3SDGA

Ethionamide boosters part 2: combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole ethr inhibitors.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
189
structure length
184
Chain Sequence
ELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor/inhibitor
molecule keywords HTH-type transcriptional regulator EthR
publication title Ethionamide Boosters. 2. Combining Bioisosteric Replacement and Structure-Based Drug Design To Solve Pharmacokinetic Issues in a Series of Potent 1,2,4-Oxadiazole EthR Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 77
structure length 184
sequence length 189
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3sdgA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3sdgA02
4C3IJ 1DU6A 5CXGA 3O8GA 2HQ5A 2LVSA 4FE4A 1A6IA 2DA4A 5FGLA 2DTZA 2X48A 3RZOJ 3BR1A 1PUFB 3RQIA 4C3HJ 5IYDJ 2LLKA 4DYQA 4UUSB 3SDGA 2DMNA 2QIBA 4CYCA 5IYBJ 3JREA 2IBDA 1TWFJ 1UG2A 3FIWA 2QWTA 3QKXA 2QTQA 2JJ7A 3GTGJ 5D19A 3LNQA 3W6VA 3RH2A 3ZQCA 3BR0A 1IDZA 2MW8A 3I4NJ 1VF9A 3QQAA 3CDLA 3JRBA 2ECCA 3BQYA 1IC8A 5J3LA 4QIWN 1GT0C 5C3EJ 3ANGA 2L7ZA 4L5EA 3BG3A 4DZJA 1LFUP 3SJMA 4ICHA 1W0UA 2YVEA 1ETWA 3HGYA 2UXIA 5AQCA 3DCFA 4FTHA 1WGXA 1TWAJ 1JT0A 4B3AA 1VNDA 2NX4A 2M9HA 4JX4A 2K9QA 4UDSA 5EYRA 5GPAA 4Y7NJ 3HOWJ 4S0HB 4Y52J 1RESA 5E3OA 2XGEA 4XICA 2M34A 2WB1N 1ZR2A 3BTCA 1MNMC 3CCYA 5IP6A 4YZEA 1LFBA 2EZLA 3Q0VA 2FJ1A 1UI6A 3O60A 1MBGA 3S2HJ 2ZB9A 3LOCA 3LWJA 2DMPA 2HDDA 3AQTA 2JN6A 4IHVA 2K40A 1ZKGA 1RKTA 2LY9A 2KT0A 4MO7A 1FIPA 5EZGA 3BJBA 1JJ6C 4CYCB 4A3EJ 1H88C 4JYKA 2O7TA 1IDYA 2KDZA 1H8AC 1R9TJ 1VFCA 1T33A 3NI7A 2M2EA 3OOUA 3JSJA 1ENHA 4HKUA 1TWCJ 2YS9A 5IYCJ 5FKKA 1W0TA 3GTKJ 3VVYA 1ETYA 4NN1A 4JX6A 4M3FA 3JR9A 2R5YA 2LD5A 5M3MJ 1B72A 2QOPA 5HSZA 2ELKA 2PZ9A 4EEFG 2E19A 3HDDA 1ORKA 3E7LA 4XRSG 2G7LA 1QPIA 2WAQN 1MBJA 2G7SA 3NXCA 3PPBA 1PUFA 2RHAA 1JUMA 4ACIA 1JUSA 1U9NA 1SGMA 3CMYA 4L62A 2YU9J 2DA6A 3HE0A 2CQXA 2CJJA 2Q24A 2DA1A 2VI6A 2RASA 3BTIA 1HLVA 1IRZA 1IG7A 2EZKA 3V6GA 3BR5A 3Q0WA 1BL0A 4D7NA 1IV6A 1IGNA 5K7FA 3GTJJ 3TP0A 3ANPA 4RBOA 4BBSJ 4JL3A 3G7RA 2LFBA 5IPAA 3KKCA 4JP0A 4I76A 3P9TA 4BXXJ 3G1LA 3S15J 1RETA 3VVXA 3I4MJ 2ZCXA 4AF5A 2TRTA 3NAUA 5BNGA 4DW6A 1JKQC 1BW6A 1Z0XA 1A5JA 2L7MP 2COBA 1MSEC 5F0CA 3F0CA 4XRSA 4X1EA 4DZPA 4HNVA 3M3YJ 1F43A 1WCMJ 2NOGA 2YUSA 4A3MJ 2LKXA 4KWAA 2IEKA 1P7JA 1Z77A 2P81A 5JLWA 2XRLA 2MSYA 4NDLA 2HOSA 5C4YA 4C3JJ 1JUPA 2R5YB 1B72B 2GFNA 3ON4A 3BNIA 3B6CA 1B8IB 4XRMA 1ZR4A 2ZOYA 3E7QA 3LSJA 5EG0A 1ETOA 4MLOA 3C07A 2UXOA 5DAJA 1QVUA 2JA8J 4NELA 3CRJA 4MFDA 3O8HA 2MGQA 4IHXA 3IH4A 3ZQIA 4JNNA 2JA7J 2VPRA 3ZQHA 1ZTRA 2GUHA 1SANA 3PM1A 5EGOA 3VPRA 3GTLJ 2YVHA 1GV5A 2OF7A 2HXOA 3OIOA 2EBIA 2AHQA 4M6VA 5J1YA 3K7AJ 5GPCA 2G3BA 2O9LA 5E3LA 4BY1J 3HOVJ 2RAEA 2Y30A 3FRQA 4DYCA 2F07A 1X2MA 1MH4A 2CQQA 3HIMA 5EFYA 3VW0A 3CWRA 2LR8A 3HM5A 3MNLA 1ETXA 1O4XA 2O8KA 3FK7A 4IHYA 4G12A 3VOXA 4LOCA 2CRGA 5F27A 2DMUA 1H89C 1MSFC 1WPKA 4A3GJ 2PBXA 3GTMJ 2L7FP 2E2JJ 1NTCA 2X9DA 4V2GA 4IHWA 2REKA 3NNRA 4A93J 4ME9A 2IAIA 1ETVA 1CQTA 2DA5A 4GFLA 4V2FA 1HF0A 2NVQJ 4A3IJ 1HCRA 5EG0B 2OERA 2EZHA 4FCYA 3NPIA 2LTPA 5EF6A 2DMTA 3VVZA 3JRAA 1IJWC 5D1RA 3H3VK 1ZQ3P 3ZQFA 1FEXA 2JMWA 2NP5A 1GV2A 1DU0A 2E2IJ 3BG9A 2UXPA 3EUPA 1POGA 4AUXA 3BQZA 3S2DJ 1S7EA 1JKOC 4PXIA 3D1NI 5FHPA 5J1RA 5EEAA 3JRDA 4AC6A 2EZIA 5EGOB 3ZQGA 1FJLA 4A69C 2VUMJ 2CUFA 1U9OA 2IU5A 2G0EA 3TW7A 4D5CA 2JA5J 1ZGWA 3JRHA 2GENA 3S17J 4XK4A 1B8IA 3VUQA 1ZK8A 5C44J 3CJDA 4CGRA 1FTTA 4A3DJ 3VW2A 5J1UA 2W48A 2TCTA 4GFKA 5FMPA 2X6OA 4XIDA 3HOYJ 1XS9A 5FKOA 1RPWA 2ECBA 3FISA 3HTHA 2FX0A 2OI8A 1FTZA 5HAWA 1LE8B 4JX5A 3V78A 3L1PA 1YRNA 1I6HJ 3BCGA 3JRIA 3PO3J 5JLXA 5C4XJ 2DA2A 4GCTA 2QF7A 4JKZA 1K61A 3F1BA 2E1OA 3HGGA 2EQRA 3JRFA 1GUUA 2FQ4A 2E2HJ 3CQZJ 2Y9ZA 5FLVA 3ZOBA 4AYBN 1MBEA 1VI0A 1UI5A 3LJLA 1OFCX 2H1KA 2NP3A 3B6AA 2JK3A 1I50J 5F04A 3S16J 1TWHJ 3AQSA 3HB9A 3HOZJ 2HI3A 4BKXA 3GTOJ 2FD5A 5IP9J 5E3MA 5FLMJ 3A01B 1MH3A 3S1MJ 3HTIA 5M5YJ 3A02A 2XPVA 3DEWA 2DA3A 2ID3A 3BTLA 4B1RA 3GZIA 2XB0X 1JTXA 2HOAA 4D7MA 5F0FA 1SFOJ 1X58A 3MN2A 4B4CA 1ETQA 2CUEA 2L9RA 1P7IA 1UHSA 2GBYA 3BT9A 3FKIJ 3IV5A 3DPJA 3IH2A 2NS7A 2NVXJ 3RD3A 4RDUA 3QPSA 5FJ8J 5IP7J 3K2AA 3GTQJ 3LHQA 2LK2A 3B81A 5F0HA 1GVDA 2XGDA 3BG5A 2I10A 1YRNB 2PMZN 2M0CA 4AC0A 1ETKA 4MFEA 1BW5A 2XGCA 3C2BA 2Y31A 4MXMA 5FKLA 1FIAA 4A3JJ 4BY7J 3S14J 2VKEA 4IEJA 2DG8A 2MG4A 3BR6A 2EH3A 2N8GA 4W1UA 3VP5A 1T56A 4M3DA 3NARA 1NK2P 3QBMA 2AO9A 1XC5A 2DJNA 2LP0A 2ZOZA 1ITYA 3H0GJ 5F1JA 3HOUJ 2R5ZB 4A3LJ 2D6YA 2NVTJ 3KNWA 2ME6A 4UUTA 3ZQLA 3IH3A 1JJ8C 2DMQA 5E3NA 3JRCA 1LE8A 2ZCNA 5HBUA 1QVTA 4GCLA 2G7GA 3BHQA 1OJLA 3S1NJ 3VW1A 1AKHA 2Y9YA 2XB5A 3GBGA 1HOMA 5CW8A 2FBQA 3PASA 2Y0SN 3KZ9A 1AU7A 3UKGA 5K7ZA 2ZCMA 1BJZA 1D5YA 2XPWA 4BBRJ 3OSFA 3HKZN 1HDDC 2HYTA 3BR2A 3HEFA 2M8GX 1JTYA 1MBFA 5C4JJ 3NRGA 5IOYA 5FKNA 1MBKA 3G1MA 5GP9A 5K7HA 3KKDA 2UXHA 3VIBA 2WGBA 3SFIA 2B63J 3COLA 3A01A 1Y1VJ 5K58A 2NVYJ 1Q1VA 3Q0UA 4DYRA 3TEDA 2XDNA 4A3KJ 2GM4A 1WH7A 3S5RA 5M5WJ 4A3BJ 3S1QJ 2HYJA 2XPUA 2UXUA 3LSGA 3TP3A 3WHBA 1WI3A 1IUFA 4W97A 5HODA 2W53A 2JA6J 3Q3SA 9ANTA 2WUIA 4A3CJ 1I3QJ 2O7OA 4M3GA 2HOTA 3BRUA 2CU7A 1G2HA 3OSGA 2V57A 2VKVA 3VOKA 4QSHA 1E3OC 4MIMA 2QKOA 2NS8A 2XSDC 1APLC 5D18A 3T6NA 3GTPJ 3MKLA 1TWGJ 5IOZA 5F08A 2D5VA 2R93J 3M4OJ 1AHDP 1X2NA 1AKHB 3G1OA 3G56A 1RKWA 1Y1WJ 4GCKA 4MK6A 4M3BA 3TW6A 1HDPA 1F36A 1JGGA 3A03A 3S1RJ 5DTDA 3BTJA 5M5XJ 4QTRA 3EGQA 4UUSA 2DG7A 3HTJA 2DN0A 1QRYA 2Y2ZA 3MVPA 3ON2A 3BR3A 1XG1A 3IUVA 1K83J 2JWTA 2R5ZA 5EZHA 1NK3P 3FK6A 1EF4A 4FISA 5CXIA 1TC3C 2K9NA 1JKRC 3LSRA 4GFBA 3RKQA 3LSPA 3HBLA 2R7ZJ 1WH5A 2ID6A 3GEUA 1OCPA 5M3FJ 4A3FJ 2K9SA 4D5FA 5EDNA 2L0KA 1OCTC 3WHCA 2DA7A 3HOXJ 1U8BA 2GLOA 3RZDJ 1GDTA 3JRGA 1RR7A 1JT6A 3HTAA 4ABZA 2OPTA 4FE7A 1BA5A 4M3EA 1JKPC 4I6ZA 1MBHA 2HXIA 4X6AJ 4J19A 5FKMA 4C2MJ 2R0QC 2WV1A 3QPLA 2R92J 1UMQA 3PO2J 2HKUA 5DS9A 5H9TA 1U78A 2QCOA 2H8RA 2ME0A
chains in the Genus database with same CATH superfamily
4XSXF 1F5TA 5E17F 1W5TA 2X6YA 1FOYA 3K10A 1PVEA 1AWCA 1ULYA 1B4AA 5CJ9A 2HQ5A 1U2WA 4NC6A 4IPAA 4UUVA 4C2MA 4KNYA 3RZOJ 3BR1A 2VKHA 5IYDJ 1DP7P 2LLKA 4MTDA 4F93B 1YW8A 4CCJA 2DMNA 1RR8C 4KFCA 2QIBA 3PFYA 4BGDA 4QLCU 3JREA 2IBDA 2IA2A 1UG2A 2QWTA 3CDIA 3DKXA 4HF2A 2QTQA 2IRFG 1FNNA 1AA7A 2DFHA 4E7KA 3GTGJ 5D19A 3LNQA 3RPUA 4OOIA 3BR0A 5BQTA 2MW8A 4M72A 3JRBA 1HW1A 2Y75A 3KYDB 2BXZA 5J3LA 3GZNB 2I5UA 2IGKA 3L2RA 3BG3A 3HHHA 2FE3A 4JOMA 3REOA 1I5ZA 3IP4B 4DZJA 3H0DA 5AIPA 3DF8A 2MYSA 4ICHA 1IXRC 4LG0A 5J8FA 1YYVA 2V1DA 3K4KA 3CC2I 2VQCA 1JT0A 4GO1A 3U9GA 1DGRM 1PYVA 2DODA 3D5RC 3MZYA 5F1RA 3EUAA 5H6RA 4GRIA 4CGZA 1TQPA 1YE9A 2XGEA 4M9ZA 2WB1N 2X1DA 2W1OA 3OYGA 2V1NA 2A61A 5CQEA 4CO8A 3NQOA 3E6BA 5KAFC 3WU1B 3DEEA 2M5WA 1SVLA 1TTYA 3Q0VA 3ZMSA 3LQQA 2DOFA 4CZZA 2XROA 2AXTC 2IJLA 2JN6A 4IHVA 1K6YA 3C3WA 3U1KA 5EZGA 1JJ6C 4CYCB 1BI0A 2HVQA 3GUDA 4YELA 1A04A 1B9MA 1H88C 2O7TA 2KDZA 2HU9A 1R9TJ 3HJEA 1T33A 4UVAA 2L9SA 4BNCA 4OMZA 4HX4A 5FLXK 4I0BA 5IYCJ 2K3PA 1QA6A 4V19K 3GTKJ 4PJMA 1QZYA 3CMMA 2R5YA 3N4MA 2M0MA 2ELKA 3K4JA 2EFNA 3BY6A 4N0BA 1OYYA 1QPIA 2WAQN 2CSOA 2ZNYA 2WV0A 5TGTA 4XM3A 4IXAA 2YSRA 3H1CA 1U9NA 4ACIA 3CMYA 2YU9J 3HE0A 2CQXA 2DCEA 2Q24A 2RASA 4F91B 1HW2A 2EZKA 3V6GA 2ELHA 3WTWC 2X6XA 2F5EA 3AG4H 4D7NA 4U7DA 3AAFA 2R7DA 3KZIC 5KK1A 3IWZA 3TP0A 4ZDOA 4BBSJ 3JSOA 1LKXA 4UV8A 1VQMI 4P5OA 2PI0A 3DBRB 4BXXJ 5LHIA 3G1LA 3G2BA 4L0ZB 3S15J 4I0AA 2C6YA 1YHQI 1T08B 4DOZA 4AF5A 2V9PA 3QYBA 4NUBA 2ZSIB 5H6QA 4DW6A 3GF2A 1BW6A 2L7MP 1ON1A 1QHHD 2RQPA 5DDGA 2UXXA 2UWMA 1DPRA 2JRMA 1VQKI 4HNVA 3M3YJ 1HXDA 3DTEA 4XLHA 3CMAI 2MSYA 1QGPA 3ABTA 3HYIA 3L2QA 4C3JJ 2O5RA 1MZBA 3O6BB 2YX4A 1T98A 2GAUA 2CUJA 4P55A 2O03A 1Z6RA 2ZOYA 3LSJA 5EG0A 5FLXZ 3TKYA 2XASA 1Z9CA 2QSGX 1IN5A 2BY2A 3FF5A 1ODDA 2RN7A 4Y17A 4EV0A 1N78A 1A31A 4QWQA 4M6XA 3K4MA 2PMUA 3KFWX 4U87A 3QODA 2MGQA 3GZ5A 4ENJA 2PMZA 2CO5A 5BMZA 4XBFA 2F5FA 2W00A 3IRQA 1LDKB 2IA0A 2EINH 2JSPA 1G59A 2ESNA 3P9CA 4HPQA 4AVPA 4ESJA 1RUNA 2OF7A 2EB7A 2H8WA 2EBIA 2AHQA 3EPZA 5GPCA 1SMTA 5E3LA 2BGCA 2WTEA 3RKXA 4DYCA 3WG7H 1MH4A 1J75A 2CQQA 2DT7B 2I8DA 3HM5A 3LAPA 3MFKA 4PFPA 4ON0A 3BP8A 2JZYA 3FK7A 4BJ6C 4IHYA 4LOCA 3FDYA 2P4WA 4CZCA 1BOBA 2HYGD 3CO7C 2OC6A 4EJWA 2REKA 4ME9A 1ETVA 2L2OA 1CQTA 4DIQA 4RGXA 4CUGA 1V55H 2HS5A 3QP6A 2QWWA 4MEYF 4HZFA 5J47A 3OS1A 3ZCOA 2Z1DA 3DFGA 2D1HA 3KPHA 1TLHB 1S8NA 3NPIA 2DMTA 1OMIA 5D1RA 1ZQ3P 3ZQFA 1SAUA 4RA2A 1MGTA 5LFAA 1J5YA 4X0GA 2E2IJ 3QYEA 2UXPA 4XLEA 3CF5F 3SHFA 4YFKF 1S7EA 2W25A 2VBWA 3JRDA 4AC6A 1YQAA 2EZIA 2OCCH 3WTVC 2KIQA 2Z2SB 5A2QK 2FOWA 2OAZA 2QQ8A 2CUFA 3DU6A 1ZG1A 2VUMJ 1TNSA 3VTIA 5AONA 1YIOA 3UR3C 2JUCA 4P96A 1OPCA 2A3SA 2YR2A 5C44J 3PUFA 3CJDA 3RDIA 1LDDA 4XSZF 3NWTA 2HKOA 5DV5A 3S93A 3VYRB 2W7NA 3WGIA 2ECBA 1V54H 3RKWA 4PJLA 2A6TA 5GAGJ 2F4IA 3V78A 4NHJA 3L1PA 1MKMA 3FMQA 2R7SA 2QF7A 3L2UA 1K61A 3F1BA 3DXJF 3CCUI 3MQ0A 3JRFA 2R7TA 5D6EA 4A2UA 3ASNH 4AIDA 3ZOBA 3LJLA 2H1KA 2JPCA 3M8JA 2FOKA 2M1BA 4F3QA 3HOSA 2XV4S 4BQOA 3AQSA 3HB9A 2EJRA 4BKXA 2AQEA 5FROA 2FD5A 3U21A 2F5VA 5HDKA 1MNEA 1BIAA 3ULQB 5M5YJ 2A07F 3D0SA 3A02A 2PX9A 2DA3A 1JTXA 3GMEA 2XAUA 4B44A 1UB9A 1ZYRF 3MN2A 2RVCA 5E79C 1P7IA 1UHSA 1UJ8A 2VL8A 3RIRA 3W3CA 1QO0D 4CHUA 1Z3YA 5E1ZB 4AIJA 3K6GA 3SXYA 4RB2C 2QKMB 4R8HA 4IQ4A 3GCMA 5LBQA 2I10A 4IL6C 1YITI 2Z33A 2GXBA 1LPQA 1JE8A 1ETKA 1FBSA 4YG2F 3MKZA 4MXMA 5FKLA 3CF2A 4A3JJ 4Y15A 3HPGA 1VQ6I 3S14J 4LGWA 2MG4A 2LBFA 2HPIA 3BR6A 1LDJA 2QA4I 3KLNA 4XN3A 3NARA 4RMNA 3TO6A 1NK2P 3R0JA 5E8IA 3VWBA 1ITYA 1Z6TA 5FGMA 2R5ZB 1P6RA 3E5UA 1R1VA 4A3LJ 3TDUC 4ENMA 4FQGA 2DFIA 2VC1A 1JJ8C 1ZELA 3I54A 4L9JA 5E3NA 2JVHA 1Z05A 4HDUA 2XSJC 2X1EA 4L9NA 4IVNA 2LSOA 2XB5A 1X3ZB 3I64A 5CW8A 3ZN1A 5ILSA 3PASA 5LGTA 3KZ9A 2Z3YA 1YJWI 2ZCMA 2AS5F 4UB8C 5BPDA 3WTSC 2M8GX 4IRHA 4ASNA 5C4JJ 2WB1A 5FKNA 3NRGA 4KIGA 4ZC3A 3KKDA 3PSIA 3FXQA 2CW8A 4BE1A 3COLA 1Y1VJ 1YJ9I 5K58A 2NVYJ 2LC2A 2QGUA 4DYRA 1D1BA 5JHFA 4A3KJ 4HX8A 4RLFA 4AIKA 2GM4A 4FT8A 4Q5SF 4EJUA 3E6DA 3B73A 1TZLA 1J7KA 3P5JA 3CD6I 1WSUA 1IRGA 2XAJA 1BBYA 3Q3SA 4KN7X 1I3QJ 1MMAA 2O7OA 2HOTA 3BRUA 1ZG3A 3HRSA 3BOQA 3OSGA 2ZJ2A 5AIQA 2V57A 2DDAA 4XRFA 3HPHA 4MIMA 1QU3A 4AVZA 4I09A 4UHTA 1KU2A 4GGGA 1HC8A 3FHNA 2Q1ZB 5F08A 3M4OJ 4WWCA 1MNDA 2L01A 4OD4A 1B59A 3L00A 4IRIA 3L09A 2LREA 2WAQA 2O8XA 3G56A 2HTJA 4N9HA 3W2VA 4GCKA 2FF4A 2KIFA 3F72A 3E3VA 4NNJA 3TW6A 2DQRA 3I5UA 4B47A 4BQNA 3CC4I 3QOEA 5L3FA 5DTDA 3BTJA 5M5XJ 4FETA 4Z2YA 3K69A 4MEXF 2EA2A 2EFWA 4KJZA 1NG7A 3V8JA 1K83J 5KCMA 2JWTA 2R5ZA 5CVRA 2ISZA 1RI7A 4BU2A 1TC3C 2K9NA 2CS3A 2IXSA 1JKRC 1IAWA 1VQ7I 3RKQA 3LSPA 2ID6A 4Z6YA 3VYSB 5M3FJ 2WA0A 3OYNA 2EK5A 1ZGJA 4N9IA 3TMOA 1D1CA 2DA7A 3HOXJ 2GLOA 1YW9A 2OQRA 3CTAA 3JRGA 3DBLB 1HKTA 3HTAA 4OMYA 4ABZA 4FE7A 4XLFA 4E7ZA 2UZKA 4N4NB 3S3OA 1CF7A 4I6ZA 4II2A 5HVQC 1XSVA 5D8KB 1SD4A 4MTEA 3DPUA 4KUMA 3IUOA 4HNUA 2R0QC 2EV6A 1HBXG 1UMQA 3ABLH 2HKUA 3A4CA 4WK8F 3R0AA 1UAAA 1U78A 2ME0A 2B9SA 5HNFA 3LMMA 2XVCA 4TV7A 5BPIA 5CVUA 1A35A 2FNPA 2LVSA 1A6IA 2DTZA 3ASOH 2E1CA 2FXAA 2VE8A 3HXLA 3FMSA 5DCMB 2XAHA 2VT3A 4XL9A 4DJAA 5IYBJ 3GFLA 2IPQX 4B09A 1TWFJ 2FJI1 3FIWA 2D2WA 2NS0A 1IXCA 1MDMB 1K78A 1IN6A 1FY7A 3LA3A 1S6LA 3NS4A 3ZRGA 3RH2A 3ZQCA 3KP2A 3I4NJ 1WRJA 4Q48A 4BQQA 2DYRH 1D0YA 3WU2C 2R7QA 4KIBA 1T8IA 1LFUP 3WTUC 3CCSI 2Q2EA 1MMGA 4ENKA 3OYDA 3HGYA 2OTJI 1OCZH 2QKLB 3RKYA 2R7OA 2KRFA 1TWAJ 3GX4X 3SWHA 4II3A 1VNDA 1YO5C 3IWFA 4IRGA 4UDSA 2W24A 3T8RA 5EYRA 3HOWJ 2QQ9A 4S0HB 2ZXJA 2VB6A 2P5VA 2KL4A 4XICA 4BE2A 1MJ9A 2E1MC 4UVBA 1KONA 4RB3C 2E1NA 1MJBA 4HQEA 4HYEA 1MNMC 4Y4RA 2P6TA 1HKQA 2OZUA 2DPUA 4YZEA 2XGXA 1U0JA 1BM9A 1BIBA 3H5AA 4KISA 4IHTA 3KIOA 3FM5A 1J59A 2K40A 2ZJQF 5CPRB 3OS0A 1ZKGA 4ZYDA 4A3EJ 4KDPA 5D5WB 1RZ4A 2EWNA 1G3WA 2IW5A 4RGUA 1P4XA 2IS2A 1ENHA 2VXDA 2YS9A 1J2XA 1W0TA 3VVYA 2LY1A 4NN1A 3JR9A 1XCBA 1T39A 4XLPF 2DQLA 4RGRA 1B72A 3CCJI 2QOPA 1R1UA 3TL4X 3OYBA 2PZ9A 4LLGF 5HSZA 4D0PA 3E7LA 2A05A 5ED4A 4LG0B 1Z91A 1FBQA 5TISC 3NXCA 4XQFA 3PIPF 3ML6A 2RHAA 4I2OA 3FXMA 1SGMA 3RPUD 2ZSHB 3VSKA 3KP7A 4L62A 3TBIA 2CJJA 2DA1A 3KX2A 1HLVA 3T5XA 2NVUB 3SZGA 3M1CA 2RC4A 1IG7A 2V79A 3LA2A 4EM2A 3BR5A 3Q0WA 4HV6A 1IV6A 1DDNA 3WG9A 4A0XA 5K7FA 1DPUA 5IT3A 2MH9A 4XLCA 1W7PB 3G7RA 4BQAA 2LFBA 5DUIA 2DFEA 1BR1A 4JP0A 4I76A 3P9TA 4CXFA 2VQLA 1O3QA 4O5VA 3P9KA 4H0EA 4HQMA 3TO9A 3NAUA 3ECOA 1JKQC 1IV8A 1Z0XA 2MH2A 2KDOA 1FPQA 5K1YA 1QPMA 1GHCA 1HSTA 1MSEC 1W7PD 1EH6A 3R4KA 4RM3A 5E8GA 4X1EA 2PG4A 4G9YA 2NRAC 2HDWA 2A2FX 2LKXA 3GFIA 2HOSA 2JA2A 5HLGA 3PJRA 3V8KA 4ENNA 3F8BA 4LLNA 2R5YB 4KT5C 1VQ5I 3KYCB 2GFNA 4YIRX 3EUHC 2BOLA 3J81K 3O3KA 2A5YB 4XRMA 2X85A 3K70C 1ETOA 2Q0OA 3OS2A 1R7JA 2UXOA 3C07A 5LLQA 2MC4A 2OUMA 4I02A 2KFDA 2H09A 1O7LA 3I3LA 3SZPA 2L54A 1YS6A 2HR3A 1P92A 3RYPA 2GA2A 2CMPA 3IC7A 5GTHC 1FP2A 1R58A 2KHMA 4CCLA 2ETHA 2BYVE 2VPRA 1XX5A 4KT6A 3V8LA 4BH9A 3KLOA 5BOXA 5EGOA 1XB4A 3HTUA 1R23A 1IRFA 1B6AA 4XMYA 3FM3A 4KITB 4PJNA 4WXCA 3L7WA 1ZG5A 3RTRA 3ZN0A 5J1YA 4BY1J 2Y30A 3FRQA 1X3UA 1ZN2A 1CGPA 2E1MB 1X1PA 1D0ZA 4C2UA 2M45A 4ZZLA 4OAYA 2O8KA 4XKBA 1ACIA 3VOXA 3V7RA 1ZGAA 3GTMJ 2L7FP 3T1BA 4EVIA 1Z3XA 1UG0A 3NNRA 3PQJA 4A93J 1W7PA 5E18F 4KN4X 1R5GA 1WWXA 5E1XA 4QPQA 5LEKA 4GFLA 3N05A 1KQ9A 1FZPB 3M7GA 1HCRA 5EG0B 2WC2A 1NG6A 3A0HC 4M74A 2OERA 2CH0A 2NNNA 3E97A 5EF6A 3TGNA 3HSFA 1FMVA 3H3VK 2RQQA 5CKTA 4C9YA 1GV2A 1M1EB 3BG9A 2VIXA 3J81Z 3BQZA 1DUXC 3S2DJ 4BDYA 4YIIA 1OR7A 2E5ZA 1YTYA 2KRHA 1K79A 2XKOA 5EEAA 4WF2A 2DPDA 2IS4A 4ZYGA 4A69C 2BY3A 4ZDPA 2H94A 1U8RA 1W5CC 2MD0A 2ZO4A 3TW7A 2IU5A 1I6XA 2JA5J 2NNYA 3S17J 3LL7A 4XORA 2FMYA 2JRTA 2M7BA 1R5ID 3R6SA 1SC7A 3VUQA 2KZVA 2LOOA 2PFVA 1R4NB 2W48A 4GFKA 1W5SA 5FMPA 2OV7A 3K4BA 2MABA 3FISA 4NQWB 2YVXA 2FX0A 2QZ8A 4M9XA 2OI8A 1FTZA 3OWTA 3C2HA 4JX5A 3IKTA 4WX9A 1I6HJ 1S7OA 3JRIA 5JLXA 3DPTA 3L2VA 3W2AA 5F6FA 3AKZA 4GYIA 4EJVA 2FQ4A 3CZ6A 2E2HJ 3ZP5A 2FBIA 2NAZA 4F92B 1S5LC 3CESA 3S3NA 1KQ8A 1H9GA 4HF0A 3S16J 2LG4A 2X0LA 3KP6A 2IS6A 5H20A 2L4MA 2HI3A 2ICWG 2DDBA 5FLMJ 3A01B 1MH3A 1Y8RB 3U2RA 3S1MJ 2GXGA 2ZC2A 3WGGA 4B1RA 3BTLA 3GZIA 2XB0X 1XMAA 2KQRA 3BLYA 2HOAA 4UNOA 3BJAA 1NHAA 3A1YA 4D7MA 4G7OF 2DK5A 3EYYA 5CVVA 3GEZA 2CUEA 1TW3A 4I01A 5ICGA 1XN7A 2GBYA 1E3HA 2DXIA 2ISYA 3FXLA 3DPJA 2FRHA 3DQVC 1OISA 4XR6A 2QUFA 2F2EA 3E5XA 5IP7J 3GTQJ 3PNYA 3HUGA 4L0YB 3K70D 1R4MB 1YIJI 2F48A 1P9QC 3ONQA 2DJIA 4OINF 2HPMA 5GAEJ 2CQKA 3DU5A 2M0CA 4AC0A 2F6CA 4MHGA 2Y31A 2VT2A 2K4BA 2E71A 3O2PE 1A6QA 2XRNA 2KLOA 1JXSA 4IEJA 4E7LA 3CCMI 5K5RA 1SMYF 2HZTA 5HLTA 4W1UA 3FXJA 5J40A 2O3FA 2HQAA 1YLFA 2DJNA 2VJIA 2ZNZA 5F64A 1T0FA 2EPFA 5J4YA 4BXUA 5B3SH 3HOUJ 2HNHA 2V6CA 2PJRA 4ZYEA 2NVTJ 3KNWA 4NQWA 1TL8A 4RAFA 3IH3A 3JRCA 3MZ8A 3R61A 3PIOF 1I39A 1WJAA 3BHQA 1OJLA 2Y0SA 1LQ1A 5DM7F 5DD4A 3NRVA 4L5JA 2FBQA 1XDUA 3UKGA 5K7ZA 2X1CA 1BJZA 2XPWA 3VSLA 3OSFA 3HKZN 2HYTA 2H1LA 2ZKZA 3ERMA 4HSRA 3RYRA 1J9IA 5IOYA 5B1AH 2XF6A 4IO9F 2HDCA 2QBYA 4JQFA 5GP9A 2MFZA 1GLNA 3A01A 2PN6A 2B0LA 3Q0UA 2CV0A 2XDNA 1SFEA 4U0WA 3EUHA 3F23A 1SAXA 3S1QJ 2BHZA 2KIMA 2EFQA 3SYTA 2EFOA 3EDPA 5EJCA 4IRVA 3QAHA 1KZHA 2XPUA 2F4MB 3QPHA 1OCCH 4HG2A 3TP3A 4EM1A 2LBFB 5HODA 2W53A 2K9LA 4XNFA 5LEJA 1ZRFA 3MZHA 9ANTA 2WUIA 4A3CJ 4WIBA 1FBUA 4RLQA 3OYLA 2FU4A 2IGNA 5ICFA 3CJTB 1KQ0A 4QSHA 5B1BH 1EH7A 1QBJA 3C2GA 1SD5A 2QYOA 2NS8A 1ZARA 2YU3A 4ZH4F 2XSDC 1APLC 3E0JB 3SZTA 4S05A 4RAZA 1TWGJ 1BI2A 2D5VA 2R93J 1AHDP 1X2NA 3G1OA 3G4SI 2XUBA 1RKWA 1J0RA 3OIQA 1PJRA 4PDKA 3ERED 4MK6A 2E36A 5CVIA 1R1TA 2VKDA 1IXSB 4L9VA 4UUSA 4OIRF 2K02A 3HTJA 1QRYA 5ERIA 3WGHA 2KP6A 2ZFWA 3ON2A 3KEYA 1WFXA 3MEXA 1XG1A 3G6EI 3IUVA 2CV2A 4KYWA 3FK6A 1EF4A 2EIJH 2A5WA 4ZYHA 1KU3A 3S32A 2IS1A 3HBLA 1WH5A 1XDSA 3WTXC 2DTRA 1OCPA 4P1WA 4A3FJ 2K9SA 3WTTC 2L0KA 3COAC 3ECHA 3FXKA 4OIQF 1U8BA 2ZMEC 1ZRCA 1GDTA 5JI6A 1JT6A 2OPTA 3ABMH 3K9TA 1QNTA 3QYFA 3HHGA 1GXPA 1R6RA 5CLSA 5A2QZ 4X6AJ 2A6EF 3BZ6A 1OKRA 4J19A 5FKMA 5JVGF 4C2MJ 1U3EM 4G7HF 2R92J 3PO2J 4EATA 4B8XA 1K7AA 1R22A 3E6CC 2E7WA 2QCOA 3P9IA 1YFHA 1FSEA 1DU6A 3ABUA 5CXGA 5DUKA 2VXZA 1W36C 3CMEI 3ZQ7A 4IX7A 1W1WE 4HDVA 2P7VB 4J00A 5FGLA 1FT9A 5CQGA 3FXUA 4G6QA 2HKXA 3DWLE 4ZTJA 1PUFB 4U9NA 3RQIA 3BROA 4C3HJ 3I58A 4Q47A 3HL2A 3H5RA 4DYQA 2PLYA 1REPC 4OD5A 4J01A 3DTIA 1JGSA 3OYHA 2FA5A 4CCMA 3BCBA 4RAYA 1VF9A 3CDLA 2X51A 3F8NA 5HNHA 1IC8A 1UHWA 4QIWN 5C3EJ 3CJNA 5D6FA 1IW7F 3IL2A 3Q5FA 5D8LB 2KJCA 1P4AA 2YVEA 2UXIA 3CUQA 1CF7B 4MGRA 4I99C 2NX4A 2M9HA 1WVRA 4JX4A 1YX3A 4RAGA 3RQ4A 3OYIA 3G71I 5GPAA 1UHMA 4Y7NJ 1FMWA 1IF1A 3GLXA 1RESA 3R60A 5E3OA 3M07A 1DQUA 1LNWA 5EEHA 3OR2C 1ZR2A 2FMLA 4N4OB 1LJ9A 3B02A 1D5VA 2OU2A 2ELJA 2VBZA 2QVOA 5L3EA 2STTA 4YFXF 1XMKA 2ZY9A 2EFPA 2BVMA 1LFBA 2V6EA 2EZLA 1UI6A 3J7YJ 2EIMH 1MBGA 1O3RA 3S2HJ 3LOCA 2DMPA 3HRTA 4OIOF 3PQKA 2P8TA 4U0YA 4MO7A 1RKTA 2LY9A 2KT0A 1L0OC 4BEHA 1IRXA 5HS9A 3BJBA 3PSFA 4BHPA 2VPLA 4BHCA 2LY2A 1BOAA 2LDUA 4RB0A 1LFPA 3CCEI 2R7UA 3LSTA 3CP2A 3NI7A 1K78B 3SDBA 2M2EA 1QZZA 2UXNA 3OOUA 3JSJA 1TWCJ 5DEQA 1G3YA 4CCKA 1TP4A 3K1PA 1SD7A 3VB2A 4M3FA 1F4KA 5M3MJ 3GWZA 2E19A 4R1HA 2EA4A 4AWXB 3HDDA 3A2KA 2XC7A 2Q2EB 1MBJA 1XGMA 4NC8A 1LEBA 2VN2A 1PUFA 4D1QA 3FBIB 1JUSA 2OQGA 3K2ZA 3D5SC 2M3AA 2DA6A 2VQHA 3BTIA 1VQNI 1IRZA 1G4DA 1OYWA 2GQQA 2M8EA 2CG4A 1BL0A 4PJJA 1IGNA 3AFHA 3QRFF 1T38A 2ZMEB 3FZVA 2DT5A 4I7HA 4RBOA 4AIHA 3OYFA 2HOEA 2UV1A 3TOBA 2HVRA 4ZTFA 2ZXWH 3DV8A 2DOAA 1RETA 1WJ5A 1Y6IA 1EH8A 5IT9K 2TRTA 5L3GA 2QLZA 1FYLA 3MKWB 3DKWA 5F0CA 3F0CA 2X6WA 3BZCA 1X19A 1X3WB 1SVMA 2NOGA 4A3MJ 3GVAA 2XAQA 4KWAA 1UZCA 1S9HA 1W4MA 2XRLA 3Q9VA 4HLXA 5C4YA 2WY7Q 1JUPA 4BS9A 1B72B 1OR7C 3BNIA 1YI2I 3I9V2 1X1BA 3CCRI 1S3JA 1B8IB 4LLLA 5HLHA 3DLAA 4MNUA 3M9AA 3LSHA 1R5HA 1W36D 1QVUA 1O7FA 4YRVA 3WTYC 3H92A 3OYEA 2JA8J 1Y8QB 4NELA 1H9TA 3VYTB 5HLIA 1N25A 3MAJA 2WY8Q 3FMRA 1NH3A 3IH4A 3KZZA 2MBFA 3CCLI 3SFZA 1USTA 3BG6A 1XSXA 3LWFA 4JNNA 3ZQHA 4ZJZA 2KMUA 4OU0A 1ZTRA 2GUHA 1SANA 3PM1A 4HW0A 5LHHA 4Q4ZF 3CLOA 1E2XA 3QPTA 3VPRA 2BW3A 1O3TA 3C1DA 5IY5H 3OYCA 4E7JA 1D1AA 4M6VA 3K7AJ 2QM3A 5GAHJ 2O9LA 4DBQA 2RAEA 3BJOA 5D5XB 3I59A 1X2MA 4HSTA 3HIMA 5EFYA 2V7FA 3VW0A 1OCRH 1WI9A 4BL0B 4HF1A 2AQFA 4C30A 2LKPA 3D5LA 2BY1A 3NWSA 2CRGA 5F27A 1S29A 2DMUA 1H89C 3MCZA 1WPKA 1MSFC 2Y48A 3LQRA 1NTCA 4V2GA 4IHWA 1HQCA 2ZMEA 2IAIA 2DA5A 2OBPA 2BY0A 1I1GA 3GO5A 3VODA 2ACJA 5HS8A 3HKZA 2NVQJ 4LK1F 3GW2A 1ZHFA 3K1NA 2EZHA 3M8FA 3FHZA 1T6SA 3OL4A 4L5IA 2LTPA 4FCYA 1D8JA 4FASD 3JRAA 3VVZA 2BV6A 4FX4A 3J7AO 5CVJA 1FEXA 2JMWA 1Y0UA 1I27A 3EUPA 3K1MA 3KP4A 4AUXA 2PFBA 2M4KA 4JBAA 3RPQA 1TT0A 1KGSA 4F7ZA 2KISA 4ZYAA 4HRIA 2HQRA 5J1RA 1MMNA 5EEGA 5EGOB 4S04A 4LK0F 1FJLA 2VC0A 3LFKA 1U9OA 3HTSB 5HS7A 2G0EA 4D5CA 3VEPA 2GENA 4PJ0C 4XK4A 1B8IA 5GADJ 1ZK8A 1SFUA 1FYKA 1Z7UA 3FX3A 4A3DJ 1FTTA 1IN8A 4KIFA 2R4GA 2X6OA 1DP3A 1XS9A 1WHUA 1MMDA 1RPWA 3HTHA 2E35A 2Q8KA 3W6KB 3H35A 4LD5A 5KVRA 3OMYA 1LE8B 1T0FC 2GXAA 3C18A 1YRNA 1ZREA 1YW7A 3BCGA 4P9UA 5C4XJ 2DA2A 1R71A 2G7HA 2O0YA 4XLNF 3V4GA 4JKZA 2E1OA 1X4OA 2CW0F 3KETA 3CQZJ 3HOTA 2IGMA 4AYBN 2Y9ZA 1V4RA 5FB2A 1OFCX 2JPBA 3QOPA 2NP3A 3B6AA 5L3DA 2FBKA 4A5MA 2JK3A 3ZR8X 1I50J 5K5OA 2JT1A 1FSHA 1TWHJ 4LG3A 2J5OA 2DFFA 2HZDA 1HSJA 1U5TA 3JTHA 5IP9J 3V7SA 5E3MA 4BE0A 3OIPA 2R7FA 2KZGA 1XMXA 1N77A 4UVCA 1JHFA 1VZ0A 2XPVA 4XLAA 4Y3OA 4E7SA 2LF7A 4ESBA 3QP5A 1BR2A 5F0FA 3ZMDA 4B4CA 4F52A 1D0XA 3RCOA 2L9RA 3K0LA 4IQJA 2G7UA 1ERDA 2VJ5A 3IAM2 3FKIJ 2HQNA 1VQ9I 2B3WA 3IH2A 2NVXJ 5CYVA 5FJ8J 2EV5A 2WAEA 3LHQA 2TDXA 1V5GA 5FFZA 1VQOI 2LK2A 2EV0A 3F3XA 2XGDA 1BJAA 2ESHA 3DBHB 4PGGA 3QU3A 4CCNA 3DP7A 1X1DA 2VONA 5B66C 4LFUA 2H6CA 4C2TA 4BY7J 2BVLA 3E6MA 5H2FC 4HEA2 3FWEA 2EH3A 4FX0A 4M6YA 3WTZA 1FLIA 3HRUA 4M3DA 3QBMA 2LP0A 3MD2A 1OLTA 1X1CA 3GFMA 4D9JA 4ETSA 1ZRDA 3H3UA 5F1JA 2GOMA 2Z5UA 3ZMTA 2K27A 3OR1C 2E5NA 4BYYA 2BZTA 1TW2A 1LB2A 2ME6A 1SFKA 2KIUA 4UUTA 1F1ZA 1MIJA 2DK8A 2V1XA 2DMQA 5JFRA 1LE8A 1FP1D 5L3BA 3CDHA 3UNGC 2NOJB 4GCLA 2G7GA 4PSWA 3S1NJ 1AKHA 4IOAF 1HOMA 1B1BA 2YX7A 2Z16A 1L3LA 1AU7A 3AG2H 2L9NA 4GDFA 6PAXA 4BBRJ 3ZMZA 3BR2A 3HEFA 3ABKH 3HUGB 4K2EA 4WXDA 2Y69H 1WJDA 3GYHX 1MBKA 5K7HA 3VIBA 1USSA 4A6EA 3CJRB 1LVKA 3DLLF 1Q1VA 1KYWA 1K4TA 2WWYA 1RUOA 4A3BJ 2F5CA 4BUPA 3LSKA 3SEZA 1VQ4I 2Z99A 4U9LA 3KP5A 3CP8A 1K4SA 2UXUA 3MKYB 3LSGA 3VDXA 5FRNA 5ILUA 4DVYP 3WHBA 1IUFA 1QHGA 4G94A 2GZWA 3AG1H 4M3GA 2LKSA 2H6BA 1G2HA 3BPVA 2B7EA 3VOKA 3F22A 2PJRB 1EV7A 1ZLJA 4CYDA 1E3OC 3H9GA 2MLGA 4LJZF 2A68F 2WBMA 1JHHA 3MKLA 1PP7U 2OZ6A 3EUKL 2W4SA 3LSMA 1X1AA 4MQVA 1N75A 1PP8F 5J4VA 3KEOA 3TQNA 4F55A 5K5QA 4M3BA 4DGWB 3ZMVA 1JGGA 3A03A 1WQ2A 4QTRA 3EGQA 4UXNA 2K3FA 2GOXB 2QBYB 4G8XA 3BR3A 3IKVA 2CGPA 4ITVA 2ZJPF 3CUQC 1NK3P 2LYCA 4EJTA 5CXIA 4E7HA 3LSRA 3SQNA 4UB6C 2R7ZJ 2XIGA 4O6JA 3GEUA 2VLAA 3LA7A 4E70A 1YX5A 2P5LC 4D5FA 5HDGA 2VOPA 5EDNA 3WHCA 2W85A 4G6DA 3RZDJ 2KKOA 5D5UB 1XGOA 2IVMA 2COMA 2P5KA 1FOXA 2HTSA 3U1DA 1KA8A 3QU6A 4M3EA 1JKPC 1X4PA 2HXIA 2LMDA 1YOVB 1AOYA 2L3DA 4IF4A 1FOKA 4Y33A 5FRMA 4E4HA 4E7IA 2H27A 1R36A 5H9TA 2WAFA 3VP5A 4C3IJ 2CUZA 4XKVA 3VYUB 2K5CA 1MJAA 2RNJA 2R7XA 3O8GA 3TOAA 4FE4A 2DA4A 4EQQA 2X48A 4L18B 4KMUX 4U88A 5D4SA 1TQMA 2QSHX 1GVJA 3JAMK 2BEOA 4UUSB 3SDGA 2LRDA 2VJ4A 3PL8A 2UUZA 3OL3A 4CYCA 4CH7A 2P7CB 3EYIA 2LH9A 4MQ9F 3QKXA 3X2QH 2DYSH 2JJ7A 5DCFA 4LMYA 3BC8A 1Q1HA 3Q9SA 4CDGA 3W6VA 1IDZA 4R79A 3QQAA 2ECCA 1G8XA 1MD0A 4G6TB 1VQ8I 1SFXA 3BQYA 1GT0C 3ANGA 2L7ZA 4L5EA 2R7RA 3SJMA 2ADUA 1YG2A 5LRRA 1W0UA 3FXOA 1ETWA 1UCRA 2DU9A 2FBHA 3T0YA 5AQCA 3DCFA 5D4RA 4FTHA 3CUOA 1EA3A 1WGXA 4B3AA 1C0WA 2K9QA 2FNAA 2KPMA 3EQLF 4HA8A 1TNTA 1SEUA 2DBBA 2W82A 4Y52J 1OCOH 2M34A 3AL0C 1WJCA 2W84A 4PK4A 3BTCA 4DBRA 3PUBA 4DNCA 3CCYA 1TT5B 5IP6A 2VQGA 2VASA 1BC7C 3ROUA 2FJ1A 1J09A 2L9VA 2K7LA 3O60A 2HYFA 2ZB9A 1D8KA 2L7KA 3LWJA 2HDDA 3AQTA 3A0BC 3V7CA 1FX7A 5TJJA 1FIPA 2FUG2 1FC3A 2V9VA 4NBQA 3GLLA 2IT0A 1KU9A 2VBYA 2G9WA 2X4HA 4JYKA 1IDYA 1H8AC 2DO7A 1VFCA 2ZXHA 4BJ5C 3FBNB 2STWA 1ZH5A 2MD5A 2OCEA 4HKUA 1R49A 3JAMZ 2XKPA 1P2FA 5FKKA 1HA8A 2JTVA 1ETYA 1TBXA 4JX6A 3V42A 2LD5A 1SD6A 3KP3A 3F8FA 3HIFA 2DW4A 1ZAOA 4EEFG 2LNBA 1LEAA 1ORKA 4XRSG 2G7LA 1QZEA 2G7SA 3PPBA 4FHTA 3F9KA 3F6VA 1BR4A 1JUMA 3CUQB 3ISPA 1E17A 4CCOA 2K86A 4IZZA 2O6GE 1JI8A 1XTAA 3VOEA 2VI6A 2QENA 3OYAA 1P4WA 4GCVA 3H9QA 2JUGA 4NC7A 3GTJJ 1XGNA 3ANPA 1VTNC 1WZ2A 2MLKA 4JL3A 4AYBA 2ZJRF 5IPAA 1UELB 1RNLA 3KKCA 3EETA 4EM0B 2HGCA 3ZMUA 5J8CA 3CO6C 3VVXA 2BE5F 3OYKA 1ZLKA 3I4MJ 2ZCXA 4BEHB 5ICCA 5BNGA 2FQ3A 1A5JA 2PQ8A 2COBA 5DM6F 4WXHA 3I56I 3KEQA 4XONA 4LIUA 4BXFA 4XRSA 4DZPA 1LVAA 1RRJA 1F43A 3CLQA 1WCMJ 2YUSA 2A6HF 4I98B 1ONVA 1TQIA 2IEKA 1P7JA 1Z77A 2P81A 5JLWA 4NDLA 2VJJA 2KRCA 4IJAA 4M9SA 3TDZC 5FD5A 4XOTA 2Y0MA 2ZXIA 3ON4A 3B6CA 1A36A 3HSEA 4EGYA 2CW7A 3KCCA 4KICA 1ZR4A 3E7QA 4RB1A 4MLOA 5DAJA 4CA0A 3DTKA 3KYLA 4L9TA 4QPOA 3CRJA 4XN0A 2EILH 4MFDA 1PDNC 3L2WA 3O8HA 4PCQA 3S2WA 2VE9A 2PJPA 4H4KC 4IHXA 2XAFA 3ZQIA 3SEQA 2JA7J 2CQNA 4E6KG 2P0WA 3I53A 1STZA 1OQYA 4ZDLA 5J6XA 4OIPF 1E0EA 2D1VA 2BBYA 3GTLJ 2YVHA 1GV5A 2B1EA 2HXOA 2V4JC 3E5QA 3K8PC 3OIOA 2G3BA 4U7BA 3ZGKA 2KJBA 1Y39A 2NXNB 3HOVJ 2F07A 3FKJA 2V9KA 4YFNF 3AL0B 2VBXA 3CWRA 2LR8A 4ESFA 3MNLA 5E1WA 3ZQQA 1ETXA 1O4XA 1IUYA 5L3CA 4G12A 4HAMA 3GZ6A 2RDPA 2PBXA 4A3GJ 3WU0A 2E2JJ 4RS8A 2X9DA 1U5TC 1K6OA 1OYIA 5HOOA 1WJEA 4XOPA 5BS6A 4G7ZF 5LD2C 1T2KA 1VQLI 3BDDA 4V2FA 3DPLC 2DI3A 3OV8A 1HF0A 4A3IJ 4EGZA 2VODA 3HZJA 3GFJA 3OOPA 3P7NA 5GTIC 1F9NA 2ZFUA 1IJWC 1UFMA 3H5NA 2D45A 2GWRA 2IA1A 3RI4A 2NP5A 1DU0A 2LF8A 3C7JA 1BN5A 1HW5A 1POGA 3ZXSA 2DLLA 3LSIA 5FD6A 2MA3A 2ZBKA 3HSRA 2BHYA 4B43A 1JKOC 4PXIA 3D1NI 2YPRA 2MC3A 4A12A 4AM3A 3RJPA 1MMSA 5FHPA 3IAS2 2PEXA 3HRMA 5FO5A 4OWRB 3ZQGA 3M8EA 1GXQA 2BW3B 4BAYA 3JW4A 1G6NA 1G3SA 2GA1A 2PBIA 4GXOA 1ZGWA 3JRHA 3RSNA 2XHKA 3I59B 5LHGA 2DAOA 3L9FA 4CGRA 4LIVA 3VW2A 3I71A 5J1UA 1EJ9A 4B48A 4IKFA 2TCTA 3H3ZA 5LRSA 5HDNA 4XIDA 3HOYJ 1XCVA 3T8TA 5FKOA 2ZCWA 1V5FA 1XSDA 4PFOA 1D3YA 5HAWA 1IO2A 4A5NA 1KU7A 2CWEA 2PMHA 4ANJA 1Y56A 2HFHA 3WE2A 3TO7A 2GIZA 3PO3J 3KZYA 4GCTA 3NEUA 2RV8A 1V5EA 3HGGA 2EQRA 1GUUA 5LGNA 2VOOA 3G73A 5FLVA 1MBEA 2R3SA 1FOWA 1VI0A 2GIVA 2RGVA 1UI5A 2HWVA 3BJ6A 3S8PA 3DKYA 2E60A 5F04A 3JCUC 2XF7A 2WADA 1V3FA 4WCGA 4BHBA 3HOZJ 3GTOJ 3JTGA 3CC7I 1XGSA 4M73A 3HTIA 2OTLI 4UV9A 2XF5A 3DEWA 2ID3A 1VQPI 2J5PA 4CSWA 1Z21A 3OYJA 4EJOA 3F8CA 1SFOJ 1X58A 3QWLA 1LUJB 1ETQA 4CICA 5B5EC 3BT9A 3IV5A 1DGWY 3RD3A 2NS7A 4RDUA 5JHUA 1HKSA 4IHSA 3QPSA 2DT6A 1BI3A 1EKEA 1WKMA 3K2AA 3B81A 5F0HA 1GVDA 2K4JA 2FSWA 4RM2A 3BG5A 3KE2A 4EMSA 5ILVA 1RIOH 1YRNB 2PMZN 5ICEA 4MFEA 1BW5A 1Z1DA 2XGCA 3C2BA 2FEZA 3WODF 3LFUA 3DEUA 1S72I 2A69F 2CQ7A 1FIAA 2AXLA 2VKEA 1KYZA 2QQAA 4UY8I 2DG8A 1Z7LA 4XKCA 2N8GA 1U6GA 4Y13A 5KAIC 1T56A 3IHUA 2XDVA 3WE3A 2AO9A 1XC5A 3VFZA 2HVSA 2ZOZA 3H0GJ 1E3PA 1U5TB 4PSXA 3LAJA 3PFIA 3J7AY 2D6YA 2M87A 3BPXA 4B3XA 3I4PA 2F4OB 4BDZA 1SVOA 5DYMA 3ZQLA 1B9NA 3PNTA 2XAGA 3PNVA 1BC8C 5IT9Z 2ZCNA 4PUSA 2CFOA 4JK1X 2L5QA 1QVTA 5HBUA 2BXYA 3ESWB 4BACA 3VW1A 2Y9YA 2NYXA 4KA4A 3GBGA 3W2WA 2Y0SN 1QQIA 2IGOA 4LB5A 3AG3H 1H0MA 3M1EA 5JR3A 3E1SA 1D5YA 2R7WA 1HDDC 3ZPLA 3ELKA 3I55I 1JTYA 1MBFA 3N97A 1T95A 2QQBA 3S3MA 3G1MA 1Y0NA 1O57A 2UXHA 2WGBA 3SFIA 4AU7A 3JSPA 2B63J 4A0ZA 2QEXI 3J7ZI 3MWMA 4HBLA 1FYMA 3TEDA 2RREA 1WH7A 3S5RA 5M5WJ 1XD7A 2L4AA 2HEOA 3FXRA 4A0YA 1PUEE 2HYJA 2RKHA 4KMFA 4U0VA 3F8MA 4HV5A 1G3TA 3J80K 4DQ2A 1Z67A 1WI3A 4LITA 4W97A 2JA6J 3BG7A 3CCQI 2F5DA 2OD5A 3BZKA 1MW7A 4XKWA 4P9FA 3CCVI 3H36A 2CU7A 3F6OA 3OYMA 2IP2A 1WJBA 2VKVA 2L02A 1WJFA 4YEJA 2OA4A 2QKOA 1RC9A 1IN7A 4GYGA 1O3SA 5D18A 3HC7A 4HLYA 4A6DA 3T6NA 3OY9A 3GTPJ 2Z9OA 5E20A 5IOZA 1YJNI 3G3ZA 4O3MA 1AKHB 3BCAA 5LGUA 1I1SA 4AD9A 4PZJA 1Y1WJ 2O61A 3K4CA 2JVGA 2EIKH 1HDPA 1F36A 3MMYB 3W6JB 5JVTA 3S1RJ 1XPXA 2CV1A 1FWZA 2DG7A 5DCMA 2DN0A 2Y2ZA 3HG9A 3MVPA 4HNTA 2RNGA 3H9JA 2M30A 2DOEA 3IRRA 3I0TA 1R00A 5KNLA 2OJED 3GXOA 4OAZA 5EZHA 1MDMA 1IZ1A 2CFXA 4ZZDA 3F21A 4FISA 4GFBA 2E34A 5D5VB 3K4NA 2JSCA 2M4GA 2M7AA 5DD8A 4PGHA 1OCTC 1YS7A 5TRDA 3K4LA 2V26A 3L2CA 4NB5A 4YIFA 1RR7A 2R7VA 4LB6B 4IOCF 5KHDA 1BA5A 3BWGA 4M71A 5FFXA 2JQ7A 1IN4A 1ON2A 4RGSA 2K9MA 2W57A 1MBHA 4HX7A 2K85A 3CJQB 4BJTA 3J80Z 2CYYA 1BI1A 4HOBA 2WV1A 3QPLA 2V1UA 5DS9A 1S7AA 2E7XA 1I3AA 2P6SA 2QSFX 2H8RA
chains in the Genus database with same CATH topology
4C3IJ 1DU6A 5CXGA 3O8GA 2HQ5A 2LVSA 4FE4A 1A6IA 2DA4A 5FGLA 2DTZA 2X48A 3RZOJ 3BR1A 1PUFB 3RQIA 4C3HJ 5IYDJ 2LLKA 4DYQA 4UUSB 3SDGA 2DMNA 2QIBA 4CYCA 5IYBJ 3JREA 2IBDA 1TWFJ 1UG2A 3FIWA 2QWTA 3QKXA 2QTQA 2JJ7A 3GTGJ 5D19A 3LNQA 3W6VA 3RH2A 3ZQCA 3BR0A 1IDZA 2MW8A 3I4NJ 1VF9A 3QQAA 3CDLA 3JRBA 2ECCA 3BQYA 1IC8A 5J3LA 4QIWN 1GT0C 5C3EJ 3ANGA 2L7ZA 4L5EA 3BG3A 4DZJA 1LFUP 3SJMA 4ICHA 1W0UA 2YVEA 1ETWA 3HGYA 2UXIA 5AQCA 3DCFA 4FTHA 1WGXA 1TWAJ 1JT0A 4B3AA 1VNDA 2NX4A 2M9HA 4JX4A 2K9QA 4UDSA 5EYRA 5GPAA 4Y7NJ 3HOWJ 4S0HB 4Y52J 1RESA 5E3OA 2XGEA 4XICA 2M34A 2WB1N 1ZR2A 3BTCA 1MNMC 3CCYA 5IP6A 4YZEA 1LFBA 2EZLA 3Q0VA 2FJ1A 1UI6A 3O60A 1MBGA 3S2HJ 2ZB9A 3LOCA 3LWJA 2DMPA 2HDDA 3AQTA 2JN6A 4IHVA 2K40A 1ZKGA 1RKTA 2LY9A 2KT0A 4MO7A 1FIPA 5EZGA 3BJBA 1JJ6C 4CYCB 4A3EJ 1H88C 4JYKA 2O7TA 1IDYA 2KDZA 1H8AC 1R9TJ 1VFCA 1T33A 3NI7A 2M2EA 3OOUA 3JSJA 1ENHA 4HKUA 1TWCJ 2YS9A 5IYCJ 5FKKA 1W0TA 3GTKJ 3VVYA 1ETYA 4NN1A 4JX6A 4M3FA 3JR9A 2R5YA 2LD5A 5M3MJ 1B72A 2QOPA 5HSZA 2ELKA 2PZ9A 4EEFG 2E19A 3HDDA 1ORKA 3E7LA 4XRSG 2G7LA 1QPIA 2WAQN 1MBJA 2G7SA 3NXCA 3PPBA 1PUFA 2RHAA 1JUMA 4ACIA 1JUSA 1U9NA 1SGMA 3CMYA 4L62A 2YU9J 2DA6A 3HE0A 2CQXA 2CJJA 2Q24A 2DA1A 2VI6A 2RASA 3BTIA 1HLVA 1IRZA 1IG7A 2EZKA 3V6GA 3BR5A 3Q0WA 1BL0A 4D7NA 1IV6A 1IGNA 5K7FA 3GTJJ 3TP0A 3ANPA 4RBOA 4BBSJ 4JL3A 3G7RA 2LFBA 5IPAA 3KKCA 4JP0A 4I76A 3P9TA 4BXXJ 3G1LA 3S15J 1RETA 3VVXA 3I4MJ 2ZCXA 4AF5A 2TRTA 3NAUA 5BNGA 4DW6A 1JKQC 1BW6A 1Z0XA 1A5JA 2L7MP 2COBA 1MSEC 5F0CA 3F0CA 4XRSA 4X1EA 4DZPA 4HNVA 3M3YJ 1F43A 1WCMJ 2NOGA 2YUSA 4A3MJ 2LKXA 4KWAA 2IEKA 1P7JA 1Z77A 2P81A 5JLWA 2XRLA 2MSYA 4NDLA 2HOSA 5C4YA 4C3JJ 1JUPA 2R5YB 1B72B 2GFNA 3ON4A 3BNIA 3B6CA 1B8IB 4XRMA 1ZR4A 2ZOYA 3E7QA 3LSJA 5EG0A 1ETOA 4MLOA 3C07A 2UXOA 5DAJA 1QVUA 2JA8J 4NELA 3CRJA 4MFDA 3O8HA 2MGQA 4IHXA 3IH4A 3ZQIA 4JNNA 2JA7J 2VPRA 3ZQHA 1ZTRA 2GUHA 1SANA 3PM1A 5EGOA 3VPRA 3GTLJ 2YVHA 1GV5A 2OF7A 2HXOA 3OIOA 2EBIA 2AHQA 4M6VA 5J1YA 3K7AJ 5GPCA 2G3BA 2O9LA 5E3LA 4BY1J 3HOVJ 2RAEA 2Y30A 3FRQA 4DYCA 2F07A 1X2MA 1MH4A 2CQQA 3HIMA 5EFYA 3VW0A 3CWRA 2LR8A 3HM5A 3MNLA 1ETXA 1O4XA 2O8KA 3FK7A 4IHYA 4G12A 3VOXA 4LOCA 2CRGA 5F27A 2DMUA 1H89C 1MSFC 1WPKA 4A3GJ 2PBXA 3GTMJ 2L7FP 2E2JJ 1NTCA 2X9DA 4V2GA 4IHWA 2REKA 3NNRA 4A93J 4ME9A 2IAIA 1ETVA 1CQTA 2DA5A 4GFLA 4V2FA 1HF0A 2NVQJ 4A3IJ 1HCRA 5EG0B 2OERA 2EZHA 4FCYA 3NPIA 2LTPA 5EF6A 2DMTA 3VVZA 3JRAA 1IJWC 5D1RA 3H3VK 1ZQ3P 3ZQFA 1FEXA 2JMWA 2NP5A 1GV2A 1DU0A 2E2IJ 3BG9A 2UXPA 3EUPA 1POGA 4AUXA 3BQZA 3S2DJ 1S7EA 1JKOC 4PXIA 3D1NI 5FHPA 5J1RA 5EEAA 3JRDA 4AC6A 2EZIA 5EGOB 3ZQGA 1FJLA 4A69C 2VUMJ 2CUFA 1U9OA 2IU5A 2G0EA 3TW7A 4D5CA 2JA5J 1ZGWA 3JRHA 2GENA 3S17J 4XK4A 1B8IA 3VUQA 1ZK8A 5C44J 3CJDA 4CGRA 1FTTA 4A3DJ 3VW2A 5J1UA 2W48A 2TCTA 4GFKA 5FMPA 2X6OA 4XIDA 3HOYJ 1XS9A 5FKOA 1RPWA 2ECBA 3FISA 3HTHA 2FX0A 2OI8A 1FTZA 5HAWA 1LE8B 4JX5A 3V78A 3L1PA 1YRNA 1I6HJ 3BCGA 3JRIA 3PO3J 5JLXA 5C4XJ 2DA2A 4GCTA 2QF7A 4JKZA 1K61A 3F1BA 2E1OA 3HGGA 2EQRA 3JRFA 1GUUA 2FQ4A 2E2HJ 3CQZJ 2Y9ZA 5FLVA 3ZOBA 4AYBN 1MBEA 1VI0A 1UI5A 3LJLA 1OFCX 2H1KA 2NP3A 3B6AA 2JK3A 1I50J 5F04A 3S16J 1TWHJ 3AQSA 3HB9A 3HOZJ 2HI3A 4BKXA 3GTOJ 2FD5A 5IP9J 5E3MA 5FLMJ 3A01B 1MH3A 3S1MJ 3HTIA 5M5YJ 3A02A 2XPVA 3DEWA 2DA3A 2ID3A 3BTLA 4B1RA 3GZIA 2XB0X 1JTXA 2HOAA 4D7MA 5F0FA 1SFOJ 1X58A 3MN2A 4B4CA 1ETQA 2CUEA 2L9RA 1P7IA 1UHSA 2GBYA 3BT9A 3FKIJ 3IV5A 3DPJA 3IH2A 2NS7A 2NVXJ 3RD3A 4RDUA 3QPSA 5FJ8J 5IP7J 3K2AA 3GTQJ 3LHQA 2LK2A 3B81A 5F0HA 1GVDA 2XGDA 3BG5A 2I10A 1YRNB 2PMZN 2M0CA 4AC0A 1ETKA 4MFEA 1BW5A 2XGCA 3C2BA 2Y31A 4MXMA 5FKLA 1FIAA 4A3JJ 4BY7J 3S14J 2VKEA 4IEJA 2DG8A 2MG4A 3BR6A 2EH3A 2N8GA 4W1UA 3VP5A 1T56A 4M3DA 3NARA 1NK2P 3QBMA 2AO9A 1XC5A 2DJNA 2LP0A 2ZOZA 1ITYA 3H0GJ 5F1JA 3HOUJ 2R5ZB 4A3LJ 2D6YA 2NVTJ 3KNWA 2ME6A 4UUTA 3ZQLA 3IH3A 1JJ8C 2DMQA 5E3NA 3JRCA 1LE8A 2ZCNA 5HBUA 1QVTA 4GCLA 2G7GA 3BHQA 1OJLA 3S1NJ 3VW1A 1AKHA 2Y9YA 2XB5A 3GBGA 1HOMA 5CW8A 2FBQA 3PASA 2Y0SN 3KZ9A 1AU7A 3UKGA 5K7ZA 2ZCMA 1BJZA 1D5YA 2XPWA 4BBRJ 3OSFA 3HKZN 1HDDC 2HYTA 3BR2A 3HEFA 2M8GX 1JTYA 1MBFA 5C4JJ 3NRGA 5IOYA 5FKNA 1MBKA 3G1MA 5GP9A 5K7HA 3KKDA 2UXHA 3VIBA 2WGBA 3SFIA 2B63J 3COLA 3A01A 1Y1VJ 5K58A 2NVYJ 1Q1VA 3Q0UA 4DYRA 3TEDA 2XDNA 4A3KJ 2GM4A 1WH7A 3S5RA 5M5WJ 4A3BJ 3S1QJ 2HYJA 2XPUA 2UXUA 3LSGA 3TP3A 3WHBA 1WI3A 1IUFA 4W97A 5HODA 2W53A 2JA6J 3Q3SA 9ANTA 2WUIA 4A3CJ 1I3QJ 2O7OA 4M3GA 2HOTA 3BRUA 2CU7A 1G2HA 3OSGA 2V57A 2VKVA 3VOKA 4QSHA 1E3OC 4MIMA 2QKOA 2NS8A 2XSDC 1APLC 5D18A 3T6NA 3GTPJ 3MKLA 1TWGJ 5IOZA 5F08A 2D5VA 2R93J 3M4OJ 1AHDP 1X2NA 1AKHB 3G1OA 3G56A 1RKWA 1Y1WJ 4GCKA 4MK6A 4M3BA 3TW6A 1HDPA 1F36A 1JGGA 3A03A 3S1RJ 5DTDA 3BTJA 5M5XJ 4QTRA 3EGQA 4UUSA 2DG7A 3HTJA 2DN0A 1QRYA 2Y2ZA 3MVPA 3ON2A 3BR3A 1XG1A 3IUVA 1K83J 2JWTA 2R5ZA 5EZHA 1NK3P 3FK6A 1EF4A 4FISA 5CXIA 1TC3C 2K9NA 1JKRC 3LSRA 4GFBA 3RKQA 3LSPA 3HBLA 2R7ZJ 1WH5A 2ID6A 3GEUA 1OCPA 5M3FJ 4A3FJ 2K9SA 4D5FA 5EDNA 2L0KA 1OCTC 3WHCA 2DA7A 3HOXJ 1U8BA 2GLOA 3RZDJ 1GDTA 3JRGA 1RR7A 1JT6A 3HTAA 4ABZA 2OPTA 4FE7A 1BA5A 4M3EA 1JKPC 4I6ZA 1MBHA 2HXIA 4X6AJ 4J19A 5FKMA 4C2MJ 2R0QC 2WV1A 3QPLA 2R92J 1UMQA 3PO2J 2HKUA 5DS9A 5H9TA 1U78A 2QCOA 2H8RA 2ME0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I J;  1DU6 A;  5CXG A;  3O8G A;  2HQ5 A;  2LVS A;  4FE4 A;  1A6I A;  2DA4 A;  5FGL A;  2DTZ A;  2X48 A;  3RZO J;  3BR1 A;  1PUF B;  3RQI A;  4C3H J;  5IYD J;  2LLK A;  4DYQ A;  4UUS B;  3SDG A;  2DMN A;  2QIB A;  4CYC A;  5IYB J;  3JRE A;  2IBD A;  1TWF J;  1UG2 A;  3FIW A;  2QWT A;  3QKX A;  2QTQ A;  2JJ7 A;  3GTG J;  5D19 A;  3LNQ A;  3W6V A;  3RH2 A;  3ZQC A;  3BR0 A;  1IDZ A;  2MW8 A;  3I4N J;  1VF9 A;  3QQA A;  3CDL A;  3JRB A;  2ECC A;  3BQY A;  1IC8 A;  5J3L A;  4QIW N;  1GT0 C;  5C3E J;  3ANG A;  2L7Z A;  4L5E A;  3BG3 A;  4DZJ A;  1LFU P;  3SJM A;  4ICH A;  1W0U A;  2YVE A;  1ETW A;  3HGY A;  2UXI A;  5AQC A;  3DCF A;  4FTH A;  1WGX A;  1TWA J;  1JT0 A;  4B3A A;  1VND A;  2NX4 A;  2M9H A;  4JX4 A;  2K9Q A;  4UDS A;  5EYR A;  5GPA A;  4Y7N J;  3HOW J;  4S0H B;  4Y52 J;  1RES A;  5E3O A;  2XGE A;  4XIC A;  2M34 A;  2WB1 N;  1ZR2 A;  3BTC A;  1MNM C;  3CCY A;  5IP6 A;  4YZE A;  1LFB A;  2EZL A;  3Q0V A;  2FJ1 A;  1UI6 A;  3O60 A;  1MBG A;  3S2H J;  2ZB9 A;  3LOC A;  3LWJ A;  2DMP A;  2HDD A;  3AQT A;  2JN6 A;  4IHV A;  2K40 A;  1ZKG A;  1RKT A;  2LY9 A;  2KT0 A;  4MO7 A;  1FIP A;  5EZG A;  3BJB A;  1JJ6 C;  4CYC B;  4A3E J;  1H88 C;  4JYK A;  2O7T A;  1IDY A;  2KDZ A;  1H8A C;  1R9T J;  1VFC A;  1T33 A;  3NI7 A;  2M2E A;  3OOU A;  3JSJ A;  1ENH A;  4HKU A;  1TWC J;  2YS9 A;  5IYC J;  5FKK A;  1W0T A;  3GTK J;  3VVY A;  1ETY A;  4NN1 A;  4JX6 A;  4M3F A;  3JR9 A;  2R5Y A;  2LD5 A;  5M3M J;  1B72 A;  2QOP A;  5HSZ A;  2ELK A;  2PZ9 A;  4EEF G;  2E19 A;  3HDD A;  1ORK A;  3E7L A;  4XRS G;  2G7L A;  1QPI A;  2WAQ N;  1MBJ A;  2G7S A;  3NXC A;  3PPB A;  1PUF A;  2RHA A;  1JUM A;  4ACI A;  1JUS A;  1U9N A;  1SGM A;  3CMY A;  4L62 A;  2YU9 J;  2DA6 A;  3HE0 A;  2CQX A;  2CJJ A;  2Q24 A;  2DA1 A;  2VI6 A;  2RAS A;  3BTI A;  1HLV A;  1IRZ A;  1IG7 A;  2EZK A;  3V6G A;  3BR5 A;  3Q0W A;  1BL0 A;  4D7N A;  1IV6 A;  1IGN A;  5K7F A;  3GTJ J;  3TP0 A;  3ANP A;  4RBO A;  4BBS J;  4JL3 A;  3G7R A;  2LFB A;  5IPA A;  3KKC A;  4JP0 A;  4I76 A;  3P9T A;  4BXX J;  3G1L A;  3S15 J;  1RET A;  3VVX A;  3I4M J;  2ZCX A;  4AF5 A;  2TRT A;  3NAU A;  5BNG A;  4DW6 A;  1JKQ C;  1BW6 A;  1Z0X A;  1A5J A;  2L7M P;  2COB A;  1MSE C;  5F0C A;  3F0C A;  4XRS A;  4X1E A;  4DZP A;  4HNV A;  3M3Y J;  1F43 A;  1WCM J;  2NOG A;  2YUS A;  4A3M J;  2LKX A;  4KWA A;  2IEK A;  1P7J A;  1Z77 A;  2P81 A;  5JLW A;  2XRL A;  2MSY A;  4NDL A;  2HOS A;  5C4Y A;  4C3J J;  1JUP A;  2R5Y B;  1B72 B;  2GFN A;  3ON4 A;  3BNI A;  3B6C A;  1B8I B;  4XRM A;  1ZR4 A;  2ZOY A;  3E7Q A;  3LSJ A;  5EG0 A;  1ETO A;  4MLO A;  3C07 A;  2UXO A;  5DAJ A;  1QVU A;  2JA8 J;  4NEL A;  3CRJ A;  4MFD A;  3O8H A;  2MGQ A;  4IHX A;  3IH4 A;  3ZQI A;  4JNN A;  2JA7 J;  2VPR A;  3ZQH A;  1ZTR A;  2GUH A;  1SAN A;  3PM1 A;  5EGO A;  3VPR A;  3GTL J;  2YVH A;  1GV5 A;  2OF7 A;  2HXO A;  3OIO A;  2EBI A;  2AHQ A;  4M6V A;  5J1Y A;  3K7A J;  5GPC A;  2G3B A;  2O9L A;  5E3L A;  4BY1 J;  3HOV J;  2RAE A;  2Y30 A;  3FRQ A;  4DYC A;  2F07 A;  1X2M A;  1MH4 A;  2CQQ A;  3HIM A;  5EFY A;  3VW0 A;  3CWR A;  2LR8 A;  3HM5 A;  3MNL A;  1ETX A;  1O4X A;  2O8K A;  3FK7 A;  4IHY A;  4G12 A;  3VOX A;  4LOC A;  2CRG A;  5F27 A;  2DMU A;  1H89 C;  1MSF C;  1WPK A;  4A3G J;  2PBX A;  3GTM J;  2L7F P;  2E2J J;  1NTC A;  2X9D A;  4V2G A;  4IHW A;  2REK A;  3NNR A;  4A93 J;  4ME9 A;  2IAI A;  1ETV A;  1CQT A;  2DA5 A;  4GFL A;  4V2F A;  1HF0 A;  2NVQ J;  4A3I J;  1HCR A;  5EG0 B;  2OER A;  2EZH A;  4FCY A;  3NPI A;  2LTP A;  5EF6 A;  2DMT A;  3VVZ A;  3JRA A;  1IJW C;  5D1R A;  3H3V K;  1ZQ3 P;  3ZQF A;  1FEX A;  2JMW A;  2NP5 A;  1GV2 A;  1DU0 A;  2E2I J;  3BG9 A;  2UXP A;  3EUP A;  1POG A;  4AUX A;  3BQZ A;  3S2D J;  1S7E A;  1JKO C;  4PXI A;  3D1N I;  5FHP A;  5J1R A;  5EEA A;  3JRD A;  4AC6 A;  2EZI A;  5EGO B;  3ZQG A;  1FJL A;  4A69 C;  2VUM J;  2CUF A;  1U9O A;  2IU5 A;  2G0E A;  3TW7 A;  4D5C A;  2JA5 J;  1ZGW A;  3JRH A;  2GEN A;  3S17 J;  4XK4 A;  1B8I A;  3VUQ A;  1ZK8 A;  5C44 J;  3CJD A;  4CGR A;  1FTT A;  4A3D J;  3VW2 A;  5J1U A;  2W48 A;  2TCT A;  4GFK A;  5FMP A;  2X6O A;  4XID A;  3HOY J;  1XS9 A;  5FKO A;  1RPW A;  2ECB A;  3FIS A;  3HTH A;  2FX0 A;  2OI8 A;  1FTZ A;  5HAW A;  1LE8 B;  4JX5 A;  3V78 A;  3L1P A;  1YRN A;  1I6H J;  3BCG A;  3JRI A;  3PO3 J;  5JLX A;  5C4X J;  2DA2 A;  4GCT A;  2QF7 A;  4JKZ A;  1K61 A;  3F1B A;  2E1O A;  3HGG A;  2EQR A;  3JRF A;  1GUU A;  2FQ4 A;  2E2H J;  3CQZ J;  2Y9Z A;  5FLV A;  3ZOB A;  4AYB N;  1MBE A;  1VI0 A;  1UI5 A;  3LJL A;  1OFC X;  2H1K A;  2NP3 A;  3B6A A;  2JK3 A;  1I50 J;  5F04 A;  3S16 J;  1TWH J;  3AQS A;  3HB9 A;  3HOZ J;  2HI3 A;  4BKX A;  3GTO J;  2FD5 A;  5IP9 J;  5E3M A;  5FLM J;  3A01 B;  1MH3 A;  3S1M J;  3HTI A;  5M5Y J;  3A02 A;  2XPV A;  3DEW A;  2DA3 A;  2ID3 A;  3BTL A;  4B1R A;  3GZI A;  2XB0 X;  1JTX A;  2HOA A;  4D7M A;  5F0F A;  1SFO J;  1X58 A;  3MN2 A;  4B4C A;  1ETQ A;  2CUE A;  2L9R A;  1P7I A;  1UHS A;  2GBY A;  3BT9 A;  3FKI J;  3IV5 A;  3DPJ A;  3IH2 A;  2NS7 A;  2NVX J;  3RD3 A;  4RDU A;  3QPS A;  5FJ8 J;  5IP7 J;  3K2A A;  3GTQ J;  3LHQ A;  2LK2 A;  3B81 A;  5F0H A;  1GVD A;  2XGD A;  3BG5 A;  2I10 A;  1YRN B;  2PMZ N;  2M0C A;  4AC0 A;  1ETK A;  4MFE A;  1BW5 A;  2XGC A;  3C2B A;  2Y31 A;  4MXM A;  5FKL A;  1FIA A;  4A3J J;  4BY7 J;  3S14 J;  2VKE A;  4IEJ A;  2DG8 A;  2MG4 A;  3BR6 A;  2EH3 A;  2N8G A;  4W1U A;  3VP5 A;  1T56 A;  4M3D A;  3NAR A;  1NK2 P;  3QBM A;  2AO9 A;  1XC5 A;  2DJN A;  2LP0 A;  2ZOZ A;  1ITY A;  3H0G J;  5F1J A;  3HOU J;  2R5Z B;  4A3L J;  2D6Y A;  2NVT J;  3KNW A;  2ME6 A;  4UUT A;  3ZQL A;  3IH3 A;  1JJ8 C;  2DMQ A;  5E3N A;  3JRC A;  1LE8 A;  2ZCN A;  5HBU A;  1QVT A;  4GCL A;  2G7G A;  3BHQ A;  1OJL A;  3S1N J;  3VW1 A;  1AKH A;  2Y9Y A;  2XB5 A;  3GBG A;  1HOM A;  5CW8 A;  2FBQ A;  3PAS A;  2Y0S N;  3KZ9 A;  1AU7 A;  3UKG A;  5K7Z A;  2ZCM A;  1BJZ A;  1D5Y A;  2XPW A;  4BBR J;  3OSF A;  3HKZ N;  1HDD C;  2HYT A;  3BR2 A;  3HEF A;  2M8G X;  1JTY A;  1MBF A;  5C4J J;  3NRG A;  5IOY A;  5FKN A;  1MBK A;  3G1M A;  5GP9 A;  5K7H A;  3KKD A;  2UXH A;  3VIB A;  2WGB A;  3SFI A;  2B63 J;  3COL A;  3A01 A;  1Y1V J;  5K58 A;  2NVY J;  1Q1V A;  3Q0U A;  4DYR A;  3TED A;  2XDN A;  4A3K J;  2GM4 A;  1WH7 A;  3S5R A;  5M5W J;  4A3B J;  3S1Q J;  2HYJ A;  2XPU A;  2UXU A;  3LSG A;  3TP3 A;  3WHB A;  1WI3 A;  1IUF A;  4W97 A;  5HOD A;  2W53 A;  2JA6 J;  3Q3S A;  9ANT A;  2WUI A;  4A3C J;  1I3Q J;  2O7O A;  4M3G A;  2HOT A;  3BRU A;  2CU7 A;  1G2H A;  3OSG A;  2V57 A;  2VKV A;  3VOK A;  4QSH A;  1E3O C;  4MIM A;  2QKO A;  2NS8 A;  2XSD C;  1APL C;  5D18 A;  3T6N A;  3GTP J;  3MKL A;  1TWG J;  5IOZ A;  5F08 A;  2D5V A;  2R93 J;  3M4O J;  1AHD P;  1X2N A;  1AKH B;  3G1O A;  3G56 A;  1RKW A;  1Y1W J;  4GCK A;  4MK6 A;  4M3B A;  3TW6 A;  1HDP A;  1F36 A;  1JGG A;  3A03 A;  3S1R J;  5DTD A;  3BTJ A;  5M5X J;  4QTR A;  3EGQ A;  4UUS A;  2DG7 A;  3HTJ A;  2DN0 A;  1QRY A;  2Y2Z A;  3MVP A;  3ON2 A;  3BR3 A;  1XG1 A;  3IUV A;  1K83 J;  2JWT A;  2R5Z A;  5EZH A;  1NK3 P;  3FK6 A;  1EF4 A;  4FIS A;  5CXI A;  1TC3 C;  2K9N A;  1JKR C;  3LSR A;  4GFB A;  3RKQ A;  3LSP A;  3HBL A;  2R7Z J;  1WH5 A;  2ID6 A;  3GEU A;  1OCP A;  5M3F J;  4A3F J;  2K9S A;  4D5F A;  5EDN A;  2L0K A;  1OCT C;  3WHC A;  2DA7 A;  3HOX J;  1U8B A;  2GLO A;  3RZD J;  1GDT A;  3JRG A;  1RR7 A;  1JT6 A;  3HTA A;  4ABZ A;  2OPT A;  4FE7 A;  1BA5 A;  4M3E A;  1JKP C;  4I6Z A;  1MBH A;  2HXI A;  4X6A J;  4J19 A;  5FKM A;  4C2M J;  2R0Q C;  2WV1 A;  3QPL A;  2R92 J;  1UMQ A;  3PO2 J;  2HKU A;  5DS9 A;  5H9T A;  1U78 A;  2QCO A;  2H8R A;  2ME0 A; 
#chains in the Genus database with same CATH topology
 4XSX F;  1F5T A;  5E17 F;  1W5T A;  2X6Y A;  1FOY A;  3K10 A;  1PVE A;  1AWC A;  1ULY A;  1B4A A;  5CJ9 A;  2HQ5 A;  1U2W A;  4NC6 A;  4IPA A;  4UUV A;  4C2M A;  4KNY A;  3RZO J;  3BR1 A;  2VKH A;  5IYD J;  1DP7 P;  2LLK A;  4MTD A;  4F93 B;  1YW8 A;  4CCJ A;  2DMN A;  1RR8 C;  4KFC A;  2QIB A;  3PFY A;  4BGD A;  4QLC U;  3JRE A;  2IBD A;  2IA2 A;  1UG2 A;  2QWT A;  3CDI A;  3DKX A;  4HF2 A;  2QTQ A;  2IRF G;  1FNN A;  1AA7 A;  2DFH A;  4E7K A;  3GTG J;  5D19 A;  3LNQ A;  3RPU A;  4OOI A;  3BR0 A;  5BQT A;  2MW8 A;  4M72 A;  3JRB A;  1HW1 A;  2Y75 A;  3KYD B;  2BXZ A;  5J3L A;  3GZN B;  2I5U A;  2IGK A;  3L2R A;  3BG3 A;  3HHH A;  2FE3 A;  4JOM A;  3REO A;  1I5Z A;  3IP4 B;  4DZJ A;  3H0D A;  5AIP A;  3DF8 A;  2MYS A;  4ICH A;  1IXR C;  4LG0 A;  5J8F A;  1YYV A;  2V1D A;  3K4K A;  3CC2 I;  2VQC A;  1JT0 A;  4GO1 A;  3U9G A;  1DGR M;  1PYV A;  2DOD A;  3D5R C;  3MZY A;  5F1R A;  3EUA A;  5H6R A;  4GRI A;  4CGZ A;  1TQP A;  1YE9 A;  2XGE A;  4M9Z A;  2WB1 N;  2X1D A;  2W1O A;  3OYG A;  2V1N A;  2A61 A;  5CQE A;  4CO8 A;  3NQO A;  3E6B A;  5KAF C;  3WU1 B;  3DEE A;  2M5W A;  1SVL A;  1TTY A;  3Q0V A;  3ZMS A;  3LQQ A;  2DOF A;  4CZZ A;  2XRO A;  2AXT C;  2IJL A;  2JN6 A;  4IHV A;  1K6Y A;  3C3W A;  3U1K A;  5EZG A;  1JJ6 C;  4CYC B;  1BI0 A;  2HVQ A;  3GUD A;  4YEL A;  1A04 A;  1B9M A;  1H88 C;  2O7T A;  2KDZ A;  2HU9 A;  1R9T J;  3HJE A;  1T33 A;  4UVA A;  2L9S A;  4BNC A;  4OMZ A;  4HX4 A;  5FLX K;  4I0B A;  5IYC J;  2K3P A;  1QA6 A;  4V19 K;  3GTK J;  4PJM A;  1QZY A;  3CMM A;  2R5Y A;  3N4M A;  2M0M A;  2ELK A;  3K4J A;  2EFN A;  3BY6 A;  4N0B A;  1OYY A;  1QPI A;  2WAQ N;  2CSO A;  2ZNY A;  2WV0 A;  5TGT A;  4XM3 A;  4IXA A;  2YSR A;  3H1C A;  1U9N A;  4ACI A;  3CMY A;  2YU9 J;  3HE0 A;  2CQX A;  2DCE A;  2Q24 A;  2RAS A;  4F91 B;  1HW2 A;  2EZK A;  3V6G A;  2ELH A;  3WTW C;  2X6X A;  2F5E A;  3AG4 H;  4D7N A;  4U7D A;  3AAF A;  2R7D A;  3KZI C;  5KK1 A;  3IWZ A;  3TP0 A;  4ZDO A;  4BBS J;  3JSO A;  1LKX A;  4UV8 A;  1VQM I;  4P5O A;  2PI0 A;  3DBR B;  4BXX J;  5LHI A;  3G1L A;  3G2B A;  4L0Z B;  3S15 J;  4I0A A;  2C6Y A;  1YHQ I;  1T08 B;  4DOZ A;  4AF5 A;  2V9P A;  3QYB A;  4NUB A;  2ZSI B;  5H6Q A;  4DW6 A;  3GF2 A;  1BW6 A;  2L7M P;  1ON1 A;  1QHH D;  2RQP A;  5DDG A;  2UXX A;  2UWM A;  1DPR A;  2JRM A;  1VQK I;  4HNV A;  3M3Y J;  1HXD A;  3DTE A;  4XLH A;  3CMA I;  2MSY A;  1QGP A;  3ABT A;  3HYI A;  3L2Q A;  4C3J J;  2O5R A;  1MZB A;  3O6B B;  2YX4 A;  1T98 A;  2GAU A;  2CUJ A;  4P55 A;  2O03 A;  1Z6R A;  2ZOY A;  3LSJ A;  5EG0 A;  5FLX Z;  3TKY A;  2XAS A;  1Z9C A;  2QSG X;  1IN5 A;  2BY2 A;  3FF5 A;  1ODD A;  2RN7 A;  4Y17 A;  4EV0 A;  1N78 A;  1A31 A;  4QWQ A;  4M6X A;  3K4M A;  2PMU A;  3KFW X;  4U87 A;  3QOD A;  2MGQ A;  3GZ5 A;  4ENJ A;  2PMZ A;  2CO5 A;  5BMZ A;  4XBF A;  2F5F A;  2W00 A;  3IRQ A;  1LDK B;  2IA0 A;  2EIN H;  2JSP A;  1G59 A;  2ESN A;  3P9C A;  4HPQ A;  4AVP A;  4ESJ A;  1RUN A;  2OF7 A;  2EB7 A;  2H8W A;  2EBI A;  2AHQ A;  3EPZ A;  5GPC A;  1SMT A;  5E3L A;  2BGC A;  2WTE A;  3RKX A;  4DYC A;  3WG7 H;  1MH4 A;  1J75 A;  2CQQ A;  2DT7 B;  2I8D A;  3HM5 A;  3LAP A;  3MFK A;  4PFP A;  4ON0 A;  3BP8 A;  2JZY A;  3FK7 A;  4BJ6 C;  4IHY A;  4LOC A;  3FDY A;  2P4W A;  4CZC A;  1BOB A;  2HYG D;  3CO7 C;  2OC6 A;  4EJW A;  2REK A;  4ME9 A;  1ETV A;  2L2O A;  1CQT A;  4DIQ A;  4RGX A;  4CUG A;  1V55 H;  2HS5 A;  3QP6 A;  2QWW A;  4MEY F;  4HZF A;  5J47 A;  3OS1 A;  3ZCO A;  2Z1D A;  3DFG A;  2D1H A;  3KPH A;  1TLH B;  1S8N A;  3NPI A;  2DMT A;  1OMI A;  5D1R A;  1ZQ3 P;  3ZQF A;  1SAU A;  4RA2 A;  1MGT A;  5LFA A;  1J5Y A;  4X0G A;  2E2I J;  3QYE A;  2UXP A;  4XLE A;  3CF5 F;  3SHF A;  4YFK F;  1S7E A;  2W25 A;  2VBW A;  3JRD A;  4AC6 A;  1YQA A;  2EZI A;  2OCC H;  3WTV C;  2KIQ A;  2Z2S B;  5A2Q K;  2FOW A;  2OAZ A;  2QQ8 A;  2CUF A;  3DU6 A;  1ZG1 A;  2VUM J;  1TNS A;  3VTI A;  5AON A;  1YIO A;  3UR3 C;  2JUC A;  4P96 A;  1OPC A;  2A3S A;  2YR2 A;  5C44 J;  3PUF A;  3CJD A;  3RDI A;  1LDD A;  4XSZ F;  3NWT A;  2HKO A;  5DV5 A;  3S93 A;  3VYR B;  2W7N A;  3WGI A;  2ECB A;  1V54 H;  3RKW A;  4PJL A;  2A6T A;  5GAG J;  2F4I A;  3V78 A;  4NHJ A;  3L1P A;  1MKM A;  3FMQ A;  2R7S A;  2QF7 A;  3L2U A;  1K61 A;  3F1B A;  3DXJ F;  3CCU I;  3MQ0 A;  3JRF A;  2R7T A;  5D6E A;  4A2U A;  3ASN H;  4AID A;  3ZOB A;  3LJL A;  2H1K A;  2JPC A;  3M8J A;  2FOK A;  2M1B A;  4F3Q A;  3HOS A;  2XV4 S;  4BQO A;  3AQS A;  3HB9 A;  2EJR A;  4BKX A;  2AQE A;  5FRO A;  2FD5 A;  3U21 A;  2F5V A;  5HDK A;  1MNE A;  1BIA A;  3ULQ B;  5M5Y J;  2A07 F;  3D0S A;  3A02 A;  2PX9 A;  2DA3 A;  1JTX A;  3GME A;  2XAU A;  4B44 A;  1UB9 A;  1ZYR F;  3MN2 A;  2RVC A;  5E79 C;  1P7I A;  1UHS A;  1UJ8 A;  2VL8 A;  3RIR A;  3W3C A;  1QO0 D;  4CHU A;  1Z3Y A;  5E1Z B;  4AIJ A;  3K6G A;  3SXY A;  4RB2 C;  2QKM B;  4R8H A;  4IQ4 A;  3GCM A;  5LBQ A;  2I10 A;  4IL6 C;  1YIT I;  2Z33 A;  2GXB A;  1LPQ A;  1JE8 A;  1ETK A;  1FBS A;  4YG2 F;  3MKZ A;  4MXM A;  5FKL A;  3CF2 A;  4A3J J;  4Y15 A;  3HPG A;  1VQ6 I;  3S14 J;  4LGW A;  2MG4 A;  2LBF A;  2HPI A;  3BR6 A;  1LDJ A;  2QA4 I;  3KLN A;  4XN3 A;  3NAR A;  4RMN A;  3TO6 A;  1NK2 P;  3R0J A;  5E8I A;  3VWB A;  1ITY A;  1Z6T A;  5FGM A;  2R5Z B;  1P6R A;  3E5U A;  1R1V A;  4A3L J;  3TDU C;  4ENM A;  4FQG A;  2DFI A;  2VC1 A;  1JJ8 C;  1ZEL A;  3I54 A;  4L9J A;  5E3N A;  2JVH A;  1Z05 A;  4HDU A;  2XSJ C;  2X1E A;  4L9N A;  4IVN A;  2LSO A;  2XB5 A;  1X3Z B;  3I64 A;  5CW8 A;  3ZN1 A;  5ILS A;  3PAS A;  5LGT A;  3KZ9 A;  2Z3Y A;  1YJW I;  2ZCM A;  2AS5 F;  4UB8 C;  5BPD A;  3WTS C;  2M8G X;  4IRH A;  4ASN A;  5C4J J;  2WB1 A;  5FKN A;  3NRG A;  4KIG A;  4ZC3 A;  3KKD A;  3PSI A;  3FXQ A;  2CW8 A;  4BE1 A;  3COL A;  1Y1V J;  1YJ9 I;  5K58 A;  2NVY J;  2LC2 A;  2QGU A;  4DYR A;  1D1B A;  5JHF A;  4A3K J;  4HX8 A;  4RLF A;  4AIK A;  2GM4 A;  4FT8 A;  4Q5S F;  4EJU A;  3E6D A;  3B73 A;  1TZL A;  1J7K A;  3P5J A;  3CD6 I;  1WSU A;  1IRG A;  2XAJ A;  1BBY A;  3Q3S A;  4KN7 X;  1I3Q J;  1MMA A;  2O7O A;  2HOT A;  3BRU A;  1ZG3 A;  3HRS A;  3BOQ A;  3OSG A;  2ZJ2 A;  5AIQ A;  2V57 A;  2DDA A;  4XRF A;  3HPH A;  4MIM A;  1QU3 A;  4AVZ A;  4I09 A;  4UHT A;  1KU2 A;  4GGG A;  1HC8 A;  3FHN A;  2Q1Z B;  5F08 A;  3M4O J;  4WWC A;  1MND A;  2L01 A;  4OD4 A;  1B59 A;  3L00 A;  4IRI A;  3L09 A;  2LRE A;  2WAQ A;  2O8X A;  3G56 A;  2HTJ A;  4N9H A;  3W2V A;  4GCK A;  2FF4 A;  2KIF A;  3F72 A;  3E3V A;  4NNJ A;  3TW6 A;  2DQR A;  3I5U A;  4B47 A;  4BQN A;  3CC4 I;  3QOE A;  5L3F A;  5DTD A;  3BTJ A;  5M5X J;  4FET A;  4Z2Y A;  3K69 A;  4MEX F;  2EA2 A;  2EFW A;  4KJZ A;  1NG7 A;  3V8J A;  1K83 J;  5KCM A;  2JWT A;  2R5Z A;  5CVR A;  2ISZ A;  1RI7 A;  4BU2 A;  1TC3 C;  2K9N A;  2CS3 A;  2IXS A;  1JKR C;  1IAW A;  1VQ7 I;  3RKQ A;  3LSP A;  2ID6 A;  4Z6Y A;  3VYS B;  5M3F J;  2WA0 A;  3OYN A;  2EK5 A;  1ZGJ A;  4N9I A;  3TMO A;  1D1C A;  2DA7 A;  3HOX J;  2GLO A;  1YW9 A;  2OQR A;  3CTA A;  3JRG A;  3DBL B;  1HKT A;  3HTA A;  4OMY A;  4ABZ A;  4FE7 A;  4XLF A;  4E7Z A;  2UZK A;  4N4N B;  3S3O A;  1CF7 A;  4I6Z A;  4II2 A;  5HVQ C;  1XSV A;  5D8K B;  1SD4 A;  4MTE A;  3DPU A;  4KUM A;  3IUO A;  4HNU A;  2R0Q C;  2EV6 A;  1HBX G;  1UMQ A;  3ABL H;  2HKU A;  3A4C A;  4WK8 F;  3R0A A;  1UAA A;  1U78 A;  2ME0 A;  2B9S A;  5HNF A;  3LMM A;  2XVC A;  4TV7 A;  5BPI A;  5CVU A;  1A35 A;  2FNP A;  2LVS A;  1A6I A;  2DTZ A;  3ASO H;  2E1C A;  2FXA A;  2VE8 A;  3HXL A;  3FMS A;  5DCM B;  2XAH A;  2VT3 A;  4XL9 A;  4DJA A;  5IYB J;  3GFL A;  2IPQ X;  4B09 A;  1TWF J;  2FJI 1;  3FIW A;  2D2W A;  2NS0 A;  1IXC A;  1MDM B;  1K78 A;  1IN6 A;  1FY7 A;  3LA3 A;  1S6L A;  3NS4 A;  3ZRG A;  3RH2 A;  3ZQC A;  3KP2 A;  3I4N J;  1WRJ A;  4Q48 A;  4BQQ A;  2DYR H;  1D0Y A;  3WU2 C;  2R7Q A;  4KIB A;  1T8I A;  1LFU P;  3WTU C;  3CCS I;  2Q2E A;  1MMG A;  4ENK A;  3OYD A;  3HGY A;  2OTJ I;  1OCZ H;  2QKL B;  3RKY A;  2R7O A;  2KRF A;  1TWA J;  3GX4 X;  3SWH A;  4II3 A;  1VND A;  1YO5 C;  3IWF A;  4IRG A;  4UDS A;  2W24 A;  3T8R A;  5EYR A;  3HOW J;  2QQ9 A;  4S0H B;  2ZXJ A;  2VB6 A;  2P5V A;  2KL4 A;  4XIC A;  4BE2 A;  1MJ9 A;  2E1M C;  4UVB A;  1KON A;  4RB3 C;  2E1N A;  1MJB A;  4HQE A;  4HYE A;  1MNM C;  4Y4R A;  2P6T A;  1HKQ A;  2OZU A;  2DPU A;  4YZE A;  2XGX A;  1U0J A;  1BM9 A;  1BIB A;  3H5A A;  4KIS A;  4IHT A;  3KIO A;  3FM5 A;  1J59 A;  2K40 A;  2ZJQ F;  5CPR B;  3OS0 A;  1ZKG A;  4ZYD A;  4A3E J;  4KDP A;  5D5W B;  1RZ4 A;  2EWN A;  1G3W A;  2IW5 A;  4RGU A;  1P4X A;  2IS2 A;  1ENH A;  2VXD A;  2YS9 A;  1J2X A;  1W0T A;  3VVY A;  2LY1 A;  4NN1 A;  3JR9 A;  1XCB A;  1T39 A;  4XLP F;  2DQL A;  4RGR A;  1B72 A;  3CCJ I;  2QOP A;  1R1U A;  3TL4 X;  3OYB A;  2PZ9 A;  4LLG F;  5HSZ A;  4D0P A;  3E7L A;  2A05 A;  5ED4 A;  4LG0 B;  1Z91 A;  1FBQ A;  5TIS C;  3NXC A;  4XQF A;  3PIP F;  3ML6 A;  2RHA A;  4I2O A;  3FXM A;  1SGM A;  3RPU D;  2ZSH B;  3VSK A;  3KP7 A;  4L62 A;  3TBI A;  2CJJ A;  2DA1 A;  3KX2 A;  1HLV A;  3T5X A;  2NVU B;  3SZG A;  3M1C A;  2RC4 A;  1IG7 A;  2V79 A;  3LA2 A;  4EM2 A;  3BR5 A;  3Q0W A;  4HV6 A;  1IV6 A;  1DDN A;  3WG9 A;  4A0X A;  5K7F A;  1DPU A;  5IT3 A;  2MH9 A;  4XLC A;  1W7P B;  3G7R A;  4BQA A;  2LFB A;  5DUI A;  2DFE A;  1BR1 A;  4JP0 A;  4I76 A;  3P9T A;  4CXF A;  2VQL A;  1O3Q A;  4O5V A;  3P9K A;  4H0E A;  4HQM A;  3TO9 A;  3NAU A;  3ECO A;  1JKQ C;  1IV8 A;  1Z0X A;  2MH2 A;  2KDO A;  1FPQ A;  5K1Y A;  1QPM A;  1GHC A;  1HST A;  1MSE C;  1W7P D;  1EH6 A;  3R4K A;  4RM3 A;  5E8G A;  4X1E A;  2PG4 A;  4G9Y A;  2NRA C;  2HDW A;  2A2F X;  2LKX A;  3GFI A;  2HOS A;  2JA2 A;  5HLG A;  3PJR A;  3V8K A;  4ENN A;  3F8B A;  4LLN A;  2R5Y B;  4KT5 C;  1VQ5 I;  3KYC B;  2GFN A;  4YIR X;  3EUH C;  2BOL A;  3J81 K;  3O3K A;  2A5Y B;  4XRM A;  2X85 A;  3K70 C;  1ETO A;  2Q0O A;  3OS2 A;  1R7J A;  2UXO A;  3C07 A;  5LLQ A;  2MC4 A;  2OUM A;  4I02 A;  2KFD A;  2H09 A;  1O7L A;  3I3L A;  3SZP A;  2L54 A;  1YS6 A;  2HR3 A;  1P92 A;  3RYP A;  2GA2 A;  2CMP A;  3IC7 A;  5GTH C;  1FP2 A;  1R58 A;  2KHM A;  4CCL A;  2ETH A;  2BYV E;  2VPR A;  1XX5 A;  4KT6 A;  3V8L A;  4BH9 A;  3KLO A;  5BOX A;  5EGO A;  1XB4 A;  3HTU A;  1R23 A;  1IRF A;  1B6A A;  4XMY A;  3FM3 A;  4KIT B;  4PJN A;  4WXC A;  3L7W A;  1ZG5 A;  3RTR A;  3ZN0 A;  5J1Y A;  4BY1 J;  2Y30 A;  3FRQ A;  1X3U A;  1ZN2 A;  1CGP A;  2E1M B;  1X1P A;  1D0Z A;  4C2U A;  2M45 A;  4ZZL A;  4OAY A;  2O8K A;  4XKB A;  1ACI A;  3VOX A;  3V7R A;  1ZGA A;  3GTM J;  2L7F P;  3T1B A;  4EVI A;  1Z3X A;  1UG0 A;  3NNR A;  3PQJ A;  4A93 J;  1W7P A;  5E18 F;  4KN4 X;  1R5G A;  1WWX A;  5E1X A;  4QPQ A;  5LEK A;  4GFL A;  3N05 A;  1KQ9 A;  1FZP B;  3M7G A;  1HCR A;  5EG0 B;  2WC2 A;  1NG6 A;  3A0H C;  4M74 A;  2OER A;  2CH0 A;  2NNN A;  3E97 A;  5EF6 A;  3TGN A;  3HSF A;  1FMV A;  3H3V K;  2RQQ A;  5CKT A;  4C9Y A;  1GV2 A;  1M1E B;  3BG9 A;  2VIX A;  3J81 Z;  3BQZ A;  1DUX C;  3S2D J;  4BDY A;  4YII A;  1OR7 A;  2E5Z A;  1YTY A;  2KRH A;  1K79 A;  2XKO A;  5EEA A;  4WF2 A;  2DPD A;  2IS4 A;  4ZYG A;  4A69 C;  2BY3 A;  4ZDP A;  2H94 A;  1U8R A;  1W5C C;  2MD0 A;  2ZO4 A;  3TW7 A;  2IU5 A;  1I6X A;  2JA5 J;  2NNY A;  3S17 J;  3LL7 A;  4XOR A;  2FMY A;  2JRT A;  2M7B A;  1R5I D;  3R6S A;  1SC7 A;  3VUQ A;  2KZV A;  2LOO A;  2PFV A;  1R4N B;  2W48 A;  4GFK A;  1W5S A;  5FMP A;  2OV7 A;  3K4B A;  2MAB A;  3FIS A;  4NQW B;  2YVX A;  2FX0 A;  2QZ8 A;  4M9X A;  2OI8 A;  1FTZ A;  3OWT A;  3C2H A;  4JX5 A;  3IKT A;  4WX9 A;  1I6H J;  1S7O A;  3JRI A;  5JLX A;  3DPT A;  3L2V A;  3W2A A;  5F6F A;  3AKZ A;  4GYI A;  4EJV A;  2FQ4 A;  3CZ6 A;  2E2H J;  3ZP5 A;  2FBI A;  2NAZ A;  4F92 B;  1S5L C;  3CES A;  3S3N A;  1KQ8 A;  1H9G A;  4HF0 A;  3S16 J;  2LG4 A;  2X0L A;  3KP6 A;  2IS6 A;  5H20 A;  2L4M A;  2HI3 A;  2ICW G;  2DDB A;  5FLM J;  3A01 B;  1MH3 A;  1Y8R B;  3U2R A;  3S1M J;  2GXG A;  2ZC2 A;  3WGG A;  4B1R A;  3BTL A;  3GZI A;  2XB0 X;  1XMA A;  2KQR A;  3BLY A;  2HOA A;  4UNO A;  3BJA A;  1NHA A;  3A1Y A;  4D7M A;  4G7O F;  2DK5 A;  3EYY A;  5CVV A;  3GEZ A;  2CUE A;  1TW3 A;  4I01 A;  5ICG A;  1XN7 A;  2GBY A;  1E3H A;  2DXI A;  2ISY A;  3FXL A;  3DPJ A;  2FRH A;  3DQV C;  1OIS A;  4XR6 A;  2QUF A;  2F2E A;  3E5X A;  5IP7 J;  3GTQ J;  3PNY A;  3HUG A;  4L0Y B;  3K70 D;  1R4M B;  1YIJ I;  2F48 A;  1P9Q C;  3ONQ A;  2DJI A;  4OIN F;  2HPM A;  5GAE J;  2CQK A;  3DU5 A;  2M0C A;  4AC0 A;  2F6C A;  4MHG A;  2Y31 A;  2VT2 A;  2K4B A;  2E71 A;  3O2P E;  1A6Q A;  2XRN A;  2KLO A;  1JXS A;  4IEJ A;  4E7L A;  3CCM I;  5K5R A;  1SMY F;  2HZT A;  5HLT A;  4W1U A;  3FXJ A;  5J40 A;  2O3F A;  2HQA A;  1YLF A;  2DJN A;  2VJI A;  2ZNZ A;  5F64 A;  1T0F A;  2EPF A;  5J4Y A;  4BXU A;  5B3S H;  3HOU J;  2HNH A;  2V6C A;  2PJR A;  4ZYE A;  2NVT J;  3KNW A;  4NQW A;  1TL8 A;  4RAF A;  3IH3 A;  3JRC A;  3MZ8 A;  3R61 A;  3PIO F;  1I39 A;  1WJA A;  3BHQ A;  1OJL A;  2Y0S A;  1LQ1 A;  5DM7 F;  5DD4 A;  3NRV A;  4L5J A;  2FBQ A;  1XDU A;  3UKG A;  5K7Z A;  2X1C A;  1BJZ A;  2XPW A;  3VSL A;  3OSF A;  3HKZ N;  2HYT A;  2H1L A;  2ZKZ A;  3ERM A;  4HSR A;  3RYR A;  1J9I A;  5IOY A;  5B1A H;  2XF6 A;  4IO9 F;  2HDC A;  2QBY A;  4JQF A;  5GP9 A;  2MFZ A;  1GLN A;  3A01 A;  2PN6 A;  2B0L A;  3Q0U A;  2CV0 A;  2XDN A;  1SFE A;  4U0W A;  3EUH A;  3F23 A;  1SAX A;  3S1Q J;  2BHZ A;  2KIM A;  2EFQ A;  3SYT A;  2EFO A;  3EDP A;  5EJC A;  4IRV A;  3QAH A;  1KZH A;  2XPU A;  2F4M B;  3QPH A;  1OCC H;  4HG2 A;  3TP3 A;  4EM1 A;  2LBF B;  5HOD A;  2W53 A;  2K9L A;  4XNF A;  5LEJ A;  1ZRF A;  3MZH A;  9ANT A;  2WUI A;  4A3C J;  4WIB A;  1FBU A;  4RLQ A;  3OYL A;  2FU4 A;  2IGN A;  5ICF A;  3CJT B;  1KQ0 A;  4QSH A;  5B1B H;  1EH7 A;  1QBJ A;  3C2G A;  1SD5 A;  2QYO A;  2NS8 A;  1ZAR A;  2YU3 A;  4ZH4 F;  2XSD C;  1APL C;  3E0J B;  3SZT A;  4S05 A;  4RAZ A;  1TWG J;  1BI2 A;  2D5V A;  2R93 J;  1AHD P;  1X2N A;  3G1O A;  3G4S I;  2XUB A;  1RKW A;  1J0R A;  3OIQ A;  1PJR A;  4PDK A;  3ERE D;  4MK6 A;  2E36 A;  5CVI A;  1R1T A;  2VKD A;  1IXS B;  4L9V A;  4UUS A;  4OIR F;  2K02 A;  3HTJ A;  1QRY A;  5ERI A;  3WGH A;  2KP6 A;  2ZFW A;  3ON2 A;  3KEY A;  1WFX A;  3MEX A;  1XG1 A;  3G6E I;  3IUV A;  2CV2 A;  4KYW A;  3FK6 A;  1EF4 A;  2EIJ H;  2A5W A;  4ZYH A;  1KU3 A;  3S32 A;  2IS1 A;  3HBL A;  1WH5 A;  1XDS A;  3WTX C;  2DTR A;  1OCP A;  4P1W A;  4A3F J;  2K9S A;  3WTT C;  2L0K A;  3COA C;  3ECH A;  3FXK A;  4OIQ F;  1U8B A;  2ZME C;  1ZRC A;  1GDT A;  5JI6 A;  1JT6 A;  2OPT A;  3ABM H;  3K9T A;  1QNT A;  3QYF A;  3HHG A;  1GXP A;  1R6R A;  5CLS A;  5A2Q Z;  4X6A J;  2A6E F;  3BZ6 A;  1OKR A;  4J19 A;  5FKM A;  5JVG F;  4C2M J;  1U3E M;  4G7H F;  2R92 J;  3PO2 J;  4EAT A;  4B8X A;  1K7A A;  1R22 A;  3E6C C;  2E7W A;  2QCO A;  3P9I A;  1YFH A;  1FSE A;  1DU6 A;  3ABU A;  5CXG A;  5DUK A;  2VXZ A;  1W36 C;  3CME I;  3ZQ7 A;  4IX7 A;  1W1W E;  4HDV A;  2P7V B;  4J00 A;  5FGL A;  1FT9 A;  5CQG A;  3FXU A;  4G6Q A;  2HKX A;  3DWL E;  4ZTJ A;  1PUF B;  4U9N A;  3RQI A;  3BRO A;  4C3H J;  3I58 A;  4Q47 A;  3HL2 A;  3H5R A;  4DYQ A;  2PLY A;  1REP C;  4OD5 A;  4J01 A;  3DTI A;  1JGS A;  3OYH A;  2FA5 A;  4CCM A;  3BCB A;  4RAY A;  1VF9 A;  3CDL A;  2X51 A;  3F8N A;  5HNH A;  1IC8 A;  1UHW A;  4QIW N;  5C3E J;  3CJN A;  5D6F A;  1IW7 F;  3IL2 A;  3Q5F A;  5D8L B;  2KJC A;  1P4A A;  2YVE A;  2UXI A;  3CUQ A;  1CF7 B;  4MGR A;  4I99 C;  2NX4 A;  2M9H A;  1WVR A;  4JX4 A;  1YX3 A;  4RAG A;  3RQ4 A;  3OYI A;  3G71 I;  5GPA A;  1UHM A;  4Y7N J;  1FMW A;  1IF1 A;  3GLX A;  1RES A;  3R60 A;  5E3O A;  3M07 A;  1DQU A;  1LNW A;  5EEH A;  3OR2 C;  1ZR2 A;  2FML A;  4N4O B;  1LJ9 A;  3B02 A;  1D5V A;  2OU2 A;  2ELJ A;  2VBZ A;  2QVO A;  5L3E A;  2STT A;  4YFX F;  1XMK A;  2ZY9 A;  2EFP A;  2BVM A;  1LFB A;  2V6E A;  2EZL A;  1UI6 A;  3J7Y J;  2EIM H;  1MBG A;  1O3R A;  3S2H J;  3LOC A;  2DMP A;  3HRT A;  4OIO F;  3PQK A;  2P8T A;  4U0Y A;  4MO7 A;  1RKT A;  2LY9 A;  2KT0 A;  1L0O C;  4BEH A;  1IRX A;  5HS9 A;  3BJB A;  3PSF A;  4BHP A;  2VPL A;  4BHC A;  2LY2 A;  1BOA A;  2LDU A;  4RB0 A;  1LFP A;  3CCE I;  2R7U A;  3LST A;  3CP2 A;  3NI7 A;  1K78 B;  3SDB A;  2M2E A;  1QZZ A;  2UXN A;  3OOU A;  3JSJ A;  1TWC J;  5DEQ A;  1G3Y A;  4CCK A;  1TP4 A;  3K1P A;  1SD7 A;  3VB2 A;  4M3F A;  1F4K A;  5M3M J;  3GWZ A;  2E19 A;  4R1H A;  2EA4 A;  4AWX B;  3HDD A;  3A2K A;  2XC7 A;  2Q2E B;  1MBJ A;  1XGM A;  4NC8 A;  1LEB A;  2VN2 A;  1PUF A;  4D1Q A;  3FBI B;  1JUS A;  2OQG A;  3K2Z A;  3D5S C;  2M3A A;  2DA6 A;  2VQH A;  3BTI A;  1VQN I;  1IRZ A;  1G4D A;  1OYW A;  2GQQ A;  2M8E A;  2CG4 A;  1BL0 A;  4PJJ A;  1IGN A;  3AFH A;  3QRF F;  1T38 A;  2ZME B;  3FZV A;  2DT5 A;  4I7H A;  4RBO A;  4AIH A;  3OYF A;  2HOE A;  2UV1 A;  3TOB A;  2HVR A;  4ZTF A;  2ZXW H;  3DV8 A;  2DOA A;  1RET A;  1WJ5 A;  1Y6I A;  1EH8 A;  5IT9 K;  2TRT A;  5L3G A;  2QLZ A;  1FYL A;  3MKW B;  3DKW A;  5F0C A;  3F0C A;  2X6W A;  3BZC A;  1X19 A;  1X3W B;  1SVM A;  2NOG A;  4A3M J;  3GVA A;  2XAQ A;  4KWA A;  1UZC A;  1S9H A;  1W4M A;  2XRL A;  3Q9V A;  4HLX A;  5C4Y A;  2WY7 Q;  1JUP A;  4BS9 A;  1B72 B;  1OR7 C;  3BNI A;  1YI2 I;  3I9V 2;  1X1B A;  3CCR I;  1S3J A;  1B8I B;  4LLL A;  5HLH A;  3DLA A;  4MNU A;  3M9A A;  3LSH A;  1R5H A;  1W36 D;  1QVU A;  1O7F A;  4YRV A;  3WTY C;  3H92 A;  3OYE A;  2JA8 J;  1Y8Q B;  4NEL A;  1H9T A;  3VYT B;  5HLI A;  1N25 A;  3MAJ A;  2WY8 Q;  3FMR A;  1NH3 A;  3IH4 A;  3KZZ A;  2MBF A;  3CCL I;  3SFZ A;  1UST A;  3BG6 A;  1XSX A;  3LWF A;  4JNN A;  3ZQH A;  4ZJZ A;  2KMU A;  4OU0 A;  1ZTR A;  2GUH A;  1SAN A;  3PM1 A;  4HW0 A;  5LHH A;  4Q4Z F;  3CLO A;  1E2X A;  3QPT A;  3VPR A;  2BW3 A;  1O3T A;  3C1D A;  5IY5 H;  3OYC A;  4E7J A;  1D1A A;  4M6V A;  3K7A J;  2QM3 A;  5GAH J;  2O9L A;  4DBQ A;  2RAE A;  3BJO A;  5D5X B;  3I59 A;  1X2M A;  4HST A;  3HIM A;  5EFY A;  2V7F A;  3VW0 A;  1OCR H;  1WI9 A;  4BL0 B;  4HF1 A;  2AQF A;  4C30 A;  2LKP A;  3D5L A;  2BY1 A;  3NWS A;  2CRG A;  5F27 A;  1S29 A;  2DMU A;  1H89 C;  3MCZ A;  1WPK A;  1MSF C;  2Y48 A;  3LQR A;  1NTC A;  4V2G A;  4IHW A;  1HQC A;  2ZME A;  2IAI A;  2DA5 A;  2OBP A;  2BY0 A;  1I1G A;  3GO5 A;  3VOD A;  2ACJ A;  5HS8 A;  3HKZ A;  2NVQ J;  4LK1 F;  3GW2 A;  1ZHF A;  3K1N A;  2EZH A;  3M8F A;  3FHZ A;  1T6S A;  3OL4 A;  4L5I A;  2LTP A;  4FCY A;  1D8J A;  4FAS D;  3JRA A;  3VVZ A;  2BV6 A;  4FX4 A;  3J7A O;  5CVJ A;  1FEX A;  2JMW A;  1Y0U A;  1I27 A;  3EUP A;  3K1M A;  3KP4 A;  4AUX A;  2PFB A;  2M4K A;  4JBA A;  3RPQ A;  1TT0 A;  1KGS A;  4F7Z A;  2KIS A;  4ZYA A;  4HRI A;  2HQR A;  5J1R A;  1MMN A;  5EEG A;  5EGO B;  4S04 A;  4LK0 F;  1FJL A;  2VC0 A;  3LFK A;  1U9O A;  3HTS B;  5HS7 A;  2G0E A;  4D5C A;  3VEP A;  2GEN A;  4PJ0 C;  4XK4 A;  1B8I A;  5GAD J;  1ZK8 A;  1SFU A;  1FYK A;  1Z7U A;  3FX3 A;  4A3D J;  1FTT A;  1IN8 A;  4KIF A;  2R4G A;  2X6O A;  1DP3 A;  1XS9 A;  1WHU A;  1MMD A;  1RPW A;  3HTH A;  2E35 A;  2Q8K A;  3W6K B;  3H35 A;  4LD5 A;  5KVR A;  3OMY A;  1LE8 B;  1T0F C;  2GXA A;  3C18 A;  1YRN A;  1ZRE A;  1YW7 A;  3BCG A;  4P9U A;  5C4X J;  2DA2 A;  1R71 A;  2G7H A;  2O0Y A;  4XLN F;  3V4G A;  4JKZ A;  2E1O A;  1X4O A;  2CW0 F;  3KET A;  3CQZ J;  3HOT A;  2IGM A;  4AYB N;  2Y9Z A;  1V4R A;  5FB2 A;  1OFC X;  2JPB A;  3QOP A;  2NP3 A;  3B6A A;  5L3D A;  2FBK A;  4A5M A;  2JK3 A;  3ZR8 X;  1I50 J;  5K5O A;  2JT1 A;  1FSH A;  1TWH J;  4LG3 A;  2J5O A;  2DFF A;  2HZD A;  1HSJ A;  1U5T A;  3JTH A;  5IP9 J;  3V7S A;  5E3M A;  4BE0 A;  3OIP A;  2R7F A;  2KZG A;  1XMX A;  1N77 A;  4UVC A;  1JHF A;  1VZ0 A;  2XPV A;  4XLA A;  4Y3O A;  4E7S A;  2LF7 A;  4ESB A;  3QP5 A;  1BR2 A;  5F0F A;  3ZMD A;  4B4C A;  4F52 A;  1D0X A;  3RCO A;  2L9R A;  3K0L A;  4IQJ A;  2G7U A;  1ERD A;  2VJ5 A;  3IAM 2;  3FKI J;  2HQN A;  1VQ9 I;  2B3W A;  3IH2 A;  2NVX J;  5CYV A;  5FJ8 J;  2EV5 A;  2WAE A;  3LHQ A;  2TDX A;  1V5G A;  5FFZ A;  1VQO I;  2LK2 A;  2EV0 A;  3F3X A;  2XGD A;  1BJA A;  2ESH A;  3DBH B;  4PGG A;  3QU3 A;  4CCN A;  3DP7 A;  1X1D A;  2VON A;  5B66 C;  4LFU A;  2H6C A;  4C2T A;  4BY7 J;  2BVL A;  3E6M A;  5H2F C;  4HEA 2;  3FWE A;  2EH3 A;  4FX0 A;  4M6Y A;  3WTZ A;  1FLI A;  3HRU A;  4M3D A;  3QBM A;  2LP0 A;  3MD2 A;  1OLT A;  1X1C A;  3GFM A;  4D9J A;  4ETS A;  1ZRD A;  3H3U A;  5F1J A;  2GOM A;  2Z5U A;  3ZMT A;  2K27 A;  3OR1 C;  2E5N A;  4BYY A;  2BZT A;  1TW2 A;  1LB2 A;  2ME6 A;  1SFK A;  2KIU A;  4UUT A;  1F1Z A;  1MIJ A;  2DK8 A;  2V1X A;  2DMQ A;  5JFR A;  1LE8 A;  1FP1 D;  5L3B A;  3CDH A;  3UNG C;  2NOJ B;  4GCL A;  2G7G A;  4PSW A;  3S1N J;  1AKH A;  4IOA F;  1HOM A;  1B1B A;  2YX7 A;  2Z16 A;  1L3L A;  1AU7 A;  3AG2 H;  2L9N A;  4GDF A;  6PAX A;  4BBR J;  3ZMZ A;  3BR2 A;  3HEF A;  3ABK H;  3HUG B;  4K2E A;  4WXD A;  2Y69 H;  1WJD A;  3GYH X;  1MBK A;  5K7H A;  3VIB A;  1USS A;  4A6E A;  3CJR B;  1LVK A;  3DLL F;  1Q1V A;  1KYW A;  1K4T A;  2WWY A;  1RUO A;  4A3B J;  2F5C A;  4BUP A;  3LSK A;  3SEZ A;  1VQ4 I;  2Z99 A;  4U9L A;  3KP5 A;  3CP8 A;  1K4S A;  2UXU A;  3MKY B;  3LSG A;  3VDX A;  5FRN A;  5ILU A;  4DVY P;  3WHB A;  1IUF A;  1QHG A;  4G94 A;  2GZW A;  3AG1 H;  4M3G A;  2LKS A;  2H6B A;  1G2H A;  3BPV A;  2B7E A;  3VOK A;  3F22 A;  2PJR B;  1EV7 A;  1ZLJ A;  4CYD A;  1E3O C;  3H9G A;  2MLG A;  4LJZ F;  2A68 F;  2WBM A;  1JHH A;  3MKL A;  1PP7 U;  2OZ6 A;  3EUK L;  2W4S A;  3LSM A;  1X1A A;  4MQV A;  1N75 A;  1PP8 F;  5J4V A;  3KEO A;  3TQN A;  4F55 A;  5K5Q A;  4M3B A;  4DGW B;  3ZMV A;  1JGG A;  3A03 A;  1WQ2 A;  4QTR A;  3EGQ A;  4UXN A;  2K3F A;  2GOX B;  2QBY B;  4G8X A;  3BR3 A;  3IKV A;  2CGP A;  4ITV A;  2ZJP F;  3CUQ C;  1NK3 P;  2LYC A;  4EJT A;  5CXI A;  4E7H A;  3LSR A;  3SQN A;  4UB6 C;  2R7Z J;  2XIG A;  4O6J A;  3GEU A;  2VLA A;  3LA7 A;  4E70 A;  1YX5 A;  2P5L C;  4D5F A;  5HDG A;  2VOP A;  5EDN A;  3WHC A;  2W85 A;  4G6D A;  3RZD J;  2KKO A;  5D5U B;  1XGO A;  2IVM A;  2COM A;  2P5K A;  1FOX A;  2HTS A;  3U1D A;  1KA8 A;  3QU6 A;  4M3E A;  1JKP C;  1X4P A;  2HXI A;  2LMD A;  1YOV B;  1AOY A;  2L3D A;  4IF4 A;  1FOK A;  4Y33 A;  5FRM A;  4E4H A;  4E7I A;  2H27 A;  1R36 A;  5H9T A;  2WAF A;  3VP5 A;  4C3I J;  2CUZ A;  4XKV A;  3VYU B;  2K5C A;  1MJA A;  2RNJ A;  2R7X A;  3O8G A;  3TOA A;  4FE4 A;  2DA4 A;  4EQQ A;  2X48 A;  4L18 B;  4KMU X;  4U88 A;  5D4S A;  1TQM A;  2QSH X;  1GVJ A;  3JAM K;  2BEO A;  4UUS B;  3SDG A;  2LRD A;  2VJ4 A;  3PL8 A;  2UUZ A;  3OL3 A;  4CYC A;  4CH7 A;  2P7C B;  3EYI A;  2LH9 A;  4MQ9 F;  3QKX A;  3X2Q H;  2DYS H;  2JJ7 A;  5DCF A;  4LMY A;  3BC8 A;  1Q1H A;  3Q9S A;  4CDG A;  3W6V A;  1IDZ A;  4R79 A;  3QQA A;  2ECC A;  1G8X A;  1MD0 A;  4G6T B;  1VQ8 I;  1SFX A;  3BQY A;  1GT0 C;  3ANG A;  2L7Z A;  4L5E A;  2R7R A;  3SJM A;  2ADU A;  1YG2 A;  5LRR A;  1W0U A;  3FXO A;  1ETW A;  1UCR A;  2DU9 A;  2FBH A;  3T0Y A;  5AQC A;  3DCF A;  5D4R A;  4FTH A;  3CUO A;  1EA3 A;  1WGX A;  4B3A A;  1C0W A;  2K9Q A;  2FNA A;  2KPM A;  3EQL F;  4HA8 A;  1TNT A;  1SEU A;  2DBB A;  2W82 A;  4Y52 J;  1OCO H;  2M34 A;  3AL0 C;  1WJC A;  2W84 A;  4PK4 A;  3BTC A;  4DBR A;  3PUB A;  4DNC A;  3CCY A;  1TT5 B;  5IP6 A;  2VQG A;  2VAS A;  1BC7 C;  3ROU A;  2FJ1 A;  1J09 A;  2L9V A;  2K7L A;  3O60 A;  2HYF A;  2ZB9 A;  1D8K A;  2L7K A;  3LWJ A;  2HDD A;  3AQT A;  3A0B C;  3V7C A;  1FX7 A;  5TJJ A;  1FIP A;  2FUG 2;  1FC3 A;  2V9V A;  4NBQ A;  3GLL A;  2IT0 A;  1KU9 A;  2VBY A;  2G9W A;  2X4H A;  4JYK A;  1IDY A;  1H8A C;  2DO7 A;  1VFC A;  2ZXH A;  4BJ5 C;  3FBN B;  2STW A;  1ZH5 A;  2MD5 A;  2OCE A;  4HKU A;  1R49 A;  3JAM Z;  2XKP A;  1P2F A;  5FKK A;  1HA8 A;  2JTV A;  1ETY A;  1TBX A;  4JX6 A;  3V42 A;  2LD5 A;  1SD6 A;  3KP3 A;  3F8F A;  3HIF A;  2DW4 A;  1ZAO A;  4EEF G;  2LNB A;  1LEA A;  1ORK A;  4XRS G;  2G7L A;  1QZE A;  2G7S A;  3PPB A;  4FHT A;  3F9K A;  3F6V A;  1BR4 A;  1JUM A;  3CUQ B;  3ISP A;  1E17 A;  4CCO A;  2K86 A;  4IZZ A;  2O6G E;  1JI8 A;  1XTA A;  3VOE A;  2VI6 A;  2QEN A;  3OYA A;  1P4W A;  4GCV A;  3H9Q A;  2JUG A;  4NC7 A;  3GTJ J;  1XGN A;  3ANP A;  1VTN C;  1WZ2 A;  2MLK A;  4JL3 A;  4AYB A;  2ZJR F;  5IPA A;  1UEL B;  1RNL A;  3KKC A;  3EET A;  4EM0 B;  2HGC A;  3ZMU A;  5J8C A;  3CO6 C;  3VVX A;  2BE5 F;  3OYK A;  1ZLK A;  3I4M J;  2ZCX A;  4BEH B;  5ICC A;  5BNG A;  2FQ3 A;  1A5J A;  2PQ8 A;  2COB A;  5DM6 F;  4WXH A;  3I56 I;  3KEQ A;  4XON A;  4LIU A;  4BXF A;  4XRS A;  4DZP A;  1LVA A;  1RRJ A;  1F43 A;  3CLQ A;  1WCM J;  2YUS A;  2A6H F;  4I98 B;  1ONV A;  1TQI A;  2IEK A;  1P7J A;  1Z77 A;  2P81 A;  5JLW A;  4NDL A;  2VJJ A;  2KRC A;  4IJA A;  4M9S A;  3TDZ C;  5FD5 A;  4XOT A;  2Y0M A;  2ZXI A;  3ON4 A;  3B6C A;  1A36 A;  3HSE A;  4EGY A;  2CW7 A;  3KCC A;  4KIC A;  1ZR4 A;  3E7Q A;  4RB1 A;  4MLO A;  5DAJ A;  4CA0 A;  3DTK A;  3KYL A;  4L9T A;  4QPO A;  3CRJ A;  4XN0 A;  2EIL H;  4MFD A;  1PDN C;  3L2W A;  3O8H A;  4PCQ A;  3S2W A;  2VE9 A;  2PJP A;  4H4K C;  4IHX A;  2XAF A;  3ZQI A;  3SEQ A;  2JA7 J;  2CQN A;  4E6K G;  2P0W A;  3I53 A;  1STZ A;  1OQY A;  4ZDL A;  5J6X A;  4OIP F;  1E0E A;  2D1V A;  2BBY A;  3GTL J;  2YVH A;  1GV5 A;  2B1E A;  2HXO A;  2V4J C;  3E5Q A;  3K8P C;  3OIO A;  2G3B A;  4U7B A;  3ZGK A;  2KJB A;  1Y39 A;  2NXN B;  3HOV J;  2F07 A;  3FKJ A;  2V9K A;  4YFN F;  3AL0 B;  2VBX A;  3CWR A;  2LR8 A;  4ESF A;  3MNL A;  5E1W A;  3ZQQ A;  1ETX A;  1O4X A;  1IUY A;  5L3C A;  4G12 A;  4HAM A;  3GZ6 A;  2RDP A;  2PBX A;  4A3G J;  3WU0 A;  2E2J J;  4RS8 A;  2X9D A;  1U5T C;  1K6O A;  1OYI A;  5HOO A;  1WJE A;  4XOP A;  5BS6 A;  4G7Z F;  5LD2 C;  1T2K A;  1VQL I;  3BDD A;  4V2F A;  3DPL C;  2DI3 A;  3OV8 A;  1HF0 A;  4A3I J;  4EGZ A;  2VOD A;  3HZJ A;  3GFJ A;  3OOP A;  3P7N A;  5GTI C;  1F9N A;  2ZFU A;  1IJW C;  1UFM A;  3H5N A;  2D45 A;  2GWR A;  2IA1 A;  3RI4 A;  2NP5 A;  1DU0 A;  2LF8 A;  3C7J A;  1BN5 A;  1HW5 A;  1POG A;  3ZXS A;  2DLL A;  3LSI A;  5FD6 A;  2MA3 A;  2ZBK A;  3HSR A;  2BHY A;  4B43 A;  1JKO C;  4PXI A;  3D1N I;  2YPR A;  2MC3 A;  4A12 A;  4AM3 A;  3RJP A;  1MMS A;  5FHP A;  3IAS 2;  2PEX A;  3HRM A;  5FO5 A;  4OWR B;  3ZQG A;  3M8E A;  1GXQ A;  2BW3 B;  4BAY A;  3JW4 A;  1G6N A;  1G3S A;  2GA1 A;  2PBI A;  4GXO A;  1ZGW A;  3JRH A;  3RSN A;  2XHK A;  3I59 B;  5LHG A;  2DAO A;  3L9F A;  4CGR A;  4LIV A;  3VW2 A;  3I71 A;  5J1U A;  1EJ9 A;  4B48 A;  4IKF A;  2TCT A;  3H3Z A;  5LRS A;  5HDN A;  4XID A;  3HOY J;  1XCV A;  3T8T A;  5FKO A;  2ZCW A;  1V5F A;  1XSD A;  4PFO A;  1D3Y A;  5HAW A;  1IO2 A;  4A5N A;  1KU7 A;  2CWE A;  2PMH A;  4ANJ A;  1Y56 A;  2HFH A;  3WE2 A;  3TO7 A;  2GIZ A;  3PO3 J;  3KZY A;  4GCT A;  3NEU A;  2RV8 A;  1V5E A;  3HGG A;  2EQR A;  1GUU A;  5LGN A;  2VOO A;  3G73 A;  5FLV A;  1MBE A;  2R3S A;  1FOW A;  1VI0 A;  2GIV A;  2RGV A;  1UI5 A;  2HWV A;  3BJ6 A;  3S8P A;  3DKY A;  2E60 A;  5F04 A;  3JCU C;  2XF7 A;  2WAD A;  1V3F A;  4WCG A;  4BHB A;  3HOZ J;  3GTO J;  3JTG A;  3CC7 I;  1XGS A;  4M73 A;  3HTI A;  2OTL I;  4UV9 A;  2XF5 A;  3DEW A;  2ID3 A;  1VQP I;  2J5P A;  4CSW A;  1Z21 A;  3OYJ A;  4EJO A;  3F8C A;  1SFO J;  1X58 A;  3QWL A;  1LUJ B;  1ETQ A;  4CIC A;  5B5E C;  3BT9 A;  3IV5 A;  1DGW Y;  3RD3 A;  2NS7 A;  4RDU A;  5JHU A;  1HKS A;  4IHS A;  3QPS A;  2DT6 A;  1BI3 A;  1EKE A;  1WKM A;  3K2A A;  3B81 A;  5F0H A;  1GVD A;  2K4J A;  2FSW A;  4RM2 A;  3BG5 A;  3KE2 A;  4EMS A;  5ILV A;  1RIO H;  1YRN B;  2PMZ N;  5ICE A;  4MFE A;  1BW5 A;  1Z1D A;  2XGC A;  3C2B A;  2FEZ A;  3WOD F;  3LFU A;  3DEU A;  1S72 I;  2A69 F;  2CQ7 A;  1FIA A;  2AXL A;  2VKE A;  1KYZ A;  2QQA A;  4UY8 I;  2DG8 A;  1Z7L A;  4XKC A;  2N8G A;  1U6G A;  4Y13 A;  5KAI C;  1T56 A;  3IHU A;  2XDV A;  3WE3 A;  2AO9 A;  1XC5 A;  3VFZ A;  2HVS A;  2ZOZ A;  3H0G J;  1E3P A;  1U5T B;  4PSX A;  3LAJ A;  3PFI A;  3J7A Y;  2D6Y A;  2M87 A;  3BPX A;  4B3X A;  3I4P A;  2F4O B;  4BDZ A;  1SVO A;  5DYM A;  3ZQL A;  1B9N A;  3PNT A;  2XAG A;  3PNV A;  1BC8 C;  5IT9 Z;  2ZCN A;  4PUS A;  2CFO A;  4JK1 X;  2L5Q A;  1QVT A;  5HBU A;  2BXY A;  3ESW B;  4BAC A;  3VW1 A;  2Y9Y A;  2NYX A;  4KA4 A;  3GBG A;  3W2W A;  2Y0S N;  1QQI A;  2IGO A;  4LB5 A;  3AG3 H;  1H0M A;  3M1E A;  5JR3 A;  3E1S A;  1D5Y A;  2R7W A;  1HDD C;  3ZPL A;  3ELK A;  3I55 I;  1JTY A;  1MBF A;  3N97 A;  1T95 A;  2QQB A;  3S3M A;  3G1M A;  1Y0N A;  1O57 A;  2UXH A;  2WGB A;  3SFI A;  4AU7 A;  3JSP A;  2B63 J;  4A0Z A;  2QEX I;  3J7Z I;  3MWM A;  4HBL A;  1FYM A;  3TED A;  2RRE A;  1WH7 A;  3S5R A;  5M5W J;  1XD7 A;  2L4A A;  2HEO A;  3FXR A;  4A0Y A;  1PUE E;  2HYJ A;  2RKH A;  4KMF A;  4U0V A;  3F8M A;  4HV5 A;  1G3T A;  3J80 K;  4DQ2 A;  1Z67 A;  1WI3 A;  4LIT A;  4W97 A;  2JA6 J;  3BG7 A;  3CCQ I;  2F5D A;  2OD5 A;  3BZK A;  1MW7 A;  4XKW A;  4P9F A;  3CCV I;  3H36 A;  2CU7 A;  3F6O A;  3OYM A;  2IP2 A;  1WJB A;  2VKV A;  2L02 A;  1WJF A;  4YEJ A;  2OA4 A;  2QKO A;  1RC9 A;  1IN7 A;  4GYG A;  1O3S A;  5D18 A;  3HC7 A;  4HLY A;  4A6D A;  3T6N A;  3OY9 A;  3GTP J;  2Z9O A;  5E20 A;  5IOZ A;  1YJN I;  3G3Z A;  4O3M A;  1AKH B;  3BCA A;  5LGU A;  1I1S A;  4AD9 A;  4PZJ A;  1Y1W J;  2O61 A;  3K4C A;  2JVG A;  2EIK H;  1HDP A;  1F36 A;  3MMY B;  3W6J B;  5JVT A;  3S1R J;  1XPX A;  2CV1 A;  1FWZ A;  2DG7 A;  5DCM A;  2DN0 A;  2Y2Z A;  3HG9 A;  3MVP A;  4HNT A;  2RNG A;  3H9J A;  2M30 A;  2DOE A;  3IRR A;  3I0T A;  1R00 A;  5KNL A;  2OJE D;  3GXO A;  4OAZ A;  5EZH A;  1MDM A;  1IZ1 A;  2CFX A;  4ZZD A;  3F21 A;  4FIS A;  4GFB A;  2E34 A;  5D5V B;  3K4N A;  2JSC A;  2M4G A;  2M7A A;  5DD8 A;  4PGH A;  1OCT C;  1YS7 A;  5TRD A;  3K4L A;  2V26 A;  3L2C A;  4NB5 A;  4YIF A;  1RR7 A;  2R7V A;  4LB6 B;  4IOC F;  5KHD A;  1BA5 A;  3BWG A;  4M71 A;  5FFX A;  2JQ7 A;  1IN4 A;  1ON2 A;  4RGS A;  2K9M A;  2W57 A;  1MBH A;  4HX7 A;  2K85 A;  3CJQ B;  4BJT A;  3J80 Z;  2CYY A;  1BI1 A;  4HOB A;  2WV1 A;  3QPL A;  2V1U A;  5DS9 A;  1S7A A;  2E7X A;  1I3A A;  2P6S A;  2QSF X;  2H8R A; 
#chains in the Genus database with same CATH homology
 4C3I J;  1DU6 A;  5CXG A;  3O8G A;  2HQ5 A;  2LVS A;  4FE4 A;  1A6I A;  2DA4 A;  5FGL A;  2DTZ A;  2X48 A;  3RZO J;  3BR1 A;  1PUF B;  3RQI A;  4C3H J;  5IYD J;  2LLK A;  4DYQ A;  4UUS B;  3SDG A;  2DMN A;  2QIB A;  4CYC A;  5IYB J;  3JRE A;  2IBD A;  1TWF J;  1UG2 A;  3FIW A;  2QWT A;  3QKX A;  2QTQ A;  2JJ7 A;  3GTG J;  5D19 A;  3LNQ A;  3W6V A;  3RH2 A;  3ZQC A;  3BR0 A;  1IDZ A;  2MW8 A;  3I4N J;  1VF9 A;  3QQA A;  3CDL A;  3JRB A;  2ECC A;  3BQY A;  1IC8 A;  5J3L A;  4QIW N;  1GT0 C;  5C3E J;  3ANG A;  2L7Z A;  4L5E A;  3BG3 A;  4DZJ A;  1LFU P;  3SJM A;  4ICH A;  1W0U A;  2YVE A;  1ETW A;  3HGY A;  2UXI A;  5AQC A;  3DCF A;  4FTH A;  1WGX A;  1TWA J;  1JT0 A;  4B3A A;  1VND A;  2NX4 A;  2M9H A;  4JX4 A;  2K9Q A;  4UDS A;  5EYR A;  5GPA A;  4Y7N J;  3HOW J;  4S0H B;  4Y52 J;  1RES A;  5E3O A;  2XGE A;  4XIC A;  2M34 A;  2WB1 N;  1ZR2 A;  3BTC A;  1MNM C;  3CCY A;  5IP6 A;  4YZE A;  1LFB A;  2EZL A;  3Q0V A;  2FJ1 A;  1UI6 A;  3O60 A;  1MBG A;  3S2H J;  2ZB9 A;  3LOC A;  3LWJ A;  2DMP A;  2HDD A;  3AQT A;  2JN6 A;  4IHV A;  2K40 A;  1ZKG A;  1RKT A;  2LY9 A;  2KT0 A;  4MO7 A;  1FIP A;  5EZG A;  3BJB A;  1JJ6 C;  4CYC B;  4A3E J;  1H88 C;  4JYK A;  2O7T A;  1IDY A;  2KDZ A;  1H8A C;  1R9T J;  1VFC A;  1T33 A;  3NI7 A;  2M2E A;  3OOU A;  3JSJ A;  1ENH A;  4HKU A;  1TWC J;  2YS9 A;  5IYC J;  5FKK A;  1W0T A;  3GTK J;  3VVY A;  1ETY A;  4NN1 A;  4JX6 A;  4M3F A;  3JR9 A;  2R5Y A;  2LD5 A;  5M3M J;  1B72 A;  2QOP A;  5HSZ A;  2ELK A;  2PZ9 A;  4EEF G;  2E19 A;  3HDD A;  1ORK A;  3E7L A;  4XRS G;  2G7L A;  1QPI A;  2WAQ N;  1MBJ A;  2G7S A;  3NXC A;  3PPB A;  1PUF A;  2RHA A;  1JUM A;  4ACI A;  1JUS A;  1U9N A;  1SGM A;  3CMY A;  4L62 A;  2YU9 J;  2DA6 A;  3HE0 A;  2CQX A;  2CJJ A;  2Q24 A;  2DA1 A;  2VI6 A;  2RAS A;  3BTI A;  1HLV A;  1IRZ A;  1IG7 A;  2EZK A;  3V6G A;  3BR5 A;  3Q0W A;  1BL0 A;  4D7N A;  1IV6 A;  1IGN A;  5K7F A;  3GTJ J;  3TP0 A;  3ANP A;  4RBO A;  4BBS J;  4JL3 A;  3G7R A;  2LFB A;  5IPA A;  3KKC A;  4JP0 A;  4I76 A;  3P9T A;  4BXX J;  3G1L A;  3S15 J;  1RET A;  3VVX A;  3I4M J;  2ZCX A;  4AF5 A;  2TRT A;  3NAU A;  5BNG A;  4DW6 A;  1JKQ C;  1BW6 A;  1Z0X A;  1A5J A;  2L7M P;  2COB A;  1MSE C;  5F0C A;  3F0C A;  4XRS A;  4X1E A;  4DZP A;  4HNV A;  3M3Y J;  1F43 A;  1WCM J;  2NOG A;  2YUS A;  4A3M J;  2LKX A;  4KWA A;  2IEK A;  1P7J A;  1Z77 A;  2P81 A;  5JLW A;  2XRL A;  2MSY A;  4NDL A;  2HOS A;  5C4Y A;  4C3J J;  1JUP A;  2R5Y B;  1B72 B;  2GFN A;  3ON4 A;  3BNI A;  3B6C A;  1B8I B;  4XRM A;  1ZR4 A;  2ZOY A;  3E7Q A;  3LSJ A;  5EG0 A;  1ETO A;  4MLO A;  3C07 A;  2UXO A;  5DAJ A;  1QVU A;  2JA8 J;  4NEL A;  3CRJ A;  4MFD A;  3O8H A;  2MGQ A;  4IHX A;  3IH4 A;  3ZQI A;  4JNN A;  2JA7 J;  2VPR A;  3ZQH A;  1ZTR A;  2GUH A;  1SAN A;  3PM1 A;  5EGO A;  3VPR A;  3GTL J;  2YVH A;  1GV5 A;  2OF7 A;  2HXO A;  3OIO A;  2EBI A;  2AHQ A;  4M6V A;  5J1Y A;  3K7A J;  5GPC A;  2G3B A;  2O9L A;  5E3L A;  4BY1 J;  3HOV J;  2RAE A;  2Y30 A;  3FRQ A;  4DYC A;  2F07 A;  1X2M A;  1MH4 A;  2CQQ A;  3HIM A;  5EFY A;  3VW0 A;  3CWR A;  2LR8 A;  3HM5 A;  3MNL A;  1ETX A;  1O4X A;  2O8K A;  3FK7 A;  4IHY A;  4G12 A;  3VOX A;  4LOC A;  2CRG A;  5F27 A;  2DMU A;  1H89 C;  1MSF C;  1WPK A;  4A3G J;  2PBX A;  3GTM J;  2L7F P;  2E2J J;  1NTC A;  2X9D A;  4V2G A;  4IHW A;  2REK A;  3NNR A;  4A93 J;  4ME9 A;  2IAI A;  1ETV A;  1CQT A;  2DA5 A;  4GFL A;  4V2F A;  1HF0 A;  2NVQ J;  4A3I J;  1HCR A;  5EG0 B;  2OER A;  2EZH A;  4FCY A;  3NPI A;  2LTP A;  5EF6 A;  2DMT A;  3VVZ A;  3JRA A;  1IJW C;  5D1R A;  3H3V K;  1ZQ3 P;  3ZQF A;  1FEX A;  2JMW A;  2NP5 A;  1GV2 A;  1DU0 A;  2E2I J;  3BG9 A;  2UXP A;  3EUP A;  1POG A;  4AUX A;  3BQZ A;  3S2D J;  1S7E A;  1JKO C;  4PXI A;  3D1N I;  5FHP A;  5J1R A;  5EEA A;  3JRD A;  4AC6 A;  2EZI A;  5EGO B;  3ZQG A;  1FJL A;  4A69 C;  2VUM J;  2CUF A;  1U9O A;  2IU5 A;  2G0E A;  3TW7 A;  4D5C A;  2JA5 J;  1ZGW A;  3JRH A;  2GEN A;  3S17 J;  4XK4 A;  1B8I A;  3VUQ A;  1ZK8 A;  5C44 J;  3CJD A;  4CGR A;  1FTT A;  4A3D J;  3VW2 A;  5J1U A;  2W48 A;  2TCT A;  4GFK A;  5FMP A;  2X6O A;  4XID A;  3HOY J;  1XS9 A;  5FKO A;  1RPW A;  2ECB A;  3FIS A;  3HTH A;  2FX0 A;  2OI8 A;  1FTZ A;  5HAW A;  1LE8 B;  4JX5 A;  3V78 A;  3L1P A;  1YRN A;  1I6H J;  3BCG A;  3JRI A;  3PO3 J;  5JLX A;  5C4X J;  2DA2 A;  4GCT A;  2QF7 A;  4JKZ A;  1K61 A;  3F1B A;  2E1O A;  3HGG A;  2EQR A;  3JRF A;  1GUU A;  2FQ4 A;  2E2H J;  3CQZ J;  2Y9Z A;  5FLV A;  3ZOB A;  4AYB N;  1MBE A;  1VI0 A;  1UI5 A;  3LJL A;  1OFC X;  2H1K A;  2NP3 A;  3B6A A;  2JK3 A;  1I50 J;  5F04 A;  3S16 J;  1TWH J;  3AQS A;  3HB9 A;  3HOZ J;  2HI3 A;  4BKX A;  3GTO J;  2FD5 A;  5IP9 J;  5E3M A;  5FLM J;  3A01 B;  1MH3 A;  3S1M J;  3HTI A;  5M5Y J;  3A02 A;  2XPV A;  3DEW A;  2DA3 A;  2ID3 A;  3BTL A;  4B1R A;  3GZI A;  2XB0 X;  1JTX A;  2HOA A;  4D7M A;  5F0F A;  1SFO J;  1X58 A;  3MN2 A;  4B4C A;  1ETQ A;  2CUE A;  2L9R A;  1P7I A;  1UHS A;  2GBY A;  3BT9 A;  3FKI J;  3IV5 A;  3DPJ A;  3IH2 A;  2NS7 A;  2NVX J;  3RD3 A;  4RDU A;  3QPS A;  5FJ8 J;  5IP7 J;  3K2A A;  3GTQ J;  3LHQ A;  2LK2 A;  3B81 A;  5F0H A;  1GVD A;  2XGD A;  3BG5 A;  2I10 A;  1YRN B;  2PMZ N;  2M0C A;  4AC0 A;  1ETK A;  4MFE A;  1BW5 A;  2XGC A;  3C2B A;  2Y31 A;  4MXM A;  5FKL A;  1FIA A;  4A3J J;  4BY7 J;  3S14 J;  2VKE A;  4IEJ A;  2DG8 A;  2MG4 A;  3BR6 A;  2EH3 A;  2N8G A;  4W1U A;  3VP5 A;  1T56 A;  4M3D A;  3NAR A;  1NK2 P;  3QBM A;  2AO9 A;  1XC5 A;  2DJN A;  2LP0 A;  2ZOZ A;  1ITY A;  3H0G J;  5F1J A;  3HOU J;  2R5Z B;  4A3L J;  2D6Y A;  2NVT J;  3KNW A;  2ME6 A;  4UUT A;  3ZQL A;  3IH3 A;  1JJ8 C;  2DMQ A;  5E3N A;  3JRC A;  1LE8 A;  2ZCN A;  5HBU A;  1QVT A;  4GCL A;  2G7G A;  3BHQ A;  1OJL A;  3S1N J;  3VW1 A;  1AKH A;  2Y9Y A;  2XB5 A;  3GBG A;  1HOM A;  5CW8 A;  2FBQ A;  3PAS A;  2Y0S N;  3KZ9 A;  1AU7 A;  3UKG A;  5K7Z A;  2ZCM A;  1BJZ A;  1D5Y A;  2XPW A;  4BBR J;  3OSF A;  3HKZ N;  1HDD C;  2HYT A;  3BR2 A;  3HEF A;  2M8G X;  1JTY A;  1MBF A;  5C4J J;  3NRG A;  5IOY A;  5FKN A;  1MBK A;  3G1M A;  5GP9 A;  5K7H A;  3KKD A;  2UXH A;  3VIB A;  2WGB A;  3SFI A;  2B63 J;  3COL A;  3A01 A;  1Y1V J;  5K58 A;  2NVY J;  1Q1V A;  3Q0U A;  4DYR A;  3TED A;  2XDN A;  4A3K J;  2GM4 A;  1WH7 A;  3S5R A;  5M5W J;  4A3B J;  3S1Q J;  2HYJ A;  2XPU A;  2UXU A;  3LSG A;  3TP3 A;  3WHB A;  1WI3 A;  1IUF A;  4W97 A;  5HOD A;  2W53 A;  2JA6 J;  3Q3S A;  9ANT A;  2WUI A;  4A3C J;  1I3Q J;  2O7O A;  4M3G A;  2HOT A;  3BRU A;  2CU7 A;  1G2H A;  3OSG A;  2V57 A;  2VKV A;  3VOK A;  4QSH A;  1E3O C;  4MIM A;  2QKO A;  2NS8 A;  2XSD C;  1APL C;  5D18 A;  3T6N A;  3GTP J;  3MKL A;  1TWG J;  5IOZ A;  5F08 A;  2D5V A;  2R93 J;  3M4O J;  1AHD P;  1X2N A;  1AKH B;  3G1O A;  3G56 A;  1RKW A;  1Y1W J;  4GCK A;  4MK6 A;  4M3B A;  3TW6 A;  1HDP A;  1F36 A;  1JGG A;  3A03 A;  3S1R J;  5DTD A;  3BTJ A;  5M5X J;  4QTR A;  3EGQ A;  4UUS A;  2DG7 A;  3HTJ A;  2DN0 A;  1QRY A;  2Y2Z A;  3MVP A;  3ON2 A;  3BR3 A;  1XG1 A;  3IUV A;  1K83 J;  2JWT A;  2R5Z A;  5EZH A;  1NK3 P;  3FK6 A;  1EF4 A;  4FIS A;  5CXI A;  1TC3 C;  2K9N A;  1JKR C;  3LSR A;  4GFB A;  3RKQ A;  3LSP A;  3HBL A;  2R7Z J;  1WH5 A;  2ID6 A;  3GEU A;  1OCP A;  5M3F J;  4A3F J;  2K9S A;  4D5F A;  5EDN A;  2L0K A;  1OCT C;  3WHC A;  2DA7 A;  3HOX J;  1U8B A;  2GLO A;  3RZD J;  1GDT A;  3JRG A;  1RR7 A;  1JT6 A;  3HTA A;  4ABZ A;  2OPT A;  4FE7 A;  1BA5 A;  4M3E A;  1JKP C;  4I6Z A;  1MBH A;  2HXI A;  4X6A J;  4J19 A;  5FKM A;  4C2M J;  2R0Q C;  2WV1 A;  3QPL A;  2R92 J;  1UMQ A;  3PO2 J;  2HKU A;  5DS9 A;  5H9T A;  1U78 A;  2QCO A;  2H8R A;  2ME0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...