5A 5M5YJ 1U9OA 2NX4A 3KNWA 3IUVA 3V78A 3S5RA 4QSHA 3FIWA 4DZPA 2GENA 5K58A 3BR3A 3O8GA 3WHCA 3QPSA 5F1JA 4A3GJ 1TWFJ 3QPLA 3JRBA 3ANPA 2UXHA 5IYCJ 3K2AA 5F0CA 3UKGA 5JLWA 1S7EA 5EFYA 3AQTA 3FISA 2CQQA 3SFIA 3CWRA 2HI3A 5IP9J 4FCYA 4MO7A 1APLC 3PPBA 1JGGA 5CW8A 2X9DA 4AYBN 2DMPA 3LNQA 3Q0WA 1AKHB 2LKXA 2PZ9A 1FTZA 1Q1VA 2VKEA 4UUSB 3TW6A 3GTPJ 1ZGWA 1VFCA 2NVQJ 1JTXA 1B8IA 4FE7A 3G1LA 4M3DA 3S1MJ 3JRAA 2ECCA 4JX4A 3I4MJ 3E7QA 3T6NA 4LOCA 3DPJA 3V6GA 5EG0A 1SFOJ 2QOPA 2QWTA 2OF7A 2Y0SN 1JT0A 2NVTJ 3C07A 2R92J 2L7ZA 3PO3J 5D18A 1XC5A 4MIMA 2QIBA 2MG4A 5C4XJ 4V2FA 5K7FA 4I6ZA 4A3MJ 3S14J 4NDLA 2WB1N 5IPAA 3HDDA 3M3YJ 1HDPA 1LFUP 4XK4A 4AC0A 2JMWA 2K9QA 1MSEC 3LSJA 4D7MA 3GTOJ 1HCRA 2B63J 2DA4A 5E3OA 1OCTC 2REKA 1UI5A 5HBUA 1YRNA 3HEFA 3VUQA 1Y1VJ 2X6OA 2HYTA 2MGQA 4M3FA 4JNNA 2HOAA 1RKTA 5E3MA 1JUMA 2DA5A 3ZQIA 3JREA 4A3JJ 5FMPA 2CU7A 1MNMC 4MLOA 4HNVA 4J19A 1JJ6C 2XGEA 1IDZA 4EEFG 3BTCA 1U9NA 3SDGA 5J3LA 2F07A 1IV6A 3HGYA 3OSFA 5F0HA 3CQZJ 3HTIA 4XRSA 3VVZA 3HOWJ 1BJZA 2O9LA 1LE8A 1LFBA 2XB5A 4ME9A 2AO9A 1H88C 2QKOA 4JX5A 1ZR2A 3ZQGA 3S1NJ 5F04A 1ENHA 4D7NA 2LTPA 5FLMJ 2OI8A 1TWGJ 2GFNA 4B3AA 2O8KA 5FJ8J 4DYRA 4GCLA 2E2JJ 3BR2A 2H8RA 2G0EA 4GFKA 2DMUA 4M3GA 1ITYA 1MBEA 5C4JJ 1IUFA 1Z0XA 3RKQA 5EZGA 5C44J 1TWHJ 5K7HA 3IV5A 1TWAJ 3JRHA 3Q3SA 1FIAA 5HAWA 1WH5A 2LVSA 5EYRA 2M9HA 1CQTA 1I50J 1FEXA 3OSGA 4JL3A 1FJLA 3HOZJ 3S17J 5M3FJ 2MW8A 3HE0A 2LK2A 5K7ZA 1RKWA 1GV5A 2HQ5A 3NARA 5GPAA 3NRGA 1MH3A 4A3LJ 1GUUA 1W0TA 2DA2A 2IBDA 3VP5A 2XRLA 1T56A 3BCGA 3COLA 3QKXA 1IG7A 2LD5A 3OIOA 4ACIA 5FGLA 3VOXA 2P81A 2VI6A 1JKRC 1R9TJ 3G1OA 3JRDA 4IEJA 4BY7J 1QPIA 1JJ8C 2NVXJ 3G7RA 4MXMA 3GTKJ 3JRCA 3RQIA 3IH3A 1WPKA 2R7ZJ 2ZOZA 3GZIA 4A3DJ 4L62A 2KT0A 1IJWC 3S1QJ 1WH7A 2L7MP 2FX0A 4A69C 5J1RA 1AU7A 2IEKA 2Y30A 1JUPA 2XGCA 2YS9A 5FKMA 4JKZA 4W97A 3MNLA 5E3NA 4AF5A 1RETA 2IAIA 3P9TA 4I76A 1POGA 3GTJJ 2LY9A 2L9RA 3EUPA 1JTYA 1X58A 4M6VA 3D1NI 3ANGA 4L5EA 4XIDA 1I6HJ 1U78A 3VOKA 4D5CA 3BJBA 2CUFA 3NXCA 2KDZA 2VUMJ 3JSJA 1QVTA 2QF7A 1GDTA 1W0UA 2PBXA 5F0FA 2EQRA 2RHAA 2FJ1A 2E2HJ 3S1RJ 3LWJA 1QVUA 2QTQA 2DA7A 3RZOJ 2W48A 2Y9YA 3BTIA 2L7FP 3JRIA 4FTHA 1VF9A 3H0GJ 3DEWA 3HTHA 2DJNA 2Y31A 2ID3A 4S0HB 3KKDA 3HBLA 3BR6A 2E1OA 4PXIA 5FHPA 2XPWA 5DS9A 4GFLA 2NOGA 2UXIA 2NP5A 2YUSA 1P7JA 4M3BA 2V57A 4V2GA 2LLKA 2H1KA 1JKPC 4QIWN 2Y9ZA 4HKUA 1IDYA 5FLVA 1ZTRA 2VPRA 3HTAA
chains in the Genus database with same CATH superfamily
3BR1A 1GLNA 2WV0A 3JR9A 2JUCA 2GXBA 3BT9A 4D9JA 4ZYGA 2ESNA 2IP2A 1JKOC 3H3VK 5E17F 2BGCA 4Y15A 3OL4A 4AVZA 2G3BA 2F4MB 2XSDC 2KLOA 4XN3A 4HSTA 2XKPA 5CJ9A 4EM0B 1OQYA 2KIUA 4PJJA 4AU7A 3KKCA 2B0LA 3HUGB 5M5XJ 1BI3A 1NK3P 2VJ4A 1QPMA 3OYLA 4M6YA 5K5QA 5D5XB 4ZH4F 2FE3A 1DP7P 1DU6A 4EJUA 2BVMA 1JHHA 2L54A 2DYRH 4UUTA 2JJ7A 1OCRH 5ILSA 4XBFA 3V7SA 2W85A 4BBRJ 1FYMA 2PJRB 3I4NJ 3SZGA 3HTSB 4NELA 2VC0A 1ZYRF 3OYEA 4KYWA 2WV1A 4LG0A 1S9HA 4BY1J 2B3WA 2CW7A 4UNOA 4F92B 2E35A 1YIJI 1X1BA 3DPLC 2R7UA 1B72A 2IS1A 4BL0B 2A3SA 3BR0A 4AIDA 1W36C 2VOPA 3KZYA 3PQKA 3OOUA 4KN4X 2CW8A 2P8TA 4BQQA 4O6JA 2LKSA 4IQ4A 4HAMA 1D0ZA 2ME6A 2WA0A 5F64A 1USTA 1Y8RB 2EH3A 3Q9VA 1YJ9I 3QU3A 1U5TC 1R71A 1GV2A 4LLNA 3QAHA 4DZJA 1OISA 1IXSB 3CJNA 3K9TA 2RNGA 1UMQA 3HC7A 4L9VA 2KQRA 4ZJZA 1U5TB 5J1UA 3GZ6A 1JKQC 2COBA 2P5KA 4CGRA 3DKYA 1K6OA 2JA6J 3COAC 3TQNA 4CXFA 3S16J 2N8GA 1F5TA 2K40A 4RGUA 2D5VA 2DA3A 3FBIB 4N4NB 2P5LC 1IRZA 2Z2SB 2F4IA 3RYRA 3LSRA 2ZNZA 3FDYA 1N25A 2IGNA 1WJAA 9ANTA 1F36A 3CDHA 1B9MA 1D1AA 1U8BA 2EZLA 2BY0A 2CGPA 3WG9A 1UHMA 3JAMZ 2LFBA 4BDZA 4CA0A 1MBHA 1BIBA 2HXIA 2TRTA 3BZCA 3R0JA 3E1SA 1UHSA 1EH7A 2BBYA 3CESA 3KX2A 2XF7A 1TP4A 3WU0A 1J09A 2KFDA 2LP0A 3L2WA 3G2BA 1ZK8A 5CVUA 2YPRA 3FF5A 3DTKA 3DLAA 1O3SA 2M8GX 2R5ZB 4RAZA 1OR7A 1H89C 2XDVA 3KETA 2L9NA 4DBQA 3IH4A 4GXOA 4CZZA 2W00A 4WX9A 3BPXA 2XV4S 3ERMA 1BOBA 3S93A 4U0YA 3CCJI 4HQEA 3DXJF 3JRFA 2XAHA 4KWAA 3C3WA 3C2HA 1BJAA 4Q48A 2H1LA 4HPQA 5BNGA 3LL7A 2D2WA 5E8IA 2IT0A 4CGZA 4NBQA 4NUBA 5IY5H 2EA4A 4BXFA 2LY1A 1ETWA 4CYCB 3HIMA 2X48A 2H8WA 4Y17A 5JHUA 1QGPA 2CFXA 2LDUA 1HOMA 1J59A 3OOPA 4RDUA 3GTQJ 3KP3A 5IP6A 5J8FA 2HOTA 2CUEA 2IS2A 4GCVA 4LIVA 5ICCA 5CYVA 3OYJA 1MDMB 2X1CA 2HPMA 1XGNA 2OD5A 5GPCA 2RASA 2RAEA 3DKXA 2DBBA 1D0XA 1MBGA 5EGOA 1FX7A 1WGXA 1XCBA 1W36D 2JRTA 2E2IJ 4HNUA 3ZQCA 2M5WA 3KIOA 3Q0VA 3WG7H 5A2QK 2VN2A 1RR8C 1G3YA 4M9ZA 3IH2A 3GTLJ 2RNJA 2YU9J 5HS9A 2CO5A 4BQOA 4NC8A 2ISYA 2DT5A 3CLOA 2FBQA 3A01A 4RM2A 4RGSA 5FKLA 1MD0A 1SVOA 2PX9A 3CO7C 4G94A 3ABUA 3K1PA 4RBOA 2KRFA 3J7ZI 2VB6A 1OCOH 4RLQA 1W7PB 2ZSHB 3HSFA 1J7KA 3I56I 4KT6A 1H9GA 4IZZA 1JT6A 3BJ6A 3FZVA 1YIOA 3KYCB 2CRGA 2HTJA 2L9SA 2M2EA 3ZMVA 2OPTA 1SFEA 4XLHA 5LD2C 2GBYA 2GUHA 1VQNI 2EV0A 2FQ3A 1E3HA 3ISPA 1M1EB 2R7FA 1OYYA 2LMDA 2D1VA 2GXAA 4PFOA 2K9SA 2LG4A 1O57A 1U0JA 2UXOA 2A68F 4MNUA 1BW6A 2HVQA 2QWWA 4U87A 4YIIA 3J80Z 1YITI 2RC4A 3TGNA 1N78A 3RSNA 3F8CA 2NS7A 1D5VA 3KP6A 4PCQA 1ZRFA 1E0EA 4XR6A 3CJQB 3P9KA 3OMYA 4XOPA 1FOXA 2JA2A 2FOKA 3BG9A 4XORA 1PUFB 1VTNC 2ZKZA 2GOXB 1BIAA 5DDGA 4OWRB 4CCJA 1K78B 4XSZF 3M4OJ 1X1CA 3BG5A 4CDGA 4FETA 3HSRA 5M5YJ 1U9OA 4ZC3A 1IN7A 2NX4A 4G6QA 3IUVA 3HPHA 3ONQA 3LWFA 5K58A 3I58A 3MKZA 2EWNA 5D5UB 4A3GJ 4ITVA 5F0CA 1Z05A 3AQTA 2CQQA 1RRJA 5IP9J 4FCYA 1Y0NA 2VONA 1APLC 4HX8A 1XDUA 3UNGC 1OR7C 2X9DA 4PDKA 1EH6A 4GYGA 5CVIA 4LLLA 1XN7A 3DU5A 4UUSB 3TMOA 2UZKA 2XGXA 4KN7X 2ZXWH 1P6RA 1VQKI 2DDAA 3MMYB 4FE7A 2GIVA 4JX4A 1R23A 3LAPA 3I4MJ 3E7QA 3G73A 2UWMA 3DPJA 3V6GA 1Z3XA 5EG0A 1SFOJ 3C1DA 3KP4A 4EJVA 2NVTJ 2P7VB 4BJ5C 2L7ZA 3PO3J 2IXSA 3PNTA 3FM3A 2VBXA 3DV8A 3E3VA 3WU2C 3PSIA 3J81K 3JCUC 3WTTC 4A3MJ 4HF0A 3S14J 2VQHA 2ZXIA 1X19A 2H6BA 5IPAA 3HDDA 1HBXG 5HDGA 4ENNA 3K4MA 2JMWA 1IN6A 4D7MA 2XIGA 4BYYA 2DA4A 1OCTC 5E1XA 3OYFA 2LF7A 4KISA 1T39A 1E2XA 2E71A 2QGUA 4DJAA 1Y1VJ 3VUQA 4OIPF 3HRUA 3CZ6A 5F1RA 4JNNA 2DA5A 2YX7A 3IUOA 3ZQIA 1A04A 2QVOA 5FMPA 3UR3C 1R6RA 2MA3A 2RDPA 2V4JC 3IAS2 4L9NA 3GFMA 1LDDA 1TQIA 3EUAA 1IV6A 3OSFA 3M8FA 4LFUA 2G7HA 4D1QA 1D3YA 5F0HA 2RV8A 3CQZJ 1YFHA 1JHFA 2L2OA 3L09A 4PFPA 2O9LA 1DGWY 1LFBA 3S2WA 1LNWA 2QKOA 1S7AA 1I3AA 2X6WA 3S1NJ 3K6GA 1ENHA 1OYIA 2ZCWA 1WJCA 2V6CA 1T0FC 2LTPA 4D7NA 2ISZA 2O3FA 1YW7A 4B3AA 1YI2I 4J00A 5FJ8J 1N77A 4GCLA 2OCCH 2H8RA 2FBHA 5HDKA 1TBXA 2E5ZA 2DMUA 2LBFA 3QODA 4M72A 3OIPA 1TWHJ 1TQMA 5LFAA 3O3KA 1BI0A 2AXTC 3A1YA 3Q5FA 4BGDA 1F4KA 1FIAA 5EYRA 1CQTA 2M9HA 4XL9A 1I50J 1GVJA 3T0YA 4ZZLA 4KMUX 4HSRA 3HOZJ 4H4KC 1ZREA 2MW8A 3C18A 2LK2A 4I0AA 2LNBA 2W84A 4AIJA 2BHYA 1RKWA 4NB5A 1GV5A 2HQ5A 4RA2A 4UUVA 1GUUA 4QWQA 3AG2H 2KRCA 2XRLA 3GXOA 2KL4A 4CCOA 2QBYB 3COLA 4B3XA 1D0YA 4ACIA 2P81A 5KHDA 2L7KA 2Q2EB 2MD0A 4I0BA 4XKCA 1VQ9I 3JRDA 2R7SA 4XLEA 4IEJA 5DCMB 2XUBA 4Y4RA 2R4GA 2BEOA 1PP8F 1SD7A 2YX4A 1NHAA 3V4GA 4L9JA 4KICA 1BI2A 3RQIA 3VSLA 4MTDA 3ABLH 1QHHD 2R7ZJ 4L62A 3CJTB 1IJWC 3FXKA 4LJZF 3O6BB 4ZDPA 2F5CA 1WH7A 3WGGA 2DT7B 2DO7A 3E5XA 2XAQA 5E1WA 3V8LA 4XN0A 4WWCA 2XASA 2QSGX 2IGOA 2YS9A 4JKZA 3MNLA 2DQRA 5E3NA 1RETA 1X3WB 3P9TA 2LY9A 3N4MA 4M6VA 4XIDA 1I6HJ 4Y3OA 3I5UA 2OUMA 3KZZA 3BCBA 1H9TA 2JVHA 4RGXA 2VUMJ 3L2UA 3F6VA 1QVTA 3FKJA 2LREA 5JHFA 1HC8A 2O61A 2OJED 2EV5A 5F0FA 2X85A 1G8XA 1S7OA 2FJ1A 1G3TA 3GUDA 3V42A 5IT3A 1NH3A 2E2HJ 3PL8A 2QTQA 4HV6A 4I99C 1YW8A 1I5ZA 4ASNA 3RZOJ 4HOBA 2Y9YA 5HS8A 1XTAA 2RGVA 2L7FP 4OOIA 5BPDA 4IHTA 1EV7A 4C2TA 1FYKA 1A31A 2Y31A 3W6KB 2ID3A 5GAEJ 3KKDA 3CP2A 1HKSA 2HZDA 3BR6A 3HBLA 5FHPA 2XPWA 4KIFA 3FXRA 3GEZA 5J40A 4C9YA 2R7RA 1P7JA 4EV0A 1HW1A 2O03A 4IVNA 2FU4A 4CUGA 1W5CC 2OC6A 3DWLE 1HW2A 2Y9ZA 4ENMA 1IDYA 4D0PA 4LD5A 4Y7NJ 1KYZA 5DTDA 3CUQC 3PNVA 3CCYA 3HGGA 2Q2EA 1U5TA 3ON4A 2RN7A 4DIQA 4KT5C 2X6YA 2PMHA 4I2OA 2CH0A 1XCVA 1K83J 5CXIA 2IVMA 1ORKA 4XRMA 4PJMA 4N0BA 1R1UA 3IC7A 1Y8QB 2W7NA 1FOYA 2VT2A 2GM4A 2W53A 1ON1A 5E18F 4FQGA 3DEUA 2L0KA 3T8RA 2Z33A 4G8XA 4CYCA 2JTVA 4JYKA 2IRFG 1SVLA 1K4SA 2VPLA 2VIXA 1EH8A 1VNDA 2XB0X 3PQJA 5ERIA 1JXSA 2K7LA 4XM3A 2UV1A 2HVSA 1IRGA 3VVXA 4FE4A 4UDSA 3I4PA 1FOWA 3SZTA 5JVGF 4B43A 1Z6TA 1ZR4A 3OYIA 1UAAA 2PFVA 1QHGA 2A5WA 3TO7A 4EJTA 2EFWA 4C2MJ 5LLQA 3WE3A 3NPIA 5KNLA 2Y0SA 4MQVA 4RAFA 1G6NA 1RZ4A 4IOCF 3GMEA 3N05A 4CO8A 3BQZA 5JVTA 1IW7F 2QSFX 2HR3A 1H0MA 1FZPB 2A69F 1HDDC 2D6YA 1P7IA 2ACJA 1KZHA 2ZXHA 3NNRA 2MABA 5HSZA 2VASA 3QOPA 3VSKA 4A6EA 2X6XA 4ENKA 4NC7A 4XKVA 2DN0A 3LA3A 4DW6A 3GO5A 2NNYA 4HA8A 3KLNA 3VFZA 5FRMA 2NXNB 1V55H 3L2VA 4RLFA 3HSEA 3CMMA 3X2QH 3ZMDA 5EDNA 2VXDA 1CF7A 4KDPA 1TZLA 3K4KA 4W1UA 1YTYA 5JLXA 2HDDA 4GCTA 4JX6A 3QPHA 3ON2A 4IRGA 4JBAA 4B44A 1QU3A 1MJAA 4S04A 4U7DA 1FBQA 3TBIA 5HLTA 4ZDLA 2K86A 2DFEA 4A3CJ 3PUBA 2XHKA 2WAQN 2ZNYA 3H5RA 2MC3A 2OA4A 1Z6RA 4PJ0C 3HKZA 3WGHA 3MKWB 5EG0B 3ZPLA 4XLCA 1GT0C 2P0WA 4R8HA 3F72A 2OZ6A 1QO0D 4UV9A 5CKTA 2K4BA 2CUZA 1EA3A 3B6CA 4X1EA 5TGTA 4BUPA 2EZIA 4K2EA 5IOYA 4B1RA 1KQ8A 2CW0F 1SFKA 1W1WE 2K9MA 2V9PA 4IHVA 4ICHA 2A6EF 2R5ZA 3K69A 3G3ZA 4LITA 4RAGA 4N9HA 2OU2A 2YVHA 3E97A 4FHTA 2LR8A 3IRQA 3K7AJ 2PMZN 1FP1D 4WXDA 4LG0B 3W3CA 1DU0A 3CMEI 3CCRI 1ON2A 1LE8B 4MFDA 4NNJA 2WGBA 3OYAA 3CRJA 2ZCXA 4FISA 1VQLI 5J4VA 1Z67A 1FTTA 3KZIC 3M9AA 1XGSA 3DTEA 2M87A 2M0MA 1T38A 4QPQA 2QSHX 1TWCJ 2MYSA 2CSOA 4XQFA 2PFBA 2KZGA 3R60A 2LRDA 1YS7A 3TW7A 2NP3A 2PG4A 3IKVA 5M3MJ 2LC2A 1NG7A 1E3OC 2ZMEA 5E79C 4IHYA 5ICGA 3FM5A 3CTAA 1B8IB 2DDBA 3VVYA 2VE9A 4Z6YA 3EUHA 1LQ1A 1R5GA 1WJEA 1D1BA 1IC8A 2WTEA 4UHTA 5CQEA 2W57A 1MBFA 2W1OA 4UXNA 2W25A 4G7ZF 5FROA 4E7JA 3GFIA 4XKWA 2HU9A 3HKZN 2EFPA 2ZCMA 5DYMA 3DQVC 1QRYA 2ELKA 2H09A 3HHGA 1ACIA 1FMWA 1MSFC 4BBSJ 2EZKA 2VKVA 1PDNC 3HOXJ 2DMNA 1WJFA 3K1MA 4Y33A 2X1DA 5DM7F 4LK0F 4A3EJ 2FOWA 2RVCA 5IP7J 2Y0MA 1BR2A 4IHWA 2G7SA 1U8RA 2I10A 3HUGA 3J7AO 2VL8A 5IT9K 2ZJPF 3KEYA 2JWTA 2CJJA 3HZJA 1LKXA 4BKXA 1W7PA 1FNNA 5EEGA 1AWCA 2CV0A 3WODF 3RD3A 4EJWA 5FFXA 2TCTA 1CF7B 3HOTA 4MGRA 2DLLA 1KA8A 2QYOA 4ZYAA 2PJRA 1LEBA 1A35A 2AHQA 2E1MC 4EJOA 5C3EJ 1FOKA 1ZGJA 1K61A 1I27A 2XAFA 3PASA 1DPUA 2R7QA 1RR7A 5D6FA 3G6EI 1H8AC 4L9TA 1ETYA 3VYRB 3F6OA 1F1ZA 1KU9A 3P9CA 3VIBA 3BTJA 2DYSH 3D5SC 1O7FA 2Q8KA 4P1WA 1HW5A 1TNSA 2FMYA 2RQPA 4H0EA 1SEUA 1BA5A 3FRQA 2KMUA 3VYSB 1BI1A 3E6CC 1EKEA 1NG6A 2FNPA 5HLHA 3LOCA 3WTZA 5J1YA 2M1BA 4B47A 1MJBA 1ETQA 3LFUA 3E6MA 5H6RA 1DQUA 2KZVA 1MMNA 3BTLA 2MH9A 3ERED 3GTMJ 2EINH 2CWEA 3E6DA 3H35A 3H92A 1LEAA 2W82A 3W2VA 2E1CA 3FIWA 3BP8A 3RIRA 5JI6A 3BR3A 4HZFA 3O8GA 3WHCA 1Y56A 2Z5UA 2STWA 1YOVB 3GFLA 3QPLA 5L3GA 2IA2A 3L2QA 2R3SA 3B73A 3H5NA 2DODA 3GZ5A 1WRJA 2CUJA 5EFYA 3FISA 1FWZA 2FJI1 4J01A 2HKXA 3GCMA 3IWFA 3AL0B 3PPBA 4OAZA 1JGGA 1VZ0A 1FBUA 5FGMA 1P9QC 3ZQ7A 3EETA 2PZ9A 1FTZA 1DDNA 2V1XA 2IW5A 4RGRA 1QNTA 3J81Z 5H6QA 1J5YA 4ZTFA 2NVQJ 1KU7A 2E7XA 1SD5A 4M3DA 4OIQF 3S1MJ 3JRAA 2R7TA 2MD5A 1K79A 3T6NA 1XX5A 3OY9A 4ON0A 2QOPA 2DAOA 3KPHA 4BE2A 2ZBKA 5EJCA 2Y0SN 3IP4B 1JT0A 4V19K 2R92J 3OYCA 4IKFA 1SAUA 2M4GA 2XSJC 1USSA 3DPUA 4UVCA 2QIBA 3F8MA 2JSCA 5C4XJ 3PIOF 5LRSA 4HF1A 2CQ7A 3M3YJ 1HDPA 2XAUA 1LFUP 4AC0A 3LSJA 3K4JA 4WXCA 2REKA 2HS5A 2DFFA 3D0SA 5D5WB 3OV8A 3S32A 2A6HF 4M3FA 2BY1A 2HOAA 3KE2A 5BPIA 4A0XA 1BN5A 3KLOA 4LGWA 3BDDA 4U88A 2QBYA 2QM3A 3BTCA 5B1BH 1YX5A 5CVRA 3MZ8A 5HLIA 3RKXA 2E36A 3ECOA 2GA2A 3IKTA 3HTIA 4HX4A 3HOWJ 2BYVE 3G4SI 2LOOA 2L3DA 4IXAA 3HRMA 2P4WA 2AQEA 2EIMH 2VKDA 3NWSA 1H88C 3DEEA 1S5LC 2PQ8A 2IPQX 4WF2A 4GGGA 3QPTA 3ZQGA 1GHCA 5HS7A 2Z16A 4P96A 1J0RA 1SMTA 2Y69H 5CQGA 2LBFB 4DYRA 2VODA 1X4PA 4M3GA 3GYHX 4LK1F 2JSPA 4BAYA 3KYDB 1IUFA 1PJRA 1Z0XA 1SMYF 3CUQA 5EZGA 3RDIA 4ZZDA 5C44J 5K7HA 1R4NB 4BS9A 1MZBA 3Q3SA 3ASOH 5HAWA 3A4CA 2V79A 2QKLB 1FJLA 5GAGJ 3S17J 2QQ9A 1VQMI 4L0YB 2BV6A 1EJ9A 5K7ZA 4BHPA 3RPUD 1W0TA 2DA2A 2IBDA 3VODA 2O0YA 4E7IA 3OS0A 2G7UA 3FWEA 3R4KA 2PI0A 2VBZA 2OBPA 4GDFA 1E17A 3HTUA 4PK4A 5FGLA 4A5NA 3SEZA 2E34A 2VI6A 1KGSA 3N97A 1R9TJ 2EPFA 3E5UA 2JPBA 1IO2A 1IAWA 4WK8F 1R1VA 3DU6A 3Q9SA 2BW3A 1TLHB 2OAZA 2MLGA 5FB2A 3DF8A 3JRCA 2DXIA 3DP7A 3NRVA 1MIJA 1BOAA 4A3DJ 4HRIA 3ELKA 1FMVA 4BJ6C 4UB8C 3CCEI 3AL0C 2L7MP 2FX0A 2Q0OA 3LSMA 3L9FA 1YJWI 1IN8A 5J1RA 4P5OA 2Y30A 2I5UA 2K02A 1Y0UA 4W97A 4AF5A 1CGPA 1S8NA 2IAIA 1ZH5A 3GTJJ 2NS0A 4YG2F 2R7VA 2OQGA 1JTYA 1X58A 3LQRA 3EUPA 4KNYA 1XSXA 4D5CA 3ZMTA 2CUFA 2E1MB 2M7AA 2PMUA 3NXCA 3CC7I 2HDCA 3SDBA 2QF7A 3ZP5A 2A07F 2PBIA 4HNTA 3A0HC 3RCOA 3MKYB 3S1RJ 4F93B 1QVUA 5D5VB 1U3EM 2CV1A 2FF4A 2W48A 3BTIA 3BROA 1VF9A 2AQFA 5LGUA 3H0GJ 3DEWA 3K2ZA 3DFGA 3MEXA 1TW2A 2EFNA 4AIHA 2PLYA 2F5EA 3CO6C 1ONVA 2M8EA 2E1OA 1L0OC 5E1ZB 4EM2A 2VQGA 5DS9A 2NOGA 2YUSA 2IJLA 2VQCA 3IWZA 4M3BA 4V2GA 3TKYA 2V57A 5EEHA 5L3EA 2H1KA 1O7LA 5AIQA 3FXJA 4ZYEA 1OYWA 3M8EA 3QU6A 4Z2YA 1B9NA 2LYCA 2WY8Q 3MWMA 1XS9A 4NN1A 2EZHA 3FXOA 2EFOA 2MBFA 4I09A 3S3MA 3H0DA 3FMQA 3HOVJ 5FKOA 3E6BA 3EDPA 3TL4X 2V1UA 3RJPA 3RH2A 2XVCA 1AOYA 4II2A 2P6TA 1G3SA 2HOSA 4FT8A 1D8KA 2P6SA 2WUIA 1FC3A 3PIPF 3WTYC 2G7GA 2PJPA 4BHBA 3VEPA 2ADUA 2ZFWA 1UI6A 1G59A 1MNEA 3FK6A 5HNFA 3CDIA 1ZHFA 5KVRA 4IQJA 4XLAA 4KA4A 2XAGA 1Q1HA 3ZMSA 4DGWB 2W24A 2QLZA 4MFEA 5JR3A 2GZWA 1ZG3A 1XMAA 2OCEA 3BWGA 3SJMA 3U9GA 4BXUA 3OYHA 1IGNA 1QZEA 1V4RA 1EF4A 3LSGA 1YLFA 4B8XA 2KJCA 4C3IJ 4G12A 1FP2A 3JSPA 3IL2A 2YVEA 4PUSA 1IN4A 4M3EA 5DM6F 3BHQA 4FX0A 1VQOI 4AUXA 4U9NA 4DYQA 3OS2A 2Z9OA 3NI7A 4YFXF 5H9TA 5DUKA 1RPWA 5B5EC 1Z7LA 2FEZA 2LH9A 2FBIA 3CCLI 2ZMEC 1NTCA 1U2WA 2E7WA 3GZNB 3HL2A 3CCUI 3BG7A 2IU5A 3R0AA 2M34A 2DA6A 4UUSA 4A93J 3C7JA 3QWLA 4OU0A 4QTRA 1X2NA 2X4HA 1WJDA 3QBMA 4E7ZA 1SD6A 2Q24A 2BVLA 2GA1A 3W6VA 1SFXA 1Z77A 2HKOA 3TP3A 4A0YA 2FA5A 1ZAOA 4PSXA 5LBQA 3GBGA 4AYBA 3CC4I 2V9KA 4UVAA 4O5VA 2JA8J 2B9SA 1RUNA 2JA7J 3FXUA 1MMGA 1WKMA 3I0TA 2CS3A 2F5VA 3BCAA 4GO1A 5DCFA 3SXYA 4AM3A 4B4CA 1MDMA 4EGYA 3QP6A 3AQSA 3ZN1A 3WGIA 2COMA 3JRGA 2X0LA 3DCFA 3LFKA 4II3A 2V6EA 3FKIJ 4XKBA 2XPUA 2ZY9A 4EATA 1OJLA 1X2MA 2ESHA 1ZLKA 3HB9A 1UFMA 4U0WA 3KEOA 4QLCU 2HQRA 4OIRF 4HX7A 2ZOYA 2ZJ2A 4IHXA 4KMFA 5F08A 4CHUA 5CLSA 1LVAA 3PFIA 2ICWG 3EGQA 4M73A 4GCKA 5FKKA 1X3ZB 3K8PC 4E6KG 2MH2A 2HXOA 4FX4A 2GQQA 2G9WA 3CMYA 3EYYA 4BXXJ 3VW2A 5LEJA 1R5HA 4AVPA 4BH9A 3SZPA 4F7ZA 4C2UA 4WIBA 3BZ6A 4A2UA 3PM1A 3GEUA 2L02A 5D4RA 4A3FJ 3Q0UA 3I53A 4HW0A 3F8NA 3A01B 4F91B 5HOOA 1AHDP 2EB7A 2DQLA 3QYEA 2DPDA 1KONA 1SANA 1ZGAA 2DCEA 2E19A 3SQNA 5LHGA 2KJBA 3CJRB 3S8PA 2JT1A 5HODA 3VYTB 5KCMA 1YQAA 4JP0A 1GXPA 1VQ7I 3HTJA 3ZCOA 4M71A 3HHHA 2VKHA 3LJLA 3B81A 5E3LA 2MFZA 2X51A 1C0WA 1R5ID 4NHJA 2HYGD 1PYVA 4KIGA 1S6LA 5EZHA 3ZOBA 2NP5A 1G4DA 1OKRA 2G7LA 5CXGA 5DEQA 4HDVA 5LHHA 1BL0A 3C2BA 3HM5A 4UVBA 2F5DA 2A05A 4DYCA 3K10A 5C4YA 2DK8A 4KIBA 2EILH 4YIRX 1O3QA 4IPAA 5DD4A 2DTZA 2OTJI 2VE8A 2Y2ZA 3LSHA 5DAJA 3O8HA 3ZQHA 4YFNF 4R79A 1A5JA 5ILVA 1HLVA 2V1NA 4CCLA 1RESA 1XGOA 3SEQA 1MMSA 4C3JJ 2DMQA 1TT5B 3G1MA 4S05A 4B48A 3CP8A 2BXZA 4YELA 1GVDA 3TO9A 5K5RA 1WCMJ 4TV7A 1F9NA 5FLXK 3MD2A 1VQ4I 1ZLJA 3ECHA 2HYFA 4KFCA 3BRUA 1RIOH 2DTRA 2K27A 1UCRA 2M0CA 1T95A 2VQLA 3EUKL 1UG2A 2UXUA 3F3XA 1P2FA 2UXPA 1LB2A 1K4TA 3HG9A 2HVRA 3A2KA 2VJJA 3CCSI 1BR1A 5EGOB 1WVRA 4MEYF 1A36A 5BOXA 5FKNA 4X6AJ 4LIUA 1OCPA 3CUOA 3NAUA 2NS8A 4Y13A 2ZXJA 1VQ8I 1KU3A 5J8CA 4L5IA 1KQ9A 3HOUJ 3S2DJ 1ERDA 2VBYA 2HNHA 1YYVA 1OCZH 3E5QA 3OYGA 5DUIA 3L00A 3GLLA 4YIFA 5J47A 3JAMK 3HRTA 1MBJA 3JTGA 1XPXA 2A6TA 5ICFA 3CDLA 2BW3B 1R1TA 3NQOA 1ZARA 1KYWA 3R61A 3U21A 3K4NA 2VC1A 2MSYA 2DU9A 5ILUA 4E7HA 1MH4A 2H94A 4BJTA 4ENJA 5IYBJ 3MVPA 1AKHA 2FUG2 2ZCNA 1Y39A 4RMNA 5FD5A 2R7WA 1ETVA 1SC7A 2KKOA 3ZMZA 3H5AA 1XG1A 1ETOA 2HOEA 2WAQA 4IL6C 4ESJA 2KIFA 3KNWA 1X4OA 3V78A 3S5RA 3QP5A 4DZPA 3CF2A 5B3SH 3QRFF 1HQCA 3QPSA 5F1JA 1PUEE 1TWFJ 1IZ1A 3BY6A 2MC4A 2R7DA 4G9YA 5IYCJ 3UKGA 1G3WA 5D6EA 1S7EA 3AAFA 1XSVA 4GRIA 2HI3A 3GW2A 4MO7A 1JI8A 1QZZA 4QPOA 1MMAA 3RKWA 2TDXA 4AYBN 4KITB 5A2QZ 3Q0WA 2XKOA 1AKHB 2H27A 3H1CA 1Q1VA 2VKEA 4PZJA 3OR1C 3R6SA 4E7KA 3GTPJ 2K85A 1DP3A 1ZGWA 4XLNF 2DFHA 2Y48A 1DPRA 2F4OB 3CC2I 1B8IA 3KCCA 3G71I 3AKZA 3RI4A 1STZA 3FHZA 2HQNA 3ABKH 1ZN2A 3FXLA 3KP5A 2QWTA 4F3QA 3H9QA 3I71A 5L3FA 4E7LA 1UHWA 3K4LA 5D18A 4MIMA 1E3PA 2NVUB 4KUMA 2MG4A 4HG2A 3W2WA 2YVXA 5K7FA 4I6ZA 3DBLB 3KEQA 4NDLA 1WSUA 4IRHA 4BE1A 3WTVC 1XD7A 1FBSA 2XC7A 2K9QA 3GTOJ 3HJEA 3TOBA 3M8JA 4G6TB 5E3OA 1QBJA 3IAM2 3OWTA 1TW3A 1N75A 2E60A 4B09A 1O3RA 3TO6A 4CCMA 4OMYA 2A61A 2X6OA 2A5YB 4EGZA 2HYTA 2DOEA 2DW4A 5E3MA 4F55A 1JUMA 1XDSA 1DGRM 1MNMC 2QKMB 1HXDA 4HNVA 1UJ8A 3HOSA 4J19A 1I1SA 2XGEA 5TJJA 1U9NA 3VDXA 3LSIA 5J3LA 4RB2C 2F07A 1LJ9A 3ULQB 2D45A 2QQ8A 3O2PE 2FMLA 6PAXA 3P5JA 3PSFA 1BM9A 4XMYA 4R1HA 4ZDOA 3VVZA 3E0JB 3TDUC 1BJZA 2EIKH 1WHUA 1LE8A 4IHSA 4HV5A 4I7HA 4ME9A 2RKHA 5H20A 4JX5A 4RB1A 1ZR2A 4IJAA 4L5JA 1T0FA 5BS6A 2CQKA 2OI8A 2EA2A 2YR2A 2O8KA 3H3ZA 2G0EA 4GFKA 2F6CA 1ITYA 3FXQA 1FT9A 1MBEA 2BY3A 2R7OA 4P55A 5L3BA 3OYBA 4IOAF 3IV5A 1TWAJ 3JRHA 1T08B 4E7SA 1U6GA 2KP6A 3K70D 2EK5A 3LQQA 1V54H 4DQ2A 3DTIA 2BXYA 1OCCH 1YX3A 3I3LA 5KK1A 2BOLA 1MH3A 3VP5A 4OD4A 3BCGA 5ED4A 1IG7A 3KP2A 4FASD 3HXLA 3MFKA 3DBHB 1D8JA 4CICA 3RYPA 2CYYA 1KU2A 3B02A 1I1GA 3HYIA 3F8FA 1UELB 5JFRA 3ZN0A 1QPIA 3NS4A 2XAJA 2IGKA 3L7WA 4BACA 2P7CB 1JJ8C 2NVXJ 4MXMA 4CCKA 3GTKJ 1YS6A 1PP7U 3ROUA 1IUYA 3SFZA 1WPKA 5J4YA 4OAYA 3GZIA 4M74A 3S1QJ 1BC7C 2JZYA 3KYLA 2I8DA 2K5CA 3BJAA 2ZMEB 1HKQA 4I01A 4A69C 2HZTA 1AU7A 4NQWB 2IEKA 1JUPA 4XOTA 5CVJA 1K6YA 4L0ZB 4WCGA 3D5RC 2AXLA 4IF4A 3AFHA 2ETHA 2RREA 3WE2A 2WWYA 1TNTA 2OZUA 3ANGA 2DPUA 2HEOA 2VT3A 3IHUA 1U78A 3LSKA 3K4CA 5J6XA 3H9GA 1REPC 2KDOA 1WFXA 4HLYA 3J7AY 3JSJA 3BG6A 3DKWA 1GDTA 5B66C 1W0UA 2DOAA 4MEXF 2PBXA 2EQRA 2RHAA 5BQTA 2Y75A 5FO5A 2DA7A 4HDUA 2HTSA 4ZTJA 2JVGA 3JRIA 3DPTA 3MAJA 3HTHA 1V5FA 4S0HB 3RQ4A 5DV5A 3AG4H 5HDNA 3WU1B 2GOMA 2V1DA 2M30A 3EUHC 5D4SA 2PN6A 4GFLA 1J2XA 2UXIA 2GWRA 1R00A 4PSWA 3CCVI 1B59A 3H3UA 2LLKA 1I39A 5LEKA 1JKPC 4HKUA 5FLVA 3FHNA 3QOEA 2UXXA 4I02A 1ZTRA 2VPRA 1JGSA 3V7RA 2OQRA 4AWXB 1XSDA 1Y6IA 3WHBA 5IYDJ 3GWZA 2KHMA 2DI3A 3JSOA 1RNLA 4XONA 2HDWA 4AIKA 3ESWB 1MGTA 2FXAA 1R7JA 4HLXA 1I6XA 3LSTA 4MQ9F 2ZFUA 2OERA 3PFYA 1V5EA 3B6AA 3PJRA 4BEHB 3CD6I 5D19A 5TISC 1P4WA 2A2FX 1TC3C 1LVKA 2Z99A 1AA7A 1R4MB 2CFOA 2QQBA 1NK2P 2NRAC 4Y52J 2IA1A 5BMZA 3VW1A 5CPRB 3AG1H 3PUFA 3L1PA 2ZB9A 2EFQA 1FY7A 2WAEA 3BQYA 3BR5A 3GLXA 2F5FA 4UY8I 2R5YA 2QEXI 4A3IJ 3S15J 1ZKGA 3EPZA 4P9UA 1G2HA 1WWXA 1RC9A 2FRHA 3BPVA 2ME0A 1MW7A 1JUSA 1Z1DA 4CCNA 4G7OF 5DCMA 3I54A 4PGGA 3F22A 3MKLA 2CG4A 4HEA2 1T6SA 2K4JA 5E8GA 5GAHJ 5K1YA 4F52A 4G7HF 3D5LA 1YRNB 4HBLA 2DK5A 5HVQC 3F21A 4A3KJ 1HF0A 2JRMA 2JPCA 3OYDA 2IS6A 3W2AA 1O3TA 2WBMA 1Z91A 2L9VA 2V26A 2L5QA 4CSWA 2HPIA 4MHGA 2XF5A 4JQFA 5F27A 2JN6A 2FBKA 1IXRC 1WI3A 2M7BA 3RTRA 3H9JA 3L2CA 1ZQ3P 3HIFA 1MKMA 3RPUA 1SGMA 3QYBA 4WXHA 4ABZA 3S2HJ 2O7TA 4A3BJ 2MLKA 2ZC2A 2L4MA 3KP7A 4ESFA 3I59A 1DUXC 2M45A 3TP0A 4JK1X 4IX7A 2QENA 1P4XA 2EBIA 3CJDA 1FLIA 3WTUC 4D5FA 1Z21A 2WAFA 1TT0A 3ASNH 1ODDA 4I98B 3CF5F 1VQ5I 1QA6A 3EYIA 1FIPA 1RI7A 2O7OA 3REOA 2NVYJ 4OINF 3MZHA 4HF2A 3FX3A 1V5GA 5EEAA 2XF6A 2KRHA 4XSXF 1Y1WJ 2L4AA 3A03A 2J5OA 1VQPI 2CV2A 3GTGJ 1TQPA 1W7PD 3BZKA 3BNIA 4AC6A 2CQNA 1PVEA 3A0BC 1YHQI 3G56A 1ZRCA 3SWHA 1WQ2A 3ZQFA 4OMZA 3I55I 3U1KA 2NOJB 4M9SA 5AQCA 2IA0A 1UB9A 2XPVA 2OV7A 2VJ5A 2HYJA 4BQAA 5H2FC 3MN2A 2HWVA 3E7LA 2EJRA 2JA5J 2R7XA 2Z1DA 3S3OA 2DA1A 1MMDA 4C3HJ 1S3JA 4YRVA 3VTIA 2LSOA 1WZ2A 1T33A 3LAJA 1R22A 5GP9A 3OL3A 2PEXA 2VLAA 3KZ9A 4YZEA 5ICEA 2E5NA 2GIZA 2H6CA 1W5TA 1MNDA 1BW5A 5IOZA 3A02A 2GAUA 4M6XA 3O60A 2ZSIB 5GTIC 4L18B 3MCZA 1ZG1A 2XGDA 4BU2A 1JE8A 3BG3A 4AD9A 4P9FA 3CUQB 2FD5A 1QZYA 1VI0A 1MBKA 2ECBA 2WADA 3RZDJ 1RUOA 2R0QC 1T2KA 2V7FA 2KISA 1BBYA 4C30A 3EQLF 4DBRA 1R58A 3ML6A 2BHZA 5EF6A 3I59B 3TEDA 2DJIA 3LSPA 3DLLF 1OFCX 1FSHA 4A5MA 1HA8A 5M5WJ 2XROA 2K9NA 3QQAA 4JOMA 1B72B 2EIJH 3F1BA 3LA2A 4U0VA 5FLXZ 1FYLA 1IV8A 2Z3YA 2DT6A 4XLFA 3MZYA 1B6AA 3LHQA 2CQXA 2XRNA 1O4XA 1A6IA 5D8KB 1S29A 4NC6A 4GFBA 5D1RA 1ZG5A 4EM1A 2XDNA 4EQQA 2DG8A 2VBWA 1FPQA 1IF1A 1YG2A 2JK3A 1F43A 3RPQA 3ZXSA 2R93J 1ETKA 3TDZC 5F6FA 3V7CA 1SVMA 4LLGF 3WTWC 1PUFA 2RQQA 2QUFA 4GYIA 2WC2A 2YU3A 2DG7A 2X1EA 3AG3H 1LDKB 5KAIC 4YEJA 2DMTA 2K3PA 3BC8A 4XICA 5L3CA 1VQ6I 5AONA 4LMYA 3VW0A 3VPRA 3F0CA 1XGMA 3FK7A 3HOYJ 3T8TA 3P7NA 3QYFA 3GX4X 2PMZA 1IXCA 2FQ4A 2VOOA 4ZYHA 3OYMA 4RM3A 5FD6A 5HNHA 1D5YA 3DBRB 1UG0A 2HKUA 1T98A 4E70A 1OLTA 3PNYA 1ETXA 2ID6A 4MTEA 3T1BA 4RS8A 2JQ7A 1I3QJ 3ZQLA 1X1DA 2QCOA 4BEHA 1LDJA 2ZJQF 1J9IA 2KPMA 3VWBA 1X1PA 3HPGA 2HFHA 1L3LA 3PO2J 2O6GE 3NEUA 2GLOA 2LY2A 2R5YB 4XRSG 4OIOF 4MK6A 4BHCA 3VYUB 4XNFA 4M9XA 4QSHA 2GENA 3K0LA 3OS1A 3JW4A 3F8BA 2K9LA 2W4SA 3K70C 3JRBA 5DD8A 3ANPA 2UXHA 3K2AA 4BDYA 5JLWA 2B7EA 2V9VA 1LFPA 4LB6B 5FRNA 3P9IA 3SFIA 3CWRA 4IRVA 3S3NA 1R49A 4UB6C 3ZR8X 5CW8A 4HQMA 4X0GA 3VB2A 1WI9A 2DMPA 3RKYA 3LNQA 2UXNA 5LGTA 2LKXA 2YSRA 3I9V2 2NAZA 3TW6A 3C2GA 1R36A 1VFCA 3ABTA 1JTXA 3SYTA 4O3MA 3G1LA 1IN5A 2M4KA 2ECCA 4LOCA 2KIQA 1LUJB 5E20A 2OF7A 4ESBA 4G6DA 4LB5A 3C07A 2HQAA 1T8IA 4DOZA 2QZ8A 1WJBA 1WJ5A 2F2EA 1XC5A 1UZCA 3ZMUA 4UV8A 3OYKA 1V3FA 1IRFA 2GXGA 3OIQA 4V2FA 3ZGKA 1ULYA 4PJNA 5B1AH 2WB1N 2O5RA 1FSEA 1K7AA 4XK4A 3M1EA 1MSEC 1LPQA 1HCRA 2B63J 1IRXA 3M1CA 3FMRA 4HYEA 1BC8C 3SHFA 4U7BA 1UI5A 5HBUA 4Q47A 1YRNA 3HEFA 1S72I 2E1NA 1W4MA 2EV6A 2MGQA 4CZCA 4CYDA 3LA7A 1RKTA 3TOAA 4OD5A 2ZO4A 3JREA 4A3JJ 2CU7A 4MLOA 1K78A 2L01A 2Q1ZB 1JJ6C 1IDZA 4EEFG 4BNCA 3SDGA 2ELJA 3HGYA 3KFWX 3IRRA 3F9KA 2BY2A 1YW9A 4XRSA 2VXZA 4LG3A 1BR4A 4DNCA 2XB5A 2AO9A 1KQ0A 4ETSA 4A12A 4A0ZA 5GTHC 5F04A 1Z7UA 4BE0A 1SD4A 1W5SA 5FLMJ 1TWGJ 2GFNA 3K1NA 5AIPA 5KAFC 5TRDA 2E2JJ 2OTLI 3BR2A 1B4AA 3ZQQA 3CLQA 3U2RA 2BZTA 1XMKA 5C4JJ 3RKQA 4N4OB 2M3AA 4BQNA 4YFKF 2ZJRF 1X3UA 4EVIA 3FMSA 5LHIA 4XRFA 2D1HA 1WH5A 2LVSA 4JL3A 3H36A 2K3FA 3I64A 2STTA 3OSGA 2ELHA 1J75A 1FEXA 5FFZA 2NYXA 5M3FJ 3HE0A 1Z9CA 2IS4A 4RAYA 5GPAA 3NARA 3NRGA 3BJOA 1P4AA 4A3LJ 2HGCA 1MJ9A 1SFUA 3FBNB 2AS5F 1T56A 4EMSA 1OPCA 3WTXC 3QKXA 4U9LA 2VJIA 2LD5A 1ZELA 2O8XA 3FXMA 3OIOA 3GF2A 3VOXA 5LGNA 2BE5F 3M07A 3VOEA 1JKRC 4ANJA 5IT9Z 3HRSA 3G1OA 4BY7J 1GXQA 1Z3YA 1A6QA 3G7RA 3ABMH 2JUGA 3OR2C 3W6JB 4RB3C 1SAXA 3IH3A 2ZOZA 5CVVA 5HLGA 2KT0A 1QQIA 2IGMA 1P92A 1OMIA 2FSWA 4XLPF 4IRIA 1TL8A 1TTYA 2DOFA 2WY7Q 3JTHA 2NNNA 2P5VA 2XGCA 3BLYA 5FKMA 5GADJ 1YO5C 4PGHA 1HSTA 3NWTA 3CCMI 4E4HA 3MQ0A 4I76A 1POGA 5K5OA 2L9RA 4NQWA 3F23A 3D1NI 3CCQI 4L5EA 2LF8A 3ZRGA 4A6DA 5LRRA 3V8JA 3CMAI 2QQAA 3VOKA 3T5XA 5L3DA 2C6YA 3BJBA 4CH7A 1XMXA 2KDZA 2B1EA 1HSJA 2WB1A 3BOQA 2UUZA 5D8LB 3J7YJ 1YE9A 1B1BA 3LWJA 1HKTA 2J5PA 2KIMA 2F48A 3LMMA 4Q4ZF 4PJLA 3OYNA 4FTHA 4RB0A 3V8KA 2DJNA 1XB4A 3J80K 4KJZA 4PXIA 3M7GA 2QA4I 2CMPA 4Q5SF 3WTSC 3K4BA 4C2MA 4N9IA 4DVYP 4IO9F 2DFIA 1YJNI 1X1AA 2FNAA 3GFJA 4QIWN 1ZRDA 2LKPA 4ZYDA 3U1DA 1D1CA 3L2RA 3GVAA 3HTAA
chains in the Genus database with same CATH topology
5DTDA 3BR1A 3WHBA 5IYDJ 3CCYA 3JR9A 1XS9A 3HGGA 3ON4A 4NN1A 2EZHA 3BT9A 3HOVJ 5FKOA 1JKOC 3H3VK 3RH2A 1K83J 5CXIA 1ORKA 4XRMA 2G3BA 2XSDC 2OERA 3B6AA 2HOSA 2WUIA 5D19A 2G7GA 1TC3C 1UI6A 1NK2P 3FK6A 2GM4A 2W53A 3KKCA 4Y52J 3VW1A 2L0KA 5M5XJ 4CYCA 1NK3P 4JYKA 3L1PA 2ZB9A 4MFEA 3BQYA 3BR5A 1DU6A 1VNDA 2XB0X 3SJMA 4UUTA 2R5YA 4A3IJ 2JJ7A 1IGNA 3S15J 3VVXA 1ZKGA 1EF4A 3LSGA 4BBRJ 4C3IJ 4G12A 4FE4A 3I4NJ 1G2HA 4UDSA 2YVEA 4M3EA 3BHQA 1ZR4A 4NELA 2ME0A 4AUXA 1JUSA 2WV1A 4BY1J 4DYQA 3NI7A 5H9TA 1RPWA 4C2MJ 3MKLA 1B72A 3NPIA 3BR0A 1NTCA 1YRNB 3OOUA 4A3KJ 1HF0A 2IU5A 2M34A 3BQZA 2DA6A 4UUSA 4A93J 4QTRA 1X2NA 2D6YA 1HDDC 2ME6A 1P7IA 3QBMA 2Q24A 3W6VA 3NNRA 1Z77A 5F27A 3TP3A 2JN6A 2EH3A 5HSZA 1WI3A 2DN0A 1GV2A 3GBGA 4DW6A 1ZQ3P 4DZJA 2JA8J 1SGMA 5EDNA 1UMQA 4ABZA 2JA7J 5J1UA 1JKQC 3S2HJ 2COBA 2O7TA 4A3BJ 4CGRA 2JA6J 4W1UA 5JLXA 3S16J 4B4CA 2N8GA 2HDDA 3AQSA 4GCTA 4JX6A 3TP0A 2K40A 3JRGA 2D5VA 2DA3A 3ON2A 3DCFA 2EBIA 1IRZA 3CJDA 3FKIJ 2XPUA 3LSRA 4A3CJ 4D5FA 1OJLA 1X2MA 2WAQN 3HB9A 9ANTA 1F36A 2ZOYA 1FIPA 2O7OA 1U8BA 2EZLA 2NVYJ 4IHXA 5EG0B 5F08A 1GT0C 5EEAA 2LFBA 1Y1WJ 1MBHA 3EGQA 3GTGJ 2HXIA 2TRTA 3A03A 4X1EA 3B6CA 4GCKA 1UHSA 3BNIA 2EZIA 5FKKA 5IOYA 4B1RA 4AC6A 4IHVA 2HXOA 3G56A 2LP0A 3ZQFA 4ICHA 1ZK8A 2R5ZA 5AQCA 3CMYA 4BXXJ 2XPVA 3VW2A 2M8GX 2YVHA 2R5ZB 2HYJA 2LR8A 4Y7NJ 3K7AJ 1H89C 2PMZN 3PM1A 3MN2A 3GEUA 3E7LA 3IH4A 4A3FJ 1DU0A 2JA5J 3Q0UA 3A01B 1AHDP 1LE8B 2DA1A 4MFDA 4C3HJ 2WGBA 3CRJA 1SANA 2ZCXA 1T33A 2E19A 4FISA 5HODA 4KWAA 5GP9A 3JRFA 3KZ9A 1FTTA 4JP0A 4YZEA 1BW5A 5BNGA 3A02A 5IOZA 3HTJA 3O60A 3LJLA 3B81A 5E3LA 1TWCJ 1ETWA 4CYCB 3HIMA 2X48A 2XGDA 5EZHA 3BG3A 1HOMA 2FD5A 3ZOBA 1VI0A 2ECBA 1MBKA 3TW7A 4RDUA 3RZDJ 3GTQJ 5IP6A 2R0QC 2G7LA 5M3MJ 2NP3A 1BL0A 2HOTA 2CUEA 5CXGA 1E3OC 3C2BA 3HM5A 4IHYA 4DYCA 1B8IB 3VVYA 5EF6A 3TEDA 5C4YA 3LSPA 1IC8A 1OFCX 5GPCA 1MBFA 2RAEA 2RASA 5EGOA 1MBGA 1WGXA 2DTZA 5M5WJ 2Y2ZA 5DAJA 2E2IJ 2K9NA 3HKZN 3O8HA 3QQAA 3ZQCA 3ZQHA 1B72B 3Q0VA 2ZCMA 3F1BA 1QRYA 1A5JA 2ELKA 1HLVA 1MSFC 4BBSJ 1RESA 2EZKA 2VKVA 4C3JJ 2DMNA 3HOXJ 2DMQA 3IH2A 3G1MA 3GTLJ 3LHQA 4A3EJ 2YU9J 2CQXA 1O4XA 1A6IA 1GVDA 5IP7J 4IHWA 2FBQA 3A01A 1WCMJ 2G7SA 2I10A 5FKLA 4GFBA 5D1RA 4RBOA 2XDNA 2DG8A 3BRUA 2JK3A 2JWTA 1F43A 2M0CA 2R93J 1UG2A 2UXUA 2CJJA 1ETKA 4BKXA 2UXPA 3RD3A 1JT6A 2TCTA 1PUFA 5EGOB 2CRGA 2M2EA 5FKNA 4X6AJ 2OPTA 2DG7A 1OCPA 2AHQA 2GUHA 2GBYA 5C3EJ 2DMTA 2NS8A 3NAUA 4XICA 1K61A 3PASA 1RR7A 3VPRA 3HOUJ 3VW0A 3F0CA 3S2DJ 3FK7A 3HOYJ 1H8AC 1ETYA 2FQ4A 2K9SA 3VIBA 1D5YA 3BTJA 2UXOA 1MBJA 2HKUA 1BW6A 1ETXA 2ID6A 3CDLA 1I3QJ 3ZQLA 1BA5A 3FRQA 2QCOA 2NS7A 2MSYA 3LOCA 5J1YA 1MH4A 5IYBJ 3BG9A 3MVPA 1ETQA 1AKHA 2ZCNA 1PUFB 3PO2J 1ETVA 3GTMJ 3BTLA 2GLOA 2R5YB 1XG1A 4XRSG 3M4OJ 4MK6A 1ETOA 3BG5A 5M5YJ 1U9OA 2NX4A 3KNWA 3IUVA 3V78A 3S5RA 4QSHA 3FIWA 4DZPA 2GENA 5K58A 3BR3A 3O8GA 3WHCA 3QPSA 5F1JA 4A3GJ 1TWFJ 3QPLA 3JRBA 3ANPA 2UXHA 5IYCJ 3K2AA 5F0CA 3UKGA 5JLWA 1S7EA 5EFYA 3AQTA 3FISA 2CQQA 3SFIA 3CWRA 2HI3A 5IP9J 4FCYA 4MO7A 1APLC 3PPBA 1JGGA 5CW8A 2X9DA 4AYBN 2DMPA 3LNQA 3Q0WA 1AKHB 2LKXA 2PZ9A 1FTZA 1Q1VA 2VKEA 4UUSB 3TW6A 3GTPJ 1ZGWA 1VFCA 2NVQJ 1JTXA 1B8IA 4FE7A 3G1LA 4M3DA 3S1MJ 3JRAA 2ECCA 4JX4A 3I4MJ 3E7QA 3T6NA 4LOCA 3DPJA 3V6GA 5EG0A 1SFOJ 2QOPA 2QWTA 2OF7A 2Y0SN 1JT0A 2NVTJ 3C07A 2R92J 2L7ZA 3PO3J 5D18A 1XC5A 4MIMA 2QIBA 2MG4A 5C4XJ 4V2FA 5K7FA 4I6ZA 4A3MJ 3S14J 4NDLA 2WB1N 5IPAA 3HDDA 3M3YJ 1HDPA 1LFUP 4XK4A 4AC0A 2JMWA 2K9QA 1MSEC 3LSJA 4D7MA 3GTOJ 1HCRA 2B63J 2DA4A 5E3OA 1OCTC 2REKA 1UI5A 5HBUA 1YRNA 3HEFA 3VUQA 1Y1VJ 2X6OA 2HYTA 2MGQA 4M3FA 4JNNA 2HOAA 1RKTA 5E3MA 1JUMA 2DA5A 3ZQIA 3JREA 4A3JJ 5FMPA 2CU7A 1MNMC 4MLOA 4HNVA 4J19A 1JJ6C 2XGEA 1IDZA 4EEFG 3BTCA 1U9NA 3SDGA 5J3LA 2F07A 1IV6A 3HGYA 3OSFA 5F0HA 3CQZJ 3HTIA 4XRSA 3VVZA 3HOWJ 1BJZA 2O9LA 1LE8A 1LFBA 2XB5A 4ME9A 2AO9A 1H88C 2QKOA 4JX5A 1ZR2A 3ZQGA 3S1NJ 5F04A 1ENHA 4D7NA 2LTPA 5FLMJ 2OI8A 1TWGJ 2GFNA 4B3AA 2O8KA 5FJ8J 4DYRA 4GCLA 2E2JJ 3BR2A 2H8RA 2G0EA 4GFKA 2DMUA 4M3GA 1ITYA 1MBEA 5C4JJ 1IUFA 1Z0XA 3RKQA 5EZGA 5C44J 1TWHJ 5K7HA 3IV5A 1TWAJ 3JRHA 3Q3SA 1FIAA 5HAWA 1WH5A 2LVSA 5EYRA 2M9HA 1CQTA 1I50J 1FEXA 3OSGA 4JL3A 1FJLA 3HOZJ 3S17J 5M3FJ 2MW8A 3HE0A 2LK2A 5K7ZA 1RKWA 1GV5A 2HQ5A 3NARA 5GPAA 3NRGA 1MH3A 4A3LJ 1GUUA 1W0TA 2DA2A 2IBDA 3VP5A 2XRLA 1T56A 3BCGA 3COLA 3QKXA 1IG7A 2LD5A 3OIOA 4ACIA 5FGLA 3VOXA 2P81A 2VI6A 1JKRC 1R9TJ 3G1OA 3JRDA 4IEJA 4BY7J 1QPIA 1JJ8C 2NVXJ 3G7RA 4MXMA 3GTKJ 3JRCA 3RQIA 3IH3A 1WPKA 2R7ZJ 2ZOZA 3GZIA 4A3DJ 4L62A 2KT0A 1IJWC 3S1QJ 1WH7A 2L7MP 2FX0A 4A69C 5J1RA 1AU7A 2IEKA 2Y30A 1JUPA 2XGCA 2YS9A 5FKMA 4JKZA 4W97A 3MNLA 5E3NA 4AF5A 1RETA 2IAIA 3P9TA 4I76A 1POGA 3GTJJ 2LY9A 2L9RA 3EUPA 1JTYA 1X58A 4M6VA 3D1NI 3ANGA 4L5EA 4XIDA 1I6HJ 1U78A 3VOKA 4D5CA 3BJBA 2CUFA 3NXCA 2KDZA 2VUMJ 3JSJA 1QVTA 2QF7A 1GDTA 1W0UA 2PBXA 5F0FA 2EQRA 2RHAA 2FJ1A 2E2HJ 3S1RJ 3LWJA 1QVUA 2QTQA 2DA7A 3RZOJ 2W48A 2Y9YA 3BTIA 2L7FP 3JRIA 4FTHA 1VF9A 3H0GJ 3DEWA 3HTHA 2DJNA 2Y31A 2ID3A 4S0HB 3KKDA 3HBLA 3BR6A 2E1OA 4PXIA 5FHPA 2XPWA 5DS9A 4GFLA 2NOGA 2UXIA 2NP5A 2YUSA 1P7JA 4M3BA 2V57A 4V2GA 2LLKA 2H1KA 1JKPC 4QIWN 2Y9ZA 4HKUA 1IDYA 5FLVA 1ZTRA 2VPRA 3HTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DTD A;  3BR1 A;  3WHB A;  5IYD J;  3CCY A;  3JR9 A;  1XS9 A;  3HGG A;  3ON4 A;  4NN1 A;  2EZH A;  3BT9 A;  3HOV J;  5FKO A;  1JKO C;  3H3V K;  3RH2 A;  1K83 J;  5CXI A;  1ORK A;  4XRM A;  2G3B A;  2XSD C;  2OER A;  3B6A A;  2HOS A;  2WUI A;  5D19 A;  2G7G A;  1TC3 C;  1UI6 A;  1NK2 P;  3FK6 A;  2GM4 A;  2W53 A;  3KKC A;  4Y52 J;  3VW1 A;  2L0K A;  5M5X J;  4CYC A;  1NK3 P;  4JYK A;  3L1P A;  2ZB9 A;  4MFE A;  3BQY A;  3BR5 A;  1DU6 A;  1VND A;  2XB0 X;  3SJM A;  4UUT A;  2R5Y A;  4A3I J;  2JJ7 A;  1IGN A;  3S15 J;  3VVX A;  1ZKG A;  1EF4 A;  3LSG A;  4BBR J;  4C3I J;  4G12 A;  4FE4 A;  3I4N J;  1G2H A;  4UDS A;  2YVE A;  4M3E A;  3BHQ A;  1ZR4 A;  4NEL A;  2ME0 A;  4AUX A;  1JUS A;  2WV1 A;  4BY1 J;  4DYQ A;  3NI7 A;  5H9T A;  1RPW A;  4C2M J;  3MKL A;  1B72 A;  3NPI A;  3BR0 A;  1NTC A;  1YRN B;  3OOU A;  4A3K J;  1HF0 A;  2IU5 A;  2M34 A;  3BQZ A;  2DA6 A;  4UUS A;  4A93 J;  4QTR A;  1X2N A;  2D6Y A;  1HDD C;  2ME6 A;  1P7I A;  3QBM A;  2Q24 A;  3W6V A;  3NNR A;  1Z77 A;  5F27 A;  3TP3 A;  2JN6 A;  2EH3 A;  5HSZ A;  1WI3 A;  2DN0 A;  1GV2 A;  3GBG A;  4DW6 A;  1ZQ3 P;  4DZJ A;  2JA8 J;  1SGM A;  5EDN A;  1UMQ A;  4ABZ A;  2JA7 J;  5J1U A;  1JKQ C;  3S2H J;  2COB A;  2O7T A;  4A3B J;  4CGR A;  2JA6 J;  4W1U A;  5JLX A;  3S16 J;  4B4C A;  2N8G A;  2HDD A;  3AQS A;  4GCT A;  4JX6 A;  3TP0 A;  2K40 A;  3JRG A;  2D5V A;  2DA3 A;  3ON2 A;  3DCF A;  2EBI A;  1IRZ A;  3CJD A;  3FKI J;  2XPU A;  3LSR A;  4A3C J;  4D5F A;  1OJL A;  1X2M A;  2WAQ N;  3HB9 A;  9ANT A;  1F36 A;  2ZOY A;  1FIP A;  2O7O A;  1U8B A;  2EZL A;  2NVY J;  4IHX A;  5EG0 B;  5F08 A;  1GT0 C;  5EEA A;  2LFB A;  1Y1W J;  1MBH A;  3EGQ A;  3GTG J;  2HXI A;  2TRT A;  3A03 A;  4X1E A;  3B6C A;  4GCK A;  1UHS A;  3BNI A;  2EZI A;  5FKK A;  5IOY A;  4B1R A;  4AC6 A;  4IHV A;  2HXO A;  3G56 A;  2LP0 A;  3ZQF A;  4ICH A;  1ZK8 A;  2R5Z A;  5AQC A;  3CMY A;  4BXX J;  2XPV A;  3VW2 A;  2M8G X;  2YVH A;  2R5Z B;  2HYJ A;  2LR8 A;  4Y7N J;  3K7A J;  1H89 C;  2PMZ N;  3PM1 A;  3MN2 A;  3GEU A;  3E7L A;  3IH4 A;  4A3F J;  1DU0 A;  2JA5 J;  3Q0U A;  3A01 B;  1AHD P;  1LE8 B;  2DA1 A;  4MFD A;  4C3H J;  2WGB A;  3CRJ A;  1SAN A;  2ZCX A;  1T33 A;  2E19 A;  4FIS A;  5HOD A;  4KWA A;  5GP9 A;  3JRF A;  3KZ9 A;  1FTT A;  4JP0 A;  4YZE A;  1BW5 A;  5BNG A;  3A02 A;  5IOZ A;  3HTJ A;  3O60 A;  3LJL A;  3B81 A;  5E3L A;  1TWC J;  1ETW A;  4CYC B;  3HIM A;  2X48 A;  2XGD A;  5EZH A;  3BG3 A;  1HOM A;  2FD5 A;  3ZOB A;  1VI0 A;  2ECB A;  1MBK A;  3TW7 A;  4RDU A;  3RZD J;  3GTQ J;  5IP6 A;  2R0Q C;  2G7L A;  5M3M J;  2NP3 A;  1BL0 A;  2HOT A;  2CUE A;  5CXG A;  1E3O C;  3C2B A;  3HM5 A;  4IHY A;  4DYC A;  1B8I B;  3VVY A;  5EF6 A;  3TED A;  5C4Y A;  3LSP A;  1IC8 A;  1OFC X;  5GPC A;  1MBF A;  2RAE A;  2RAS A;  5EGO A;  1MBG A;  1WGX A;  2DTZ A;  5M5W J;  2Y2Z A;  5DAJ A;  2E2I J;  2K9N A;  3HKZ N;  3O8H A;  3QQA A;  3ZQC A;  3ZQH A;  1B72 B;  3Q0V A;  2ZCM A;  3F1B A;  1QRY A;  1A5J A;  2ELK A;  1HLV A;  1MSF C;  4BBS J;  1RES A;  2EZK A;  2VKV A;  4C3J J;  2DMN A;  3HOX J;  2DMQ A;  3IH2 A;  3G1M A;  3GTL J;  3LHQ A;  4A3E J;  2YU9 J;  2CQX A;  1O4X A;  1A6I A;  1GVD A;  5IP7 J;  4IHW A;  2FBQ A;  3A01 A;  1WCM J;  2G7S A;  2I10 A;  5FKL A;  4GFB A;  5D1R A;  4RBO A;  2XDN A;  2DG8 A;  3BRU A;  2JK3 A;  2JWT A;  1F43 A;  2M0C A;  2R93 J;  1UG2 A;  2UXU A;  2CJJ A;  1ETK A;  4BKX A;  2UXP A;  3RD3 A;  1JT6 A;  2TCT A;  1PUF A;  5EGO B;  2CRG A;  2M2E A;  5FKN A;  4X6A J;  2OPT A;  2DG7 A;  1OCP A;  2AHQ A;  2GUH A;  2GBY A;  5C3E J;  2DMT A;  2NS8 A;  3NAU A;  4XIC A;  1K61 A;  3PAS A;  1RR7 A;  3VPR A;  3HOU J;  3VW0 A;  3F0C A;  3S2D J;  3FK7 A;  3HOY J;  1H8A C;  1ETY A;  2FQ4 A;  2K9S A;  3VIB A;  1D5Y A;  3BTJ A;  2UXO A;  1MBJ A;  2HKU A;  1BW6 A;  1ETX A;  2ID6 A;  3CDL A;  1I3Q J;  3ZQL A;  1BA5 A;  3FRQ A;  2QCO A;  2NS7 A;  2MSY A;  3LOC A;  5J1Y A;  1MH4 A;  5IYB J;  3BG9 A;  3MVP A;  1ETQ A;  1AKH A;  2ZCN A;  1PUF B;  3PO2 J;  1ETV A;  3GTM J;  3BTL A;  2GLO A;  2R5Y B;  1XG1 A;  4XRS G;  3M4O J;  4MK6 A;  1ETO A;  3BG5 A;  5M5Y J;  1U9O A;  2NX4 A;  3KNW A;  3IUV A;  3V78 A;  3S5R A;  4QSH A;  3FIW A;  4DZP A;  2GEN A;  5K58 A;  3BR3 A;  3O8G A;  3WHC A;  3QPS A;  5F1J A;  4A3G J;  1TWF J;  3QPL A;  3JRB A;  3ANP A;  2UXH A;  5IYC J;  3K2A A;  5F0C A;  3UKG A;  5JLW A;  1S7E A;  5EFY A;  3AQT A;  3FIS A;  2CQQ A;  3SFI A;  3CWR A;  2HI3 A;  5IP9 J;  4FCY A;  4MO7 A;  1APL C;  3PPB A;  1JGG A;  5CW8 A;  2X9D A;  4AYB N;  2DMP A;  3LNQ A;  3Q0W A;  1AKH B;  2LKX A;  2PZ9 A;  1FTZ A;  1Q1V A;  2VKE A;  4UUS B;  3TW6 A;  3GTP J;  1ZGW A;  1VFC A;  2NVQ J;  1JTX A;  1B8I A;  4FE7 A;  3G1L A;  4M3D A;  3S1M J;  3JRA A;  2ECC A;  4JX4 A;  3I4M J;  3E7Q A;  3T6N A;  4LOC A;  3DPJ A;  3V6G A;  5EG0 A;  1SFO J;  2QOP A;  2QWT A;  2OF7 A;  2Y0S N;  1JT0 A;  2NVT J;  3C07 A;  2R92 J;  2L7Z A;  3PO3 J;  5D18 A;  1XC5 A;  4MIM A;  2QIB A;  2MG4 A;  5C4X J;  4V2F A;  5K7F A;  4I6Z A;  4A3M J;  3S14 J;  4NDL A;  2WB1 N;  5IPA A;  3HDD A;  3M3Y J;  1HDP A;  1LFU P;  4XK4 A;  4AC0 A;  2JMW A;  2K9Q A;  1MSE C;  3LSJ A;  4D7M A;  3GTO J;  1HCR A;  2B63 J;  2DA4 A;  5E3O A;  1OCT C;  2REK A;  1UI5 A;  5HBU A;  1YRN A;  3HEF A;  3VUQ A;  1Y1V J;  2X6O A;  2HYT A;  2MGQ A;  4M3F A;  4JNN A;  2HOA A;  1RKT A;  5E3M A;  1JUM A;  2DA5 A;  3ZQI A;  3JRE A;  4A3J J;  5FMP A;  2CU7 A;  1MNM C;  4MLO A;  4HNV A;  4J19 A;  1JJ6 C;  2XGE A;  1IDZ A;  4EEF G;  3BTC A;  1U9N A;  3SDG A;  5J3L A;  2F07 A;  1IV6 A;  3HGY A;  3OSF A;  5F0H A;  3CQZ J;  3HTI A;  4XRS A;  3VVZ A;  3HOW J;  1BJZ A;  2O9L A;  1LE8 A;  1LFB A;  2XB5 A;  4ME9 A;  2AO9 A;  1H88 C;  2QKO A;  4JX5 A;  1ZR2 A;  3ZQG A;  3S1N J;  5F04 A;  1ENH A;  4D7N A;  2LTP A;  5FLM J;  2OI8 A;  1TWG J;  2GFN A;  4B3A A;  2O8K A;  5FJ8 J;  4DYR A;  4GCL A;  2E2J J;  3BR2 A;  2H8R A;  2G0E A;  4GFK A;  2DMU A;  4M3G A;  1ITY A;  1MBE A;  5C4J J;  1IUF A;  1Z0X A;  3RKQ A;  5EZG A;  5C44 J;  1TWH J;  5K7H A;  3IV5 A;  1TWA J;  3JRH A;  3Q3S A;  1FIA A;  5HAW A;  1WH5 A;  2LVS A;  5EYR A;  2M9H A;  1CQT A;  1I50 J;  1FEX A;  3OSG A;  4JL3 A;  1FJL A;  3HOZ J;  3S17 J;  5M3F J;  2MW8 A;  3HE0 A;  2LK2 A;  5K7Z A;  1RKW A;  1GV5 A;  2HQ5 A;  3NAR A;  5GPA A;  3NRG A;  1MH3 A;  4A3L J;  1GUU A;  1W0T A;  2DA2 A;  2IBD A;  3VP5 A;  2XRL A;  1T56 A;  3BCG A;  3COL A;  3QKX A;  1IG7 A;  2LD5 A;  3OIO A;  4ACI A;  5FGL A;  3VOX A;  2P81 A;  2VI6 A;  1JKR C;  1R9T J;  3G1O A;  3JRD A;  4IEJ A;  4BY7 J;  1QPI A;  1JJ8 C;  2NVX J;  3G7R A;  4MXM A;  3GTK J;  3JRC A;  3RQI A;  3IH3 A;  1WPK A;  2R7Z J;  2ZOZ A;  3GZI A;  4A3D J;  4L62 A;  2KT0 A;  1IJW C;  3S1Q J;  1WH7 A;  2L7M P;  2FX0 A;  4A69 C;  5J1R A;  1AU7 A;  2IEK A;  2Y30 A;  1JUP A;  2XGC A;  2YS9 A;  5FKM A;  4JKZ A;  4W97 A;  3MNL A;  5E3N A;  4AF5 A;  1RET A;  2IAI A;  3P9T A;  4I76 A;  1POG A;  3GTJ J;  2LY9 A;  2L9R A;  3EUP A;  1JTY A;  1X58 A;  4M6V A;  3D1N I;  3ANG A;  4L5E A;  4XID A;  1I6H J;  1U78 A;  3VOK A;  4D5C A;  3BJB A;  2CUF A;  3NXC A;  2KDZ A;  2VUM J;  3JSJ A;  1QVT A;  2QF7 A;  1GDT A;  1W0U A;  2PBX A;  5F0F A;  2EQR A;  2RHA A;  2FJ1 A;  2E2H J;  3S1R J;  3LWJ A;  1QVU A;  2QTQ A;  2DA7 A;  3RZO J;  2W48 A;  2Y9Y A;  3BTI A;  2L7F P;  3JRI A;  4FTH A;  1VF9 A;  3H0G J;  3DEW A;  3HTH A;  2DJN A;  2Y31 A;  2ID3 A;  4S0H B;  3KKD A;  3HBL A;  3BR6 A;  2E1O A;  4PXI A;  5FHP A;  2XPW A;  5DS9 A;  4GFL A;  2NOG A;  2UXI A;  2NP5 A;  2YUS A;  1P7J A;  4M3B A;  2V57 A;  4V2G A;  2LLK A;  2H1K A;  1JKP C;  4QIW N;  2Y9Z A;  4HKU A;  1IDY A;  5FLV A;  1ZTR A;  2VPR A;  3HTA A; 
#chains in the Genus database with same CATH topology
 3BR1 A;  1GLN A;  2WV0 A;  3JR9 A;  2JUC A;  2GXB A;  3BT9 A;  4D9J A;  4ZYG A;  2ESN A;  2IP2 A;  1JKO C;  3H3V K;  5E17 F;  2BGC A;  4Y15 A;  3OL4 A;  4AVZ A;  2G3B A;  2F4M B;  2XSD C;  2KLO A;  4XN3 A;  4HST A;  2XKP A;  5CJ9 A;  4EM0 B;  1OQY A;  2KIU A;  4PJJ A;  4AU7 A;  3KKC A;  2B0L A;  3HUG B;  5M5X J;  1BI3 A;  1NK3 P;  2VJ4 A;  1QPM A;  3OYL A;  4M6Y A;  5K5Q A;  5D5X B;  4ZH4 F;  2FE3 A;  1DP7 P;  1DU6 A;  4EJU A;  2BVM A;  1JHH A;  2L54 A;  2DYR H;  4UUT A;  2JJ7 A;  1OCR H;  5ILS A;  4XBF A;  3V7S A;  2W85 A;  4BBR J;  1FYM A;  2PJR B;  3I4N J;  3SZG A;  3HTS B;  4NEL A;  2VC0 A;  1ZYR F;  3OYE A;  4KYW A;  2WV1 A;  4LG0 A;  1S9H A;  4BY1 J;  2B3W A;  2CW7 A;  4UNO A;  4F92 B;  2E35 A;  1YIJ I;  1X1B A;  3DPL C;  2R7U A;  1B72 A;  2IS1 A;  4BL0 B;  2A3S A;  3BR0 A;  4AID A;  1W36 C;  2VOP A;  3KZY A;  3PQK A;  3OOU A;  4KN4 X;  2CW8 A;  2P8T A;  4BQQ A;  4O6J A;  2LKS A;  4IQ4 A;  4HAM A;  1D0Z A;  2ME6 A;  2WA0 A;  5F64 A;  1UST A;  1Y8R B;  2EH3 A;  3Q9V A;  1YJ9 I;  3QU3 A;  1U5T C;  1R71 A;  1GV2 A;  4LLN A;  3QAH A;  4DZJ A;  1OIS A;  1IXS B;  3CJN A;  3K9T A;  2RNG A;  1UMQ A;  3HC7 A;  4L9V A;  2KQR A;  4ZJZ A;  1U5T B;  5J1U A;  3GZ6 A;  1JKQ C;  2COB A;  2P5K A;  4CGR A;  3DKY A;  1K6O A;  2JA6 J;  3COA C;  3TQN A;  4CXF A;  3S16 J;  2N8G A;  1F5T A;  2K40 A;  4RGU A;  2D5V A;  2DA3 A;  3FBI B;  4N4N B;  2P5L C;  1IRZ A;  2Z2S B;  2F4I A;  3RYR A;  3LSR A;  2ZNZ A;  3FDY A;  1N25 A;  2IGN A;  1WJA A;  9ANT A;  1F36 A;  3CDH A;  1B9M A;  1D1A A;  1U8B A;  2EZL A;  2BY0 A;  2CGP A;  3WG9 A;  1UHM A;  3JAM Z;  2LFB A;  4BDZ A;  4CA0 A;  1MBH A;  1BIB A;  2HXI A;  2TRT A;  3BZC A;  3R0J A;  3E1S A;  1UHS A;  1EH7 A;  2BBY A;  3CES A;  3KX2 A;  2XF7 A;  1TP4 A;  3WU0 A;  1J09 A;  2KFD A;  2LP0 A;  3L2W A;  3G2B A;  1ZK8 A;  5CVU A;  2YPR A;  3FF5 A;  3DTK A;  3DLA A;  1O3S A;  2M8G X;  2R5Z B;  4RAZ A;  1OR7 A;  1H89 C;  2XDV A;  3KET A;  2L9N A;  4DBQ A;  3IH4 A;  4GXO A;  4CZZ A;  2W00 A;  4WX9 A;  3BPX A;  2XV4 S;  3ERM A;  1BOB A;  3S93 A;  4U0Y A;  3CCJ I;  4HQE A;  3DXJ F;  3JRF A;  2XAH A;  4KWA A;  3C3W A;  3C2H A;  1BJA A;  4Q48 A;  2H1L A;  4HPQ A;  5BNG A;  3LL7 A;  2D2W A;  5E8I A;  2IT0 A;  4CGZ A;  4NBQ A;  4NUB A;  5IY5 H;  2EA4 A;  4BXF A;  2LY1 A;  1ETW A;  4CYC B;  3HIM A;  2X48 A;  2H8W A;  4Y17 A;  5JHU A;  1QGP A;  2CFX A;  2LDU A;  1HOM A;  1J59 A;  3OOP A;  4RDU A;  3GTQ J;  3KP3 A;  5IP6 A;  5J8F A;  2HOT A;  2CUE A;  2IS2 A;  4GCV A;  4LIV A;  5ICC A;  5CYV A;  3OYJ A;  1MDM B;  2X1C A;  2HPM A;  1XGN A;  2OD5 A;  5GPC A;  2RAS A;  2RAE A;  3DKX A;  2DBB A;  1D0X A;  1MBG A;  5EGO A;  1FX7 A;  1WGX A;  1XCB A;  1W36 D;  2JRT A;  2E2I J;  4HNU A;  3ZQC A;  2M5W A;  3KIO A;  3Q0V A;  3WG7 H;  5A2Q K;  2VN2 A;  1RR8 C;  1G3Y A;  4M9Z A;  3IH2 A;  3GTL J;  2RNJ A;  2YU9 J;  5HS9 A;  2CO5 A;  4BQO A;  4NC8 A;  2ISY A;  2DT5 A;  3CLO A;  2FBQ A;  3A01 A;  4RM2 A;  4RGS A;  5FKL A;  1MD0 A;  1SVO A;  2PX9 A;  3CO7 C;  4G94 A;  3ABU A;  3K1P A;  4RBO A;  2KRF A;  3J7Z I;  2VB6 A;  1OCO H;  4RLQ A;  1W7P B;  2ZSH B;  3HSF A;  1J7K A;  3I56 I;  4KT6 A;  1H9G A;  4IZZ A;  1JT6 A;  3BJ6 A;  3FZV A;  1YIO A;  3KYC B;  2CRG A;  2HTJ A;  2L9S A;  2M2E A;  3ZMV A;  2OPT A;  1SFE A;  4XLH A;  5LD2 C;  2GBY A;  2GUH A;  1VQN I;  2EV0 A;  2FQ3 A;  1E3H A;  3ISP A;  1M1E B;  2R7F A;  1OYY A;  2LMD A;  2D1V A;  2GXA A;  4PFO A;  2K9S A;  2LG4 A;  1O57 A;  1U0J A;  2UXO A;  2A68 F;  4MNU A;  1BW6 A;  2HVQ A;  2QWW A;  4U87 A;  4YII A;  3J80 Z;  1YIT I;  2RC4 A;  3TGN A;  1N78 A;  3RSN A;  3F8C A;  2NS7 A;  1D5V A;  3KP6 A;  4PCQ A;  1ZRF A;  1E0E A;  4XR6 A;  3CJQ B;  3P9K A;  3OMY A;  4XOP A;  1FOX A;  2JA2 A;  2FOK A;  3BG9 A;  4XOR A;  1PUF B;  1VTN C;  2ZKZ A;  2GOX B;  1BIA A;  5DDG A;  4OWR B;  4CCJ A;  1K78 B;  4XSZ F;  3M4O J;  1X1C A;  3BG5 A;  4CDG A;  4FET A;  3HSR A;  5M5Y J;  1U9O A;  4ZC3 A;  1IN7 A;  2NX4 A;  4G6Q A;  3IUV A;  3HPH A;  3ONQ A;  3LWF A;  5K58 A;  3I58 A;  3MKZ A;  2EWN A;  5D5U B;  4A3G J;  4ITV A;  5F0C A;  1Z05 A;  3AQT A;  2CQQ A;  1RRJ A;  5IP9 J;  4FCY A;  1Y0N A;  2VON A;  1APL C;  4HX8 A;  1XDU A;  3UNG C;  1OR7 C;  2X9D A;  4PDK A;  1EH6 A;  4GYG A;  5CVI A;  4LLL A;  1XN7 A;  3DU5 A;  4UUS B;  3TMO A;  2UZK A;  2XGX A;  4KN7 X;  2ZXW H;  1P6R A;  1VQK I;  2DDA A;  3MMY B;  4FE7 A;  2GIV A;  4JX4 A;  1R23 A;  3LAP A;  3I4M J;  3E7Q A;  3G73 A;  2UWM A;  3DPJ A;  3V6G A;  1Z3X A;  5EG0 A;  1SFO J;  3C1D A;  3KP4 A;  4EJV A;  2NVT J;  2P7V B;  4BJ5 C;  2L7Z A;  3PO3 J;  2IXS A;  3PNT A;  3FM3 A;  2VBX A;  3DV8 A;  3E3V A;  3WU2 C;  3PSI A;  3J81 K;  3JCU C;  3WTT C;  4A3M J;  4HF0 A;  3S14 J;  2VQH A;  2ZXI A;  1X19 A;  2H6B A;  5IPA A;  3HDD A;  1HBX G;  5HDG A;  4ENN A;  3K4M A;  2JMW A;  1IN6 A;  4D7M A;  2XIG A;  4BYY A;  2DA4 A;  1OCT C;  5E1X A;  3OYF A;  2LF7 A;  4KIS A;  1T39 A;  1E2X A;  2E71 A;  2QGU A;  4DJA A;  1Y1V J;  3VUQ A;  4OIP F;  3HRU A;  3CZ6 A;  5F1R A;  4JNN A;  2DA5 A;  2YX7 A;  3IUO A;  3ZQI A;  1A04 A;  2QVO A;  5FMP A;  3UR3 C;  1R6R A;  2MA3 A;  2RDP A;  2V4J C;  3IAS 2;  4L9N A;  3GFM A;  1LDD A;  1TQI A;  3EUA A;  1IV6 A;  3OSF A;  3M8F A;  4LFU A;  2G7H A;  4D1Q A;  1D3Y A;  5F0H A;  2RV8 A;  3CQZ J;  1YFH A;  1JHF A;  2L2O A;  3L09 A;  4PFP A;  2O9L A;  1DGW Y;  1LFB A;  3S2W A;  1LNW A;  2QKO A;  1S7A A;  1I3A A;  2X6W A;  3S1N J;  3K6G A;  1ENH A;  1OYI A;  2ZCW A;  1WJC A;  2V6C A;  1T0F C;  2LTP A;  4D7N A;  2ISZ A;  2O3F A;  1YW7 A;  4B3A A;  1YI2 I;  4J00 A;  5FJ8 J;  1N77 A;  4GCL A;  2OCC H;  2H8R A;  2FBH A;  5HDK A;  1TBX A;  2E5Z A;  2DMU A;  2LBF A;  3QOD A;  4M72 A;  3OIP A;  1TWH J;  1TQM A;  5LFA A;  3O3K A;  1BI0 A;  2AXT C;  3A1Y A;  3Q5F A;  4BGD A;  1F4K A;  1FIA A;  5EYR A;  1CQT A;  2M9H A;  4XL9 A;  1I50 J;  1GVJ A;  3T0Y A;  4ZZL A;  4KMU X;  4HSR A;  3HOZ J;  4H4K C;  1ZRE A;  2MW8 A;  3C18 A;  2LK2 A;  4I0A A;  2LNB A;  2W84 A;  4AIJ A;  2BHY A;  1RKW A;  4NB5 A;  1GV5 A;  2HQ5 A;  4RA2 A;  4UUV A;  1GUU A;  4QWQ A;  3AG2 H;  2KRC A;  2XRL A;  3GXO A;  2KL4 A;  4CCO A;  2QBY B;  3COL A;  4B3X A;  1D0Y A;  4ACI A;  2P81 A;  5KHD A;  2L7K A;  2Q2E B;  2MD0 A;  4I0B A;  4XKC A;  1VQ9 I;  3JRD A;  2R7S A;  4XLE A;  4IEJ A;  5DCM B;  2XUB A;  4Y4R A;  2R4G A;  2BEO A;  1PP8 F;  1SD7 A;  2YX4 A;  1NHA A;  3V4G A;  4L9J A;  4KIC A;  1BI2 A;  3RQI A;  3VSL A;  4MTD A;  3ABL H;  1QHH D;  2R7Z J;  4L62 A;  3CJT B;  1IJW C;  3FXK A;  4LJZ F;  3O6B B;  4ZDP A;  2F5C A;  1WH7 A;  3WGG A;  2DT7 B;  2DO7 A;  3E5X A;  2XAQ A;  5E1W A;  3V8L A;  4XN0 A;  4WWC A;  2XAS A;  2QSG X;  2IGO A;  2YS9 A;  4JKZ A;  3MNL A;  2DQR A;  5E3N A;  1RET A;  1X3W B;  3P9T A;  2LY9 A;  3N4M A;  4M6V A;  4XID A;  1I6H J;  4Y3O A;  3I5U A;  2OUM A;  3KZZ A;  3BCB A;  1H9T A;  2JVH A;  4RGX A;  2VUM J;  3L2U A;  3F6V A;  1QVT A;  3FKJ A;  2LRE A;  5JHF A;  1HC8 A;  2O61 A;  2OJE D;  2EV5 A;  5F0F A;  2X85 A;  1G8X A;  1S7O A;  2FJ1 A;  1G3T A;  3GUD A;  3V42 A;  5IT3 A;  1NH3 A;  2E2H J;  3PL8 A;  2QTQ A;  4HV6 A;  4I99 C;  1YW8 A;  1I5Z A;  4ASN A;  3RZO J;  4HOB A;  2Y9Y A;  5HS8 A;  1XTA A;  2RGV A;  2L7F P;  4OOI A;  5BPD A;  4IHT A;  1EV7 A;  4C2T A;  1FYK A;  1A31 A;  2Y31 A;  3W6K B;  2ID3 A;  5GAE J;  3KKD A;  3CP2 A;  1HKS A;  2HZD A;  3BR6 A;  3HBL A;  5FHP A;  2XPW A;  4KIF A;  3FXR A;  3GEZ A;  5J40 A;  4C9Y A;  2R7R A;  1P7J A;  4EV0 A;  1HW1 A;  2O03 A;  4IVN A;  2FU4 A;  4CUG A;  1W5C C;  2OC6 A;  3DWL E;  1HW2 A;  2Y9Z A;  4ENM A;  1IDY A;  4D0P A;  4LD5 A;  4Y7N J;  1KYZ A;  5DTD A;  3CUQ C;  3PNV A;  3CCY A;  3HGG A;  2Q2E A;  1U5T A;  3ON4 A;  2RN7 A;  4DIQ A;  4KT5 C;  2X6Y A;  2PMH A;  4I2O A;  2CH0 A;  1XCV A;  1K83 J;  5CXI A;  2IVM A;  1ORK A;  4XRM A;  4PJM A;  4N0B A;  1R1U A;  3IC7 A;  1Y8Q B;  2W7N A;  1FOY A;  2VT2 A;  2GM4 A;  2W53 A;  1ON1 A;  5E18 F;  4FQG A;  3DEU A;  2L0K A;  3T8R A;  2Z33 A;  4G8X A;  4CYC A;  2JTV A;  4JYK A;  2IRF G;  1SVL A;  1K4S A;  2VPL A;  2VIX A;  1EH8 A;  1VND A;  2XB0 X;  3PQJ A;  5ERI A;  1JXS A;  2K7L A;  4XM3 A;  2UV1 A;  2HVS A;  1IRG A;  3VVX A;  4FE4 A;  4UDS A;  3I4P A;  1FOW A;  3SZT A;  5JVG F;  4B43 A;  1Z6T A;  1ZR4 A;  3OYI A;  1UAA A;  2PFV A;  1QHG A;  2A5W A;  3TO7 A;  4EJT A;  2EFW A;  4C2M J;  5LLQ A;  3WE3 A;  3NPI A;  5KNL A;  2Y0S A;  4MQV A;  4RAF A;  1G6N A;  1RZ4 A;  4IOC F;  3GME A;  3N05 A;  4CO8 A;  3BQZ A;  5JVT A;  1IW7 F;  2QSF X;  2HR3 A;  1H0M A;  1FZP B;  2A69 F;  1HDD C;  2D6Y A;  1P7I A;  2ACJ A;  1KZH A;  2ZXH A;  3NNR A;  2MAB A;  5HSZ A;  2VAS A;  3QOP A;  3VSK A;  4A6E A;  2X6X A;  4ENK A;  4NC7 A;  4XKV A;  2DN0 A;  3LA3 A;  4DW6 A;  3GO5 A;  2NNY A;  4HA8 A;  3KLN A;  3VFZ A;  5FRM A;  2NXN B;  1V55 H;  3L2V A;  4RLF A;  3HSE A;  3CMM A;  3X2Q H;  3ZMD A;  5EDN A;  2VXD A;  1CF7 A;  4KDP A;  1TZL A;  3K4K A;  4W1U A;  1YTY A;  5JLX A;  2HDD A;  4GCT A;  4JX6 A;  3QPH A;  3ON2 A;  4IRG A;  4JBA A;  4B44 A;  1QU3 A;  1MJA A;  4S04 A;  4U7D A;  1FBQ A;  3TBI A;  5HLT A;  4ZDL A;  2K86 A;  2DFE A;  4A3C J;  3PUB A;  2XHK A;  2WAQ N;  2ZNY A;  3H5R A;  2MC3 A;  2OA4 A;  1Z6R A;  4PJ0 C;  3HKZ A;  3WGH A;  3MKW B;  5EG0 B;  3ZPL A;  4XLC A;  1GT0 C;  2P0W A;  4R8H A;  3F72 A;  2OZ6 A;  1QO0 D;  4UV9 A;  5CKT A;  2K4B A;  2CUZ A;  1EA3 A;  3B6C A;  4X1E A;  5TGT A;  4BUP A;  2EZI A;  4K2E A;  5IOY A;  4B1R A;  1KQ8 A;  2CW0 F;  1SFK A;  1W1W E;  2K9M A;  2V9P A;  4IHV A;  4ICH A;  2A6E F;  2R5Z A;  3K69 A;  3G3Z A;  4LIT A;  4RAG A;  4N9H A;  2OU2 A;  2YVH A;  3E97 A;  4FHT A;  2LR8 A;  3IRQ A;  3K7A J;  2PMZ N;  1FP1 D;  4WXD A;  4LG0 B;  3W3C A;  1DU0 A;  3CME I;  3CCR I;  1ON2 A;  1LE8 B;  4MFD A;  4NNJ A;  2WGB A;  3OYA A;  3CRJ A;  2ZCX A;  4FIS A;  1VQL I;  5J4V A;  1Z67 A;  1FTT A;  3KZI C;  3M9A A;  1XGS A;  3DTE A;  2M87 A;  2M0M A;  1T38 A;  4QPQ A;  2QSH X;  1TWC J;  2MYS A;  2CSO A;  4XQF A;  2PFB A;  2KZG A;  3R60 A;  2LRD A;  1YS7 A;  3TW7 A;  2NP3 A;  2PG4 A;  3IKV A;  5M3M J;  2LC2 A;  1NG7 A;  1E3O C;  2ZME A;  5E79 C;  4IHY A;  5ICG A;  3FM5 A;  3CTA A;  1B8I B;  2DDB A;  3VVY A;  2VE9 A;  4Z6Y A;  3EUH A;  1LQ1 A;  1R5G A;  1WJE A;  1D1B A;  1IC8 A;  2WTE A;  4UHT A;  5CQE A;  2W57 A;  1MBF A;  2W1O A;  4UXN A;  2W25 A;  4G7Z F;  5FRO A;  4E7J A;  3GFI A;  4XKW A;  2HU9 A;  3HKZ N;  2EFP A;  2ZCM A;  5DYM A;  3DQV C;  1QRY A;  2ELK A;  2H09 A;  3HHG A;  1ACI A;  1FMW A;  1MSF C;  4BBS J;  2EZK A;  2VKV A;  1PDN C;  3HOX J;  2DMN A;  1WJF A;  3K1M A;  4Y33 A;  2X1D A;  5DM7 F;  4LK0 F;  4A3E J;  2FOW A;  2RVC A;  5IP7 J;  2Y0M A;  1BR2 A;  4IHW A;  2G7S A;  1U8R A;  2I10 A;  3HUG A;  3J7A O;  2VL8 A;  5IT9 K;  2ZJP F;  3KEY A;  2JWT A;  2CJJ A;  3HZJ A;  1LKX A;  4BKX A;  1W7P A;  1FNN A;  5EEG A;  1AWC A;  2CV0 A;  3WOD F;  3RD3 A;  4EJW A;  5FFX A;  2TCT A;  1CF7 B;  3HOT A;  4MGR A;  2DLL A;  1KA8 A;  2QYO A;  4ZYA A;  2PJR A;  1LEB A;  1A35 A;  2AHQ A;  2E1M C;  4EJO A;  5C3E J;  1FOK A;  1ZGJ A;  1K61 A;  1I27 A;  2XAF A;  3PAS A;  1DPU A;  2R7Q A;  1RR7 A;  5D6F A;  3G6E I;  1H8A C;  4L9T A;  1ETY A;  3VYR B;  3F6O A;  1F1Z A;  1KU9 A;  3P9C A;  3VIB A;  3BTJ A;  2DYS H;  3D5S C;  1O7F A;  2Q8K A;  4P1W A;  1HW5 A;  1TNS A;  2FMY A;  2RQP A;  4H0E A;  1SEU A;  1BA5 A;  3FRQ A;  2KMU A;  3VYS B;  1BI1 A;  3E6C C;  1EKE A;  1NG6 A;  2FNP A;  5HLH A;  3LOC A;  3WTZ A;  5J1Y A;  2M1B A;  4B47 A;  1MJB A;  1ETQ A;  3LFU A;  3E6M A;  5H6R A;  1DQU A;  2KZV A;  1MMN A;  3BTL A;  2MH9 A;  3ERE D;  3GTM J;  2EIN H;  2CWE A;  3E6D A;  3H35 A;  3H92 A;  1LEA A;  2W82 A;  3W2V A;  2E1C A;  3FIW A;  3BP8 A;  3RIR A;  5JI6 A;  3BR3 A;  4HZF A;  3O8G A;  3WHC A;  1Y56 A;  2Z5U A;  2STW A;  1YOV B;  3GFL A;  3QPL A;  5L3G A;  2IA2 A;  3L2Q A;  2R3S A;  3B73 A;  3H5N A;  2DOD A;  3GZ5 A;  1WRJ A;  2CUJ A;  5EFY A;  3FIS A;  1FWZ A;  2FJI 1;  4J01 A;  2HKX A;  3GCM A;  3IWF A;  3AL0 B;  3PPB A;  4OAZ A;  1JGG A;  1VZ0 A;  1FBU A;  5FGM A;  1P9Q C;  3ZQ7 A;  3EET A;  2PZ9 A;  1FTZ A;  1DDN A;  2V1X A;  2IW5 A;  4RGR A;  1QNT A;  3J81 Z;  5H6Q A;  1J5Y A;  4ZTF A;  2NVQ J;  1KU7 A;  2E7X A;  1SD5 A;  4M3D A;  4OIQ F;  3S1M J;  3JRA A;  2R7T A;  2MD5 A;  1K79 A;  3T6N A;  1XX5 A;  3OY9 A;  4ON0 A;  2QOP A;  2DAO A;  3KPH A;  4BE2 A;  2ZBK A;  5EJC A;  2Y0S N;  3IP4 B;  1JT0 A;  4V19 K;  2R92 J;  3OYC A;  4IKF A;  1SAU A;  2M4G A;  2XSJ C;  1USS A;  3DPU A;  4UVC A;  2QIB A;  3F8M A;  2JSC A;  5C4X J;  3PIO F;  5LRS A;  4HF1 A;  2CQ7 A;  3M3Y J;  1HDP A;  2XAU A;  1LFU P;  4AC0 A;  3LSJ A;  3K4J A;  4WXC A;  2REK A;  2HS5 A;  2DFF A;  3D0S A;  5D5W B;  3OV8 A;  3S32 A;  2A6H F;  4M3F A;  2BY1 A;  2HOA A;  3KE2 A;  5BPI A;  4A0X A;  1BN5 A;  3KLO A;  4LGW A;  3BDD A;  4U88 A;  2QBY A;  2QM3 A;  3BTC A;  5B1B H;  1YX5 A;  5CVR A;  3MZ8 A;  5HLI A;  3RKX A;  2E36 A;  3ECO A;  2GA2 A;  3IKT A;  3HTI A;  4HX4 A;  3HOW J;  2BYV E;  3G4S I;  2LOO A;  2L3D A;  4IXA A;  3HRM A;  2P4W A;  2AQE A;  2EIM H;  2VKD A;  3NWS A;  1H88 C;  3DEE A;  1S5L C;  2PQ8 A;  2IPQ X;  4WF2 A;  4GGG A;  3QPT A;  3ZQG A;  1GHC A;  5HS7 A;  2Z16 A;  4P96 A;  1J0R A;  1SMT A;  2Y69 H;  5CQG A;  2LBF B;  4DYR A;  2VOD A;  1X4P A;  4M3G A;  3GYH X;  4LK1 F;  2JSP A;  4BAY A;  3KYD B;  1IUF A;  1PJR A;  1Z0X A;  1SMY F;  3CUQ A;  5EZG A;  3RDI A;  4ZZD A;  5C44 J;  5K7H A;  1R4N B;  4BS9 A;  1MZB A;  3Q3S A;  3ASO H;  5HAW A;  3A4C A;  2V79 A;  2QKL B;  1FJL A;  5GAG J;  3S17 J;  2QQ9 A;  1VQM I;  4L0Y B;  2BV6 A;  1EJ9 A;  5K7Z A;  4BHP A;  3RPU D;  1W0T A;  2DA2 A;  2IBD A;  3VOD A;  2O0Y A;  4E7I A;  3OS0 A;  2G7U A;  3FWE A;  3R4K A;  2PI0 A;  2VBZ A;  2OBP A;  4GDF A;  1E17 A;  3HTU A;  4PK4 A;  5FGL A;  4A5N A;  3SEZ A;  2E34 A;  2VI6 A;  1KGS A;  3N97 A;  1R9T J;  2EPF A;  3E5U A;  2JPB A;  1IO2 A;  1IAW A;  4WK8 F;  1R1V A;  3DU6 A;  3Q9S A;  2BW3 A;  1TLH B;  2OAZ A;  2MLG A;  5FB2 A;  3DF8 A;  3JRC A;  2DXI A;  3DP7 A;  3NRV A;  1MIJ A;  1BOA A;  4A3D J;  4HRI A;  3ELK A;  1FMV A;  4BJ6 C;  4UB8 C;  3CCE I;  3AL0 C;  2L7M P;  2FX0 A;  2Q0O A;  3LSM A;  3L9F A;  1YJW I;  1IN8 A;  5J1R A;  4P5O A;  2Y30 A;  2I5U A;  2K02 A;  1Y0U A;  4W97 A;  4AF5 A;  1CGP A;  1S8N A;  2IAI A;  1ZH5 A;  3GTJ J;  2NS0 A;  4YG2 F;  2R7V A;  2OQG A;  1JTY A;  1X58 A;  3LQR A;  3EUP A;  4KNY A;  1XSX A;  4D5C A;  3ZMT A;  2CUF A;  2E1M B;  2M7A A;  2PMU A;  3NXC A;  3CC7 I;  2HDC A;  3SDB A;  2QF7 A;  3ZP5 A;  2A07 F;  2PBI A;  4HNT A;  3A0H C;  3RCO A;  3MKY B;  3S1R J;  4F93 B;  1QVU A;  5D5V B;  1U3E M;  2CV1 A;  2FF4 A;  2W48 A;  3BTI A;  3BRO A;  1VF9 A;  2AQF A;  5LGU A;  3H0G J;  3DEW A;  3K2Z A;  3DFG A;  3MEX A;  1TW2 A;  2EFN A;  4AIH A;  2PLY A;  2F5E A;  3CO6 C;  1ONV A;  2M8E A;  2E1O A;  1L0O C;  5E1Z B;  4EM2 A;  2VQG A;  5DS9 A;  2NOG A;  2YUS A;  2IJL A;  2VQC A;  3IWZ A;  4M3B A;  4V2G A;  3TKY A;  2V57 A;  5EEH A;  5L3E A;  2H1K A;  1O7L A;  5AIQ A;  3FXJ A;  4ZYE A;  1OYW A;  3M8E A;  3QU6 A;  4Z2Y A;  1B9N A;  2LYC A;  2WY8 Q;  3MWM A;  1XS9 A;  4NN1 A;  2EZH A;  3FXO A;  2EFO A;  2MBF A;  4I09 A;  3S3M A;  3H0D A;  3FMQ A;  3HOV J;  5FKO A;  3E6B A;  3EDP A;  3TL4 X;  2V1U A;  3RJP A;  3RH2 A;  2XVC A;  1AOY A;  4II2 A;  2P6T A;  1G3S A;  2HOS A;  4FT8 A;  1D8K A;  2P6S A;  2WUI A;  1FC3 A;  3PIP F;  3WTY C;  2G7G A;  2PJP A;  4BHB A;  3VEP A;  2ADU A;  2ZFW A;  1UI6 A;  1G59 A;  1MNE A;  3FK6 A;  5HNF A;  3CDI A;  1ZHF A;  5KVR A;  4IQJ A;  4XLA A;  4KA4 A;  2XAG A;  1Q1H A;  3ZMS A;  4DGW B;  2W24 A;  2QLZ A;  4MFE A;  5JR3 A;  2GZW A;  1ZG3 A;  1XMA A;  2OCE A;  3BWG A;  3SJM A;  3U9G A;  4BXU A;  3OYH A;  1IGN A;  1QZE A;  1V4R A;  1EF4 A;  3LSG A;  1YLF A;  4B8X A;  2KJC A;  4C3I J;  4G12 A;  1FP2 A;  3JSP A;  3IL2 A;  2YVE A;  4PUS A;  1IN4 A;  4M3E A;  5DM6 F;  3BHQ A;  4FX0 A;  1VQO I;  4AUX A;  4U9N A;  4DYQ A;  3OS2 A;  2Z9O A;  3NI7 A;  4YFX F;  5H9T A;  5DUK A;  1RPW A;  5B5E C;  1Z7L A;  2FEZ A;  2LH9 A;  2FBI A;  3CCL I;  2ZME C;  1NTC A;  1U2W A;  2E7W A;  3GZN B;  3HL2 A;  3CCU I;  3BG7 A;  2IU5 A;  3R0A A;  2M34 A;  2DA6 A;  4UUS A;  4A93 J;  3C7J A;  3QWL A;  4OU0 A;  4QTR A;  1X2N A;  2X4H A;  1WJD A;  3QBM A;  4E7Z A;  1SD6 A;  2Q24 A;  2BVL A;  2GA1 A;  3W6V A;  1SFX A;  1Z77 A;  2HKO A;  3TP3 A;  4A0Y A;  2FA5 A;  1ZAO A;  4PSX A;  5LBQ A;  3GBG A;  4AYB A;  3CC4 I;  2V9K A;  4UVA A;  4O5V A;  2JA8 J;  2B9S A;  1RUN A;  2JA7 J;  3FXU A;  1MMG A;  1WKM A;  3I0T A;  2CS3 A;  2F5V A;  3BCA A;  4GO1 A;  5DCF A;  3SXY A;  4AM3 A;  4B4C A;  1MDM A;  4EGY A;  3QP6 A;  3AQS A;  3ZN1 A;  3WGI A;  2COM A;  3JRG A;  2X0L A;  3DCF A;  3LFK A;  4II3 A;  2V6E A;  3FKI J;  4XKB A;  2XPU A;  2ZY9 A;  4EAT A;  1OJL A;  1X2M A;  2ESH A;  1ZLK A;  3HB9 A;  1UFM A;  4U0W A;  3KEO A;  4QLC U;  2HQR A;  4OIR F;  4HX7 A;  2ZOY A;  2ZJ2 A;  4IHX A;  4KMF A;  5F08 A;  4CHU A;  5CLS A;  1LVA A;  3PFI A;  2ICW G;  3EGQ A;  4M73 A;  4GCK A;  5FKK A;  1X3Z B;  3K8P C;  4E6K G;  2MH2 A;  2HXO A;  4FX4 A;  2GQQ A;  2G9W A;  3CMY A;  3EYY A;  4BXX J;  3VW2 A;  5LEJ A;  1R5H A;  4AVP A;  4BH9 A;  3SZP A;  4F7Z A;  4C2U A;  4WIB A;  3BZ6 A;  4A2U A;  3PM1 A;  3GEU A;  2L02 A;  5D4R A;  4A3F J;  3Q0U A;  3I53 A;  4HW0 A;  3F8N A;  3A01 B;  4F91 B;  5HOO A;  1AHD P;  2EB7 A;  2DQL A;  3QYE A;  2DPD A;  1KON A;  1SAN A;  1ZGA A;  2DCE A;  2E19 A;  3SQN A;  5LHG A;  2KJB A;  3CJR B;  3S8P A;  2JT1 A;  5HOD A;  3VYT B;  5KCM A;  1YQA A;  4JP0 A;  1GXP A;  1VQ7 I;  3HTJ A;  3ZCO A;  4M71 A;  3HHH A;  2VKH A;  3LJL A;  3B81 A;  5E3L A;  2MFZ A;  2X51 A;  1C0W A;  1R5I D;  4NHJ A;  2HYG D;  1PYV A;  4KIG A;  1S6L A;  5EZH A;  3ZOB A;  2NP5 A;  1G4D A;  1OKR A;  2G7L A;  5CXG A;  5DEQ A;  4HDV A;  5LHH A;  1BL0 A;  3C2B A;  3HM5 A;  4UVB A;  2F5D A;  2A05 A;  4DYC A;  3K10 A;  5C4Y A;  2DK8 A;  4KIB A;  2EIL H;  4YIR X;  1O3Q A;  4IPA A;  5DD4 A;  2DTZ A;  2OTJ I;  2VE8 A;  2Y2Z A;  3LSH A;  5DAJ A;  3O8H A;  3ZQH A;  4YFN F;  4R79 A;  1A5J A;  5ILV A;  1HLV A;  2V1N A;  4CCL A;  1RES A;  1XGO A;  3SEQ A;  1MMS A;  4C3J J;  2DMQ A;  1TT5 B;  3G1M A;  4S05 A;  4B48 A;  3CP8 A;  2BXZ A;  4YEL A;  1GVD A;  3TO9 A;  5K5R A;  1WCM J;  4TV7 A;  1F9N A;  5FLX K;  3MD2 A;  1VQ4 I;  1ZLJ A;  3ECH A;  2HYF A;  4KFC A;  3BRU A;  1RIO H;  2DTR A;  2K27 A;  1UCR A;  2M0C A;  1T95 A;  2VQL A;  3EUK L;  1UG2 A;  2UXU A;  3F3X A;  1P2F A;  2UXP A;  1LB2 A;  1K4T A;  3HG9 A;  2HVR A;  3A2K A;  2VJJ A;  3CCS I;  1BR1 A;  5EGO B;  1WVR A;  4MEY F;  1A36 A;  5BOX A;  5FKN A;  4X6A J;  4LIU A;  1OCP A;  3CUO A;  3NAU A;  2NS8 A;  4Y13 A;  2ZXJ A;  1VQ8 I;  1KU3 A;  5J8C A;  4L5I A;  1KQ9 A;  3HOU J;  3S2D J;  1ERD A;  2VBY A;  2HNH A;  1YYV A;  1OCZ H;  3E5Q A;  3OYG A;  5DUI A;  3L00 A;  3GLL A;  4YIF A;  5J47 A;  3JAM K;  3HRT A;  1MBJ A;  3JTG A;  1XPX A;  2A6T A;  5ICF A;  3CDL A;  2BW3 B;  1R1T A;  3NQO A;  1ZAR A;  1KYW A;  3R61 A;  3U21 A;  3K4N A;  2VC1 A;  2MSY A;  2DU9 A;  5ILU A;  4E7H A;  1MH4 A;  2H94 A;  4BJT A;  4ENJ A;  5IYB J;  3MVP A;  1AKH A;  2FUG 2;  2ZCN A;  1Y39 A;  4RMN A;  5FD5 A;  2R7W A;  1ETV A;  1SC7 A;  2KKO A;  3ZMZ A;  3H5A A;  1XG1 A;  1ETO A;  2HOE A;  2WAQ A;  4IL6 C;  4ESJ A;  2KIF A;  3KNW A;  1X4O A;  3V78 A;  3S5R A;  3QP5 A;  4DZP A;  3CF2 A;  5B3S H;  3QRF F;  1HQC A;  3QPS A;  5F1J A;  1PUE E;  1TWF J;  1IZ1 A;  3BY6 A;  2MC4 A;  2R7D A;  4G9Y A;  5IYC J;  3UKG A;  1G3W A;  5D6E A;  1S7E A;  3AAF A;  1XSV A;  4GRI A;  2HI3 A;  3GW2 A;  4MO7 A;  1JI8 A;  1QZZ A;  4QPO A;  1MMA A;  3RKW A;  2TDX A;  4AYB N;  4KIT B;  5A2Q Z;  3Q0W A;  2XKO A;  1AKH B;  2H27 A;  3H1C A;  1Q1V A;  2VKE A;  4PZJ A;  3OR1 C;  3R6S A;  4E7K A;  3GTP J;  2K85 A;  1DP3 A;  1ZGW A;  4XLN F;  2DFH A;  2Y48 A;  1DPR A;  2F4O B;  3CC2 I;  1B8I A;  3KCC A;  3G71 I;  3AKZ A;  3RI4 A;  1STZ A;  3FHZ A;  2HQN A;  3ABK H;  1ZN2 A;  3FXL A;  3KP5 A;  2QWT A;  4F3Q A;  3H9Q A;  3I71 A;  5L3F A;  4E7L A;  1UHW A;  3K4L A;  5D18 A;  4MIM A;  1E3P A;  2NVU B;  4KUM A;  2MG4 A;  4HG2 A;  3W2W A;  2YVX A;  5K7F A;  4I6Z A;  3DBL B;  3KEQ A;  4NDL A;  1WSU A;  4IRH A;  4BE1 A;  3WTV C;  1XD7 A;  1FBS A;  2XC7 A;  2K9Q A;  3GTO J;  3HJE A;  3TOB A;  3M8J A;  4G6T B;  5E3O A;  1QBJ A;  3IAM 2;  3OWT A;  1TW3 A;  1N75 A;  2E60 A;  4B09 A;  1O3R A;  3TO6 A;  4CCM A;  4OMY A;  2A61 A;  2X6O A;  2A5Y B;  4EGZ A;  2HYT A;  2DOE A;  2DW4 A;  5E3M A;  4F55 A;  1JUM A;  1XDS A;  1DGR M;  1MNM C;  2QKM B;  1HXD A;  4HNV A;  1UJ8 A;  3HOS A;  4J19 A;  1I1S A;  2XGE A;  5TJJ A;  1U9N A;  3VDX A;  3LSI A;  5J3L A;  4RB2 C;  2F07 A;  1LJ9 A;  3ULQ B;  2D45 A;  2QQ8 A;  3O2P E;  2FML A;  6PAX A;  3P5J A;  3PSF A;  1BM9 A;  4XMY A;  4R1H A;  4ZDO A;  3VVZ A;  3E0J B;  3TDU C;  1BJZ A;  2EIK H;  1WHU A;  1LE8 A;  4IHS A;  4HV5 A;  4I7H A;  4ME9 A;  2RKH A;  5H20 A;  4JX5 A;  4RB1 A;  1ZR2 A;  4IJA A;  4L5J A;  1T0F A;  5BS6 A;  2CQK A;  2OI8 A;  2EA2 A;  2YR2 A;  2O8K A;  3H3Z A;  2G0E A;  4GFK A;  2F6C A;  1ITY A;  3FXQ A;  1FT9 A;  1MBE A;  2BY3 A;  2R7O A;  4P55 A;  5L3B A;  3OYB A;  4IOA F;  3IV5 A;  1TWA J;  3JRH A;  1T08 B;  4E7S A;  1U6G A;  2KP6 A;  3K70 D;  2EK5 A;  3LQQ A;  1V54 H;  4DQ2 A;  3DTI A;  2BXY A;  1OCC H;  1YX3 A;  3I3L A;  5KK1 A;  2BOL A;  1MH3 A;  3VP5 A;  4OD4 A;  3BCG A;  5ED4 A;  1IG7 A;  3KP2 A;  4FAS D;  3HXL A;  3MFK A;  3DBH B;  1D8J A;  4CIC A;  3RYP A;  2CYY A;  1KU2 A;  3B02 A;  1I1G A;  3HYI A;  3F8F A;  1UEL B;  5JFR A;  3ZN0 A;  1QPI A;  3NS4 A;  2XAJ A;  2IGK A;  3L7W A;  4BAC A;  2P7C B;  1JJ8 C;  2NVX J;  4MXM A;  4CCK A;  3GTK J;  1YS6 A;  1PP7 U;  3ROU A;  1IUY A;  3SFZ A;  1WPK A;  5J4Y A;  4OAY A;  3GZI A;  4M74 A;  3S1Q J;  1BC7 C;  2JZY A;  3KYL A;  2I8D A;  2K5C A;  3BJA A;  2ZME B;  1HKQ A;  4I01 A;  4A69 C;  2HZT A;  1AU7 A;  4NQW B;  2IEK A;  1JUP A;  4XOT A;  5CVJ A;  1K6Y A;  4L0Z B;  4WCG A;  3D5R C;  2AXL A;  4IF4 A;  3AFH A;  2ETH A;  2RRE A;  3WE2 A;  2WWY A;  1TNT A;  2OZU A;  3ANG A;  2DPU A;  2HEO A;  2VT3 A;  3IHU A;  1U78 A;  3LSK A;  3K4C A;  5J6X A;  3H9G A;  1REP C;  2KDO A;  1WFX A;  4HLY A;  3J7A Y;  3JSJ A;  3BG6 A;  3DKW A;  1GDT A;  5B66 C;  1W0U A;  2DOA A;  4MEX F;  2PBX A;  2EQR A;  2RHA A;  5BQT A;  2Y75 A;  5FO5 A;  2DA7 A;  4HDU A;  2HTS A;  4ZTJ A;  2JVG A;  3JRI A;  3DPT A;  3MAJ A;  3HTH A;  1V5F A;  4S0H B;  3RQ4 A;  5DV5 A;  3AG4 H;  5HDN A;  3WU1 B;  2GOM A;  2V1D A;  2M30 A;  3EUH C;  5D4S A;  2PN6 A;  4GFL A;  1J2X A;  2UXI A;  2GWR A;  1R00 A;  4PSW A;  3CCV I;  1B59 A;  3H3U A;  2LLK A;  1I39 A;  5LEK A;  1JKP C;  4HKU A;  5FLV A;  3FHN A;  3QOE A;  2UXX A;  4I02 A;  1ZTR A;  2VPR A;  1JGS A;  3V7R A;  2OQR A;  4AWX B;  1XSD A;  1Y6I A;  3WHB A;  5IYD J;  3GWZ A;  2KHM A;  2DI3 A;  3JSO A;  1RNL A;  4XON A;  2HDW A;  4AIK A;  3ESW B;  1MGT A;  2FXA A;  1R7J A;  4HLX A;  1I6X A;  3LST A;  4MQ9 F;  2ZFU A;  2OER A;  3PFY A;  1V5E A;  3B6A A;  3PJR A;  4BEH B;  3CD6 I;  5D19 A;  5TIS C;  1P4W A;  2A2F X;  1TC3 C;  1LVK A;  2Z99 A;  1AA7 A;  1R4M B;  2CFO A;  2QQB A;  1NK2 P;  2NRA C;  4Y52 J;  2IA1 A;  5BMZ A;  3VW1 A;  5CPR B;  3AG1 H;  3PUF A;  3L1P A;  2ZB9 A;  2EFQ A;  1FY7 A;  2WAE A;  3BQY A;  3BR5 A;  3GLX A;  2F5F A;  4UY8 I;  2R5Y A;  2QEX I;  4A3I J;  3S15 J;  1ZKG A;  3EPZ A;  4P9U A;  1G2H A;  1WWX A;  1RC9 A;  2FRH A;  3BPV A;  2ME0 A;  1MW7 A;  1JUS A;  1Z1D A;  4CCN A;  4G7O F;  5DCM A;  3I54 A;  4PGG A;  3F22 A;  3MKL A;  2CG4 A;  4HEA 2;  1T6S A;  2K4J A;  5E8G A;  5GAH J;  5K1Y A;  4F52 A;  4G7H F;  3D5L A;  1YRN B;  4HBL A;  2DK5 A;  5HVQ C;  3F21 A;  4A3K J;  1HF0 A;  2JRM A;  2JPC A;  3OYD A;  2IS6 A;  3W2A A;  1O3T A;  2WBM A;  1Z91 A;  2L9V A;  2V26 A;  2L5Q A;  4CSW A;  2HPI A;  4MHG A;  2XF5 A;  4JQF A;  5F27 A;  2JN6 A;  2FBK A;  1IXR C;  1WI3 A;  2M7B A;  3RTR A;  3H9J A;  3L2C A;  1ZQ3 P;  3HIF A;  1MKM A;  3RPU A;  1SGM A;  3QYB A;  4WXH A;  4ABZ A;  3S2H J;  2O7T A;  4A3B J;  2MLK A;  2ZC2 A;  2L4M A;  3KP7 A;  4ESF A;  3I59 A;  1DUX C;  2M45 A;  3TP0 A;  4JK1 X;  4IX7 A;  2QEN A;  1P4X A;  2EBI A;  3CJD A;  1FLI A;  3WTU C;  4D5F A;  1Z21 A;  2WAF A;  1TT0 A;  3ASN H;  1ODD A;  4I98 B;  3CF5 F;  1VQ5 I;  1QA6 A;  3EYI A;  1FIP A;  1RI7 A;  2O7O A;  3REO A;  2NVY J;  4OIN F;  3MZH A;  4HF2 A;  3FX3 A;  1V5G A;  5EEA A;  2XF6 A;  2KRH A;  4XSX F;  1Y1W J;  2L4A A;  3A03 A;  2J5O A;  1VQP I;  2CV2 A;  3GTG J;  1TQP A;  1W7P D;  3BZK A;  3BNI A;  4AC6 A;  2CQN A;  1PVE A;  3A0B C;  1YHQ I;  3G56 A;  1ZRC A;  3SWH A;  1WQ2 A;  3ZQF A;  4OMZ A;  3I55 I;  3U1K A;  2NOJ B;  4M9S A;  5AQC A;  2IA0 A;  1UB9 A;  2XPV A;  2OV7 A;  2VJ5 A;  2HYJ A;  4BQA A;  5H2F C;  3MN2 A;  2HWV A;  3E7L A;  2EJR A;  2JA5 J;  2R7X A;  2Z1D A;  3S3O A;  2DA1 A;  1MMD A;  4C3H J;  1S3J A;  4YRV A;  3VTI A;  2LSO A;  1WZ2 A;  1T33 A;  3LAJ A;  1R22 A;  5GP9 A;  3OL3 A;  2PEX A;  2VLA A;  3KZ9 A;  4YZE A;  5ICE A;  2E5N A;  2GIZ A;  2H6C A;  1W5T A;  1MND A;  1BW5 A;  5IOZ A;  3A02 A;  2GAU A;  4M6X A;  3O60 A;  2ZSI B;  5GTI C;  4L18 B;  3MCZ A;  1ZG1 A;  2XGD A;  4BU2 A;  1JE8 A;  3BG3 A;  4AD9 A;  4P9F A;  3CUQ B;  2FD5 A;  1QZY A;  1VI0 A;  1MBK A;  2ECB A;  2WAD A;  3RZD J;  1RUO A;  2R0Q C;  1T2K A;  2V7F A;  2KIS A;  1BBY A;  4C30 A;  3EQL F;  4DBR A;  1R58 A;  3ML6 A;  2BHZ A;  5EF6 A;  3I59 B;  3TED A;  2DJI A;  3LSP A;  3DLL F;  1OFC X;  1FSH A;  4A5M A;  1HA8 A;  5M5W J;  2XRO A;  2K9N A;  3QQA A;  4JOM A;  1B72 B;  2EIJ H;  3F1B A;  3LA2 A;  4U0V A;  5FLX Z;  1FYL A;  1IV8 A;  2Z3Y A;  2DT6 A;  4XLF A;  3MZY A;  1B6A A;  3LHQ A;  2CQX A;  2XRN A;  1O4X A;  1A6I A;  5D8K B;  1S29 A;  4NC6 A;  4GFB A;  5D1R A;  1ZG5 A;  4EM1 A;  2XDN A;  4EQQ A;  2DG8 A;  2VBW A;  1FPQ A;  1IF1 A;  1YG2 A;  2JK3 A;  1F43 A;  3RPQ A;  3ZXS A;  2R93 J;  1ETK A;  3TDZ C;  5F6F A;  3V7C A;  1SVM A;  4LLG F;  3WTW C;  1PUF A;  2RQQ A;  2QUF A;  4GYI A;  2WC2 A;  2YU3 A;  2DG7 A;  2X1E A;  3AG3 H;  1LDK B;  5KAI C;  4YEJ A;  2DMT A;  2K3P A;  3BC8 A;  4XIC A;  5L3C A;  1VQ6 I;  5AON A;  4LMY A;  3VW0 A;  3VPR A;  3F0C A;  1XGM A;  3FK7 A;  3HOY J;  3T8T A;  3P7N A;  3QYF A;  3GX4 X;  2PMZ A;  1IXC A;  2FQ4 A;  2VOO A;  4ZYH A;  3OYM A;  4RM3 A;  5FD6 A;  5HNH A;  1D5Y A;  3DBR B;  1UG0 A;  2HKU A;  1T98 A;  4E70 A;  1OLT A;  3PNY A;  1ETX A;  2ID6 A;  4MTE A;  3T1B A;  4RS8 A;  2JQ7 A;  1I3Q J;  3ZQL A;  1X1D A;  2QCO A;  4BEH A;  1LDJ A;  2ZJQ F;  1J9I A;  2KPM A;  3VWB A;  1X1P A;  3HPG A;  2HFH A;  1L3L A;  3PO2 J;  2O6G E;  3NEU A;  2GLO A;  2LY2 A;  2R5Y B;  4XRS G;  4OIO F;  4MK6 A;  4BHC A;  3VYU B;  4XNF A;  4M9X A;  4QSH A;  2GEN A;  3K0L A;  3OS1 A;  3JW4 A;  3F8B A;  2K9L A;  2W4S A;  3K70 C;  3JRB A;  5DD8 A;  3ANP A;  2UXH A;  3K2A A;  4BDY A;  5JLW A;  2B7E A;  2V9V A;  1LFP A;  4LB6 B;  5FRN A;  3P9I A;  3SFI A;  3CWR A;  4IRV A;  3S3N A;  1R49 A;  4UB6 C;  3ZR8 X;  5CW8 A;  4HQM A;  4X0G A;  3VB2 A;  1WI9 A;  2DMP A;  3RKY A;  3LNQ A;  2UXN A;  5LGT A;  2LKX A;  2YSR A;  3I9V 2;  2NAZ A;  3TW6 A;  3C2G A;  1R36 A;  1VFC A;  3ABT A;  1JTX A;  3SYT A;  4O3M A;  3G1L A;  1IN5 A;  2M4K A;  2ECC A;  4LOC A;  2KIQ A;  1LUJ B;  5E20 A;  2OF7 A;  4ESB A;  4G6D A;  4LB5 A;  3C07 A;  2HQA A;  1T8I A;  4DOZ A;  2QZ8 A;  1WJB A;  1WJ5 A;  2F2E A;  1XC5 A;  1UZC A;  3ZMU A;  4UV8 A;  3OYK A;  1V3F A;  1IRF A;  2GXG A;  3OIQ A;  4V2F A;  3ZGK A;  1ULY A;  4PJN A;  5B1A H;  2WB1 N;  2O5R A;  1FSE A;  1K7A A;  4XK4 A;  3M1E A;  1MSE C;  1LPQ A;  1HCR A;  2B63 J;  1IRX A;  3M1C A;  3FMR A;  4HYE A;  1BC8 C;  3SHF A;  4U7B A;  1UI5 A;  5HBU A;  4Q47 A;  1YRN A;  3HEF A;  1S72 I;  2E1N A;  1W4M A;  2EV6 A;  2MGQ A;  4CZC A;  4CYD A;  3LA7 A;  1RKT A;  3TOA A;  4OD5 A;  2ZO4 A;  3JRE A;  4A3J J;  2CU7 A;  4MLO A;  1K78 A;  2L01 A;  2Q1Z B;  1JJ6 C;  1IDZ A;  4EEF G;  4BNC A;  3SDG A;  2ELJ A;  3HGY A;  3KFW X;  3IRR A;  3F9K A;  2BY2 A;  1YW9 A;  4XRS A;  2VXZ A;  4LG3 A;  1BR4 A;  4DNC A;  2XB5 A;  2AO9 A;  1KQ0 A;  4ETS A;  4A12 A;  4A0Z A;  5GTH C;  5F04 A;  1Z7U A;  4BE0 A;  1SD4 A;  1W5S A;  5FLM J;  1TWG J;  2GFN A;  3K1N A;  5AIP A;  5KAF C;  5TRD A;  2E2J J;  2OTL I;  3BR2 A;  1B4A A;  3ZQQ A;  3CLQ A;  3U2R A;  2BZT A;  1XMK A;  5C4J J;  3RKQ A;  4N4O B;  2M3A A;  4BQN A;  4YFK F;  2ZJR F;  1X3U A;  4EVI A;  3FMS A;  5LHI A;  4XRF A;  2D1H A;  1WH5 A;  2LVS A;  4JL3 A;  3H36 A;  2K3F A;  3I64 A;  2STT A;  3OSG A;  2ELH A;  1J75 A;  1FEX A;  5FFZ A;  2NYX A;  5M3F J;  3HE0 A;  1Z9C A;  2IS4 A;  4RAY A;  5GPA A;  3NAR A;  3NRG A;  3BJO A;  1P4A A;  4A3L J;  2HGC A;  1MJ9 A;  1SFU A;  3FBN B;  2AS5 F;  1T56 A;  4EMS A;  1OPC A;  3WTX C;  3QKX A;  4U9L A;  2VJI A;  2LD5 A;  1ZEL A;  2O8X A;  3FXM A;  3OIO A;  3GF2 A;  3VOX A;  5LGN A;  2BE5 F;  3M07 A;  3VOE A;  1JKR C;  4ANJ A;  5IT9 Z;  3HRS A;  3G1O A;  4BY7 J;  1GXQ A;  1Z3Y A;  1A6Q A;  3G7R A;  3ABM H;  2JUG A;  3OR2 C;  3W6J B;  4RB3 C;  1SAX A;  3IH3 A;  2ZOZ A;  5CVV A;  5HLG A;  2KT0 A;  1QQI A;  2IGM A;  1P92 A;  1OMI A;  2FSW A;  4XLP F;  4IRI A;  1TL8 A;  1TTY A;  2DOF A;  2WY7 Q;  3JTH A;  2NNN A;  2P5V A;  2XGC A;  3BLY A;  5FKM A;  5GAD J;  1YO5 C;  4PGH A;  1HST A;  3NWT A;  3CCM I;  4E4H A;  3MQ0 A;  4I76 A;  1POG A;  5K5O A;  2L9R A;  4NQW A;  3F23 A;  3D1N I;  3CCQ I;  4L5E A;  2LF8 A;  3ZRG A;  4A6D A;  5LRR A;  3V8J A;  3CMA I;  2QQA A;  3VOK A;  3T5X A;  5L3D A;  2C6Y A;  3BJB A;  4CH7 A;  1XMX A;  2KDZ A;  2B1E A;  1HSJ A;  2WB1 A;  3BOQ A;  2UUZ A;  5D8L B;  3J7Y J;  1YE9 A;  1B1B A;  3LWJ A;  1HKT A;  2J5P A;  2KIM A;  2F48 A;  3LMM A;  4Q4Z F;  4PJL A;  3OYN A;  4FTH A;  4RB0 A;  3V8K A;  2DJN A;  1XB4 A;  3J80 K;  4KJZ A;  4PXI A;  3M7G A;  2QA4 I;  2CMP A;  4Q5S F;  3WTS C;  3K4B A;  4C2M A;  4N9I A;  4DVY P;  4IO9 F;  2DFI A;  1YJN I;  1X1A A;  2FNA A;  3GFJ A;  4QIW N;  1ZRD A;  2LKP A;  4ZYD A;  3U1D A;  1D1C A;  3L2R A;  3GVA A;  3HTA A; 
#chains in the Genus database with same CATH homology
 5DTD A;  3BR1 A;  3WHB A;  5IYD J;  3CCY A;  3JR9 A;  1XS9 A;  3HGG A;  3ON4 A;  4NN1 A;  2EZH A;  3BT9 A;  3HOV J;  5FKO A;  1JKO C;  3H3V K;  3RH2 A;  1K83 J;  5CXI A;  1ORK A;  4XRM A;  2G3B A;  2XSD C;  2OER A;  3B6A A;  2HOS A;  2WUI A;  5D19 A;  2G7G A;  1TC3 C;  1UI6 A;  1NK2 P;  3FK6 A;  2GM4 A;  2W53 A;  3KKC A;  4Y52 J;  3VW1 A;  2L0K A;  5M5X J;  4CYC A;  1NK3 P;  4JYK A;  3L1P A;  2ZB9 A;  4MFE A;  3BQY A;  3BR5 A;  1DU6 A;  1VND A;  2XB0 X;  3SJM A;  4UUT A;  2R5Y A;  4A3I J;  2JJ7 A;  1IGN A;  3S15 J;  3VVX A;  1ZKG A;  1EF4 A;  3LSG A;  4BBR J;  4C3I J;  4G12 A;  4FE4 A;  3I4N J;  1G2H A;  4UDS A;  2YVE A;  4M3E A;  3BHQ A;  1ZR4 A;  4NEL A;  2ME0 A;  4AUX A;  1JUS A;  2WV1 A;  4BY1 J;  4DYQ A;  3NI7 A;  5H9T A;  1RPW A;  4C2M J;  3MKL A;  1B72 A;  3NPI A;  3BR0 A;  1NTC A;  1YRN B;  3OOU A;  4A3K J;  1HF0 A;  2IU5 A;  2M34 A;  3BQZ A;  2DA6 A;  4UUS A;  4A93 J;  4QTR A;  1X2N A;  2D6Y A;  1HDD C;  2ME6 A;  1P7I A;  3QBM A;  2Q24 A;  3W6V A;  3NNR A;  1Z77 A;  5F27 A;  3TP3 A;  2JN6 A;  2EH3 A;  5HSZ A;  1WI3 A;  2DN0 A;  1GV2 A;  3GBG A;  4DW6 A;  1ZQ3 P;  4DZJ A;  2JA8 J;  1SGM A;  5EDN A;  1UMQ A;  4ABZ A;  2JA7 J;  5J1U A;  1JKQ C;  3S2H J;  2COB A;  2O7T A;  4A3B J;  4CGR A;  2JA6 J;  4W1U A;  5JLX A;  3S16 J;  4B4C A;  2N8G A;  2HDD A;  3AQS A;  4GCT A;  4JX6 A;  3TP0 A;  2K40 A;  3JRG A;  2D5V A;  2DA3 A;  3ON2 A;  3DCF A;  2EBI A;  1IRZ A;  3CJD A;  3FKI J;  2XPU A;  3LSR A;  4A3C J;  4D5F A;  1OJL A;  1X2M A;  2WAQ N;  3HB9 A;  9ANT A;  1F36 A;  2ZOY A;  1FIP A;  2O7O A;  1U8B A;  2EZL A;  2NVY J;  4IHX A;  5EG0 B;  5F08 A;  1GT0 C;  5EEA A;  2LFB A;  1Y1W J;  1MBH A;  3EGQ A;  3GTG J;  2HXI A;  2TRT A;  3A03 A;  4X1E A;  3B6C A;  4GCK A;  1UHS A;  3BNI A;  2EZI A;  5FKK A;  5IOY A;  4B1R A;  4AC6 A;  4IHV A;  2HXO A;  3G56 A;  2LP0 A;  3ZQF A;  4ICH A;  1ZK8 A;  2R5Z A;  5AQC A;  3CMY A;  4BXX J;  2XPV A;  3VW2 A;  2M8G X;  2YVH A;  2R5Z B;  2HYJ A;  2LR8 A;  4Y7N J;  3K7A J;  1H89 C;  2PMZ N;  3PM1 A;  3MN2 A;  3GEU A;  3E7L A;  3IH4 A;  4A3F J;  1DU0 A;  2JA5 J;  3Q0U A;  3A01 B;  1AHD P;  1LE8 B;  2DA1 A;  4MFD A;  4C3H J;  2WGB A;  3CRJ A;  1SAN A;  2ZCX A;  1T33 A;  2E19 A;  4FIS A;  5HOD A;  4KWA A;  5GP9 A;  3JRF A;  3KZ9 A;  1FTT A;  4JP0 A;  4YZE A;  1BW5 A;  5BNG A;  3A02 A;  5IOZ A;  3HTJ A;  3O60 A;  3LJL A;  3B81 A;  5E3L A;  1TWC J;  1ETW A;  4CYC B;  3HIM A;  2X48 A;  2XGD A;  5EZH A;  3BG3 A;  1HOM A;  2FD5 A;  3ZOB A;  1VI0 A;  2ECB A;  1MBK A;  3TW7 A;  4RDU A;  3RZD J;  3GTQ J;  5IP6 A;  2R0Q C;  2G7L A;  5M3M J;  2NP3 A;  1BL0 A;  2HOT A;  2CUE A;  5CXG A;  1E3O C;  3C2B A;  3HM5 A;  4IHY A;  4DYC A;  1B8I B;  3VVY A;  5EF6 A;  3TED A;  5C4Y A;  3LSP A;  1IC8 A;  1OFC X;  5GPC A;  1MBF A;  2RAE A;  2RAS A;  5EGO A;  1MBG A;  1WGX A;  2DTZ A;  5M5W J;  2Y2Z A;  5DAJ A;  2E2I J;  2K9N A;  3HKZ N;  3O8H A;  3QQA A;  3ZQC A;  3ZQH A;  1B72 B;  3Q0V A;  2ZCM A;  3F1B A;  1QRY A;  1A5J A;  2ELK A;  1HLV A;  1MSF C;  4BBS J;  1RES A;  2EZK A;  2VKV A;  4C3J J;  2DMN A;  3HOX J;  2DMQ A;  3IH2 A;  3G1M A;  3GTL J;  3LHQ A;  4A3E J;  2YU9 J;  2CQX A;  1O4X A;  1A6I A;  1GVD A;  5IP7 J;  4IHW A;  2FBQ A;  3A01 A;  1WCM J;  2G7S A;  2I10 A;  5FKL A;  4GFB A;  5D1R A;  4RBO A;  2XDN A;  2DG8 A;  3BRU A;  2JK3 A;  2JWT A;  1F43 A;  2M0C A;  2R93 J;  1UG2 A;  2UXU A;  2CJJ A;  1ETK A;  4BKX A;  2UXP A;  3RD3 A;  1JT6 A;  2TCT A;  1PUF A;  5EGO B;  2CRG A;  2M2E A;  5FKN A;  4X6A J;  2OPT A;  2DG7 A;  1OCP A;  2AHQ A;  2GUH A;  2GBY A;  5C3E J;  2DMT A;  2NS8 A;  3NAU A;  4XIC A;  1K61 A;  3PAS A;  1RR7 A;  3VPR A;  3HOU J;  3VW0 A;  3F0C A;  3S2D J;  3FK7 A;  3HOY J;  1H8A C;  1ETY A;  2FQ4 A;  2K9S A;  3VIB A;  1D5Y A;  3BTJ A;  2UXO A;  1MBJ A;  2HKU A;  1BW6 A;  1ETX A;  2ID6 A;  3CDL A;  1I3Q J;  3ZQL A;  1BA5 A;  3FRQ A;  2QCO A;  2NS7 A;  2MSY A;  3LOC A;  5J1Y A;  1MH4 A;  5IYB J;  3BG9 A;  3MVP A;  1ETQ A;  1AKH A;  2ZCN A;  1PUF B;  3PO2 J;  1ETV A;  3GTM J;  3BTL A;  2GLO A;  2R5Y B;  1XG1 A;  4XRS G;  3M4O J;  4MK6 A;  1ETO A;  3BG5 A;  5M5Y J;  1U9O A;  2NX4 A;  3KNW A;  3IUV A;  3V78 A;  3S5R A;  4QSH A;  3FIW A;  4DZP A;  2GEN A;  5K58 A;  3BR3 A;  3O8G A;  3WHC A;  3QPS A;  5F1J A;  4A3G J;  1TWF J;  3QPL A;  3JRB A;  3ANP A;  2UXH A;  5IYC J;  3K2A A;  5F0C A;  3UKG A;  5JLW A;  1S7E A;  5EFY A;  3AQT A;  3FIS A;  2CQQ A;  3SFI A;  3CWR A;  2HI3 A;  5IP9 J;  4FCY A;  4MO7 A;  1APL C;  3PPB A;  1JGG A;  5CW8 A;  2X9D A;  4AYB N;  2DMP A;  3LNQ A;  3Q0W A;  1AKH B;  2LKX A;  2PZ9 A;  1FTZ A;  1Q1V A;  2VKE A;  4UUS B;  3TW6 A;  3GTP J;  1ZGW A;  1VFC A;  2NVQ J;  1JTX A;  1B8I A;  4FE7 A;  3G1L A;  4M3D A;  3S1M J;  3JRA A;  2ECC A;  4JX4 A;  3I4M J;  3E7Q A;  3T6N A;  4LOC A;  3DPJ A;  3V6G A;  5EG0 A;  1SFO J;  2QOP A;  2QWT A;  2OF7 A;  2Y0S N;  1JT0 A;  2NVT J;  3C07 A;  2R92 J;  2L7Z A;  3PO3 J;  5D18 A;  1XC5 A;  4MIM A;  2QIB A;  2MG4 A;  5C4X J;  4V2F A;  5K7F A;  4I6Z A;  4A3M J;  3S14 J;  4NDL A;  2WB1 N;  5IPA A;  3HDD A;  3M3Y J;  1HDP A;  1LFU P;  4XK4 A;  4AC0 A;  2JMW A;  2K9Q A;  1MSE C;  3LSJ A;  4D7M A;  3GTO J;  1HCR A;  2B63 J;  2DA4 A;  5E3O A;  1OCT C;  2REK A;  1UI5 A;  5HBU A;  1YRN A;  3HEF A;  3VUQ A;  1Y1V J;  2X6O A;  2HYT A;  2MGQ A;  4M3F A;  4JNN A;  2HOA A;  1RKT A;  5E3M A;  1JUM A;  2DA5 A;  3ZQI A;  3JRE A;  4A3J J;  5FMP A;  2CU7 A;  1MNM C;  4MLO A;  4HNV A;  4J19 A;  1JJ6 C;  2XGE A;  1IDZ A;  4EEF G;  3BTC A;  1U9N A;  3SDG A;  5J3L A;  2F07 A;  1IV6 A;  3HGY A;  3OSF A;  5F0H A;  3CQZ J;  3HTI A;  4XRS A;  3VVZ A;  3HOW J;  1BJZ A;  2O9L A;  1LE8 A;  1LFB A;  2XB5 A;  4ME9 A;  2AO9 A;  1H88 C;  2QKO A;  4JX5 A;  1ZR2 A;  3ZQG A;  3S1N J;  5F04 A;  1ENH A;  4D7N A;  2LTP A;  5FLM J;  2OI8 A;  1TWG J;  2GFN A;  4B3A A;  2O8K A;  5FJ8 J;  4DYR A;  4GCL A;  2E2J J;  3BR2 A;  2H8R A;  2G0E A;  4GFK A;  2DMU A;  4M3G A;  1ITY A;  1MBE A;  5C4J J;  1IUF A;  1Z0X A;  3RKQ A;  5EZG A;  5C44 J;  1TWH J;  5K7H A;  3IV5 A;  1TWA J;  3JRH A;  3Q3S A;  1FIA A;  5HAW A;  1WH5 A;  2LVS A;  5EYR A;  2M9H A;  1CQT A;  1I50 J;  1FEX A;  3OSG A;  4JL3 A;  1FJL A;  3HOZ J;  3S17 J;  5M3F J;  2MW8 A;  3HE0 A;  2LK2 A;  5K7Z A;  1RKW A;  1GV5 A;  2HQ5 A;  3NAR A;  5GPA A;  3NRG A;  1MH3 A;  4A3L J;  1GUU A;  1W0T A;  2DA2 A;  2IBD A;  3VP5 A;  2XRL A;  1T56 A;  3BCG A;  3COL A;  3QKX A;  1IG7 A;  2LD5 A;  3OIO A;  4ACI A;  5FGL A;  3VOX A;  2P81 A;  2VI6 A;  1JKR C;  1R9T J;  3G1O A;  3JRD A;  4IEJ A;  4BY7 J;  1QPI A;  1JJ8 C;  2NVX J;  3G7R A;  4MXM A;  3GTK J;  3JRC A;  3RQI A;  3IH3 A;  1WPK A;  2R7Z J;  2ZOZ A;  3GZI A;  4A3D J;  4L62 A;  2KT0 A;  1IJW C;  3S1Q J;  1WH7 A;  2L7M P;  2FX0 A;  4A69 C;  5J1R A;  1AU7 A;  2IEK A;  2Y30 A;  1JUP A;  2XGC A;  2YS9 A;  5FKM A;  4JKZ A;  4W97 A;  3MNL A;  5E3N A;  4AF5 A;  1RET A;  2IAI A;  3P9T A;  4I76 A;  1POG A;  3GTJ J;  2LY9 A;  2L9R A;  3EUP A;  1JTY A;  1X58 A;  4M6V A;  3D1N I;  3ANG A;  4L5E A;  4XID A;  1I6H J;  1U78 A;  3VOK A;  4D5C A;  3BJB A;  2CUF A;  3NXC A;  2KDZ A;  2VUM J;  3JSJ A;  1QVT A;  2QF7 A;  1GDT A;  1W0U A;  2PBX A;  5F0F A;  2EQR A;  2RHA A;  2FJ1 A;  2E2H J;  3S1R J;  3LWJ A;  1QVU A;  2QTQ A;  2DA7 A;  3RZO J;  2W48 A;  2Y9Y A;  3BTI A;  2L7F P;  3JRI A;  4FTH A;  1VF9 A;  3H0G J;  3DEW A;  3HTH A;  2DJN A;  2Y31 A;  2ID3 A;  4S0H B;  3KKD A;  3HBL A;  3BR6 A;  2E1O A;  4PXI A;  5FHP A;  2XPW A;  5DS9 A;  4GFL A;  2NOG A;  2UXI A;  2NP5 A;  2YUS A;  1P7J A;  4M3B A;  2V57 A;  4V2G A;  2LLK A;  2H1K A;  1JKP C;  4QIW N;  2Y9Z A;  4HKU A;  1IDY A;  5FLV A;  1ZTR A;  2VPR A;  3HTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...