3SDGA

Ethionamide boosters part 2: combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole ethr inhibitors.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
189
structure length
184
Chain Sequence
b'ELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Ethionamide Boosters. 2. Combining Bioisosteric Replacement and Structure-Based Drug Design To Solve Pharmacokinetic Issues in a Series of Potent 1,2,4-Oxadiazole EthR Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
total genus 77
structure length 184
sequence length 189
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3sdgA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3sdgA02
1ETQA 5FMPA 1FTTA 5F08A 3JRBA 1WPKA 3UKGA 4A3FJ 2CUFA 3Q3SA 5GPCA 5M5XJ 3G56A 3D1NI 2DMQA 4AC6A 2E1OA 3BNIA 2IEKA 2DN0A 2DA6A 1PUFB 5JLWA 2O7TA 2CQXA 2JWTA 1XS9A 1WH7A 3S17J 1A5JA 2YUSA 3JSJA 3HOXJ 3TEDA 1CQTA 1HDPA 5HSZA 3MNLA 4DYCA 3IH3A 5CW8A 5E3NA 3BJBA 1SGMA 3JRGA 1ETXA 3BTJA 3CDLA 3PPBA 1LFBA 5FKLA 1R9TJ 4M3GA 2P81A 2OF7A 1H88C 1MBJA 2DMPA 1ETVA 5IP6A 1IC8A 2HOAA 2WB1N 3LSRA 1MSFC 5HBUA 4A3IJ 1B8IA 3BRUA 1JUSA 2HOSA 3RH2A 3F0CA 1E3OC 2CUEA 5F27A 3GTLJ 1ZK8A 1XC5A 3S15J 5HAWA 3HKZN 1B72B 5K58A 1JTYA 4X1EA 4ME9A 5EZGA 2LLKA 1MNMC 2NX4A 1U8BA 4XRMA 4IHXA 1IJWC 3OOUA 2ZCXA 4A3KJ 5EGOA 3G1MA 4MXMA 1I3QJ 3FK7A 2R93J 2M9HA 3K2AA 1IDZA 2XB5A 4ICHA 2NVXJ 1Z0XA 4DW6A 3HTAA 2DA3A 2VKVA 4L62A 2ZCNA 4ACIA 1JT6A 1U78A 1T33A 1TWGJ 1DU0A 3I4NJ 3JRAA 1TC3C 1JUMA 5E3LA 3HIMA 2JA6J 2NS8A 3HB9A 3TP3A 1JKPC 3RZDJ 1UMQA 4JX5A 1BL0A 2HKUA 3SJMA 3BQYA 3S5RA 2K40A 3LSGA 2L7MP 4M3EA 3OSGA 2KT0A 4D7NA 2XGCA 3H3VK 5D19A 1DU6A 2JA8J 3GBGA 3T6NA 5D18A 4FTHA 3E7QA 5FLMJ 2R5ZA 1D5YA 4IHWA 2MSYA 2QCOA 2YS9A 2B63J 4A3BJ 2N8GA 2EBIA 1IRZA 3M4OJ 2WUIA 3NARA 1A6IA 1IGNA 5CXGA 3TW6A 3LSJA 1GV5A 4A3LJ 3AQSA 3ZQCA 3G1OA 3B81A 3QPLA 2PMZN 2CQQA 2EZHA 1GV2A 2HXIA 3FRQA 5DAJA 5GP9A 5FKKA 2R0QC 2XB0X 3S1QJ 3DCFA 1B72A 1TWCJ 1XG1A 4D5CA 1U9NA 4EEFG 1B8IB 3JRHA 2JA5J 4MO7A 4NDLA 2G7GA 4A93J 1JKRC 2R92J 3AQTA 3QKXA 3ZQHA 3NRGA 4MIMA 5F0FA 2QF7A 3GTOJ 1RPWA 2ID6A 2Q24A 1JTXA 4UUTA 5EGOB 2TRTA 3BQZA 3W6VA 1BJZA 5FLVA 5FGLA 3HBLA 1GVDA 2K9QA 2MW8A 3G1LA 5IYBJ 2QIBA 2DMUA 3EGQA 5FKOA 3CRJA 4DZPA 3S2HJ 4MFEA 3HOYJ 3KKDA 3LSPA 4D5FA 3VIBA 2E19A 3PO2J 1GUUA 1JJ8C 2EZIA 1ITYA 1U9OA 3NNRA 3HM5A 1QPIA 2YVHA 5C3EJ 3HOWJ 4XK4A 4AYBN 1S7EA 5EZHA 1YRNA 3BHQA 3P9TA 2PBXA 1ETYA 3HDDA 4B3AA 3RZOJ 3HE0A 2JK3A 2ZCMA 2R5YB 2GLOA 2K9SA 5IOYA 4FE7A 1IG7A 3FIWA 2R5ZB 4DYRA 2XPUA 4B4CA 4MLOA 4C2MJ 3FISA 2EQRA 3HGGA 2Y0SN 1ZKGA 3B6CA 2HXOA 4I76A 2OI8A 4FCYA 2RAEA 3B6AA 2G0EA 1GT0C 4A3EJ 3Q0VA 2D6YA 5JLXA 3VW1A 3S14J 1MBKA 2AO9A 3BR5A 2RHAA 5C4YA 5D1RA 1O4XA 3ZQGA 4QTRA 2E2HJ 3QPSA 3SDGA 3PASA 3HOZJ 3OIOA 1X2NA 2W48A 5F0HA 5K7HA 3CMYA 2ECBA 4D7MA 4C3HJ 4JNNA 4GFLA 2LFBA 3WHCA 4KWAA 2FX0A 5J3LA 1VF9A 3GTGJ 1P7IA 1SFOJ 2VI6A 1WH5A 2ID3A 4XIDA 1ZQ3P 1TWFJ 2ELKA 3BR1A 3M3YJ 3HTHA 1Z77A 2DMNA 4RDUA 1Y1WJ 2Y30A 3GTMJ 2L0KA 2X9DA 1T56A 2HOTA 3C2BA 1HF0A 2G7SA 4MK6A 2M2EA 1RESA 4XICA 4RBOA 2ZOZA 2ME6A 5DTDA 5C4XJ 2UXOA 1JJ6C 4NELA 1VI0A 3LNQA 3LHQA 2HDDA 5HODA 2UXUA 3BTLA 3IUVA 3ZQLA 1MBEA 3HTJA 2R5YA 2DMTA 4BY7J 2HYTA 2MG4A 5IYCJ 1ZGWA 2UXPA 2LVSA 1QVUA 1AU7A 2NP3A 3L1PA 5FJ8J 2NOGA 3S16J 2NVQJ 3CWRA 3NXCA 2V57A 1WI3A 2JMWA 2E2JJ 3V6GA 1YRNB 5K7ZA 3HEFA 2ME0A 3VVXA 2YU9J 5C4JJ 2G7LA 5FHPA 1FIAA 2LY9A 3NI7A 1MBGA 4A3CJ 2LTPA 2M8GX 3LOCA 2Y31A 2KDZA 3JRDA 2LR8A 1UI5A 2H1KA 3LWJA 2ZB9A 1FIPA 3HGYA 4A69C 4HKUA 3JREA 5BNGA 5M3FJ 5FKMA 1ENHA 3MVPA 4XRSA 1HDDC 2RASA 4Y7NJ 5EEAA 3GZIA 3NPIA 4GFBA 2VUMJ 3BR6A 3C07A 5EFYA 1W0TA 1TWAJ 1WCMJ 3S1RJ 2CU7A 5AQCA 3A01B 3BTCA 3F1BA 1TWHJ 2Y9ZA 5J1RA 4GCTA 1NK2P 2XSDC 3NAUA 2XGDA 1ZTRA 3BR0A 1GDTA 2M34A 1RKTA 1MSEC 5J1YA 2FJ1A 3S1MJ 4J19A 1AKHA 2FD5A 3QBMA 3S1NJ 2XPVA 1VFCA 3A02A 3V78A 2QOPA 3BG3A 1VNDA 3JR9A 2LKXA 5EG0A 4A3DJ 2OERA 1NTCA 3HOVJ 3ANGA 4QSHA 3RD3A 1POGA 3K7AJ 5C44J 2L9RA 2X6OA 1MBHA 4V2FA 2CJJA 2E2IJ 1OJLA 2DA7A 4M3DA 3GTQJ 4M3FA 4QIWN 1JT0A 2GENA 1IDYA 3GEUA 5M3MJ 3S2DJ 1H8AC 3DPJA 2DJNA 4UUSA 3CJDA 2XPWA 4JP0A 5IPAA 1APLC 4XRSG 2O9LA 2F07A 2IU5A 1EF4A 1JKQC 3KKCA 4LOCA 5EYRA 3VVYA 1H89C 2XDNA 1FEXA 3FKIJ 3BCGA 2TCTA 2COBA 3MN2A 3FK6A 2NS7A 1ETKA 5J1UA 2HI3A 2NVTJ 4W1UA 3TW7A 2VPRA 3BG9A 3Q0WA 3IH4A 2H8RA 1K61A 1ETOA 3QQAA 3A01A 1HCRA 4GCLA 4IEJA 3HTIA 2L7FP 3I4MJ 4GFKA 5M5WJ 1FJLA 3TP0A 3WHBA 1UHSA 4A3MJ 9ANTA 2DG8A 1JUPA 4ABZA 2R7ZJ 2UXIA 2O7OA 3KZ9A 3VVZA 4FE4A 3O60A 2XGEA 1K83J 3OSFA 2QTQA 3PO3J 4I6ZA 4CYCA 1LE8A 2D5VA 3RQIA 3ZQFA 3LJLA 4UDSA 5H9TA 1RR7A 3GTPJ 4AF5A 3ZQIA 4X6AJ 1MH4A 3ON2A 5IP9J 3BG5A 5IYDJ 1X58A 2CRGA 1BW5A 4NN1A 1AKHB 1OFCX 3O8HA 3G7RA 5DS9A 3EUPA 5M5YJ 2Y9YA 2PZ9A 1F36A 1RETA 4Y52J 2FBQA 2M0CA 3BR3A 1BW6A 5EG0B 4CGRA 2JN6A 1FTZA 5F04A 4M3BA 2Y2ZA 4YZEA 4HNVA 1ZR2A 2JA7J 2XRLA 3BR2A 4JX6A 2GM4A 5K7FA 3GTJJ 2GFNA 1WGXA 3ZOBA 3E7LA 4BXXJ 2K9NA 1ETWA 1JKOC 2EH3A 3RKQA 5F0CA 3BTIA 4AUXA 4UUSB 5FKNA 3MKLA 3VPRA 1OCTC 2IAIA 1UG2A 2AHQA 2QWTA 2WAQN 1ORKA 3JRIA 4A3GJ 3JRFA 2ZOYA 4IHYA 4BKXA 2DA5A 2REKA 1PUFA 1AHDP 3VUQA 4BBSJ 3VOKA 4W97A 2VKEA 4A3JJ 2UXHA 2IBDA 3DEWA 1HLVA 5IOZA 1QVTA 2WGBA 2LK2A 3SFIA 2DA2A 2LP0A 3PM1A 1UI6A 2LD5A 2L7ZA 3JRCA 4IHVA 2MGQA 1F43A 2GBYA 4G12A 4AC0A 3VOXA 4BBRJ 2G3BA 2OPTA 2QKOA 4GCKA 1Q1VA 1JGGA 3O8GA 4BY1J 2DTZA 4DZJA 2W53A 1MBFA 4JL3A 1Y1VJ 4C3IJ 4B1RA 2I10A 1QRYA 4FISA 1I6HJ 4C3JJ 5GPAA 1G2HA 2ECCA 3GTKJ 3ANPA 1MH3A 3VW2A 4JKZA 4CYCB 3HOUJ 2HYJA 1LE8B 1OCPA 5E3OA 2JJ7A 3Q0UA 4JYKA 5F1JA 1IV6A 1RKWA 2X48A 3VW0A 2O8KA 5EF6A 2DA1A 1IUFA 2HQ5A 3VP5A 4JX4A 3BT9A 2EZLA 3H0GJ 4M6VA 3IH2A 4PXIA 2NVYJ 5EDNA 2FQ4A 3IV5A 1P7JA 2WV1A 1W0UA 1LFUP 1BA5A 1I50J 3CCYA 3CQZJ 2DA4A 5IP7J 3ON4A 4L5EA 5E3MA 1NK3P 3KNWA 4MFDA 2DG7A 4S0HB 1X2MA 2YVEA 3COLA 2GUHA 2NP5A 2EZKA 4V2GA 3A03A 1SANA 1ZR4A 5CXIA 4DYQA 1HOMA
chains in the Genus database with same CATH superfamily
2X1DA 5FMPA 1WPKA 2CUFA 4UB8C 5ILSA 3FKJA 5M5XJ 3RKXA 3G56A 2XKOA 3OY9A 1TQIA 1W5SA 2DMQA 4A0ZA 4BXUA 3D1NI 4AC6A 4BHCA 2A69F 1AWCA 1RUNA 1PUFB 4O6JA 4BU2A 2JWTA 1FBUA 1WH7A 1A5JA 2GIVA 1W4MA 3TEDA 3QPHA 3LA7A 1XCBA 4CXFA 3U21A 1SGMA 1K6OA 3HRSA 1X1DA 1QBJA 2OCEA 3CJTB 2HPMA 2EB7A 1DDNA 2BY2A 4B48A 1IO2A 1K6YA 5ILVA 1ETVA 5IP6A 1VQLI 4KISA 2HOAA 2WB1N 4PSXA 3LSRA 1MSFC 5HBUA 4A3IJ 3BRUA 2KPMA 1JUSA 2HOSA 3HRTA 1OLTA 1WWXA 4HX8A 3VYUB 3RH2A 1FOKA 2CUEA 3CCRI 5F27A 3WTWC 2EILH 3L2UA 3KP4A 2DDBA 3GUDA 4ME9A 3H3UA 2JA8J 4IHXA 2DU9A 1T39A 3DKXA 4KYWA 2R7TA 3OOUA 3OYCA 5EGOA 1R00A 4CGZA 1I3QJ 3ZN0A 3M1CA 4C2UA 2HVQA 4CH7A 2EWNA 4F93B 3EYYA 4DBQA 2NVXJ 4ICHA 4XLCA 4LG0A 4NHJA 2ZXIA 4UNOA 5E3LA 4P55A 2JA6J 5E8IA 3M8FA 1B1BA 3RZDJ 4JX5A 1BL0A 2HKUA 3S5RA 3BQYA 4Z2YA 3RPUA 4BEHA 2QENA 1Y39A 2H8WA 1F9NA 4N9IA 3OSGA 4XMYA 4D7NA 4BHPA 1KQ0A 2XGCA 5D19A 3TBIA 5D18A 3E6BA 1OR7A 2CUZA 3H1CA 2B63J 1DGWY 2YS9A 4A3BJ 3BPXA 3ECHA 3ESWB 2W24A 2EBIA 1BC8C 3HPGA 3M4OJ 3ZPLA 1IGNA 3FBNB 4RLFA 5CXGA 4E7JA 3LSJA 1GV5A 3GF2A 4Q5SF 2DDAA 4KIGA 4A3LJ 3AQSA 3KZIC 4A5MA 3G1OA 3B81A 5LRRA 4GYIA 1GV2A 2M3AA 3FRQA 5DAJA 5GP9A 4F55A 3DP7A 4M6XA 5LFAA 1U8RA 2PJRB 1TW3A 4CCOA 1SD6A 3OYEA 2MBFA 4QLCU 4FETA 1HKTA 1USSA 2PEXA 2LBFA 3ASOH 4DJAA 1KU7A 2M0MA 1U9NA 3JAMK 5DM7F 3HHHA 2R92J 3SWHA 1QGPA 3CJQB 3ZQHA 2O0YA 1SMTA 2XGXA 3GTOJ 1RPWA 1I6XA 4P9FA 1GLNA 1R58A 3IC7A 3CCEI 4UUTA 4LFUA 1RZ4A 2TRTA 3LSMA 5FLVA 2OTJI 3DEEA 5JFRA 4M73A 3QP6A 3E5UA 1TNSA 2DMUA 3MQ0A 3EGQA 4DZPA 3S2HJ 3VFZA 2YPRA 4KN4X 2IS4A 4HQMA 4KJZA 3H36A 1TTYA 1GUUA 4BE2A 2E7XA 2XAGA 3HM5A 4C2TA 1YRNA 4MQVA 3HJEA 1R6RA 3F8BA 3BHQA 3P9TA 2FMLA 4B3AA 4EATA 5A2QZ 1FYKA 3RZOJ 2IPQX 1V5GA 3PQJA 4PJJA 5B3SH 3DU5A 3ZMSA 4DYRA 4CCNA 5HLTA 2EA2A 3OYGA 5J4VA 4MLOA 3V7SA 2F6CA 1OCCH 1IXCA 2W7NA 4E7HA 1HSTA 1V3FA 2EQRA 2ZC2A 5JI6A 1ZKGA 3B6CA 2HZTA 3OYKA 2OI8A 3B6AA 4RB3C 1GT0C 5L3CA 1G59A 3VW1A 3S14J 3BR5A 5C4YA 2RNGA 5ICGA 4KMFA 3PASA 2Y48A 1Z7LA 3BWGA 2DTRA 5K7HA 2ESNA 5KNLA 2R7UA 2ECBA 3KEOA 1D1BA 3HUGB 3OR2C 2VBXA 4IVNA 2F2EA 2YX7A 1XN7A 2FX0A 3GEZA 1X1BA 5FROA 2KRCA 3V7CA 4BL0B 3D5SC 2BW3A 1P7IA 2A5YB 2ZNZA 2VI6A 2H6CA 2P6SA 3FXRA 1T08B 5ILUA 2ELKA 4XIDA 2Z33A 1ZQ3P 3M3YJ 4I98B 1CF7B 3SQNA 3GW2A 4XLNF 4A6DA 3ZXSA 2L9SA 3GO5A 3CC4I 1P4XA 2P6TA 3PSIA 2G7SA 2CW7A 1HSJA 2M2EA 2D1VA 4XICA 2CH0A 2XSJC 3E6DA 2LMDA 1UG0A 4RGRA 1VI0A 3ABKH 3LNQA 1FSEA 2YR2A 5ICEA 3LHQA 4YFNF 5DDGA 2UXUA 3BTLA 1OPCA 3HTJA 1NHAA 5EJCA 1K4TA 2HYTA 1ZGWA 3O6BB 3TL4X 3LQRA 1O3QA 3QPTA 3L1PA 3WTVC 3CWRA 3SHFA 2NVQJ 5KVRA 3V6GA 1FNNA 1VQ4I 3A0BC 5K7ZA 5LRSA 3ZQQA 2YU9J 2LY9A 3RCOA 2LTPA 1LNWA 3W6KB 1XPXA 2Y31A 2HGCA 4PFOA 2X0LA 1FIPA 5M3FJ 1OCRH 3QOEA 1FY7A 3ISPA 5FKMA 4F7ZA 3W6JB 1YHQI 3K4NA 4AIKA 2FJI1 4Y7NJ 5EEAA 1YO5C 3CJRB 2FSWA 2KIUA 4PJ0C 2A6HF 1E3HA 3KLNA 3S1RJ 2CU7A 3BROA 5E8GA 2L9NA 1FC3A 3F1BA 2OQRA 5J1RA 3F22A 2IVMA 2QBYB 2Z5UA 2M34A 1MSEC 2XAFA 2FJ1A 2MA3A 2EJRA 3BG6A 3H92A 2VL8A 3GFJA 4UXNA 1MMAA 3VODA 3K2ZA 4EJWA 2F5CA 3K10A 3GLLA 4M9XA 3HOVJ 3ANGA 5DUIA 1XD7A 5FB2A 4RM3A 4N9HA 1YQAA 2ZMEA 4NQWB 5E79C 4OMYA 1FX7A 3VDXA 4M3DA 2E1MB 3JSOA 2GENA 4OOIA 4KFCA 4E7ZA 4Y33A 2QUFA 1PUEE 1FLIA 4PSWA 4UUSA 4ANJA 1D8KA 2X6WA 1O3RA 5IPAA 2LDUA 1D0XA 5D5VB 3LSHA 2F07A 2WA0A 3PFYA 4ITVA 4FX0A 4BUPA 3CMEI 2VE8A 2A05A 4L9TA 4TV7A 2XDNA 4I09A 1XDUA 3I0TA 3HHGA 4F92B 3GZNB 4K2EA 3K8PC 1B9NA 3F3XA 3MN2A 5J1UA 1K4SA 2HI3A 1MJBA 3C2GA 2FEZA 1QNTA 3K70C 2F5EA 1QPMA 2LREA 3K9TA 3TMOA 1K61A 3KIOA 4HG2A 2KP6A 2LYCA 3B02A 1KYZA 1U0JA 4GFKA 1Z91A 2GAUA 4ZTFA 3S3OA 4XLAA 4GO1A 3TP0A 2DG8A 3KZ9A 2H94A 2JSPA 4OAZA 3RYRA 1MIJA 4CYCA 1LE8A 4N4OB 3RQIA 3E6CC 3ZQFA 3OYJA 1QU3A 4DNCA 5ED4A 1RR7A 4F52A 3FWEA 3ZMTA 5IYDJ 3BG5A 4NN1A 4OAYA 1AKHB 3O8HA 2DT7B 3I58A 4LMYA 3IRRA 1F36A 4RB0A 2XAHA 1MJAA 2NNYA 3BR3A 1BW6A 4M3BA 4YZEA 4BAYA 3GFLA 2MD0A 1ZR2A 2JA7J 2KIMA 3AG4H 3BR2A 4B43A 2X6XA 1W7PA 2JUGA 3WGHA 4BHBA 4H0EA 4XKWA 2GFNA 3I54A 2FOKA 3G3ZA 3ZOBA 3J7AO 3E7LA 1R36A 3CF2A 2QSFX 4ZZLA 2VN2A 4M9ZA 5HNFA 2ZY9A 2PMZA 4U87A 2DQLA 3GZ6A 3ERED 3M8EA 3RKQA 2ZNYA 2X4HA 4AUXA 2QSHX 3VPRA 2L9VA 5K1YA 2R7RA 2EA4A 3FM3A 3E97A 2E71A 5B66C 5HLGA 5CYVA 4ETSA 1PUFA 3L2CA 3DTIA 1W1WE 1A31A 2M30A 4YEJA 3H5AA 3MZYA 1J09A 3SFIA 4ZC3A 1TQPA 1YJ9I 2LD5A 1XMAA 4PCQA 4UVCA 3D0SA 5B1BH 1WFXA 5IT9Z 3NWTA 4XSZF 1E0EA 3BJOA 2W53A 4JL3A 2WV0A 4C3IJ 1IXSB 3LAPA 2DFEA 1I6HJ 1G2HA 3ANPA 2ECCA 5DD4A 3GTKJ 4L5JA 2KISA 5F1JA 3Q0UA 3Q5FA 1S29A 1LEBA 2R7QA 2X48A 2HKOA 4KIFA 2HQ5A 1UAAA 1P6RA 5JR3A 1N25A 3H0GJ 2ZBKA 4PGHA 4XNFA 2KZGA 2FBKA 5FGMA 4UY8I 5EDNA 2LY2A 4XKCA 2ZFUA 4XOTA 5HOOA 4XQFA 1ZAOA 5IP7J 3ON4A 1P92A 1YITI 4L5EA 2LH9A 3DV8A 2MC3A 2IGNA 4MFDA 2DG7A 3ZMUA 3PJRA 1MJ9A 2HU9A 4IL6C 5ICCA 5TJJA 4HF2A 4PUSA 4BJ5C 1R1UA 2CWEA 1SANA 1ZR4A 3K0LA 2YX4A 5E1WA 1HOMA 2IA2A 5F08A 3WTSC 2CQNA 5L3DA 3JRBA 1YW9A 4XLHA 5GPCA 2PX9A 3HKZA 4U7DA 4XLPF 2K9LA 1U5TA 1WVRA 2VQCA 1T8IA 3FMSA 2DN0A 3KLOA 4CDGA 3LL7A 2DA6A 4KICA 2NRAC 2CQXA 4EM0B 1WJEA 3K4BA 3JSJA 1IW7F 3N05A 3HOXJ 4ZH4F 3Q9SA 1USTA 2M7BA 1HDPA 4LGWA 3TO7A 3K70D 3OYMA 5HSZA 3REOA 1OQYA 4DYCA 4HX4A 3F8CA 5E3NA 2VBWA 2PJRA 1ETXA 3QU6A 4LB6B 2NNNA 3PPBA 1LFBA 5FKLA 3S32A 2DMPA 3DBRB 1EJ9A 4J01A 2HOEA 3OYIA 2M8EA 3I59B 2O3FA 3A1YA 2QQBA 2DPUA 3HKZN 4BE0A 2QGUA 1FBQA 5K58A 4EJUA 2AQFA 1K79A 4CCMA 1VQ7I 4NC7A 1IJWC 3AL0B 4A0XA 3G1MA 3F72A 1WRJA 3T8TA 4LLLA 3LSTA 4BQNA 3HTAA 4L62A 4ACIA 1JT6A 4DBRA 3DLLF 3LQQA 3S93A 1Y0UA 1YOVB 3FXKA 2MH9A 4CZZA 1BR2A 5TISC 5D5WB 3JRAA 1DU0A 2A07F 3HIMA 2CGPA 2GWRA 3HB9A 4ZYHA 1JKPC 3CP2A 3OIQA 2DK5A 2GOXB 3NEUA 2X51A 4RAGA 3RPQA 3VEPA 2VONA 2K40A 3ONQA 3LSGA 1JHFA 3BJAA 2OTLI 4M3EA 3GWZA 3RKYA 1TZLA 4HOBA 1DU6A 2I5UA 3GBGA 1ZLJA 2QKLB 5DCMB 2Y69H 3WU1B 4FTHA 4V19K 5FLMJ 3E7QA 1IF1A 2MSYA 5FRNA 2IRFG 2DYRH 4PGGA 4HPQA 1LEAA 1A6IA 3NRVA 2STWA 3JSPA 2VT3A 2F4MB 4KMUX 4EGZA 4P96A 3TDUC 3TQNA 4WIBA 2OAZA 3H5NA 4F3QA 1RRJA 4HSRA 4DIQA 3NS4A 2CQQA 2OZ6A 4AU7A 4KIBA 2KDOA 3J80Z 2DQRA 2EV5A 3OYFA 3H0DA 2W00A 4G7HF 2R7XA 2Q0OA 2XB0X 3ULQB 2R0QC 2X85A 5GTHC 1B72A 2K85A 1J59A 3HUGA 1W36C 1QZYA 4ESJA 1J75A 4N0BA 1U3EM 1I1GA 4ESFA 1IUYA 3NWSA 3JRHA 3CUQB 4MO7A 2GOMA 2CMPA 1R71A 4IOCF 3AQTA 5DEQA 2XF6A 3QKXA 2E7WA 1TNTA 2EIJH 4YIIA 1CF7A 5LEJA 4PJNA 3E6MA 2R7DA 1WJAA 1FMWA 2A5WA 1RC9A 2IA1A 3BQZA 1I39A 2Y75A 2DXIA 3W6VA 3R60A 2MW8A 5GTIC 1W5TA 4OMZA 2ZO4A 2DOEA 3KKDA 1Y8RB 3LSPA 2ISZA 3VIBA 2W25A 1R23A 5LLQA 1VQMI 5LEKA 4UB6C 3PO2J 2PBIA 3M1EA 5FLXZ 1OCZH 2NAZA 3N97A 1X1CA 1NH3A 1X4OA 3M9AA 4NB5A 2G7UA 1QPIA 2FU4A 3HOWJ 2JSCA 4YIFA 4XONA 4IKFA 3NQOA 3WE2A 2V1NA 1ETYA 4WF2A 2PBXA 3EUKL 2ELHA 3E5XA 2PLYA 1T0FA 2WWYA 2K9SA 2O03A 3FIWA 2R5ZB 1LFPA 3A0HC 4LK0F 1HC8A 2BEOA 2HKXA 3FISA 1SFXA 5CJ9A 4XORA 3MKZA 2Y0SN 4I76A 4A5NA 4A3EJ 1U5TC 3F9KA 3Q0VA 5JLXA 5HLHA 1MBKA 2AO9A 1R5ID 5D1RA 2V6EA 1PP7U 2E2HJ 2QBYA 1P4WA 1XSDA 3SDGA 3OIOA 5F0HA 1RI7A 1OYIA 4Y4RA 2VPLA 4D7MA 2ZXHA 2BY0A 4CHUA 4B47A 4CSWA 5GAEJ 3G6EI 4NUBA 4KWAA 2GZWA 4L5IA 4L9NA 3CD6I 3PUFA 4U0WA 3GTGJ 1JE8A 1K7AA 1IN4A 3BOQA 2WAQA 3HRUA 1MKMA 1TWFJ 3HTHA 5J4YA 2DMNA 1ZELA 4I02A 4XKVA 3HZJA 1I3AA 2L0KA 4NQWA 2X9DA 1T56A 4XLFA 1MMSA 5CLSA 3G4SI 2FXAA 2W1OA 3AKZA 2HOTA 3C2BA 4CO8A 1YW8A 1HF0A 1FSHA 1RESA 3W2AA 5C4XJ 2FA5A 2UXOA 1JJ6C 1OISA 4EGYA 1ZG1A 4AVPA 3FXUA 4FHTA 4LIUA 5D6EA 2L02A 1OMIA 2CFOA 3CF5F 5LHIA 1N75A 2R5YA 2DMTA 2EFWA 4BY7J 1MGTA 2MG4A 1Z6RA 5HDKA 4UV8A 3V8KA 3UR3C 2NOGA 4CA0A 4U9NA 2JMWA 2E2JJ 3MZ8A 3VSLA 2W4SA 3WE3A 3FZVA 2ME0A 2IJLA 3PNYA 5CVIA 2P8TA 3DBHB 1UI5A 4IHSA 3I9V2 3HGYA 5BNGA 1BI3A 1XCVA 4MQ9F 4IRIA 2D45A 3OL3A 4ZDOA 2R3SA 2KIFA 3R4KA 2EFNA 2Y0MA 3C2HA 3I5UA 3C07A 3BR6A 4DQ2A 5EFYA 1W0TA 1WCMJ 3DTEA 3A01B 5FD5A 4II2A 2VXDA 4GCTA 4P1WA 1BBYA 2KHMA 5DD8A 3CMAI 1ONVA 2XGDA 3BR0A 3NAUA 4L18B 2PQ8A 4E70A 2OA4A 2R7FA 2AQEA 1ZREA 4O3MA 2L54A 4RAZA 4Y17A 5KAIC 4D9JA 1W36D 1AKHA 5B5EC 5AONA 1LUJB 3S1NJ 3A02A 4B09A 2QOPA 3V78A 5CPRB 2K86A 3JR9A 1REPC 2LRDA 4PZJA 1QHGA 1STZA 1LVKA 3EUHC 3LFUA 4HQEA 2HDCA 2OERA 4XM3A 3D5RC 1X3ZB 2K5CA 3LFKA 1G8XA 3ZR8X 2L9RA 2CQ7A 4MEYF 3FF5A 5DM6F 1MBHA 4V2FA 2WBMA 2E2IJ 3GTQJ 4QIWN 1KONA 3D5LA 3COAC 3GFMA 2Q2EB 4S04A 1S8NA 5EEGA 3DF8A 5FLXK 2LG4A 4ZYDA 2DFFA 4JP0A 4UUVA 2BXZA 2IA0A 3KZZA 3HG9A 3U9GA 4BQOA 4ZYEA 5H2FC 3SZPA 2A6TA 4XOPA 1H89C 1FEXA 4YFXF 2H27A 3FKIJ 4F91B 1LB2A 3L00A 5GAGJ 1T6SA 1SD7A 2COBA 1H0MA 3FK6A 1ETKA 5BMZA 3TW7A 3Q9VA 4G9YA 1HBXG 3IH4A 4XLEA 2BZTA 2LY1A 1HCRA 4MNUA 2OC6A 3KYLA 2KJBA 2XRNA 4IEJA 1U6GA 5BQTA 3I3LA 5HS8A 4HZFA 4RGXA 2W82A 3WTTC 2L7FP 1LDKB 1SFKA 4Y15A 2ESHA 3VYTB 2PMUA 4A3MJ 2MD5A 3OR1C 1JUPA 2UXIA 3O60A 5EEHA 2P5LC 1HXDA 3PO3J 1HKQA 3S2WA 2I8DA 3GCMA 3VYSB 1GXQA 2JT1A 4XN0A 4GCVA 3LJLA 1WKMA 4UDSA 4HW0A 2B9SA 2DAOA 3KP5A 1X58A 5CVUA 3EUPA 2Y9YA 2G7HA 2PZ9A 3EPZA 4MTEA 4CICA 1BJAA 2B1EA 2X6YA 4Y52J 2FBQA 2M0CA 5EG0B 4II3A 5FD6A 2XROA 1LQ1A 3ABLH 1XMKA 5E18F 1S7OA 4HNVA 3V4GA 2XRLA 2DLLA 2DK8A 2J5PA 1JHHA 2HR3A 2RNJA 2AXLA 3ZMDA 1WGXA 1P9QC 1X1AA 1JGSA 4G94A 4BDZA 1JKOC 1IN6A 4I7HA 3WTZA 2A3SA 3L09A 3MZHA 2LC2A 1FYLA 1ZRDA 2EH3A 1FWZA 2HVRA 5F0CA 2A61A 3P5JA 2EINH 1BI0A 3QYFA 1UG2A 4JQFA 2QWTA 3GX4X 2ZFWA 2LKSA 3JRIA 1BI1A 2P0WA 4IHYA 2O5RA 2XHKA 3FXQA 4BKXA 4DOZA 2REKA 4W97A 2VKEA 4CZCA 5DYMA 3LSIA 1D3YA 2VBZA 5IOZA 1YFHA 2WGBA 3KZYA 3GZ5A 3CC7I 2KL4A 2LK2A 5HDNA 1A36A 3ZMZA 4IPAA 2ZSIB 2MGQA 1OR7C 4KN7X 2RDPA 3BLYA 1R1VA 5CQGA 1Q1VA 2YU3A 3I64A 3DXJF 2DTZA 2XV4S 2NVUB 2IGKA 4CYDA 2HWVA 3F6VA 1Z3XA 2I10A 4U88A 1QRYA 4C3JJ 5GPAA 3I59A 2KRFA 4ZYAA 4ENNA 5D5XB 3HOUJ 3V42A 2VE9A 4MHGA 5FFXA 1IV6A 2W57A 3ZQ7A 2H1LA 2O8KA 2CFXA 2FUG2 5EF6A 3VP5A 4HA8A 4AYBA 2EZLA 3IH2A 2NVYJ 1SVLA 3BDDA 4Y3OA 1P7JA 4HNUA 2WV1A 2QQ9A 3TGNA 1LFUP 3BZKA 2DOFA 3HRMA 1KU2A 2BGCA 1FOXA 4WXCA 4N4NB 1EH8A 1SFUA 3RKWA 4BACA 1NK3P 1S3JA 2EFOA 3KNWA 2EPFA 1VZ0A 2PI0A 4NC6A 1QA6A 1EV7A 2MYSA 2LSOA 2GUHA 3HXLA 2EZKA 5CVJA 1V5EA 1Y56A 2AXTC 4Y13A 2DYSH 3AG3H 3WG9A 4DYQA 5A2QK 1ETQA 2XAJA 4RAYA 3UKGA 4XR6A 4A3FJ 3HSEA 3Q3SA 5J40A 4HNTA 5DCMA 4G6DA 5HDGA 3S8PA 3BNIA 1Z21A 3BP8A 2DT5A 3SYTA 3W2VA 5JLWA 5KK1A 1LPQA 2F5DA 2OBPA 2UXXA 2KKOA 2OD5A 3ABMH 3MMYB 4JBAA 4PDKA 1CQTA 1A04A 1DUXC 2QQAA 3LMMA 3BG7A 1RR8C 4IQ4A 4KDPA 1R22A 4R8HA 3BJBA 2HVSA 1DPUA 1FOYA 1O57A 5E17F 2RGVA 1LJ9A 4GGGA 3CDLA 3GLXA 2BBYA 1B59A 1IRXA 2ADUA 4M3GA 1R9TJ 2Z2SB 1H88C 1IC8A 1PJRA 4BE1A 3GXOA 2WY8Q 4ZDPA 3PIPF 5LGUA 2HDWA 3CUQA 1ZLKA 5DCFA 2GXBA 2FNPA 2Z9OA 2Q1ZB 3N4MA 1E3OC 3GTLJ 1J5YA 5HAWA 3MAJA 3DTKA 1JTYA 3LA3A 2KFDA 4OD5A 4X1EA 5LHGA 5EZGA 2LLKA 3K4JA 1U8BA 3G2BA 2D2WA 4BS9A 4Q4ZF 4A3KJ 2FBHA 1OKRA 2EV6A 4ZZDA 4MXMA 4IOAF 1DGRM 2R93J 2M9HA 1PP8F 1K78B 1PDNC 3K4KA 3MWMA 1YI2I 1IDZA 2XB5A 3GMEA 4YG2F 2CV0A 4IHTA 4DW6A 3SFZA 3QWLA 1TL8A 2ZCNA 5D4SA 1T33A 5KHDA 1U78A 1BIAA 1TWGJ 1UB9A 1D5VA 1QQIA 4M72A 2E1CA 3PNVA 4R1HA 3EYIA 1TC3C 1JUMA 1IN7A 3TP3A 4MTDA 1VQOI 1KU9A 4GYGA 5E20A 1V4RA 3BCBA 1XGOA 2L7MP 1BIBA 3K4MA 1PVEA 2DBBA 2KT0A 4OIRF 2JQ7A 3IWZA 3CO6C 3V7RA 2OUMA 2R5ZA 1D5YA 5ERIA 2QCOA 4EM2A 1IRZA 1MNDA 1TLHB 3TW6A 5D5UB 3RPUD 3F6OA 2CUJA 2VODA 3V8LA 5J8FA 3QPLA 2PMZN 1TW2A 3F23A 2HQNA 5BPDA 1QHHD 1X3WB 3ML6A 4B8XA 2KZVA 2M87A 3CESA 1BR4A 1SFEA 3DKWA 5L3EA 2LKPA 1JXSA 1XG1A 2HQAA 2EIMH 4YELA 3RYPA 4Z6YA 2HEOA 4G6TB 3WTYC 4EEFG 3E1SA 1B8IB 2JA5J 3FXLA 1T98A 4NDLA 2G7GA 2QYOA 4KT5C 4M71A 1JKRC 4A93J 2JUCA 3NRGA 3BZCA 1M1EB 1J0RA 4QWQA 4HRIA 1Z67A 2ID6A 2L2OA 3OYLA 3LAJA 1XX5A 5GADJ 1JTXA 2R4GA 3SZTA 1V54H 2OZUA 3JW4A 2H09A 2F4IA 5H6QA 3G1LA 3KEQA 3CRJA 2F4OB 2XKPA 4WWCA 2E19A 5B1AH 3WU0A 2IGMA 5CKTA 2ZMEC 1ON2A 3I53A 2HYGD 1JJ8C 2EZIA 3CCJI 1Z7UA 3EETA 5C3EJ 2OU2A 5GAHJ 1XB4A 5EZHA 1L3LA 1BN5A 1GHCA 1DPRA 1E3PA 3O3KA 5KAFC 3K1PA 4U0YA 1G6NA 1OYWA 2ZCMA 1MMDA 3CUOA 1Z05A 1IG7A 3KP3A 2V1XA 1RIOH 1X1PA 3HSRA 3WGGA 3K1NA 2XPUA 2EFQA 3TOBA 4KT6A 1NG7A 3A4CA 3KP2A 2MLGA 5K5OA 4BQAA 3X2QH 2G0EA 4IRVA 1ZH5A 4UVAA 2V1DA 2HTJA 1BOAA 3LWFA 3ZQGA 1S9HA 1UHMA 2GXAA 3GFIA 3HL2A 1ZHFA 3HOZJ 2DOAA 1X2NA 2W48A 3WTUC 1BC7C 4AVZA 4GFLA 5JHUA 3WHCA 2DT6A 4OU0A 2K02A 2ID3A 1ZGJA 3BR1A 1YG2A 3PIOF 1IAWA 2IS2A 1Z77A 5BPIA 3IUOA 1Y1WJ 4XRFA 4C9YA 1DP3A 4OINF 1F4KA 4M74A 5BOXA 1J7KA 2L4AA 1LDJA 1TP4A 2Q2EA 3CZ6A 4IZZA 4RBOA 5DTDA 4AWXB 1N77A 3ZRGA 2RQQA 4NELA 4ZJZA 2WTEA 3VYRB 5LD2C 1ZN2A 1UZCA 3QAHA 1AA7A 5HODA 5IYCJ 1R4NB 4D0PA 4HDUA 2LVSA 2Z99A 1AU7A 1VQ9I 2NP3A 2UXPA 3H9GA 5KCMA 3S16J 4UVBA 3NXCA 2FF4A 1KGSA 2V57A 1WI3A 4X0GA 3SDBA 3VVXA 2G7LA 5FHPA 1R1TA 1FIAA 3NI7A 4ENKA 4A3CJ 2M8GX 3HPHA 5IT9K 2KDZA 3SZGA 2KIQA 3V8JA 3IL2A 2LR8A 3JRDA 3LWJA 2E5ZA 4HKUA 3AG1H 4A12A 2RASA 4HF0A 3GZIA 3HTUA 4Q48A 3AG2H 4E6KG 4E7KA 2JPBA 4GFBA 1ULYA 1PYVA 4LK1F 2VUMJ 1TWAJ 3CCVI 1O7LA 5AQCA 4RS8A 4BXFA 3O2PE 3T5XA 3G73A 4LLNA 3R61A 3BTCA 3H35A 1TWHJ 2Y9ZA 2MFZA 3ZGKA 2XSDC 4BDYA 1ERDA 2PJPA 2XDVA 5J1YA 3S1MJ 4J19A 2DJIA 2FD5A 1OCOH 1WJCA 2JPCA 2VC1A 1VFCA 3QRFF 1R49A 1VNDA 2QWWA 5EG0A 1NTCA 3DPLC 3F8MA 3JAMZ 2QSGX 3RD3A 5C44J 3L9FA 4I0BA 2X6OA 4AIDA 2K3PA 2DPDA 1MNEA 2BV6A 4E7LA 1OJLA 2DA7A 1R5HA 2KQRA 1IN8A 3PNTA 3JTHA 5LGNA 1H8AC 1G4DA 2DJNA 2XPWA 4XSXF 2WAFA 2O9LA 2ELJA 1V55H 5J6XA 4XN3A 2IU5A 4E4HA 2KJCA 3R6SA 1BM9A 3KKCA 4LOCA 3VVYA 4ENMA 4U9LA 1S7AA 3K4CA 3FMRA 3RTRA 3FMQA 3BCGA 2L5QA 3ROUA 4OD4A 3OYBA 2TCTA 2MH2A 3MEXA 3PUBA 4OIOF 4P9UA 1WJBA 3MCZA 4JOMA 3J7YJ 2P7CB 3BG9A 2V79A 4BJTA 1ETOA 2GIZA 1QZZA 1Z3YA 3HYIA 2J5OA 1X3UA 2MC4A 4P5OA 2V1UA 2K7LA 1FJLA 3TKYA 1UHSA 9ANTA 4ABZA 3DQVC 1OYYA 5IY5H 4IO9F 1T2KA 4IQJA 4FE4A 2CW0F 2XGEA 3OSFA 1DQUA 2CS3A 2COMA 3OMYA 1CGPA 4LIVA 5K5RA 3TO6A 4I6ZA 2D5VA 4CUGA 2KMUA 4YRVA 2QLZA 1YTYA 3HSFA 3BPVA 3CCSI 3ZQIA 1VQ8I 1MH4A 3ON2A 5IP9J 4YIRX 4MEXF 2V26A 3CP8A 5DS9A 5CQEA 1T38A 1ZARA 4WCGA 3K69A 4E7SA 1FP2A 3QU3A 5TRDA 3T8RA 2Y2ZA 4FQGA 2VOOA 4JX6A 2GM4A 2BYVE 3GTJJ 1O3SA 2BVLA 1KQ9A 4KUMA 3P9CA 1I27A 4RB1A 2K4BA 2A68F 1ZRFA 1ETWA 3ABTA 5H6RA 1UCRA 4C30A 2ZSHB 3RJPA 2WAEA 2UV1A 2FBIA 4NNJA 3KX2A 4L0ZB 5FKNA 1FBSA 3A2KA 1OCTC 2ZKZA 4WK8F 1ON1A 1W7PD 4A6EA 2AHQA 2VQGA 2WAQN 3CCQI 1MDMB 1XGSA 4A3GJ 2F5FA 3L7WA 5CVRA 2L01A 2DA5A 1VQNI 3DPTA 3R0JA 4BBSJ 4A3JJ 3F8FA 3DKYA 2WY7Q 2UXHA 2FQ3A 2M7AA 3WODF 2IBDA 3CJNA 3DEWA 3KCCA 1HLVA 2V6CA 2L4MA 3J80K 1SMYF 1YJNI 2WC2A 2DA2A 1U5TB 2BOLA 1UI6A 3GYHX 3JRCA 3CLQA 1E2XA 3JTGA 3CO7C 2DODA 4S05A 4OIQF 2CQKA 2GBYA 4G12A 5LHHA 1N78A 2ZJQF 3VOXA 2QKOA 1YYVA 3DLAA 3HOTA 5HVQC 1JGGA 2X1CA 4DZJA 1MBFA 2MABA 2FNAA 2Q8KA 1Y1VJ 4FISA 4PK4A 3TOAA 3IKTA 3C7JA 3KP6A 3VW2A 4JKZA 5E1ZB 4A2UA 1OCPA 1VQ6I 2MLKA 2DFHA 2JJ7A 3L2QA 3JCUC 4JYKA 1SAUA 4H4KC 4WXHA 1KU3A 1GVJA 4FASD 2FMYA 1IUFA 4EJOA 3J7AY 4JX4A 1BI2A 2V9KA 3I4PA 4M6VA 1U2WA 1G3SA 1K78A 3IV5A 3B73A 4EM1A 3VB2A 3H5RA 3CQZJ 1S5LC 2DA4A 1ACIA 2ACJA 3WG7H 1J9IA 3HC7A 4KITB 4S0HB 2YVEA 3UNGC 2M4KA 3COLA 2LF7A 1HQCA 4V2GA 4CCJA 1GXPA 5LBQA 3M7GA 2XASA 4UHTA 1KA8A 2HPIA 1VQKI 2NXNB 3GVAA 2FOWA 1FTTA 2D1HA 3TO9A 3CMMA 2ZJRF 2E1OA 4RGUA 2IEKA 3KYDB 3AAFA 1H9GA 4IJAA 5AIPA 4BQQA 3HOSA 2O7TA 1XS9A 2IGOA 1YIOA 2M4GA 3MFKA 3S17J 2YUSA 1Z9CA 4C2MA 3C1DA 3H9JA 4RA2A 1EKEA 1WHUA 3OL4A 4UV9A 4HF1A 1S6LA 3J81Z 3MNLA 4PJLA 3IH3A 5CW8A 5F6FA 4LITA 3RIRA 1T0FC 3ECOA 3JRGA 3OYAA 3KE2A 1I1SA 3BTJA 4L9JA 2P81A 2OF7A 4L9VA 1MBJA 4BGDA 3G71I 3CLOA 4HLYA 6PAXA 4KNYA 2B7EA 2XVCA 1EH6A 1B8IA 2CO5A 1XGMA 3VSKA 2O8XA 1HA8A 4ON0A 1O3TA 3F0CA 4L0YB 1AOYA 4MGRA 4Q47A 1XDSA 1ZK8A 1XC5A 3S15J 3VTIA 2VC0A 1B72B 1MNMC 2EFPA 2NX4A 3KFWX 4XRMA 5HS9A 4EVIA 4RMNA 4EV0A 2ZCXA 1W5CC 3KP7A 1LDDA 3MKYB 3FK7A 1WSUA 2L7KA 3K2AA 4LB5A 2IW5A 2LOOA 2QKMB 4I0AA 2EIKH 4EMSA 2W85A 2HFHA 1Z0XA 2DA3A 2VKVA 1SAXA 3KETA 1VQ5I 1XMXA 3AFHA 2VKDA 4OWRB 2JRMA 3I4NJ 2CSOA 1R4MB 2NS8A 3PFIA 1HKSA 2E1MC 3ABUA 1UMQA 2E60A 4PFPA 5D8LB 3SJMA 4LLGF 2ZJ2A 1FZPB 1TT0A 1WQ2A 1O7FA 2K4JA 4HAMA 4YFKF 3FDYA 4M6YA 3R0AA 1UJ8A 5H20A 3H3VK 5J47A 2QEXI 2L3DA 3T6NA 4IHWA 1J2XA 4QPQA 2N8GA 2WUIA 1ZGAA 3NARA 2UWMA 5FFZA 3IRQA 4OIPF 2VXZA 2JTVA 1P2FA 3ZQCA 4QPOA 1LKXA 2V7FA 1F1ZA 1Y0NA 2EZHA 2HXIA 3F8NA 3DBLB 1T95A 3K1MA 4IF4A 2ZJPF 3FHNA 3FXOA 5FKKA 1Z1DA 3CDIA 4FT8A 3DCFA 5D4RA 3S1QJ 1BR1A 2VJJA 4G7OF 1DP7P 3EQLF 1TWCJ 3P9KA 3PL8A 2F48A 4GRIA 3RI4A 4D5CA 1IXRC 2JZYA 2R7WA 4HV6A 1B4AA 2EV0A 3QP5A 1XTAA 4LD5A 4MIMA 3WTXC 1H9TA 5F0FA 2QF7A 4B3XA 1Y6IA 3ZP5A 1IV8A 1ZG3A 2M45A 3OWTA 1Z6TA 4ENJA 3CDHA 1YE9A 1D8JA 4RM2A 2Q24A 2FRHA 1WJ5A 5EGOB 2LNBA 4I99C 3WGIA 1BJZA 5FGLA 3P7NA 3HBLA 1JI8A 1GVDA 2K9QA 2XAUA 2QIBA 5IYBJ 2HZDA 5FKOA 5HNHA 3I55I 2VJIA 3ELKA 4MFEA 3HOYJ 4A0YA 3L2WA 4LG0B 4D5FA 4G8XA 1D0YA 2V9PA 3SEQA 2ISYA 2V9VA 2OCCH 1D1AA 2O6GE 4HBLA 2XF7A 1ITYA 1U9OA 3NNRA 2RVCA 2YVHA 2VB6A 2PFVA 4XK4A 4AYBN 2IS6A 1S7EA 3S3NA 3H3ZA 3IHUA 3BY6A 4BEHB 1XSXA 2DO7A 3HDDA 3HE0A 1B9MA 2JK3A 1F5TA 4G6QA 2R5YB 2GLOA 5IOYA 4FE7A 1MMNA 1A35A 4B4CA 1KQ8A 3J81K 4C2MJ 1L0OC 1QO0D 1RNLA 3DWLE 4M9SA 4DGWB 4HDVA 5J8CA 3HGGA 5K5QA 2HXOA 2HQRA 4FCYA 2RAEA 1TQMA 1WI9A 2E36A 4IXAA 4BH9A 2D6YA 4U7BA 2JA2A 4J00A 4I01A 2RHAA 2M5WA 1O4XA 2QQ8A 2DI3A 4AD9A 4QTRA 4ZYGA 3QPSA 3KYCB 5LGTA 2HS5A 3CMYA 4CCLA 4EQQA 1SD5A 5D6FA 1X4PA 3U1DA 4C3HJ 4BYYA 3C3WA 3K4LA 2LBFB 4JNNA 2LFBA 2VJ4A 4RGSA 4D1QA 5J3LA 1VF9A 2VT2A 1V5FA 3QOPA 1SFOJ 2CV1A 3QYBA 2VLAA 3I71A 2QA4I 4DVYP 3M8JA 1WH5A 1D0ZA 1XSVA 1EH7A 2ZXJA 2VOPA 2R7SA 4RDUA 2Y30A 3GTMJ 3IAM2 2K3FA 2CYYA 2CV2A 1FYMA 1QZEA 5JVTA 2XUBA 2UZKA 1ZRCA 2BY1A 3T1BA 1SEUA 4MK6A 4XKBA 2A6EF 2ZOZA 2ME6A 3VOEA 4AM3A 1ZYRF 2ZXWH 3MD2A 4ZDLA 2NS0A 2RN7A 1MMGA 2O61A 1XGNA 2HDDA 3IUVA 3FXJA 1IN5A 2BHZA 2TDXA 3ZQLA 1MBEA 2ETHA 2VQLA 2F5VA 2H6BA 1G3YA 2BVMA 1QVUA 2P4WA 2QM3A 1HW2A 3W3CA 5FJ8J 2PFBA 1FPQA 2A2FX 1ODDA 4HSTA 1YRNB 5L3FA 2EK5A 1FMVA 3HEFA 1SC7A 1EA3A 5C4JJ 2BY3A 1MBGA 1FP1D 3LOCA 2YVXA 3PSFA 4RB2C 1TBXA 3OV8A 2H1KA 1YJWI 3OS1A 2P7VB 2ZB9A 1S72I 2RKHA 4A69C 3U1KA 3IP4B 2QVOA 3JREA 3C18A 1WZ2A 2VASA 1FOWA 1ENHA 3MVPA 4XRSA 1HDDC 4GXOA 3E0JB 3NPIA 5L3GA 2DFIA 3FHZA 2VBYA 4XBFA 1SVOA 5E1XA 3BCAA 5FRMA 3QYEA 3OS2A 5TGTA 1WJDA 2OV7A 1HW5A 1NK2P 3RDIA 1ZTRA 1GDTA 2JVGA 4LG3A 4XL9A 1RKTA 4RAFA 4HV5A 3QBMA 1UELB 1MW7A 2XPVA 4NBQA 2XC7A 3MKWB 1IZ1A 3RQ4A 5HLIA 3BG3A 2BW3B 2E35A 2LKXA 4A3DJ 1ZG5A 2RREA 2P5VA 2X1EA 3LA2A 2VKHA 4JK1X 5D8KB 3I56I 3DU6A 4QSHA 2RV8A 1POGA 3K7AJ 1NG6A 2BE5F 3AL0C 2CJJA 2CG4A 4M3FA 3L2VA 2BHYA 1IRFA 3SXYA 1JT0A 1IDYA 1Y8QB 1FT9A 2UXNA 5M3MJ 5IT3A 3GEUA 5JHFA 4LJZF 3S2DJ 2Z16A 3DPJA 2Z1DA 2PG4A 4BJ6C 3CJDA 3OIPA 1HW1A 2JRTA 1YX3A 2NOJB 4XRSG 3IWFA 1VQPI 1APLC 1EF4A 1MDMA 3BC8A 1JKQC 3W2WA 3J7ZI 5EYRA 2C6YA 2B3WA 3DFGA 1B6AA 4PJMA 1YS7A 2JVHA 2HTSA 2XF5A 1G3TA 5JVGF 3IAS2 4AIJA 2Z3YA 2NS7A 2NVTJ 2VJ5A 4W1UA 5BS6A 2IP2A 3FM5A 4HEA2 3U2RA 5L3BA 4G7ZF 2K27A 2VPRA 3Q0WA 2M1BA 5CVVA 2H8RA 1P4AA 2V4JC 3QQAA 3E3VA 2IS1A 3A01A 4CCKA 1MD0A 4GCLA 3VWBA 1A6QA 3IKVA 3ZN1A 1UHWA 3HTIA 3I4MJ 4RLQA 5M5WJ 2PN6A 2FE3A 3M07A 3WHBA 3VVZA 2R7ZJ 2O7OA 2GA2A 4IRHA 1K83J 2BXYA 2G9WA 1BOBA 3OS0A 2QTQA 4HX7A 1WJFA 2E1NA 4FX4A 2IT0A 5H9TA 1TT5B 3GTPJ 3PQKA 4AF5A 4X6AJ 3CTAA 1C0WA 2CRGA 1BW5A 1YIJI 1OFCX 3G7RA 1LVAA 2KLOA 3ZMVA 5F1RA 2QZ8A 5M5YJ 2HYFA 2R7VA 2NYXA 2VIXA 3L2RA 1I5ZA 1RETA 3OYNA 3CUQC 4HYEA 5F64A 3LSKA 4CGRA 2JN6A 2STTA 2RC4A 5F04A 1FTZA 2ICWG 5K7FA 2ZMEB 2GA1A 2PMHA 5AIQA 4BXXJ 4O5VA 2K9NA 5ICFA 3ASNH 3FX3A 1G3WA 2E5NA 4EJVA 4WX9A 4ZTJA 3FXMA 1Q1HA 4B44A 1YS6A 3CCUI 3DPUA 3S3MA 3CC2I 3BTIA 4UUSB 3MKLA 4U0VA 4I2OA 2IAIA 1R5GA 2CW8A 3OYHA 3CCMI 1ORKA 4KA4A 3T0YA 4E7IA 3JRFA 2IXSA 3HIFA 4GDFA 2ZOYA 3ERMA 1R7JA 1AHDP 3VUQA 3VOKA 1SD4A 4AIHA 2B0LA 2LF8A 1UFMA 2HNHA 1YW7A 3BZ6A 1QVTA 4IRGA 2AS5F 2DW4A 4HLXA 5HS7A 3QODA 1YX5A 3TDZC 2LP0A 2OQGA 2E34A 2KRHA 3PM1A 4NC8A 2L7ZA 4IHVA 3H9QA 2K9MA 1SVMA 4AC0A 1F43A 3OYDA 3E5QA 4BBRJ 3KPHA 2G3BA 2OPTA 4R79A 2RQPA 4GCKA 3O8GA 3HTSB 1KZHA 4BY1J 2OJED 4ESBA 1MZBA 1IRGA 4B1RA 3EUAA 3RSNA 3FBIB 3EUHA 1MH3A 2R7OA 1RUOA 5FO5A 4CYCB 2HYJA 1LE8B 5E3OA 3EDPA 5DV5A 3F21A 2UUZA 1RKWA 2GQQA 3VW0A 2DA1A 3OOPA 3BJ6A 3KEYA 2DCEA 3BT9A 4BNCA 4IX7A 5DUKA 4PXIA 1X19A 2FQ4A 3ZCOA 2VQHA 1W0UA 1VTNC 1BA5A 1I50J 3CCYA 1D1CA 3WU2C 3CCLI 1W7PB 5E3MA 1E17A 3DEUA 2ZCWA 3P9IA 1X2MA 4EJTA 2XIGA 2WADA 2NP5A 2Y0SA 4WXDA 3A03A 1KYWA 2W84A 2GXGA 3SEZA 2WB1A 2YSRA 1YLFA 4ASNA 2XAQA 2P5KA 5CXIA 3K6GA
chains in the Genus database with same CATH topology
1ETQA 5FMPA 1FTTA 5F08A 3JRBA 1WPKA 3UKGA 4A3FJ 2CUFA 3Q3SA 5GPCA 5M5XJ 3G56A 3D1NI 2DMQA 4AC6A 2E1OA 3BNIA 2IEKA 2DN0A 2DA6A 1PUFB 5JLWA 2O7TA 2CQXA 2JWTA 1XS9A 1WH7A 3S17J 1A5JA 2YUSA 3JSJA 3HOXJ 3TEDA 1CQTA 1HDPA 5HSZA 3MNLA 4DYCA 3IH3A 5CW8A 5E3NA 3BJBA 1SGMA 3JRGA 1ETXA 3BTJA 3CDLA 3PPBA 1LFBA 5FKLA 1R9TJ 4M3GA 2P81A 2OF7A 1H88C 1MBJA 2DMPA 1ETVA 5IP6A 1IC8A 2HOAA 2WB1N 3LSRA 1MSFC 5HBUA 4A3IJ 1B8IA 3BRUA 1JUSA 2HOSA 3RH2A 3F0CA 1E3OC 2CUEA 5F27A 3GTLJ 1ZK8A 1XC5A 3S15J 5HAWA 3HKZN 1B72B 5K58A 1JTYA 4X1EA 4ME9A 5EZGA 2LLKA 1MNMC 2NX4A 1U8BA 4XRMA 4IHXA 1IJWC 3OOUA 2ZCXA 4A3KJ 5EGOA 3G1MA 4MXMA 1I3QJ 3FK7A 2R93J 2M9HA 3K2AA 1IDZA 2XB5A 4ICHA 2NVXJ 1Z0XA 4DW6A 3HTAA 2DA3A 2VKVA 4L62A 2ZCNA 4ACIA 1JT6A 1U78A 1T33A 1TWGJ 1DU0A 3I4NJ 3JRAA 1TC3C 1JUMA 5E3LA 3HIMA 2JA6J 2NS8A 3HB9A 3TP3A 1JKPC 3RZDJ 1UMQA 4JX5A 1BL0A 2HKUA 3SJMA 3BQYA 3S5RA 2K40A 3LSGA 2L7MP 4M3EA 3OSGA 2KT0A 4D7NA 2XGCA 3H3VK 5D19A 1DU6A 2JA8J 3GBGA 3T6NA 5D18A 4FTHA 3E7QA 5FLMJ 2R5ZA 1D5YA 4IHWA 2MSYA 2QCOA 2YS9A 2B63J 4A3BJ 2N8GA 2EBIA 1IRZA 3M4OJ 2WUIA 3NARA 1A6IA 1IGNA 5CXGA 3TW6A 3LSJA 1GV5A 4A3LJ 3AQSA 3ZQCA 3G1OA 3B81A 3QPLA 2PMZN 2CQQA 2EZHA 1GV2A 2HXIA 3FRQA 5DAJA 5GP9A 5FKKA 2R0QC 2XB0X 3S1QJ 3DCFA 1B72A 1TWCJ 1XG1A 4D5CA 1U9NA 4EEFG 1B8IB 3JRHA 2JA5J 4MO7A 4NDLA 2G7GA 4A93J 1JKRC 2R92J 3AQTA 3QKXA 3ZQHA 3NRGA 4MIMA 5F0FA 2QF7A 3GTOJ 1RPWA 2ID6A 2Q24A 1JTXA 4UUTA 5EGOB 2TRTA 3BQZA 3W6VA 1BJZA 5FLVA 5FGLA 3HBLA 1GVDA 2K9QA 2MW8A 3G1LA 5IYBJ 2QIBA 2DMUA 3EGQA 5FKOA 3CRJA 4DZPA 3S2HJ 4MFEA 3HOYJ 3KKDA 3LSPA 4D5FA 3VIBA 2E19A 3PO2J 1GUUA 1JJ8C 2EZIA 1ITYA 1U9OA 3NNRA 3HM5A 1QPIA 2YVHA 5C3EJ 3HOWJ 4XK4A 4AYBN 1S7EA 5EZHA 1YRNA 3BHQA 3P9TA 2PBXA 1ETYA 3HDDA 4B3AA 3RZOJ 3HE0A 2JK3A 2ZCMA 2R5YB 2GLOA 2K9SA 5IOYA 4FE7A 1IG7A 3FIWA 2R5ZB 4DYRA 2XPUA 4B4CA 4MLOA 4C2MJ 3FISA 2EQRA 3HGGA 2Y0SN 1ZKGA 3B6CA 2HXOA 4I76A 2OI8A 4FCYA 2RAEA 3B6AA 2G0EA 1GT0C 4A3EJ 3Q0VA 2D6YA 5JLXA 3VW1A 3S14J 1MBKA 2AO9A 3BR5A 2RHAA 5C4YA 5D1RA 1O4XA 3ZQGA 4QTRA 2E2HJ 3QPSA 3SDGA 3PASA 3HOZJ 3OIOA 1X2NA 2W48A 5F0HA 5K7HA 3CMYA 2ECBA 4D7MA 4C3HJ 4JNNA 4GFLA 2LFBA 3WHCA 4KWAA 2FX0A 5J3LA 1VF9A 3GTGJ 1P7IA 1SFOJ 2VI6A 1WH5A 2ID3A 4XIDA 1ZQ3P 1TWFJ 2ELKA 3BR1A 3M3YJ 3HTHA 1Z77A 2DMNA 4RDUA 1Y1WJ 2Y30A 3GTMJ 2L0KA 2X9DA 1T56A 2HOTA 3C2BA 1HF0A 2G7SA 4MK6A 2M2EA 1RESA 4XICA 4RBOA 2ZOZA 2ME6A 5DTDA 5C4XJ 2UXOA 1JJ6C 4NELA 1VI0A 3LNQA 3LHQA 2HDDA 5HODA 2UXUA 3BTLA 3IUVA 3ZQLA 1MBEA 3HTJA 2R5YA 2DMTA 4BY7J 2HYTA 2MG4A 5IYCJ 1ZGWA 2UXPA 2LVSA 1QVUA 1AU7A 2NP3A 3L1PA 5FJ8J 2NOGA 3S16J 2NVQJ 3CWRA 3NXCA 2V57A 1WI3A 2JMWA 2E2JJ 3V6GA 1YRNB 5K7ZA 3HEFA 2ME0A 3VVXA 2YU9J 5C4JJ 2G7LA 5FHPA 1FIAA 2LY9A 3NI7A 1MBGA 4A3CJ 2LTPA 2M8GX 3LOCA 2Y31A 2KDZA 3JRDA 2LR8A 1UI5A 2H1KA 3LWJA 2ZB9A 1FIPA 3HGYA 4A69C 4HKUA 3JREA 5BNGA 5M3FJ 5FKMA 1ENHA 3MVPA 4XRSA 1HDDC 2RASA 4Y7NJ 5EEAA 3GZIA 3NPIA 4GFBA 2VUMJ 3BR6A 3C07A 5EFYA 1W0TA 1TWAJ 1WCMJ 3S1RJ 2CU7A 5AQCA 3A01B 3BTCA 3F1BA 1TWHJ 2Y9ZA 5J1RA 4GCTA 1NK2P 2XSDC 3NAUA 2XGDA 1ZTRA 3BR0A 1GDTA 2M34A 1RKTA 1MSEC 5J1YA 2FJ1A 3S1MJ 4J19A 1AKHA 2FD5A 3QBMA 3S1NJ 2XPVA 1VFCA 3A02A 3V78A 2QOPA 3BG3A 1VNDA 3JR9A 2LKXA 5EG0A 4A3DJ 2OERA 1NTCA 3HOVJ 3ANGA 4QSHA 3RD3A 1POGA 3K7AJ 5C44J 2L9RA 2X6OA 1MBHA 4V2FA 2CJJA 2E2IJ 1OJLA 2DA7A 4M3DA 3GTQJ 4M3FA 4QIWN 1JT0A 2GENA 1IDYA 3GEUA 5M3MJ 3S2DJ 1H8AC 3DPJA 2DJNA 4UUSA 3CJDA 2XPWA 4JP0A 5IPAA 1APLC 4XRSG 2O9LA 2F07A 2IU5A 1EF4A 1JKQC 3KKCA 4LOCA 5EYRA 3VVYA 1H89C 2XDNA 1FEXA 3FKIJ 3BCGA 2TCTA 2COBA 3MN2A 3FK6A 2NS7A 1ETKA 5J1UA 2HI3A 2NVTJ 4W1UA 3TW7A 2VPRA 3BG9A 3Q0WA 3IH4A 2H8RA 1K61A 1ETOA 3QQAA 3A01A 1HCRA 4GCLA 4IEJA 3HTIA 2L7FP 3I4MJ 4GFKA 5M5WJ 1FJLA 3TP0A 3WHBA 1UHSA 4A3MJ 9ANTA 2DG8A 1JUPA 4ABZA 2R7ZJ 2UXIA 2O7OA 3KZ9A 3VVZA 4FE4A 3O60A 2XGEA 1K83J 3OSFA 2QTQA 3PO3J 4I6ZA 4CYCA 1LE8A 2D5VA 3RQIA 3ZQFA 3LJLA 4UDSA 5H9TA 1RR7A 3GTPJ 4AF5A 3ZQIA 4X6AJ 1MH4A 3ON2A 5IP9J 3BG5A 5IYDJ 1X58A 2CRGA 1BW5A 4NN1A 1AKHB 1OFCX 3O8HA 3G7RA 5DS9A 3EUPA 5M5YJ 2Y9YA 2PZ9A 1F36A 1RETA 4Y52J 2FBQA 2M0CA 3BR3A 1BW6A 5EG0B 4CGRA 2JN6A 1FTZA 5F04A 4M3BA 2Y2ZA 4YZEA 4HNVA 1ZR2A 2JA7J 2XRLA 3BR2A 4JX6A 2GM4A 5K7FA 3GTJJ 2GFNA 1WGXA 3ZOBA 3E7LA 4BXXJ 2K9NA 1ETWA 1JKOC 2EH3A 3RKQA 5F0CA 3BTIA 4AUXA 4UUSB 5FKNA 3MKLA 3VPRA 1OCTC 2IAIA 1UG2A 2AHQA 2QWTA 2WAQN 1ORKA 3JRIA 4A3GJ 3JRFA 2ZOYA 4IHYA 4BKXA 2DA5A 2REKA 1PUFA 1AHDP 3VUQA 4BBSJ 3VOKA 4W97A 2VKEA 4A3JJ 2UXHA 2IBDA 3DEWA 1HLVA 5IOZA 1QVTA 2WGBA 2LK2A 3SFIA 2DA2A 2LP0A 3PM1A 1UI6A 2LD5A 2L7ZA 3JRCA 4IHVA 2MGQA 1F43A 2GBYA 4G12A 4AC0A 3VOXA 4BBRJ 2G3BA 2OPTA 2QKOA 4GCKA 1Q1VA 1JGGA 3O8GA 4BY1J 2DTZA 4DZJA 2W53A 1MBFA 4JL3A 1Y1VJ 4C3IJ 4B1RA 2I10A 1QRYA 4FISA 1I6HJ 4C3JJ 5GPAA 1G2HA 2ECCA 3GTKJ 3ANPA 1MH3A 3VW2A 4JKZA 4CYCB 3HOUJ 2HYJA 1LE8B 1OCPA 5E3OA 2JJ7A 3Q0UA 4JYKA 5F1JA 1IV6A 1RKWA 2X48A 3VW0A 2O8KA 5EF6A 2DA1A 1IUFA 2HQ5A 3VP5A 4JX4A 3BT9A 2EZLA 3H0GJ 4M6VA 3IH2A 4PXIA 2NVYJ 5EDNA 2FQ4A 3IV5A 1P7JA 2WV1A 1W0UA 1LFUP 1BA5A 1I50J 3CCYA 3CQZJ 2DA4A 5IP7J 3ON4A 4L5EA 5E3MA 1NK3P 3KNWA 4MFDA 2DG7A 4S0HB 1X2MA 2YVEA 3COLA 2GUHA 2NP5A 2EZKA 4V2GA 3A03A 1SANA 1ZR4A 5CXIA 4DYQA 1HOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETQ A;  5FMP A;  1FTT A;  5F08 A;  3JRB A;  1WPK A;  3UKG A;  4A3F J;  2CUF A;  3Q3S A;  5GPC A;  5M5X J;  3G56 A;  3D1N I;  2DMQ A;  4AC6 A;  2E1O A;  3BNI A;  2IEK A;  2DN0 A;  2DA6 A;  1PUF B;  5JLW A;  2O7T A;  2CQX A;  2JWT A;  1XS9 A;  1WH7 A;  3S17 J;  1A5J A;  2YUS A;  3JSJ A;  3HOX J;  3TED A;  1CQT A;  1HDP A;  5HSZ A;  3MNL A;  4DYC A;  3IH3 A;  5CW8 A;  5E3N A;  3BJB A;  1SGM A;  3JRG A;  1ETX A;  3BTJ A;  3CDL A;  3PPB A;  1LFB A;  5FKL A;  1R9T J;  4M3G A;  2P81 A;  2OF7 A;  1H88 C;  1MBJ A;  2DMP A;  1ETV A;  5IP6 A;  1IC8 A;  2HOA A;  2WB1 N;  3LSR A;  1MSF C;  5HBU A;  4A3I J;  1B8I A;  3BRU A;  1JUS A;  2HOS A;  3RH2 A;  3F0C A;  1E3O C;  2CUE A;  5F27 A;  3GTL J;  1ZK8 A;  1XC5 A;  3S15 J;  5HAW A;  3HKZ N;  1B72 B;  5K58 A;  1JTY A;  4X1E A;  4ME9 A;  5EZG A;  2LLK A;  1MNM C;  2NX4 A;  1U8B A;  4XRM A;  4IHX A;  1IJW C;  3OOU A;  2ZCX A;  4A3K J;  5EGO A;  3G1M A;  4MXM A;  1I3Q J;  3FK7 A;  2R93 J;  2M9H A;  3K2A A;  1IDZ A;  2XB5 A;  4ICH A;  2NVX J;  1Z0X A;  4DW6 A;  3HTA A;  2DA3 A;  2VKV A;  4L62 A;  2ZCN A;  4ACI A;  1JT6 A;  1U78 A;  1T33 A;  1TWG J;  1DU0 A;  3I4N J;  3JRA A;  1TC3 C;  1JUM A;  5E3L A;  3HIM A;  2JA6 J;  2NS8 A;  3HB9 A;  3TP3 A;  1JKP C;  3RZD J;  1UMQ A;  4JX5 A;  1BL0 A;  2HKU A;  3SJM A;  3BQY A;  3S5R A;  2K40 A;  3LSG A;  2L7M P;  4M3E A;  3OSG A;  2KT0 A;  4D7N A;  2XGC A;  3H3V K;  5D19 A;  1DU6 A;  2JA8 J;  3GBG A;  3T6N A;  5D18 A;  4FTH A;  3E7Q A;  5FLM J;  2R5Z A;  1D5Y A;  4IHW A;  2MSY A;  2QCO A;  2YS9 A;  2B63 J;  4A3B J;  2N8G A;  2EBI A;  1IRZ A;  3M4O J;  2WUI A;  3NAR A;  1A6I A;  1IGN A;  5CXG A;  3TW6 A;  3LSJ A;  1GV5 A;  4A3L J;  3AQS A;  3ZQC A;  3G1O A;  3B81 A;  3QPL A;  2PMZ N;  2CQQ A;  2EZH A;  1GV2 A;  2HXI A;  3FRQ A;  5DAJ A;  5GP9 A;  5FKK A;  2R0Q C;  2XB0 X;  3S1Q J;  3DCF A;  1B72 A;  1TWC J;  1XG1 A;  4D5C A;  1U9N A;  4EEF G;  1B8I B;  3JRH A;  2JA5 J;  4MO7 A;  4NDL A;  2G7G A;  4A93 J;  1JKR C;  2R92 J;  3AQT A;  3QKX A;  3ZQH A;  3NRG A;  4MIM A;  5F0F A;  2QF7 A;  3GTO J;  1RPW A;  2ID6 A;  2Q24 A;  1JTX A;  4UUT A;  5EGO B;  2TRT A;  3BQZ A;  3W6V A;  1BJZ A;  5FLV A;  5FGL A;  3HBL A;  1GVD A;  2K9Q A;  2MW8 A;  3G1L A;  5IYB J;  2QIB A;  2DMU A;  3EGQ A;  5FKO A;  3CRJ A;  4DZP A;  3S2H J;  4MFE A;  3HOY J;  3KKD A;  3LSP A;  4D5F A;  3VIB A;  2E19 A;  3PO2 J;  1GUU A;  1JJ8 C;  2EZI A;  1ITY A;  1U9O A;  3NNR A;  3HM5 A;  1QPI A;  2YVH A;  5C3E J;  3HOW J;  4XK4 A;  4AYB N;  1S7E A;  5EZH A;  1YRN A;  3BHQ A;  3P9T A;  2PBX A;  1ETY A;  3HDD A;  4B3A A;  3RZO J;  3HE0 A;  2JK3 A;  2ZCM A;  2R5Y B;  2GLO A;  2K9S A;  5IOY A;  4FE7 A;  1IG7 A;  3FIW A;  2R5Z B;  4DYR A;  2XPU A;  4B4C A;  4MLO A;  4C2M J;  3FIS A;  2EQR A;  3HGG A;  2Y0S N;  1ZKG A;  3B6C A;  2HXO A;  4I76 A;  2OI8 A;  4FCY A;  2RAE A;  3B6A A;  2G0E A;  1GT0 C;  4A3E J;  3Q0V A;  2D6Y A;  5JLX A;  3VW1 A;  3S14 J;  1MBK A;  2AO9 A;  3BR5 A;  2RHA A;  5C4Y A;  5D1R A;  1O4X A;  3ZQG A;  4QTR A;  2E2H J;  3QPS A;  3SDG A;  3PAS A;  3HOZ J;  3OIO A;  1X2N A;  2W48 A;  5F0H A;  5K7H A;  3CMY A;  2ECB A;  4D7M A;  4C3H J;  4JNN A;  4GFL A;  2LFB A;  3WHC A;  4KWA A;  2FX0 A;  5J3L A;  1VF9 A;  3GTG J;  1P7I A;  1SFO J;  2VI6 A;  1WH5 A;  2ID3 A;  4XID A;  1ZQ3 P;  1TWF J;  2ELK A;  3BR1 A;  3M3Y J;  3HTH A;  1Z77 A;  2DMN A;  4RDU A;  1Y1W J;  2Y30 A;  3GTM J;  2L0K A;  2X9D A;  1T56 A;  2HOT A;  3C2B A;  1HF0 A;  2G7S A;  4MK6 A;  2M2E A;  1RES A;  4XIC A;  4RBO A;  2ZOZ A;  2ME6 A;  5DTD A;  5C4X J;  2UXO A;  1JJ6 C;  4NEL A;  1VI0 A;  3LNQ A;  3LHQ A;  2HDD A;  5HOD A;  2UXU A;  3BTL A;  3IUV A;  3ZQL A;  1MBE A;  3HTJ A;  2R5Y A;  2DMT A;  4BY7 J;  2HYT A;  2MG4 A;  5IYC J;  1ZGW A;  2UXP A;  2LVS A;  1QVU A;  1AU7 A;  2NP3 A;  3L1P A;  5FJ8 J;  2NOG A;  3S16 J;  2NVQ J;  3CWR A;  3NXC A;  2V57 A;  1WI3 A;  2JMW A;  2E2J J;  3V6G A;  1YRN B;  5K7Z A;  3HEF A;  2ME0 A;  3VVX A;  2YU9 J;  5C4J J;  2G7L A;  5FHP A;  1FIA A;  2LY9 A;  3NI7 A;  1MBG A;  4A3C J;  2LTP A;  2M8G X;  3LOC A;  2Y31 A;  2KDZ A;  3JRD A;  2LR8 A;  1UI5 A;  2H1K A;  3LWJ A;  2ZB9 A;  1FIP A;  3HGY A;  4A69 C;  4HKU A;  3JRE A;  5BNG A;  5M3F J;  5FKM A;  1ENH A;  3MVP A;  4XRS A;  1HDD C;  2RAS A;  4Y7N J;  5EEA A;  3GZI A;  3NPI A;  4GFB A;  2VUM J;  3BR6 A;  3C07 A;  5EFY A;  1W0T A;  1TWA J;  1WCM J;  3S1R J;  2CU7 A;  5AQC A;  3A01 B;  3BTC A;  3F1B A;  1TWH J;  2Y9Z A;  5J1R A;  4GCT A;  1NK2 P;  2XSD C;  3NAU A;  2XGD A;  1ZTR A;  3BR0 A;  1GDT A;  2M34 A;  1RKT A;  1MSE C;  5J1Y A;  2FJ1 A;  3S1M J;  4J19 A;  1AKH A;  2FD5 A;  3QBM A;  3S1N J;  2XPV A;  1VFC A;  3A02 A;  3V78 A;  2QOP A;  3BG3 A;  1VND A;  3JR9 A;  2LKX A;  5EG0 A;  4A3D J;  2OER A;  1NTC A;  3HOV J;  3ANG A;  4QSH A;  3RD3 A;  1POG A;  3K7A J;  5C44 J;  2L9R A;  2X6O A;  1MBH A;  4V2F A;  2CJJ A;  2E2I J;  1OJL A;  2DA7 A;  4M3D A;  3GTQ J;  4M3F A;  4QIW N;  1JT0 A;  2GEN A;  1IDY A;  3GEU A;  5M3M J;  3S2D J;  1H8A C;  3DPJ A;  2DJN A;  4UUS A;  3CJD A;  2XPW A;  4JP0 A;  5IPA A;  1APL C;  4XRS G;  2O9L A;  2F07 A;  2IU5 A;  1EF4 A;  1JKQ C;  3KKC A;  4LOC A;  5EYR A;  3VVY A;  1H89 C;  2XDN A;  1FEX A;  3FKI J;  3BCG A;  2TCT A;  2COB A;  3MN2 A;  3FK6 A;  2NS7 A;  1ETK A;  5J1U A;  2HI3 A;  2NVT J;  4W1U A;  3TW7 A;  2VPR A;  3BG9 A;  3Q0W A;  3IH4 A;  2H8R A;  1K61 A;  1ETO A;  3QQA A;  3A01 A;  1HCR A;  4GCL A;  4IEJ A;  3HTI A;  2L7F P;  3I4M J;  4GFK A;  5M5W J;  1FJL A;  3TP0 A;  3WHB A;  1UHS A;  4A3M J;  9ANT A;  2DG8 A;  1JUP A;  4ABZ A;  2R7Z J;  2UXI A;  2O7O A;  3KZ9 A;  3VVZ A;  4FE4 A;  3O60 A;  2XGE A;  1K83 J;  3OSF A;  2QTQ A;  3PO3 J;  4I6Z A;  4CYC A;  1LE8 A;  2D5V A;  3RQI A;  3ZQF A;  3LJL A;  4UDS A;  5H9T A;  1RR7 A;  3GTP J;  4AF5 A;  3ZQI A;  4X6A J;  1MH4 A;  3ON2 A;  5IP9 J;  3BG5 A;  5IYD J;  1X58 A;  2CRG A;  1BW5 A;  4NN1 A;  1AKH B;  1OFC X;  3O8H A;  3G7R A;  5DS9 A;  3EUP A;  5M5Y J;  2Y9Y A;  2PZ9 A;  1F36 A;  1RET A;  4Y52 J;  2FBQ A;  2M0C A;  3BR3 A;  1BW6 A;  5EG0 B;  4CGR A;  2JN6 A;  1FTZ A;  5F04 A;  4M3B A;  2Y2Z A;  4YZE A;  4HNV A;  1ZR2 A;  2JA7 J;  2XRL A;  3BR2 A;  4JX6 A;  2GM4 A;  5K7F A;  3GTJ J;  2GFN A;  1WGX A;  3ZOB A;  3E7L A;  4BXX J;  2K9N A;  1ETW A;  1JKO C;  2EH3 A;  3RKQ A;  5F0C A;  3BTI A;  4AUX A;  4UUS B;  5FKN A;  3MKL A;  3VPR A;  1OCT C;  2IAI A;  1UG2 A;  2AHQ A;  2QWT A;  2WAQ N;  1ORK A;  3JRI A;  4A3G J;  3JRF A;  2ZOY A;  4IHY A;  4BKX A;  2DA5 A;  2REK A;  1PUF A;  1AHD P;  3VUQ A;  4BBS J;  3VOK A;  4W97 A;  2VKE A;  4A3J J;  2UXH A;  2IBD A;  3DEW A;  1HLV A;  5IOZ A;  1QVT A;  2WGB A;  2LK2 A;  3SFI A;  2DA2 A;  2LP0 A;  3PM1 A;  1UI6 A;  2LD5 A;  2L7Z A;  3JRC A;  4IHV A;  2MGQ A;  1F43 A;  2GBY A;  4G12 A;  4AC0 A;  3VOX A;  4BBR J;  2G3B A;  2OPT A;  2QKO A;  4GCK A;  1Q1V A;  1JGG A;  3O8G A;  4BY1 J;  2DTZ A;  4DZJ A;  2W53 A;  1MBF A;  4JL3 A;  1Y1V J;  4C3I J;  4B1R A;  2I10 A;  1QRY A;  4FIS A;  1I6H J;  4C3J J;  5GPA A;  1G2H A;  2ECC A;  3GTK J;  3ANP A;  1MH3 A;  3VW2 A;  4JKZ A;  4CYC B;  3HOU J;  2HYJ A;  1LE8 B;  1OCP A;  5E3O A;  2JJ7 A;  3Q0U A;  4JYK A;  5F1J A;  1IV6 A;  1RKW A;  2X48 A;  3VW0 A;  2O8K A;  5EF6 A;  2DA1 A;  1IUF A;  2HQ5 A;  3VP5 A;  4JX4 A;  3BT9 A;  2EZL A;  3H0G J;  4M6V A;  3IH2 A;  4PXI A;  2NVY J;  5EDN A;  2FQ4 A;  3IV5 A;  1P7J A;  2WV1 A;  1W0U A;  1LFU P;  1BA5 A;  1I50 J;  3CCY A;  3CQZ J;  2DA4 A;  5IP7 J;  3ON4 A;  4L5E A;  5E3M A;  1NK3 P;  3KNW A;  4MFD A;  2DG7 A;  4S0H B;  1X2M A;  2YVE A;  3COL A;  2GUH A;  2NP5 A;  2EZK A;  4V2G A;  3A03 A;  1SAN A;  1ZR4 A;  5CXI A;  4DYQ A;  1HOM A; 
#chains in the Genus database with same CATH topology
 2X1D A;  5FMP A;  1WPK A;  2CUF A;  4UB8 C;  5ILS A;  3FKJ A;  5M5X J;  3RKX A;  3G56 A;  2XKO A;  3OY9 A;  1TQI A;  1W5S A;  2DMQ A;  4A0Z A;  4BXU A;  3D1N I;  4AC6 A;  4BHC A;  2A69 F;  1AWC A;  1RUN A;  1PUF B;  4O6J A;  4BU2 A;  2JWT A;  1FBU A;  1WH7 A;  1A5J A;  2GIV A;  1W4M A;  3TED A;  3QPH A;  3LA7 A;  1XCB A;  4CXF A;  3U21 A;  1SGM A;  1K6O A;  3HRS A;  1X1D A;  1QBJ A;  2OCE A;  3CJT B;  2HPM A;  2EB7 A;  1DDN A;  2BY2 A;  4B48 A;  1IO2 A;  1K6Y A;  5ILV A;  1ETV A;  5IP6 A;  1VQL I;  4KIS A;  2HOA A;  2WB1 N;  4PSX A;  3LSR A;  1MSF C;  5HBU A;  4A3I J;  3BRU A;  2KPM A;  1JUS A;  2HOS A;  3HRT A;  1OLT A;  1WWX A;  4HX8 A;  3VYU B;  3RH2 A;  1FOK A;  2CUE A;  3CCR I;  5F27 A;  3WTW C;  2EIL H;  3L2U A;  3KP4 A;  2DDB A;  3GUD A;  4ME9 A;  3H3U A;  2JA8 J;  4IHX A;  2DU9 A;  1T39 A;  3DKX A;  4KYW A;  2R7T A;  3OOU A;  3OYC A;  5EGO A;  1R00 A;  4CGZ A;  1I3Q J;  3ZN0 A;  3M1C A;  4C2U A;  2HVQ A;  4CH7 A;  2EWN A;  4F93 B;  3EYY A;  4DBQ A;  2NVX J;  4ICH A;  4XLC A;  4LG0 A;  4NHJ A;  2ZXI A;  4UNO A;  5E3L A;  4P55 A;  2JA6 J;  5E8I A;  3M8F A;  1B1B A;  3RZD J;  4JX5 A;  1BL0 A;  2HKU A;  3S5R A;  3BQY A;  4Z2Y A;  3RPU A;  4BEH A;  2QEN A;  1Y39 A;  2H8W A;  1F9N A;  4N9I A;  3OSG A;  4XMY A;  4D7N A;  4BHP A;  1KQ0 A;  2XGC A;  5D19 A;  3TBI A;  5D18 A;  3E6B A;  1OR7 A;  2CUZ A;  3H1C A;  2B63 J;  1DGW Y;  2YS9 A;  4A3B J;  3BPX A;  3ECH A;  3ESW B;  2W24 A;  2EBI A;  1BC8 C;  3HPG A;  3M4O J;  3ZPL A;  1IGN A;  3FBN B;  4RLF A;  5CXG A;  4E7J A;  3LSJ A;  1GV5 A;  3GF2 A;  4Q5S F;  2DDA A;  4KIG A;  4A3L J;  3AQS A;  3KZI C;  4A5M A;  3G1O A;  3B81 A;  5LRR A;  4GYI A;  1GV2 A;  2M3A A;  3FRQ A;  5DAJ A;  5GP9 A;  4F55 A;  3DP7 A;  4M6X A;  5LFA A;  1U8R A;  2PJR B;  1TW3 A;  4CCO A;  1SD6 A;  3OYE A;  2MBF A;  4QLC U;  4FET A;  1HKT A;  1USS A;  2PEX A;  2LBF A;  3ASO H;  4DJA A;  1KU7 A;  2M0M A;  1U9N A;  3JAM K;  5DM7 F;  3HHH A;  2R92 J;  3SWH A;  1QGP A;  3CJQ B;  3ZQH A;  2O0Y A;  1SMT A;  2XGX A;  3GTO J;  1RPW A;  1I6X A;  4P9F A;  1GLN A;  1R58 A;  3IC7 A;  3CCE I;  4UUT A;  4LFU A;  1RZ4 A;  2TRT A;  3LSM A;  5FLV A;  2OTJ I;  3DEE A;  5JFR A;  4M73 A;  3QP6 A;  3E5U A;  1TNS A;  2DMU A;  3MQ0 A;  3EGQ A;  4DZP A;  3S2H J;  3VFZ A;  2YPR A;  4KN4 X;  2IS4 A;  4HQM A;  4KJZ A;  3H36 A;  1TTY A;  1GUU A;  4BE2 A;  2E7X A;  2XAG A;  3HM5 A;  4C2T A;  1YRN A;  4MQV A;  3HJE A;  1R6R A;  3F8B A;  3BHQ A;  3P9T A;  2FML A;  4B3A A;  4EAT A;  5A2Q Z;  1FYK A;  3RZO J;  2IPQ X;  1V5G A;  3PQJ A;  4PJJ A;  5B3S H;  3DU5 A;  3ZMS A;  4DYR A;  4CCN A;  5HLT A;  2EA2 A;  3OYG A;  5J4V A;  4MLO A;  3V7S A;  2F6C A;  1OCC H;  1IXC A;  2W7N A;  4E7H A;  1HST A;  1V3F A;  2EQR A;  2ZC2 A;  5JI6 A;  1ZKG A;  3B6C A;  2HZT A;  3OYK A;  2OI8 A;  3B6A A;  4RB3 C;  1GT0 C;  5L3C A;  1G59 A;  3VW1 A;  3S14 J;  3BR5 A;  5C4Y A;  2RNG A;  5ICG A;  4KMF A;  3PAS A;  2Y48 A;  1Z7L A;  3BWG A;  2DTR A;  5K7H A;  2ESN A;  5KNL A;  2R7U A;  2ECB A;  3KEO A;  1D1B A;  3HUG B;  3OR2 C;  2VBX A;  4IVN A;  2F2E A;  2YX7 A;  1XN7 A;  2FX0 A;  3GEZ A;  1X1B A;  5FRO A;  2KRC A;  3V7C A;  4BL0 B;  3D5S C;  2BW3 A;  1P7I A;  2A5Y B;  2ZNZ A;  2VI6 A;  2H6C A;  2P6S A;  3FXR A;  1T08 B;  5ILU A;  2ELK A;  4XID A;  2Z33 A;  1ZQ3 P;  3M3Y J;  4I98 B;  1CF7 B;  3SQN A;  3GW2 A;  4XLN F;  4A6D A;  3ZXS A;  2L9S A;  3GO5 A;  3CC4 I;  1P4X A;  2P6T A;  3PSI A;  2G7S A;  2CW7 A;  1HSJ A;  2M2E A;  2D1V A;  4XIC A;  2CH0 A;  2XSJ C;  3E6D A;  2LMD A;  1UG0 A;  4RGR A;  1VI0 A;  3ABK H;  3LNQ A;  1FSE A;  2YR2 A;  5ICE A;  3LHQ A;  4YFN F;  5DDG A;  2UXU A;  3BTL A;  1OPC A;  3HTJ A;  1NHA A;  5EJC A;  1K4T A;  2HYT A;  1ZGW A;  3O6B B;  3TL4 X;  3LQR A;  1O3Q A;  3QPT A;  3L1P A;  3WTV C;  3CWR A;  3SHF A;  2NVQ J;  5KVR A;  3V6G A;  1FNN A;  1VQ4 I;  3A0B C;  5K7Z A;  5LRS A;  3ZQQ A;  2YU9 J;  2LY9 A;  3RCO A;  2LTP A;  1LNW A;  3W6K B;  1XPX A;  2Y31 A;  2HGC A;  4PFO A;  2X0L A;  1FIP A;  5M3F J;  1OCR H;  3QOE A;  1FY7 A;  3ISP A;  5FKM A;  4F7Z A;  3W6J B;  1YHQ I;  3K4N A;  4AIK A;  2FJI 1;  4Y7N J;  5EEA A;  1YO5 C;  3CJR B;  2FSW A;  2KIU A;  4PJ0 C;  2A6H F;  1E3H A;  3KLN A;  3S1R J;  2CU7 A;  3BRO A;  5E8G A;  2L9N A;  1FC3 A;  3F1B A;  2OQR A;  5J1R A;  3F22 A;  2IVM A;  2QBY B;  2Z5U A;  2M34 A;  1MSE C;  2XAF A;  2FJ1 A;  2MA3 A;  2EJR A;  3BG6 A;  3H92 A;  2VL8 A;  3GFJ A;  4UXN A;  1MMA A;  3VOD A;  3K2Z A;  4EJW A;  2F5C A;  3K10 A;  3GLL A;  4M9X A;  3HOV J;  3ANG A;  5DUI A;  1XD7 A;  5FB2 A;  4RM3 A;  4N9H A;  1YQA A;  2ZME A;  4NQW B;  5E79 C;  4OMY A;  1FX7 A;  3VDX A;  4M3D A;  2E1M B;  3JSO A;  2GEN A;  4OOI A;  4KFC A;  4E7Z A;  4Y33 A;  2QUF A;  1PUE E;  1FLI A;  4PSW A;  4UUS A;  4ANJ A;  1D8K A;  2X6W A;  1O3R A;  5IPA A;  2LDU A;  1D0X A;  5D5V B;  3LSH A;  2F07 A;  2WA0 A;  3PFY A;  4ITV A;  4FX0 A;  4BUP A;  3CME I;  2VE8 A;  2A05 A;  4L9T A;  4TV7 A;  2XDN A;  4I09 A;  1XDU A;  3I0T A;  3HHG A;  4F92 B;  3GZN B;  4K2E A;  3K8P C;  1B9N A;  3F3X A;  3MN2 A;  5J1U A;  1K4S A;  2HI3 A;  1MJB A;  3C2G A;  2FEZ A;  1QNT A;  3K70 C;  2F5E A;  1QPM A;  2LRE A;  3K9T A;  3TMO A;  1K61 A;  3KIO A;  4HG2 A;  2KP6 A;  2LYC A;  3B02 A;  1KYZ A;  1U0J A;  4GFK A;  1Z91 A;  2GAU A;  4ZTF A;  3S3O A;  4XLA A;  4GO1 A;  3TP0 A;  2DG8 A;  3KZ9 A;  2H94 A;  2JSP A;  4OAZ A;  3RYR A;  1MIJ A;  4CYC A;  1LE8 A;  4N4O B;  3RQI A;  3E6C C;  3ZQF A;  3OYJ A;  1QU3 A;  4DNC A;  5ED4 A;  1RR7 A;  4F52 A;  3FWE A;  3ZMT A;  5IYD J;  3BG5 A;  4NN1 A;  4OAY A;  1AKH B;  3O8H A;  2DT7 B;  3I58 A;  4LMY A;  3IRR A;  1F36 A;  4RB0 A;  2XAH A;  1MJA A;  2NNY A;  3BR3 A;  1BW6 A;  4M3B A;  4YZE A;  4BAY A;  3GFL A;  2MD0 A;  1ZR2 A;  2JA7 J;  2KIM A;  3AG4 H;  3BR2 A;  4B43 A;  2X6X A;  1W7P A;  2JUG A;  3WGH A;  4BHB A;  4H0E A;  4XKW A;  2GFN A;  3I54 A;  2FOK A;  3G3Z A;  3ZOB A;  3J7A O;  3E7L A;  1R36 A;  3CF2 A;  2QSF X;  4ZZL A;  2VN2 A;  4M9Z A;  5HNF A;  2ZY9 A;  2PMZ A;  4U87 A;  2DQL A;  3GZ6 A;  3ERE D;  3M8E A;  3RKQ A;  2ZNY A;  2X4H A;  4AUX A;  2QSH X;  3VPR A;  2L9V A;  5K1Y A;  2R7R A;  2EA4 A;  3FM3 A;  3E97 A;  2E71 A;  5B66 C;  5HLG A;  5CYV A;  4ETS A;  1PUF A;  3L2C A;  3DTI A;  1W1W E;  1A31 A;  2M30 A;  4YEJ A;  3H5A A;  3MZY A;  1J09 A;  3SFI A;  4ZC3 A;  1TQP A;  1YJ9 I;  2LD5 A;  1XMA A;  4PCQ A;  4UVC A;  3D0S A;  5B1B H;  1WFX A;  5IT9 Z;  3NWT A;  4XSZ F;  1E0E A;  3BJO A;  2W53 A;  4JL3 A;  2WV0 A;  4C3I J;  1IXS B;  3LAP A;  2DFE A;  1I6H J;  1G2H A;  3ANP A;  2ECC A;  5DD4 A;  3GTK J;  4L5J A;  2KIS A;  5F1J A;  3Q0U A;  3Q5F A;  1S29 A;  1LEB A;  2R7Q A;  2X48 A;  2HKO A;  4KIF A;  2HQ5 A;  1UAA A;  1P6R A;  5JR3 A;  1N25 A;  3H0G J;  2ZBK A;  4PGH A;  4XNF A;  2KZG A;  2FBK A;  5FGM A;  4UY8 I;  5EDN A;  2LY2 A;  4XKC A;  2ZFU A;  4XOT A;  5HOO A;  4XQF A;  1ZAO A;  5IP7 J;  3ON4 A;  1P92 A;  1YIT I;  4L5E A;  2LH9 A;  3DV8 A;  2MC3 A;  2IGN A;  4MFD A;  2DG7 A;  3ZMU A;  3PJR A;  1MJ9 A;  2HU9 A;  4IL6 C;  5ICC A;  5TJJ A;  4HF2 A;  4PUS A;  4BJ5 C;  1R1U A;  2CWE A;  1SAN A;  1ZR4 A;  3K0L A;  2YX4 A;  5E1W A;  1HOM A;  2IA2 A;  5F08 A;  3WTS C;  2CQN A;  5L3D A;  3JRB A;  1YW9 A;  4XLH A;  5GPC A;  2PX9 A;  3HKZ A;  4U7D A;  4XLP F;  2K9L A;  1U5T A;  1WVR A;  2VQC A;  1T8I A;  3FMS A;  2DN0 A;  3KLO A;  4CDG A;  3LL7 A;  2DA6 A;  4KIC A;  2NRA C;  2CQX A;  4EM0 B;  1WJE A;  3K4B A;  3JSJ A;  1IW7 F;  3N05 A;  3HOX J;  4ZH4 F;  3Q9S A;  1UST A;  2M7B A;  1HDP A;  4LGW A;  3TO7 A;  3K70 D;  3OYM A;  5HSZ A;  3REO A;  1OQY A;  4DYC A;  4HX4 A;  3F8C A;  5E3N A;  2VBW A;  2PJR A;  1ETX A;  3QU6 A;  4LB6 B;  2NNN A;  3PPB A;  1LFB A;  5FKL A;  3S32 A;  2DMP A;  3DBR B;  1EJ9 A;  4J01 A;  2HOE A;  3OYI A;  2M8E A;  3I59 B;  2O3F A;  3A1Y A;  2QQB A;  2DPU A;  3HKZ N;  4BE0 A;  2QGU A;  1FBQ A;  5K58 A;  4EJU A;  2AQF A;  1K79 A;  4CCM A;  1VQ7 I;  4NC7 A;  1IJW C;  3AL0 B;  4A0X A;  3G1M A;  3F72 A;  1WRJ A;  3T8T A;  4LLL A;  3LST A;  4BQN A;  3HTA A;  4L62 A;  4ACI A;  1JT6 A;  4DBR A;  3DLL F;  3LQQ A;  3S93 A;  1Y0U A;  1YOV B;  3FXK A;  2MH9 A;  4CZZ A;  1BR2 A;  5TIS C;  5D5W B;  3JRA A;  1DU0 A;  2A07 F;  3HIM A;  2CGP A;  2GWR A;  3HB9 A;  4ZYH A;  1JKP C;  3CP2 A;  3OIQ A;  2DK5 A;  2GOX B;  3NEU A;  2X51 A;  4RAG A;  3RPQ A;  3VEP A;  2VON A;  2K40 A;  3ONQ A;  3LSG A;  1JHF A;  3BJA A;  2OTL I;  4M3E A;  3GWZ A;  3RKY A;  1TZL A;  4HOB A;  1DU6 A;  2I5U A;  3GBG A;  1ZLJ A;  2QKL B;  5DCM B;  2Y69 H;  3WU1 B;  4FTH A;  4V19 K;  5FLM J;  3E7Q A;  1IF1 A;  2MSY A;  5FRN A;  2IRF G;  2DYR H;  4PGG A;  4HPQ A;  1LEA A;  1A6I A;  3NRV A;  2STW A;  3JSP A;  2VT3 A;  2F4M B;  4KMU X;  4EGZ A;  4P96 A;  3TDU C;  3TQN A;  4WIB A;  2OAZ A;  3H5N A;  4F3Q A;  1RRJ A;  4HSR A;  4DIQ A;  3NS4 A;  2CQQ A;  2OZ6 A;  4AU7 A;  4KIB A;  2KDO A;  3J80 Z;  2DQR A;  2EV5 A;  3OYF A;  3H0D A;  2W00 A;  4G7H F;  2R7X A;  2Q0O A;  2XB0 X;  3ULQ B;  2R0Q C;  2X85 A;  5GTH C;  1B72 A;  2K85 A;  1J59 A;  3HUG A;  1W36 C;  1QZY A;  4ESJ A;  1J75 A;  4N0B A;  1U3E M;  1I1G A;  4ESF A;  1IUY A;  3NWS A;  3JRH A;  3CUQ B;  4MO7 A;  2GOM A;  2CMP A;  1R71 A;  4IOC F;  3AQT A;  5DEQ A;  2XF6 A;  3QKX A;  2E7W A;  1TNT A;  2EIJ H;  4YII A;  1CF7 A;  5LEJ A;  4PJN A;  3E6M A;  2R7D A;  1WJA A;  1FMW A;  2A5W A;  1RC9 A;  2IA1 A;  3BQZ A;  1I39 A;  2Y75 A;  2DXI A;  3W6V A;  3R60 A;  2MW8 A;  5GTI C;  1W5T A;  4OMZ A;  2ZO4 A;  2DOE A;  3KKD A;  1Y8R B;  3LSP A;  2ISZ A;  3VIB A;  2W25 A;  1R23 A;  5LLQ A;  1VQM I;  5LEK A;  4UB6 C;  3PO2 J;  2PBI A;  3M1E A;  5FLX Z;  1OCZ H;  2NAZ A;  3N97 A;  1X1C A;  1NH3 A;  1X4O A;  3M9A A;  4NB5 A;  2G7U A;  1QPI A;  2FU4 A;  3HOW J;  2JSC A;  4YIF A;  4XON A;  4IKF A;  3NQO A;  3WE2 A;  2V1N A;  1ETY A;  4WF2 A;  2PBX A;  3EUK L;  2ELH A;  3E5X A;  2PLY A;  1T0F A;  2WWY A;  2K9S A;  2O03 A;  3FIW A;  2R5Z B;  1LFP A;  3A0H C;  4LK0 F;  1HC8 A;  2BEO A;  2HKX A;  3FIS A;  1SFX A;  5CJ9 A;  4XOR A;  3MKZ A;  2Y0S N;  4I76 A;  4A5N A;  4A3E J;  1U5T C;  3F9K A;  3Q0V A;  5JLX A;  5HLH A;  1MBK A;  2AO9 A;  1R5I D;  5D1R A;  2V6E A;  1PP7 U;  2E2H J;  2QBY A;  1P4W A;  1XSD A;  3SDG A;  3OIO A;  5F0H A;  1RI7 A;  1OYI A;  4Y4R A;  2VPL A;  4D7M A;  2ZXH A;  2BY0 A;  4CHU A;  4B47 A;  4CSW A;  5GAE J;  3G6E I;  4NUB A;  4KWA A;  2GZW A;  4L5I A;  4L9N A;  3CD6 I;  3PUF A;  4U0W A;  3GTG J;  1JE8 A;  1K7A A;  1IN4 A;  3BOQ A;  2WAQ A;  3HRU A;  1MKM A;  1TWF J;  3HTH A;  5J4Y A;  2DMN A;  1ZEL A;  4I02 A;  4XKV A;  3HZJ A;  1I3A A;  2L0K A;  4NQW A;  2X9D A;  1T56 A;  4XLF A;  1MMS A;  5CLS A;  3G4S I;  2FXA A;  2W1O A;  3AKZ A;  2HOT A;  3C2B A;  4CO8 A;  1YW8 A;  1HF0 A;  1FSH A;  1RES A;  3W2A A;  5C4X J;  2FA5 A;  2UXO A;  1JJ6 C;  1OIS A;  4EGY A;  1ZG1 A;  4AVP A;  3FXU A;  4FHT A;  4LIU A;  5D6E A;  2L02 A;  1OMI A;  2CFO A;  3CF5 F;  5LHI A;  1N75 A;  2R5Y A;  2DMT A;  2EFW A;  4BY7 J;  1MGT A;  2MG4 A;  1Z6R A;  5HDK A;  4UV8 A;  3V8K A;  3UR3 C;  2NOG A;  4CA0 A;  4U9N A;  2JMW A;  2E2J J;  3MZ8 A;  3VSL A;  2W4S A;  3WE3 A;  3FZV A;  2ME0 A;  2IJL A;  3PNY A;  5CVI A;  2P8T A;  3DBH B;  1UI5 A;  4IHS A;  3I9V 2;  3HGY A;  5BNG A;  1BI3 A;  1XCV A;  4MQ9 F;  4IRI A;  2D45 A;  3OL3 A;  4ZDO A;  2R3S A;  2KIF A;  3R4K A;  2EFN A;  2Y0M A;  3C2H A;  3I5U A;  3C07 A;  3BR6 A;  4DQ2 A;  5EFY A;  1W0T A;  1WCM J;  3DTE A;  3A01 B;  5FD5 A;  4II2 A;  2VXD A;  4GCT A;  4P1W A;  1BBY A;  2KHM A;  5DD8 A;  3CMA I;  1ONV A;  2XGD A;  3BR0 A;  3NAU A;  4L18 B;  2PQ8 A;  4E70 A;  2OA4 A;  2R7F A;  2AQE A;  1ZRE A;  4O3M A;  2L54 A;  4RAZ A;  4Y17 A;  5KAI C;  4D9J A;  1W36 D;  1AKH A;  5B5E C;  5AON A;  1LUJ B;  3S1N J;  3A02 A;  4B09 A;  2QOP A;  3V78 A;  5CPR B;  2K86 A;  3JR9 A;  1REP C;  2LRD A;  4PZJ A;  1QHG A;  1STZ A;  1LVK A;  3EUH C;  3LFU A;  4HQE A;  2HDC A;  2OER A;  4XM3 A;  3D5R C;  1X3Z B;  2K5C A;  3LFK A;  1G8X A;  3ZR8 X;  2L9R A;  2CQ7 A;  4MEY F;  3FF5 A;  5DM6 F;  1MBH A;  4V2F A;  2WBM A;  2E2I J;  3GTQ J;  4QIW N;  1KON A;  3D5L A;  3COA C;  3GFM A;  2Q2E B;  4S04 A;  1S8N A;  5EEG A;  3DF8 A;  5FLX K;  2LG4 A;  4ZYD A;  2DFF A;  4JP0 A;  4UUV A;  2BXZ A;  2IA0 A;  3KZZ A;  3HG9 A;  3U9G A;  4BQO A;  4ZYE A;  5H2F C;  3SZP A;  2A6T A;  4XOP A;  1H89 C;  1FEX A;  4YFX F;  2H27 A;  3FKI J;  4F91 B;  1LB2 A;  3L00 A;  5GAG J;  1T6S A;  1SD7 A;  2COB A;  1H0M A;  3FK6 A;  1ETK A;  5BMZ A;  3TW7 A;  3Q9V A;  4G9Y A;  1HBX G;  3IH4 A;  4XLE A;  2BZT A;  2LY1 A;  1HCR A;  4MNU A;  2OC6 A;  3KYL A;  2KJB A;  2XRN A;  4IEJ A;  1U6G A;  5BQT A;  3I3L A;  5HS8 A;  4HZF A;  4RGX A;  2W82 A;  3WTT C;  2L7F P;  1LDK B;  1SFK A;  4Y15 A;  2ESH A;  3VYT B;  2PMU A;  4A3M J;  2MD5 A;  3OR1 C;  1JUP A;  2UXI A;  3O60 A;  5EEH A;  2P5L C;  1HXD A;  3PO3 J;  1HKQ A;  3S2W A;  2I8D A;  3GCM A;  3VYS B;  1GXQ A;  2JT1 A;  4XN0 A;  4GCV A;  3LJL A;  1WKM A;  4UDS A;  4HW0 A;  2B9S A;  2DAO A;  3KP5 A;  1X58 A;  5CVU A;  3EUP A;  2Y9Y A;  2G7H A;  2PZ9 A;  3EPZ A;  4MTE A;  4CIC A;  1BJA A;  2B1E A;  2X6Y A;  4Y52 J;  2FBQ A;  2M0C A;  5EG0 B;  4II3 A;  5FD6 A;  2XRO A;  1LQ1 A;  3ABL H;  1XMK A;  5E18 F;  1S7O A;  4HNV A;  3V4G A;  2XRL A;  2DLL A;  2DK8 A;  2J5P A;  1JHH A;  2HR3 A;  2RNJ A;  2AXL A;  3ZMD A;  1WGX A;  1P9Q C;  1X1A A;  1JGS A;  4G94 A;  4BDZ A;  1JKO C;  1IN6 A;  4I7H A;  3WTZ A;  2A3S A;  3L09 A;  3MZH A;  2LC2 A;  1FYL A;  1ZRD A;  2EH3 A;  1FWZ A;  2HVR A;  5F0C A;  2A61 A;  3P5J A;  2EIN H;  1BI0 A;  3QYF A;  1UG2 A;  4JQF A;  2QWT A;  3GX4 X;  2ZFW A;  2LKS A;  3JRI A;  1BI1 A;  2P0W A;  4IHY A;  2O5R A;  2XHK A;  3FXQ A;  4BKX A;  4DOZ A;  2REK A;  4W97 A;  2VKE A;  4CZC A;  5DYM A;  3LSI A;  1D3Y A;  2VBZ A;  5IOZ A;  1YFH A;  2WGB A;  3KZY A;  3GZ5 A;  3CC7 I;  2KL4 A;  2LK2 A;  5HDN A;  1A36 A;  3ZMZ A;  4IPA A;  2ZSI B;  2MGQ A;  1OR7 C;  4KN7 X;  2RDP A;  3BLY A;  1R1V A;  5CQG A;  1Q1V A;  2YU3 A;  3I64 A;  3DXJ F;  2DTZ A;  2XV4 S;  2NVU B;  2IGK A;  4CYD A;  2HWV A;  3F6V A;  1Z3X A;  2I10 A;  4U88 A;  1QRY A;  4C3J J;  5GPA A;  3I59 A;  2KRF A;  4ZYA A;  4ENN A;  5D5X B;  3HOU J;  3V42 A;  2VE9 A;  4MHG A;  5FFX A;  1IV6 A;  2W57 A;  3ZQ7 A;  2H1L A;  2O8K A;  2CFX A;  2FUG 2;  5EF6 A;  3VP5 A;  4HA8 A;  4AYB A;  2EZL A;  3IH2 A;  2NVY J;  1SVL A;  3BDD A;  4Y3O A;  1P7J A;  4HNU A;  2WV1 A;  2QQ9 A;  3TGN A;  1LFU P;  3BZK A;  2DOF A;  3HRM A;  1KU2 A;  2BGC A;  1FOX A;  4WXC A;  4N4N B;  1EH8 A;  1SFU A;  3RKW A;  4BAC A;  1NK3 P;  1S3J A;  2EFO A;  3KNW A;  2EPF A;  1VZ0 A;  2PI0 A;  4NC6 A;  1QA6 A;  1EV7 A;  2MYS A;  2LSO A;  2GUH A;  3HXL A;  2EZK A;  5CVJ A;  1V5E A;  1Y56 A;  2AXT C;  4Y13 A;  2DYS H;  3AG3 H;  3WG9 A;  4DYQ A;  5A2Q K;  1ETQ A;  2XAJ A;  4RAY A;  3UKG A;  4XR6 A;  4A3F J;  3HSE A;  3Q3S A;  5J40 A;  4HNT A;  5DCM A;  4G6D A;  5HDG A;  3S8P A;  3BNI A;  1Z21 A;  3BP8 A;  2DT5 A;  3SYT A;  3W2V A;  5JLW A;  5KK1 A;  1LPQ A;  2F5D A;  2OBP A;  2UXX A;  2KKO A;  2OD5 A;  3ABM H;  3MMY B;  4JBA A;  4PDK A;  1CQT A;  1A04 A;  1DUX C;  2QQA A;  3LMM A;  3BG7 A;  1RR8 C;  4IQ4 A;  4KDP A;  1R22 A;  4R8H A;  3BJB A;  2HVS A;  1DPU A;  1FOY A;  1O57 A;  5E17 F;  2RGV A;  1LJ9 A;  4GGG A;  3CDL A;  3GLX A;  2BBY A;  1B59 A;  1IRX A;  2ADU A;  4M3G A;  1R9T J;  2Z2S B;  1H88 C;  1IC8 A;  1PJR A;  4BE1 A;  3GXO A;  2WY8 Q;  4ZDP A;  3PIP F;  5LGU A;  2HDW A;  3CUQ A;  1ZLK A;  5DCF A;  2GXB A;  2FNP A;  2Z9O A;  2Q1Z B;  3N4M A;  1E3O C;  3GTL J;  1J5Y A;  5HAW A;  3MAJ A;  3DTK A;  1JTY A;  3LA3 A;  2KFD A;  4OD5 A;  4X1E A;  5LHG A;  5EZG A;  2LLK A;  3K4J A;  1U8B A;  3G2B A;  2D2W A;  4BS9 A;  4Q4Z F;  4A3K J;  2FBH A;  1OKR A;  2EV6 A;  4ZZD A;  4MXM A;  4IOA F;  1DGR M;  2R93 J;  2M9H A;  1PP8 F;  1K78 B;  1PDN C;  3K4K A;  3MWM A;  1YI2 I;  1IDZ A;  2XB5 A;  3GME A;  4YG2 F;  2CV0 A;  4IHT A;  4DW6 A;  3SFZ A;  3QWL A;  1TL8 A;  2ZCN A;  5D4S A;  1T33 A;  5KHD A;  1U78 A;  1BIA A;  1TWG J;  1UB9 A;  1D5V A;  1QQI A;  4M72 A;  2E1C A;  3PNV A;  4R1H A;  3EYI A;  1TC3 C;  1JUM A;  1IN7 A;  3TP3 A;  4MTD A;  1VQO I;  1KU9 A;  4GYG A;  5E20 A;  1V4R A;  3BCB A;  1XGO A;  2L7M P;  1BIB A;  3K4M A;  1PVE A;  2DBB A;  2KT0 A;  4OIR F;  2JQ7 A;  3IWZ A;  3CO6 C;  3V7R A;  2OUM A;  2R5Z A;  1D5Y A;  5ERI A;  2QCO A;  4EM2 A;  1IRZ A;  1MND A;  1TLH B;  3TW6 A;  5D5U B;  3RPU D;  3F6O A;  2CUJ A;  2VOD A;  3V8L A;  5J8F A;  3QPL A;  2PMZ N;  1TW2 A;  3F23 A;  2HQN A;  5BPD A;  1QHH D;  1X3W B;  3ML6 A;  4B8X A;  2KZV A;  2M87 A;  3CES A;  1BR4 A;  1SFE A;  3DKW A;  5L3E A;  2LKP A;  1JXS A;  1XG1 A;  2HQA A;  2EIM H;  4YEL A;  3RYP A;  4Z6Y A;  2HEO A;  4G6T B;  3WTY C;  4EEF G;  3E1S A;  1B8I B;  2JA5 J;  3FXL A;  1T98 A;  4NDL A;  2G7G A;  2QYO A;  4KT5 C;  4M71 A;  1JKR C;  4A93 J;  2JUC A;  3NRG A;  3BZC A;  1M1E B;  1J0R A;  4QWQ A;  4HRI A;  1Z67 A;  2ID6 A;  2L2O A;  3OYL A;  3LAJ A;  1XX5 A;  5GAD J;  1JTX A;  2R4G A;  3SZT A;  1V54 H;  2OZU A;  3JW4 A;  2H09 A;  2F4I A;  5H6Q A;  3G1L A;  3KEQ A;  3CRJ A;  2F4O B;  2XKP A;  4WWC A;  2E19 A;  5B1A H;  3WU0 A;  2IGM A;  5CKT A;  2ZME C;  1ON2 A;  3I53 A;  2HYG D;  1JJ8 C;  2EZI A;  3CCJ I;  1Z7U A;  3EET A;  5C3E J;  2OU2 A;  5GAH J;  1XB4 A;  5EZH A;  1L3L A;  1BN5 A;  1GHC A;  1DPR A;  1E3P A;  3O3K A;  5KAF C;  3K1P A;  4U0Y A;  1G6N A;  1OYW A;  2ZCM A;  1MMD A;  3CUO A;  1Z05 A;  1IG7 A;  3KP3 A;  2V1X A;  1RIO H;  1X1P A;  3HSR A;  3WGG A;  3K1N A;  2XPU A;  2EFQ A;  3TOB A;  4KT6 A;  1NG7 A;  3A4C A;  3KP2 A;  2MLG A;  5K5O A;  4BQA A;  3X2Q H;  2G0E A;  4IRV A;  1ZH5 A;  4UVA A;  2V1D A;  2HTJ A;  1BOA A;  3LWF A;  3ZQG A;  1S9H A;  1UHM A;  2GXA A;  3GFI A;  3HL2 A;  1ZHF A;  3HOZ J;  2DOA A;  1X2N A;  2W48 A;  3WTU C;  1BC7 C;  4AVZ A;  4GFL A;  5JHU A;  3WHC A;  2DT6 A;  4OU0 A;  2K02 A;  2ID3 A;  1ZGJ A;  3BR1 A;  1YG2 A;  3PIO F;  1IAW A;  2IS2 A;  1Z77 A;  5BPI A;  3IUO A;  1Y1W J;  4XRF A;  4C9Y A;  1DP3 A;  4OIN F;  1F4K A;  4M74 A;  5BOX A;  1J7K A;  2L4A A;  1LDJ A;  1TP4 A;  2Q2E A;  3CZ6 A;  4IZZ A;  4RBO A;  5DTD A;  4AWX B;  1N77 A;  3ZRG A;  2RQQ A;  4NEL A;  4ZJZ A;  2WTE A;  3VYR B;  5LD2 C;  1ZN2 A;  1UZC A;  3QAH A;  1AA7 A;  5HOD A;  5IYC J;  1R4N B;  4D0P A;  4HDU A;  2LVS A;  2Z99 A;  1AU7 A;  1VQ9 I;  2NP3 A;  2UXP A;  3H9G A;  5KCM A;  3S16 J;  4UVB A;  3NXC A;  2FF4 A;  1KGS A;  2V57 A;  1WI3 A;  4X0G A;  3SDB A;  3VVX A;  2G7L A;  5FHP A;  1R1T A;  1FIA A;  3NI7 A;  4ENK A;  4A3C J;  2M8G X;  3HPH A;  5IT9 K;  2KDZ A;  3SZG A;  2KIQ A;  3V8J A;  3IL2 A;  2LR8 A;  3JRD A;  3LWJ A;  2E5Z A;  4HKU A;  3AG1 H;  4A12 A;  2RAS A;  4HF0 A;  3GZI A;  3HTU A;  4Q48 A;  3AG2 H;  4E6K G;  4E7K A;  2JPB A;  4GFB A;  1ULY A;  1PYV A;  4LK1 F;  2VUM J;  1TWA J;  3CCV I;  1O7L A;  5AQC A;  4RS8 A;  4BXF A;  3O2P E;  3T5X A;  3G73 A;  4LLN A;  3R61 A;  3BTC A;  3H35 A;  1TWH J;  2Y9Z A;  2MFZ A;  3ZGK A;  2XSD C;  4BDY A;  1ERD A;  2PJP A;  2XDV A;  5J1Y A;  3S1M J;  4J19 A;  2DJI A;  2FD5 A;  1OCO H;  1WJC A;  2JPC A;  2VC1 A;  1VFC A;  3QRF F;  1R49 A;  1VND A;  2QWW A;  5EG0 A;  1NTC A;  3DPL C;  3F8M A;  3JAM Z;  2QSG X;  3RD3 A;  5C44 J;  3L9F A;  4I0B A;  2X6O A;  4AID A;  2K3P A;  2DPD A;  1MNE A;  2BV6 A;  4E7L A;  1OJL A;  2DA7 A;  1R5H A;  2KQR A;  1IN8 A;  3PNT A;  3JTH A;  5LGN A;  1H8A C;  1G4D A;  2DJN A;  2XPW A;  4XSX F;  2WAF A;  2O9L A;  2ELJ A;  1V55 H;  5J6X A;  4XN3 A;  2IU5 A;  4E4H A;  2KJC A;  3R6S A;  1BM9 A;  3KKC A;  4LOC A;  3VVY A;  4ENM A;  4U9L A;  1S7A A;  3K4C A;  3FMR A;  3RTR A;  3FMQ A;  3BCG A;  2L5Q A;  3ROU A;  4OD4 A;  3OYB A;  2TCT A;  2MH2 A;  3MEX A;  3PUB A;  4OIO F;  4P9U A;  1WJB A;  3MCZ A;  4JOM A;  3J7Y J;  2P7C B;  3BG9 A;  2V79 A;  4BJT A;  1ETO A;  2GIZ A;  1QZZ A;  1Z3Y A;  3HYI A;  2J5O A;  1X3U A;  2MC4 A;  4P5O A;  2V1U A;  2K7L A;  1FJL A;  3TKY A;  1UHS A;  9ANT A;  4ABZ A;  3DQV C;  1OYY A;  5IY5 H;  4IO9 F;  1T2K A;  4IQJ A;  4FE4 A;  2CW0 F;  2XGE A;  3OSF A;  1DQU A;  2CS3 A;  2COM A;  3OMY A;  1CGP A;  4LIV A;  5K5R A;  3TO6 A;  4I6Z A;  2D5V A;  4CUG A;  2KMU A;  4YRV A;  2QLZ A;  1YTY A;  3HSF A;  3BPV A;  3CCS I;  3ZQI A;  1VQ8 I;  1MH4 A;  3ON2 A;  5IP9 J;  4YIR X;  4MEX F;  2V26 A;  3CP8 A;  5DS9 A;  5CQE A;  1T38 A;  1ZAR A;  4WCG A;  3K69 A;  4E7S A;  1FP2 A;  3QU3 A;  5TRD A;  3T8R A;  2Y2Z A;  4FQG A;  2VOO A;  4JX6 A;  2GM4 A;  2BYV E;  3GTJ J;  1O3S A;  2BVL A;  1KQ9 A;  4KUM A;  3P9C A;  1I27 A;  4RB1 A;  2K4B A;  2A68 F;  1ZRF A;  1ETW A;  3ABT A;  5H6R A;  1UCR A;  4C30 A;  2ZSH B;  3RJP A;  2WAE A;  2UV1 A;  2FBI A;  4NNJ A;  3KX2 A;  4L0Z B;  5FKN A;  1FBS A;  3A2K A;  1OCT C;  2ZKZ A;  4WK8 F;  1ON1 A;  1W7P D;  4A6E A;  2AHQ A;  2VQG A;  2WAQ N;  3CCQ I;  1MDM B;  1XGS A;  4A3G J;  2F5F A;  3L7W A;  5CVR A;  2L01 A;  2DA5 A;  1VQN I;  3DPT A;  3R0J A;  4BBS J;  4A3J J;  3F8F A;  3DKY A;  2WY7 Q;  2UXH A;  2FQ3 A;  2M7A A;  3WOD F;  2IBD A;  3CJN A;  3DEW A;  3KCC A;  1HLV A;  2V6C A;  2L4M A;  3J80 K;  1SMY F;  1YJN I;  2WC2 A;  2DA2 A;  1U5T B;  2BOL A;  1UI6 A;  3GYH X;  3JRC A;  3CLQ A;  1E2X A;  3JTG A;  3CO7 C;  2DOD A;  4S05 A;  4OIQ F;  2CQK A;  2GBY A;  4G12 A;  5LHH A;  1N78 A;  2ZJQ F;  3VOX A;  2QKO A;  1YYV A;  3DLA A;  3HOT A;  5HVQ C;  1JGG A;  2X1C A;  4DZJ A;  1MBF A;  2MAB A;  2FNA A;  2Q8K A;  1Y1V J;  4FIS A;  4PK4 A;  3TOA A;  3IKT A;  3C7J A;  3KP6 A;  3VW2 A;  4JKZ A;  5E1Z B;  4A2U A;  1OCP A;  1VQ6 I;  2MLK A;  2DFH A;  2JJ7 A;  3L2Q A;  3JCU C;  4JYK A;  1SAU A;  4H4K C;  4WXH A;  1KU3 A;  1GVJ A;  4FAS D;  2FMY A;  1IUF A;  4EJO A;  3J7A Y;  4JX4 A;  1BI2 A;  2V9K A;  3I4P A;  4M6V A;  1U2W A;  1G3S A;  1K78 A;  3IV5 A;  3B73 A;  4EM1 A;  3VB2 A;  3H5R A;  3CQZ J;  1S5L C;  2DA4 A;  1ACI A;  2ACJ A;  3WG7 H;  1J9I A;  3HC7 A;  4KIT B;  4S0H B;  2YVE A;  3UNG C;  2M4K A;  3COL A;  2LF7 A;  1HQC A;  4V2G A;  4CCJ A;  1GXP A;  5LBQ A;  3M7G A;  2XAS A;  4UHT A;  1KA8 A;  2HPI A;  1VQK I;  2NXN B;  3GVA A;  2FOW A;  1FTT A;  2D1H A;  3TO9 A;  3CMM A;  2ZJR F;  2E1O A;  4RGU A;  2IEK A;  3KYD B;  3AAF A;  1H9G A;  4IJA A;  5AIP A;  4BQQ A;  3HOS A;  2O7T A;  1XS9 A;  2IGO A;  1YIO A;  2M4G A;  3MFK A;  3S17 J;  2YUS A;  1Z9C A;  4C2M A;  3C1D A;  3H9J A;  4RA2 A;  1EKE A;  1WHU A;  3OL4 A;  4UV9 A;  4HF1 A;  1S6L A;  3J81 Z;  3MNL A;  4PJL A;  3IH3 A;  5CW8 A;  5F6F A;  4LIT A;  3RIR A;  1T0F C;  3ECO A;  3JRG A;  3OYA A;  3KE2 A;  1I1S A;  3BTJ A;  4L9J A;  2P81 A;  2OF7 A;  4L9V A;  1MBJ A;  4BGD A;  3G71 I;  3CLO A;  4HLY A;  6PAX A;  4KNY A;  2B7E A;  2XVC A;  1EH6 A;  1B8I A;  2CO5 A;  1XGM A;  3VSK A;  2O8X A;  1HA8 A;  4ON0 A;  1O3T A;  3F0C A;  4L0Y B;  1AOY A;  4MGR A;  4Q47 A;  1XDS A;  1ZK8 A;  1XC5 A;  3S15 J;  3VTI A;  2VC0 A;  1B72 B;  1MNM C;  2EFP A;  2NX4 A;  3KFW X;  4XRM A;  5HS9 A;  4EVI A;  4RMN A;  4EV0 A;  2ZCX A;  1W5C C;  3KP7 A;  1LDD A;  3MKY B;  3FK7 A;  1WSU A;  2L7K A;  3K2A A;  4LB5 A;  2IW5 A;  2LOO A;  2QKM B;  4I0A A;  2EIK H;  4EMS A;  2W85 A;  2HFH A;  1Z0X A;  2DA3 A;  2VKV A;  1SAX A;  3KET A;  1VQ5 I;  1XMX A;  3AFH A;  2VKD A;  4OWR B;  2JRM A;  3I4N J;  2CSO A;  1R4M B;  2NS8 A;  3PFI A;  1HKS A;  2E1M C;  3ABU A;  1UMQ A;  2E60 A;  4PFP A;  5D8L B;  3SJM A;  4LLG F;  2ZJ2 A;  1FZP B;  1TT0 A;  1WQ2 A;  1O7F A;  2K4J A;  4HAM A;  4YFK F;  3FDY A;  4M6Y A;  3R0A A;  1UJ8 A;  5H20 A;  3H3V K;  5J47 A;  2QEX I;  2L3D A;  3T6N A;  4IHW A;  1J2X A;  4QPQ A;  2N8G A;  2WUI A;  1ZGA A;  3NAR A;  2UWM A;  5FFZ A;  3IRQ A;  4OIP F;  2VXZ A;  2JTV A;  1P2F A;  3ZQC A;  4QPO A;  1LKX A;  2V7F A;  1F1Z A;  1Y0N A;  2EZH A;  2HXI A;  3F8N A;  3DBL B;  1T95 A;  3K1M A;  4IF4 A;  2ZJP F;  3FHN A;  3FXO A;  5FKK A;  1Z1D A;  3CDI A;  4FT8 A;  3DCF A;  5D4R A;  3S1Q J;  1BR1 A;  2VJJ A;  4G7O F;  1DP7 P;  3EQL F;  1TWC J;  3P9K A;  3PL8 A;  2F48 A;  4GRI A;  3RI4 A;  4D5C A;  1IXR C;  2JZY A;  2R7W A;  4HV6 A;  1B4A A;  2EV0 A;  3QP5 A;  1XTA A;  4LD5 A;  4MIM A;  3WTX C;  1H9T A;  5F0F A;  2QF7 A;  4B3X A;  1Y6I A;  3ZP5 A;  1IV8 A;  1ZG3 A;  2M45 A;  3OWT A;  1Z6T A;  4ENJ A;  3CDH A;  1YE9 A;  1D8J A;  4RM2 A;  2Q24 A;  2FRH A;  1WJ5 A;  5EGO B;  2LNB A;  4I99 C;  3WGI A;  1BJZ A;  5FGL A;  3P7N A;  3HBL A;  1JI8 A;  1GVD A;  2K9Q A;  2XAU A;  2QIB A;  5IYB J;  2HZD A;  5FKO A;  5HNH A;  3I55 I;  2VJI A;  3ELK A;  4MFE A;  3HOY J;  4A0Y A;  3L2W A;  4LG0 B;  4D5F A;  4G8X A;  1D0Y A;  2V9P A;  3SEQ A;  2ISY A;  2V9V A;  2OCC H;  1D1A A;  2O6G E;  4HBL A;  2XF7 A;  1ITY A;  1U9O A;  3NNR A;  2RVC A;  2YVH A;  2VB6 A;  2PFV A;  4XK4 A;  4AYB N;  2IS6 A;  1S7E A;  3S3N A;  3H3Z A;  3IHU A;  3BY6 A;  4BEH B;  1XSX A;  2DO7 A;  3HDD A;  3HE0 A;  1B9M A;  2JK3 A;  1F5T A;  4G6Q A;  2R5Y B;  2GLO A;  5IOY A;  4FE7 A;  1MMN A;  1A35 A;  4B4C A;  1KQ8 A;  3J81 K;  4C2M J;  1L0O C;  1QO0 D;  1RNL A;  3DWL E;  4M9S A;  4DGW B;  4HDV A;  5J8C A;  3HGG A;  5K5Q A;  2HXO A;  2HQR A;  4FCY A;  2RAE A;  1TQM A;  1WI9 A;  2E36 A;  4IXA A;  4BH9 A;  2D6Y A;  4U7B A;  2JA2 A;  4J00 A;  4I01 A;  2RHA A;  2M5W A;  1O4X A;  2QQ8 A;  2DI3 A;  4AD9 A;  4QTR A;  4ZYG A;  3QPS A;  3KYC B;  5LGT A;  2HS5 A;  3CMY A;  4CCL A;  4EQQ A;  1SD5 A;  5D6F A;  1X4P A;  3U1D A;  4C3H J;  4BYY A;  3C3W A;  3K4L A;  2LBF B;  4JNN A;  2LFB A;  2VJ4 A;  4RGS A;  4D1Q A;  5J3L A;  1VF9 A;  2VT2 A;  1V5F A;  3QOP A;  1SFO J;  2CV1 A;  3QYB A;  2VLA A;  3I71 A;  2QA4 I;  4DVY P;  3M8J A;  1WH5 A;  1D0Z A;  1XSV A;  1EH7 A;  2ZXJ A;  2VOP A;  2R7S A;  4RDU A;  2Y30 A;  3GTM J;  3IAM 2;  2K3F A;  2CYY A;  2CV2 A;  1FYM A;  1QZE A;  5JVT A;  2XUB A;  2UZK A;  1ZRC A;  2BY1 A;  3T1B A;  1SEU A;  4MK6 A;  4XKB A;  2A6E F;  2ZOZ A;  2ME6 A;  3VOE A;  4AM3 A;  1ZYR F;  2ZXW H;  3MD2 A;  4ZDL A;  2NS0 A;  2RN7 A;  1MMG A;  2O61 A;  1XGN A;  2HDD A;  3IUV A;  3FXJ A;  1IN5 A;  2BHZ A;  2TDX A;  3ZQL A;  1MBE A;  2ETH A;  2VQL A;  2F5V A;  2H6B A;  1G3Y A;  2BVM A;  1QVU A;  2P4W A;  2QM3 A;  1HW2 A;  3W3C A;  5FJ8 J;  2PFB A;  1FPQ A;  2A2F X;  1ODD A;  4HST A;  1YRN B;  5L3F A;  2EK5 A;  1FMV A;  3HEF A;  1SC7 A;  1EA3 A;  5C4J J;  2BY3 A;  1MBG A;  1FP1 D;  3LOC A;  2YVX A;  3PSF A;  4RB2 C;  1TBX A;  3OV8 A;  2H1K A;  1YJW I;  3OS1 A;  2P7V B;  2ZB9 A;  1S72 I;  2RKH A;  4A69 C;  3U1K A;  3IP4 B;  2QVO A;  3JRE A;  3C18 A;  1WZ2 A;  2VAS A;  1FOW A;  1ENH A;  3MVP A;  4XRS A;  1HDD C;  4GXO A;  3E0J B;  3NPI A;  5L3G A;  2DFI A;  3FHZ A;  2VBY A;  4XBF A;  1SVO A;  5E1X A;  3BCA A;  5FRM A;  3QYE A;  3OS2 A;  5TGT A;  1WJD A;  2OV7 A;  1HW5 A;  1NK2 P;  3RDI A;  1ZTR A;  1GDT A;  2JVG A;  4LG3 A;  4XL9 A;  1RKT A;  4RAF A;  4HV5 A;  3QBM A;  1UEL B;  1MW7 A;  2XPV A;  4NBQ A;  2XC7 A;  3MKW B;  1IZ1 A;  3RQ4 A;  5HLI A;  3BG3 A;  2BW3 B;  2E35 A;  2LKX A;  4A3D J;  1ZG5 A;  2RRE A;  2P5V A;  2X1E A;  3LA2 A;  2VKH A;  4JK1 X;  5D8K B;  3I56 I;  3DU6 A;  4QSH A;  2RV8 A;  1POG A;  3K7A J;  1NG6 A;  2BE5 F;  3AL0 C;  2CJJ A;  2CG4 A;  4M3F A;  3L2V A;  2BHY A;  1IRF A;  3SXY A;  1JT0 A;  1IDY A;  1Y8Q B;  1FT9 A;  2UXN A;  5M3M J;  5IT3 A;  3GEU A;  5JHF A;  4LJZ F;  3S2D J;  2Z16 A;  3DPJ A;  2Z1D A;  2PG4 A;  4BJ6 C;  3CJD A;  3OIP A;  1HW1 A;  2JRT A;  1YX3 A;  2NOJ B;  4XRS G;  3IWF A;  1VQP I;  1APL C;  1EF4 A;  1MDM A;  3BC8 A;  1JKQ C;  3W2W A;  3J7Z I;  5EYR A;  2C6Y A;  2B3W A;  3DFG A;  1B6A A;  4PJM A;  1YS7 A;  2JVH A;  2HTS A;  2XF5 A;  1G3T A;  5JVG F;  3IAS 2;  4AIJ A;  2Z3Y A;  2NS7 A;  2NVT J;  2VJ5 A;  4W1U A;  5BS6 A;  2IP2 A;  3FM5 A;  4HEA 2;  3U2R A;  5L3B A;  4G7Z F;  2K27 A;  2VPR A;  3Q0W A;  2M1B A;  5CVV A;  2H8R A;  1P4A A;  2V4J C;  3QQA A;  3E3V A;  2IS1 A;  3A01 A;  4CCK A;  1MD0 A;  4GCL A;  3VWB A;  1A6Q A;  3IKV A;  3ZN1 A;  1UHW A;  3HTI A;  3I4M J;  4RLQ A;  5M5W J;  2PN6 A;  2FE3 A;  3M07 A;  3WHB A;  3VVZ A;  2R7Z J;  2O7O A;  2GA2 A;  4IRH A;  1K83 J;  2BXY A;  2G9W A;  1BOB A;  3OS0 A;  2QTQ A;  4HX7 A;  1WJF A;  2E1N A;  4FX4 A;  2IT0 A;  5H9T A;  1TT5 B;  3GTP J;  3PQK A;  4AF5 A;  4X6A J;  3CTA A;  1C0W A;  2CRG A;  1BW5 A;  1YIJ I;  1OFC X;  3G7R A;  1LVA A;  2KLO A;  3ZMV A;  5F1R A;  2QZ8 A;  5M5Y J;  2HYF A;  2R7V A;  2NYX A;  2VIX A;  3L2R A;  1I5Z A;  1RET A;  3OYN A;  3CUQ C;  4HYE A;  5F64 A;  3LSK A;  4CGR A;  2JN6 A;  2STT A;  2RC4 A;  5F04 A;  1FTZ A;  2ICW G;  5K7F A;  2ZME B;  2GA1 A;  2PMH A;  5AIQ A;  4BXX J;  4O5V A;  2K9N A;  5ICF A;  3ASN H;  3FX3 A;  1G3W A;  2E5N A;  4EJV A;  4WX9 A;  4ZTJ A;  3FXM A;  1Q1H A;  4B44 A;  1YS6 A;  3CCU I;  3DPU A;  3S3M A;  3CC2 I;  3BTI A;  4UUS B;  3MKL A;  4U0V A;  4I2O A;  2IAI A;  1R5G A;  2CW8 A;  3OYH A;  3CCM I;  1ORK A;  4KA4 A;  3T0Y A;  4E7I A;  3JRF A;  2IXS A;  3HIF A;  4GDF A;  2ZOY A;  3ERM A;  1R7J A;  1AHD P;  3VUQ A;  3VOK A;  1SD4 A;  4AIH A;  2B0L A;  2LF8 A;  1UFM A;  2HNH A;  1YW7 A;  3BZ6 A;  1QVT A;  4IRG A;  2AS5 F;  2DW4 A;  4HLX A;  5HS7 A;  3QOD A;  1YX5 A;  3TDZ C;  2LP0 A;  2OQG A;  2E34 A;  2KRH A;  3PM1 A;  4NC8 A;  2L7Z A;  4IHV A;  3H9Q A;  2K9M A;  1SVM A;  4AC0 A;  1F43 A;  3OYD A;  3E5Q A;  4BBR J;  3KPH A;  2G3B A;  2OPT A;  4R79 A;  2RQP A;  4GCK A;  3O8G A;  3HTS B;  1KZH A;  4BY1 J;  2OJE D;  4ESB A;  1MZB A;  1IRG A;  4B1R A;  3EUA A;  3RSN A;  3FBI B;  3EUH A;  1MH3 A;  2R7O A;  1RUO A;  5FO5 A;  4CYC B;  2HYJ A;  1LE8 B;  5E3O A;  3EDP A;  5DV5 A;  3F21 A;  2UUZ A;  1RKW A;  2GQQ A;  3VW0 A;  2DA1 A;  3OOP A;  3BJ6 A;  3KEY A;  2DCE A;  3BT9 A;  4BNC A;  4IX7 A;  5DUK A;  4PXI A;  1X19 A;  2FQ4 A;  3ZCO A;  2VQH A;  1W0U A;  1VTN C;  1BA5 A;  1I50 J;  3CCY A;  1D1C A;  3WU2 C;  3CCL I;  1W7P B;  5E3M A;  1E17 A;  3DEU A;  2ZCW A;  3P9I A;  1X2M A;  4EJT A;  2XIG A;  2WAD A;  2NP5 A;  2Y0S A;  4WXD A;  3A03 A;  1KYW A;  2W84 A;  2GXG A;  3SEZ A;  2WB1 A;  2YSR A;  1YLF A;  4ASN A;  2XAQ A;  2P5K A;  5CXI A;  3K6G A; 
#chains in the Genus database with same CATH homology
 1ETQ A;  5FMP A;  1FTT A;  5F08 A;  3JRB A;  1WPK A;  3UKG A;  4A3F J;  2CUF A;  3Q3S A;  5GPC A;  5M5X J;  3G56 A;  3D1N I;  2DMQ A;  4AC6 A;  2E1O A;  3BNI A;  2IEK A;  2DN0 A;  2DA6 A;  1PUF B;  5JLW A;  2O7T A;  2CQX A;  2JWT A;  1XS9 A;  1WH7 A;  3S17 J;  1A5J A;  2YUS A;  3JSJ A;  3HOX J;  3TED A;  1CQT A;  1HDP A;  5HSZ A;  3MNL A;  4DYC A;  3IH3 A;  5CW8 A;  5E3N A;  3BJB A;  1SGM A;  3JRG A;  1ETX A;  3BTJ A;  3CDL A;  3PPB A;  1LFB A;  5FKL A;  1R9T J;  4M3G A;  2P81 A;  2OF7 A;  1H88 C;  1MBJ A;  2DMP A;  1ETV A;  5IP6 A;  1IC8 A;  2HOA A;  2WB1 N;  3LSR A;  1MSF C;  5HBU A;  4A3I J;  1B8I A;  3BRU A;  1JUS A;  2HOS A;  3RH2 A;  3F0C A;  1E3O C;  2CUE A;  5F27 A;  3GTL J;  1ZK8 A;  1XC5 A;  3S15 J;  5HAW A;  3HKZ N;  1B72 B;  5K58 A;  1JTY A;  4X1E A;  4ME9 A;  5EZG A;  2LLK A;  1MNM C;  2NX4 A;  1U8B A;  4XRM A;  4IHX A;  1IJW C;  3OOU A;  2ZCX A;  4A3K J;  5EGO A;  3G1M A;  4MXM A;  1I3Q J;  3FK7 A;  2R93 J;  2M9H A;  3K2A A;  1IDZ A;  2XB5 A;  4ICH A;  2NVX J;  1Z0X A;  4DW6 A;  3HTA A;  2DA3 A;  2VKV A;  4L62 A;  2ZCN A;  4ACI A;  1JT6 A;  1U78 A;  1T33 A;  1TWG J;  1DU0 A;  3I4N J;  3JRA A;  1TC3 C;  1JUM A;  5E3L A;  3HIM A;  2JA6 J;  2NS8 A;  3HB9 A;  3TP3 A;  1JKP C;  3RZD J;  1UMQ A;  4JX5 A;  1BL0 A;  2HKU A;  3SJM A;  3BQY A;  3S5R A;  2K40 A;  3LSG A;  2L7M P;  4M3E A;  3OSG A;  2KT0 A;  4D7N A;  2XGC A;  3H3V K;  5D19 A;  1DU6 A;  2JA8 J;  3GBG A;  3T6N A;  5D18 A;  4FTH A;  3E7Q A;  5FLM J;  2R5Z A;  1D5Y A;  4IHW A;  2MSY A;  2QCO A;  2YS9 A;  2B63 J;  4A3B J;  2N8G A;  2EBI A;  1IRZ A;  3M4O J;  2WUI A;  3NAR A;  1A6I A;  1IGN A;  5CXG A;  3TW6 A;  3LSJ A;  1GV5 A;  4A3L J;  3AQS A;  3ZQC A;  3G1O A;  3B81 A;  3QPL A;  2PMZ N;  2CQQ A;  2EZH A;  1GV2 A;  2HXI A;  3FRQ A;  5DAJ A;  5GP9 A;  5FKK A;  2R0Q C;  2XB0 X;  3S1Q J;  3DCF A;  1B72 A;  1TWC J;  1XG1 A;  4D5C A;  1U9N A;  4EEF G;  1B8I B;  3JRH A;  2JA5 J;  4MO7 A;  4NDL A;  2G7G A;  4A93 J;  1JKR C;  2R92 J;  3AQT A;  3QKX A;  3ZQH A;  3NRG A;  4MIM A;  5F0F A;  2QF7 A;  3GTO J;  1RPW A;  2ID6 A;  2Q24 A;  1JTX A;  4UUT A;  5EGO B;  2TRT A;  3BQZ A;  3W6V A;  1BJZ A;  5FLV A;  5FGL A;  3HBL A;  1GVD A;  2K9Q A;  2MW8 A;  3G1L A;  5IYB J;  2QIB A;  2DMU A;  3EGQ A;  5FKO A;  3CRJ A;  4DZP A;  3S2H J;  4MFE A;  3HOY J;  3KKD A;  3LSP A;  4D5F A;  3VIB A;  2E19 A;  3PO2 J;  1GUU A;  1JJ8 C;  2EZI A;  1ITY A;  1U9O A;  3NNR A;  3HM5 A;  1QPI A;  2YVH A;  5C3E J;  3HOW J;  4XK4 A;  4AYB N;  1S7E A;  5EZH A;  1YRN A;  3BHQ A;  3P9T A;  2PBX A;  1ETY A;  3HDD A;  4B3A A;  3RZO J;  3HE0 A;  2JK3 A;  2ZCM A;  2R5Y B;  2GLO A;  2K9S A;  5IOY A;  4FE7 A;  1IG7 A;  3FIW A;  2R5Z B;  4DYR A;  2XPU A;  4B4C A;  4MLO A;  4C2M J;  3FIS A;  2EQR A;  3HGG A;  2Y0S N;  1ZKG A;  3B6C A;  2HXO A;  4I76 A;  2OI8 A;  4FCY A;  2RAE A;  3B6A A;  2G0E A;  1GT0 C;  4A3E J;  3Q0V A;  2D6Y A;  5JLX A;  3VW1 A;  3S14 J;  1MBK A;  2AO9 A;  3BR5 A;  2RHA A;  5C4Y A;  5D1R A;  1O4X A;  3ZQG A;  4QTR A;  2E2H J;  3QPS A;  3SDG A;  3PAS A;  3HOZ J;  3OIO A;  1X2N A;  2W48 A;  5F0H A;  5K7H A;  3CMY A;  2ECB A;  4D7M A;  4C3H J;  4JNN A;  4GFL A;  2LFB A;  3WHC A;  4KWA A;  2FX0 A;  5J3L A;  1VF9 A;  3GTG J;  1P7I A;  1SFO J;  2VI6 A;  1WH5 A;  2ID3 A;  4XID A;  1ZQ3 P;  1TWF J;  2ELK A;  3BR1 A;  3M3Y J;  3HTH A;  1Z77 A;  2DMN A;  4RDU A;  1Y1W J;  2Y30 A;  3GTM J;  2L0K A;  2X9D A;  1T56 A;  2HOT A;  3C2B A;  1HF0 A;  2G7S A;  4MK6 A;  2M2E A;  1RES A;  4XIC A;  4RBO A;  2ZOZ A;  2ME6 A;  5DTD A;  5C4X J;  2UXO A;  1JJ6 C;  4NEL A;  1VI0 A;  3LNQ A;  3LHQ A;  2HDD A;  5HOD A;  2UXU A;  3BTL A;  3IUV A;  3ZQL A;  1MBE A;  3HTJ A;  2R5Y A;  2DMT A;  4BY7 J;  2HYT A;  2MG4 A;  5IYC J;  1ZGW A;  2UXP A;  2LVS A;  1QVU A;  1AU7 A;  2NP3 A;  3L1P A;  5FJ8 J;  2NOG A;  3S16 J;  2NVQ J;  3CWR A;  3NXC A;  2V57 A;  1WI3 A;  2JMW A;  2E2J J;  3V6G A;  1YRN B;  5K7Z A;  3HEF A;  2ME0 A;  3VVX A;  2YU9 J;  5C4J J;  2G7L A;  5FHP A;  1FIA A;  2LY9 A;  3NI7 A;  1MBG A;  4A3C J;  2LTP A;  2M8G X;  3LOC A;  2Y31 A;  2KDZ A;  3JRD A;  2LR8 A;  1UI5 A;  2H1K A;  3LWJ A;  2ZB9 A;  1FIP A;  3HGY A;  4A69 C;  4HKU A;  3JRE A;  5BNG A;  5M3F J;  5FKM A;  1ENH A;  3MVP A;  4XRS A;  1HDD C;  2RAS A;  4Y7N J;  5EEA A;  3GZI A;  3NPI A;  4GFB A;  2VUM J;  3BR6 A;  3C07 A;  5EFY A;  1W0T A;  1TWA J;  1WCM J;  3S1R J;  2CU7 A;  5AQC A;  3A01 B;  3BTC A;  3F1B A;  1TWH J;  2Y9Z A;  5J1R A;  4GCT A;  1NK2 P;  2XSD C;  3NAU A;  2XGD A;  1ZTR A;  3BR0 A;  1GDT A;  2M34 A;  1RKT A;  1MSE C;  5J1Y A;  2FJ1 A;  3S1M J;  4J19 A;  1AKH A;  2FD5 A;  3QBM A;  3S1N J;  2XPV A;  1VFC A;  3A02 A;  3V78 A;  2QOP A;  3BG3 A;  1VND A;  3JR9 A;  2LKX A;  5EG0 A;  4A3D J;  2OER A;  1NTC A;  3HOV J;  3ANG A;  4QSH A;  3RD3 A;  1POG A;  3K7A J;  5C44 J;  2L9R A;  2X6O A;  1MBH A;  4V2F A;  2CJJ A;  2E2I J;  1OJL A;  2DA7 A;  4M3D A;  3GTQ J;  4M3F A;  4QIW N;  1JT0 A;  2GEN A;  1IDY A;  3GEU A;  5M3M J;  3S2D J;  1H8A C;  3DPJ A;  2DJN A;  4UUS A;  3CJD A;  2XPW A;  4JP0 A;  5IPA A;  1APL C;  4XRS G;  2O9L A;  2F07 A;  2IU5 A;  1EF4 A;  1JKQ C;  3KKC A;  4LOC A;  5EYR A;  3VVY A;  1H89 C;  2XDN A;  1FEX A;  3FKI J;  3BCG A;  2TCT A;  2COB A;  3MN2 A;  3FK6 A;  2NS7 A;  1ETK A;  5J1U A;  2HI3 A;  2NVT J;  4W1U A;  3TW7 A;  2VPR A;  3BG9 A;  3Q0W A;  3IH4 A;  2H8R A;  1K61 A;  1ETO A;  3QQA A;  3A01 A;  1HCR A;  4GCL A;  4IEJ A;  3HTI A;  2L7F P;  3I4M J;  4GFK A;  5M5W J;  1FJL A;  3TP0 A;  3WHB A;  1UHS A;  4A3M J;  9ANT A;  2DG8 A;  1JUP A;  4ABZ A;  2R7Z J;  2UXI A;  2O7O A;  3KZ9 A;  3VVZ A;  4FE4 A;  3O60 A;  2XGE A;  1K83 J;  3OSF A;  2QTQ A;  3PO3 J;  4I6Z A;  4CYC A;  1LE8 A;  2D5V A;  3RQI A;  3ZQF A;  3LJL A;  4UDS A;  5H9T A;  1RR7 A;  3GTP J;  4AF5 A;  3ZQI A;  4X6A J;  1MH4 A;  3ON2 A;  5IP9 J;  3BG5 A;  5IYD J;  1X58 A;  2CRG A;  1BW5 A;  4NN1 A;  1AKH B;  1OFC X;  3O8H A;  3G7R A;  5DS9 A;  3EUP A;  5M5Y J;  2Y9Y A;  2PZ9 A;  1F36 A;  1RET A;  4Y52 J;  2FBQ A;  2M0C A;  3BR3 A;  1BW6 A;  5EG0 B;  4CGR A;  2JN6 A;  1FTZ A;  5F04 A;  4M3B A;  2Y2Z A;  4YZE A;  4HNV A;  1ZR2 A;  2JA7 J;  2XRL A;  3BR2 A;  4JX6 A;  2GM4 A;  5K7F A;  3GTJ J;  2GFN A;  1WGX A;  3ZOB A;  3E7L A;  4BXX J;  2K9N A;  1ETW A;  1JKO C;  2EH3 A;  3RKQ A;  5F0C A;  3BTI A;  4AUX A;  4UUS B;  5FKN A;  3MKL A;  3VPR A;  1OCT C;  2IAI A;  1UG2 A;  2AHQ A;  2QWT A;  2WAQ N;  1ORK A;  3JRI A;  4A3G J;  3JRF A;  2ZOY A;  4IHY A;  4BKX A;  2DA5 A;  2REK A;  1PUF A;  1AHD P;  3VUQ A;  4BBS J;  3VOK A;  4W97 A;  2VKE A;  4A3J J;  2UXH A;  2IBD A;  3DEW A;  1HLV A;  5IOZ A;  1QVT A;  2WGB A;  2LK2 A;  3SFI A;  2DA2 A;  2LP0 A;  3PM1 A;  1UI6 A;  2LD5 A;  2L7Z A;  3JRC A;  4IHV A;  2MGQ A;  1F43 A;  2GBY A;  4G12 A;  4AC0 A;  3VOX A;  4BBR J;  2G3B A;  2OPT A;  2QKO A;  4GCK A;  1Q1V A;  1JGG A;  3O8G A;  4BY1 J;  2DTZ A;  4DZJ A;  2W53 A;  1MBF A;  4JL3 A;  1Y1V J;  4C3I J;  4B1R A;  2I10 A;  1QRY A;  4FIS A;  1I6H J;  4C3J J;  5GPA A;  1G2H A;  2ECC A;  3GTK J;  3ANP A;  1MH3 A;  3VW2 A;  4JKZ A;  4CYC B;  3HOU J;  2HYJ A;  1LE8 B;  1OCP A;  5E3O A;  2JJ7 A;  3Q0U A;  4JYK A;  5F1J A;  1IV6 A;  1RKW A;  2X48 A;  3VW0 A;  2O8K A;  5EF6 A;  2DA1 A;  1IUF A;  2HQ5 A;  3VP5 A;  4JX4 A;  3BT9 A;  2EZL A;  3H0G J;  4M6V A;  3IH2 A;  4PXI A;  2NVY J;  5EDN A;  2FQ4 A;  3IV5 A;  1P7J A;  2WV1 A;  1W0U A;  1LFU P;  1BA5 A;  1I50 J;  3CCY A;  3CQZ J;  2DA4 A;  5IP7 J;  3ON4 A;  4L5E A;  5E3M A;  1NK3 P;  3KNW A;  4MFD A;  2DG7 A;  4S0H B;  1X2M A;  2YVE A;  3COL A;  2GUH A;  2NP5 A;  2EZK A;  4V2G A;  3A03 A;  1SAN A;  1ZR4 A;  5CXI A;  4DYQ A;  1HOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...