3SDGA

Ethionamide boosters part 2: combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole ethr inhibitors.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
189
structure length
184
Chain Sequence
ELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ethionamide Boosters. 2. Combining Bioisosteric Replacement and Structure-Based Drug Design To Solve Pharmacokinetic Issues in a Series of Potent 1,2,4-Oxadiazole EthR Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
molecule keywords HTH-type transcriptional regulator EthR
total genus 77
structure length 184
sequence length 189
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3sdgA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3sdgA02
1B72A 1JKRC 4J19A 3BHQA 1BW6A 1MBEA 5FHPA 2DG7A 1IDZA 1ITYA 4ICHA 4M3BA 2WV1A 2TRTA 2XB5A 3G1LA 4DYRA 3VOXA 1K61A 4W1UA 2X48A 5EF6A 3I4MJ 2K9NA 5F08A 5J1YA 5C44J 3QKXA 2DMQA 1RKWA 2JA5J 1OCPA 3VPRA 1APLC 2QOPA 3C07A 4IHWA 1Y1VJ 3PASA 1MBGA 1NK2P 2K40A 1IUFA 5E3MA 2G3BA 1UI5A 1RESA 5D19A 1GVDA 5J1RA 4BBSJ 3RD3A 2NS8A 5EEAA 2L9RA 5FJ8J 3ON2A 1RPWA 1JTYA 5K7FA 2QTQA 3NPIA 4UUSB 4A3FJ 2R7ZJ 1QVUA 2L0KA 2WGBA 3LSJA 4A69C 1F43A 2CUEA 2K9SA 4JP0A 2G7GA 5FKKA 4UDSA 2HQ5A 4D5CA 3G7RA 2M9HA 3FK7A 4C3IJ 4QTRA 4NDLA 4S0HB 1HCRA 2IEKA 2FBQA 2EH3A 2O9LA 3CQZJ 2WAQN 3VVYA 2UXHA 3S16J 3FRQA 3RQIA 3HGYA 5GPCA 4FTHA 3TEDA 2DA7A 1UI6A 2JJ7A 4L62A 2EBIA 5JLWA 2KDZA 2QF7A 3S5RA 2W53A 2DMNA 3GTOJ 4ACIA 1ETYA 4MK6A 4A3DJ 4GFLA 2DA6A 1TC3C 1A5JA 1P7IA 4XK4A 2ZOZA 4A3LJ 3KKDA 1XG1A 2QWTA 1FIPA 1TWAJ 1E3OC 2ZCXA 4I76A 5EG0B 5F04A 1T56A 3GZIA 3JRDA 2CQXA 3F0CA 1MSFC 2M8GX 2XGEA 4DYQA 2UXPA 2ZCNA 2M34A 3QPLA 2DMPA 5M3FJ 1BJZA 1PUFA 1UHSA 5GP9A 3T6NA 2WUIA 4I6ZA 3BQYA 4B1RA 3EGQA 1AKHA 3Q3SA 2Y9YA 4W97A 1ETWA 3MN2A 3LOCA 3HTIA 3BTJA 3ZQFA 4DZPA 4GFKA 3PM1A 3S1NJ 4AUXA 3GTKJ 2K9QA 1U9NA 2MW8A 1I50J 5M5XJ 3ZQHA 1U8BA 4XIDA 3FKIJ 3HBLA 2HYJA 5EDNA 5FKLA 3HTJA 2FX0A 4JX6A 2R5ZA 1HDDC 9ANTA 5J3LA 2YUSA 3JRHA 3OSGA 2AO9A 2QIBA 2H1KA 3HTAA 3HIMA 2R5YA 1LFBA 1EF4A 1MBHA 3A03A 4FE7A 2VPRA 5CXGA 3LSPA 2TCTA 3LSRA 2LKXA 3I4NJ 3JRAA 3JRGA 4MFDA 1I3QJ 2ELKA 4A3JJ 1SGMA 1JKOC 3VW2A 4ME9A 5AQCA 2ECBA 2CQQA 1H88C 5DS9A 3O8GA 2LVSA 5D18A 2PZ9A 3IH4A 5BNGA 3GTPJ 5HSZA 3JRFA 3LNQA 2NVTJ 3COLA 1R9TJ 3B6AA 1H8AC 4BY7J 3BNIA 2LLKA 2NVXJ 4V2FA 1GV2A 1QPIA 3BR1A 2XGCA 4MLOA 2EZLA 2GENA 3RZDJ 1QRYA 4AYBN 3KNWA 2V57A 1OJLA 1XS9A 2MSYA 1SFOJ 2W48A 3L1PA 4L5EA 2MGQA 3G1MA 3VVZA 5J1UA 3IUVA 3HOWJ 1MH4A 4RDUA 1JJ6C 2JA8J 4A3KJ 2ME6A 3HOXJ 1MH3A 2G7SA 3JRIA 5H9TA 2LY9A 4A3BJ 4G12A 2D6YA 1QVTA 3ON4A 5CXIA 4XICA 1FTZA 4JKZA 5IOZA 1ZK8A 2CU7A 3S14J 1DU6A 1B8IA 2LTPA 4JX5A 1GT0C 3KZ9A 1JUMA 2RHAA 1T33A 3OOUA 2COBA 3Q0UA 5IP9J 1FIAA 3GTJJ 3SJMA 4M3EA 5FMPA 3Q0WA 2NS7A 4M6VA 1LE8A 2EZKA 3AQSA 1ETQA 1IRZA 2OI8A 2LK2A 2HI3A 2PBXA 3VW0A 5JLXA 2LFBA 2M2EA 2ZB9A 4C2MJ 1UMQA 3GBGA 2IAIA 2XB0X 4Y7NJ 3Q0VA 4AC6A 5C3EJ 2O7TA 3WHCA 2OF7A 4CYCA 5F0HA 4FISA 5IOYA 2R5ZB 3CCYA 1ZQ3P 5HODA 2DTZA 1GDTA 3NAUA 4IHVA 2NOGA 1K83J 2HOTA 3BJBA 2LD5A 2VKEA 2E2IJ 1P7JA 4A3MJ 1U78A 1JJ8C 1W0TA 2XSDC 3HM5A 2HKUA 2N8GA 5IYCJ 4A3GJ 3S15J 2GFNA 1UG2A 2D5VA 5FKOA 3A01B 3GEUA 1S7EA 3FK6A 2IBDA 2ID3A 2JK3A 2L7ZA 1ETVA 3MVPA 5C4YA 4M3FA 2JA6J 4MXMA 2ID6A 4NELA 3LWJA 4NN1A 3BCGA 3BR3A 1IG7A 5D1RA 4A93J 4QSHA 4LOCA 3S17J 4IHXA 1ZGWA 4DZJA 2I10A 1AKHB 2F07A 3M3YJ 4C3JJ 4CGRA 4BXXJ 2XDNA 3BR2A 1HF0A 2R93J 3NNRA 4DYCA 2R0QC 2VI6A 3A01A 1JGGA 2Y2ZA 1TWCJ 3OSFA 1PUFB 5K7HA 3HTHA 5EZGA 2E2HJ 2HDDA 4CYCB 2H8RA 2O8KA 1JT6A 3BG5A 1H89C 2ZOYA 4AF5A 5EG0A 5EYRA 1RKTA 3CRJA 3BTLA 3HDDA 4HKUA 3BG3A 3HOYJ 1O4XA 5IP7J 1LE8B 3EUPA 2DA5A 1AU7A 3F1BA 2OPTA 3K2AA 4XRMA 3SFIA 2R92J 3VW1A 4AC0A 1ENHA 2PMZN 5HBUA 3H0GJ 4D7NA 3UKGA 1JUPA 1W0UA 1MSEC 5F0CA 3BR5A 2YU9J 1CQTA 4ABZA 3TW7A 2E19A 1FEXA 4BY1J 2GUHA 2DMUA 2VUMJ 3ZQGA 3HGGA 3LHQA 3BR0A 1VI0A 2AHQA 3HEFA 4UUSA 3QBMA 2REKA 3BRUA 4A3CJ 3IV5A 4RBOA 3C2BA 3RZOJ 3JRBA 4GFBA 4X6AJ 5M5YJ 1WH7A 3JR9A 3GTMJ 3VVXA 1NTCA 3QQAA 5K7ZA 3A02A 3M4OJ 1I6HJ 1ZTRA 4MFEA 2XPUA 4JYKA 4M3GA 3P9TA 1VFCA 3PO3J 2P81A 1A6IA 5CW8A 1JKQC 4JL3A 2Y0SN 2UXIA 1HOMA 4A3EJ 1IDYA 3FIWA 4GCKA 5EZHA 1IGNA 2ME0A 2NP5A 2XGDA 1Q1VA 3TW6A 2DA1A 5C4XJ 1IV6A 1X2NA 2HYTA 1B72B 3G56A 2HXIA 5F27A 4B4CA 4XRSA 3GTLJ 2QKOA 2CRGA 2LP0A 4UUTA 3S2HJ 5FLVA 2DA4A 4BKXA 5E3OA 2EQRA 3DCFA 1ZR2A 3ZQCA 1YRNB 3NRGA 2DG8A 4YZEA 4GCLA 3NXCA 4PXIA 2E2JJ 4A3IJ 3BTIA 2JWTA 1ZR4A 2X9DA 1TWGJ 4IHYA 1MBKA 3PPBA 3CDLA 1LFUP 3IH2A 1FTTA 4KWAA 2NVYJ 4QIWN 3TP3A 1MNMC 2B63J 4FCYA 3WHBA 2QCOA 2Q24A 2JN6A 1MBFA 3BQZA 3S1QJ 2NP3A 1YRNA 3W6VA 5IP6A 5M3MJ 1D5YA 2CUFA 1WPKA 3CWRA 1BA5A 1SANA 3O8HA 5EGOA 2NVQJ 3CJDA 1JKPC 3BT9A 1WCMJ 4V2GA 4BBRJ 3S1RJ 2YVEA 1HLVA 3VIBA 2L7MP 2VKVA 2DJNA 3ANGA 3VUQA 2X6OA 2HOAA 3HB9A 2ZCMA 1X58A 3OIOA 2IU5A 5HAWA 2XRLA 5FLMJ 5EFYA 3G1OA 2L7FP 5C4JJ 3RKQA 5F1JA 3HE0A 2CJJA 3ZQIA 3HOZJ 4B3AA 2NX4A 3K7AJ 1XC5A 2XPWA 1ZKGA 3ZOBA 3PO2J 3RH2A 2DN0A 5DTDA 1JTXA 2FQ4A 1ETXA 1Y1WJ 3S1MJ 2OERA 2DMTA 1BW5A 1B8IB 4Y52J 3FISA 3HOVJ 5E3LA 4D5FA 3HKZN 2MG4A 3MNLA 5FGLA 1BL0A 1VNDA 1Z0XA 2Y30A 2YVHA 5K58A 4EEFG 2GM4A 1X2MA 2YS9A 1OFCX 1GV5A 1WGXA 4X1EA 3V78A 2HXOA 3E7LA 5DAJA 2FD5A 5F0FA 3QPSA 1ETKA 2O7OA 1G2HA 1RETA 3MKLA 2EZIA 3DPJA 2JA7J 3E7QA 2Y9ZA 4D7MA 1NK3P 2GBYA 1VF9A 1OCTC 3B6CA 5IPAA 3VP5A 1WI3A 3SDGA 1TWFJ 4MIMA 1Z77A 5FKMA 4FE4A 4C3HJ 3BTCA 1U9OA 2ECCA 1DU0A 2RAEA 3JRCA 2HOSA 5FKNA 3TP0A 1TWHJ 2RASA 3B81A 2KT0A 1MBJA 4HNVA 3NARA 2E1OA 3D1NI 3HOUJ 3ANPA 1F36A 3LJLA 2DA2A 3IH3A 1ETOA 5IYDJ 2WB1N 2LR8A 5E3NA 3H3VK 2JMWA 1POGA 2R5YB 3S2DJ 1AHDP 1HDPA 5EGOB 3O60A 4JNNA 4MO7A 4DW6A 2FJ1A 4JX4A 4XRSG 3ZQLA 1IJWC 1ORKA 1FJLA 3DEWA 3V6GA 5M5WJ 5GPAA 2G0EA 1JT0A 3KKCA 1GUUA 2XPVA 3NI7A 1RR7A 3AQTA 5IYBJ 2DA3A 1IC8A 2M0CA 3BG9A 3JREA 3JSJA 3LSGA 4M3DA 2G7LA 2EZHA 3GTGJ 2UXUA 3GTQJ 3VOKA 2Y31A 2UXOA 4IEJA 4GCTA 1JUSA 2GLOA 1WH5A 3CMYA 3BR6A
chains in the Genus database with same CATH superfamily
1HQCA 1FBSA 1ZGJA 5HS9A 3CO6C 1IDZA 2G7HA 1VZ0A 2WAEA 3E6DA 4RAGA 4M3BA 4Z6YA 3T1BA 2XB5A 2ZXHA 3KIOA 2E1MC 2MYSA 5CVIA 1VQNI 4GYGA 1OCRH 1E3PA 3HRSA 1RKWA 2LSOA 1OCPA 3F3XA 5KAFC 3E5UA 3KFWX 2LDUA 1MBGA 4YFXF 2EIJH 4HZFA 3F72A 4XRFA 5E3MA 1UI5A 5D19A 2YX7A 1U0JA 4B8XA 1T95A 3CUQC 1JTYA 3CJTB 5K7FA 2QTQA 1A31A 5K5OA 2GA1A 3LSJA 1OYYA 2DDBA 1R4MB 2XAUA 3P9CA 4GDFA 4AYBA 4D5CA 1WZ2A 4QTRA 2OQRA 4NDLA 4XL9A 4P9UA 1FBQA 3QPTA 3A0BC 3R60A 5GAGJ 3ABKH 3ROUA 3T0YA 2HEOA 2CSOA 2CV2A 2R7DA 5HNFA 2UXHA 3VVYA 3BOQA 3MMYB 3JSPA 3COAC 1D1BA 1R6RA 5E1WA 3HGYA 4EJVA 1U5TA 3TEDA 2H27A 4CCLA 3H5AA 3KPHA 2YX4A 1YS7A 5F6FA 3CCUI 2VQGA 3DBHB 2VE9A 4A0YA 4MGRA 2W53A 1FY7A 1XD7A 2XVCA 3VWBA 3P5JA 1JXSA 1FYLA 2DA6A 2HYFA 2ZOZA 3A2KA 2WAFA 4L5IA 4IRGA 2Y48A 2EV0A 3WG9A 2ISZA 4AVZA 3JRDA 3F0CA 2XGEA 3W2VA 4EJWA 2M34A 2UXPA 4H4KC 2I5UA 3K2ZA 1PUFA 1BOAA 3C2HA 4I6ZA 1S3JA 4BACA 1W36C 2KRHA 4M73A 2R3SA 2ZXIA 4W97A 1I3AA 3LOCA 3ZQFA 1X3UA 3M1EA 4DNCA 3RIRA 2K9QA 2VJ5A 4RB3C 4N0BA 5BQTA 1TW2A 4L18B 3GUDA 1HSJA 2ZSHB 3ZQHA 2HTSA 2FEZA 3ERMA 1BM9A 2ZXJA 3HRMA 5D6EA 2AO9A 2QIBA 2KRFA 3HTAA 4KFCA 3L9FA 3ELKA 3GWZA 1MBHA 1D3YA 2IGOA 1XPXA 2STTA 3OL3A 4M9SA 4PSWA 3ULQB 3LSRA 4BS9A 1SGMA 3JRAA 4MFDA 2ELKA 4G9YA 3HIFA 2DQRA 4XORA 2XAHA 2K85A 2M3AA 2EV6A 5AQCA 2D2WA 1Y6IA 2CQQA 1H88C 2CFOA 3O8GA 1V55H 3BJAA 5D18A 4EJTA 3E6MA 1YX5A 3KYDB 5HSZA 3JAMZ 2NVTJ 4ZDOA 2Y0MA 1R9TJ 4V2FA 1GV2A 3OYFA 2RGVA 3BR1A 1X1BA 2XF6A 1I6XA 3DLAA 4AYBN 4U7DA 2H94A 2IS2A 2FNAA 4IOCF 1ZG3A 1SFOJ 3FHNA 2A2FX 2O61A 2AS5F 5E79C 4L5EA 4ZJZA 1SEUA 3F8BA 3IUVA 2MBFA 3PIPF 3HTSB 1R00A 1MDMA 2EFWA 2L5QA 1JJ6C 1GVJA 2ME6A 2DFHA 3HOXJ 1QNTA 2GAUA 2ESHA 3TDZC 2JUGA 1QVTA 3HPHA 4AIKA 4XICA 5IOZA 2STWA 1DU6A 5LEKA 4P5OA 2LTPA 2LY2A 2V1NA 4JX5A 3VB2A 3OYLA 2DPUA 2C6YA 3KZ9A 1LJ9A 2K4BA 4HQEA 3W2AA 5IP9J 2RV8A 4M3EA 3P7NA 5FMPA 3Q0WA 2XDVA 2VODA 2EZKA 3GYHX 2BY1A 1IRZA 4YIFA 2HI3A 3WG7H 5JLXA 2WB1A 3HUGB 2M2EA 2ZB9A 4C2MJ 5J8FA 3CC7I 3U1KA 3L2VA 1TW3A 2XB0X 1MGTA 3H1CA 1HKTA 3HSEA 2OF7A 2CQNA 3K1NA 4ZTFA 2UUZA 5HLTA 1LEAA 2ZO4A 4IHVA 1K83J 3KZIC 3MAJA 1PP8F 1P7JA 3H35A 4A3MJ 1MZBA 1W0TA 5IYCJ 3CMEI 3S15J 3BROA 3BJOA 3W6JB 3RSNA 2FQ3A 1MMGA 3GEUA 3FK6A 1FBUA 1OCOH 2CG4A 2Q1ZB 1XGOA 2HOEA 1IRFA 4CXFA 2EJRA 1VQLI 1N75A 2Y75A 4U87A 4QSHA 1MMSA 4B3XA 5HOOA 2QQAA 1A04A 1AKHB 2UZKA 2XDNA 4DYCA 1R1UA 1JGGA 2Y69H 4XM3A 2VBWA 2FU4A 3DXJF 1PUFB 1S29A 3DP7A 3HTHA 5EZGA 2VIXA 2E2HJ 2R4GA 4CH7A 5KNLA 1JT6A 3BG5A 4RB2C 2F5VA 4AF5A 1VQ7I 3OIPA 5EYRA 5D5UB 1FLIA 3BTLA 1P9QC 1QPMA 2RKHA 1BBYA 4F91B 5HLIA 2IA2A 3FBNB 5IP7J 2P6TA 3ABMH 3E97A 4I99C 4RMNA 3VYUB 4BE0A 3EUPA 2Z9OA 2XV4S 1R49A 4M71A 3QYEA 2KPMA 1HA8A 4KITB 2M4KA 3FMQA 1OCZH 2P6SA 2R92J 3D5LA 2CQ7A 2HWVA 4AC0A 4ANJA 4BH9A 2AQFA 1LFPA 2G9WA 3HSRA 3OIQA 4OD4A 1UJ8A 1Y0NA 3BR5A 3MFKA 1WKMA 4ABZA 1CQTA 2E19A 4BY1J 4IOAF 3WTXC 3LHQA 3BR0A 1G3YA 2AHQA 3HEFA 4AIDA 4BJTA 3QBMA 3BRUA 3ZP5A 3DWLE 2Q8KA 4NC8A 4RBOA 3PL8A 2BY0A 3J7ZI 3JRBA 4GFBA 3RZOJ 1P4AA 3JR9A 3ZGKA 3VVXA 2AQEA 5IT9K 2CYYA 5K7ZA 3M4OJ 3PSIA 1I6HJ 1ZTRA 1YI2I 2PQ8A 1FYMA 2QBYA 3C1DA 3ZMDA 2XPUA 3OYEA 4A12A 1RRJA 3EUAA 2OZ6A 3DTKA 4M3GA 1ZARA 3OL4A 3BG7A 5B3SH 4BXFA 2KISA 2VJIA 2Y0SN 4LB5A 2COMA 1FSHA 4LG0A 2GIVA 1IGNA 1QZEA 1DPRA 3M07A 1Q1VA 3TW6A 3V4GA 5C4XJ 1IV6A 1B72B 4E4HA 1TBXA 3CO7C 4ZYDA 2QLZA 4CCKA 2CRGA 2IS6A 2XRNA 3KETA 4UUTA 3S2HJ 2YU3A 5E3OA 2EQRA 3DCFA 5FD6A 5HS7A 1MJAA 1Z1DA 2NXNB 2EINH 2QQ8A 1A35A 1D0YA 4HW0A 2H8WA 1I27A 1X1AA 2M8EA 3K8PC 2M7AA 1IN8A 4XR6A 2JVGA 2E2JJ 1PVEA 4PXIA 1UHWA 2DXIA 4IHYA 1MBKA 3H5RA 2CGPA 1LVKA 4RA2A 3OYDA 1N78A 3L2QA 2DFEA 2B63J 3VYTB 3WHBA 1MBFA 3BQZA 2NP3A 2HYGD 2VXDA 1QA6A 3W6VA 1ZYRF 3F8CA 3IWFA 4OAYA 5CVVA 1I5ZA 4MHGA 2NNYA 3FXRA 1YTYA 1YLFA 3OYIA 4Y13A 2BV6A 3CWRA 1BA5A 1FZPB 3BZKA 3PQKA 5EGOA 2NVQJ 1JKPC 3BT9A 2CV0A 1O7LA 3S1RJ 3H92A 1K4TA 3ZXSA 3CP8A 3CLOA 5JVTA 4MTDA 4WWCA 2X6OA 1W5CC 1JE8A 4UVCA 2X6WA 3LA3A 4YIIA 4BXUA 5HAWA 3CDHA 2WWYA 3HE0A 2JSCA 3T5XA 1S9HA 4CCMA 2NX4A 1ZKGA 2ZXWH 3L2UA 2DN0A 3CCQI 1Z67A 1Y1WJ 1KU9A 1R5ID 3FXOA 1X3WB 1R4NB 1W5TA 2QBYB 1VQMI 5KHDA 1YW7A 1RIOH 4RM2A 2MG4A 4L9TA 1W36D 5FGLA 2XASA 2CFXA 1VNDA 3QODA 3L2RA 2LF7A 2YS9A 1OFCX 3V78A 4M72A 5D5XB 4D9JA 1OCCH 5H6RA 2OAZA 4X0GA 4ETSA 4OWRB 2FD5A 5J40A 5CQGA 2EZIA 3DPJA 3S93A 2H6CA 4PJMA 4YFNF 2LOOA 1OCTC 3B6CA 2M4GA 3J81Z 3I56I 1TWFJ 5ILVA 1EH6A 2JA2A 2ZBKA 4FE4A 4O5VA 2TDXA 5FKNA 2HVSA 2RASA 1G6NA 2KT0A 4XLPF 3B81A 4HNVA 3CESA 1F36A 1ETOA 4HV5A 2QUFA 4NC7A 5FO5A 1ZG1A 5DV5A 1POGA 1AHDP 1HDPA 3RDIA 4MO7A 4XRSG 1XSVA 1IJWC 3VTIA 4UUVA 2RQQA 2Z33A 3MCZA 5GPAA 4IPAA 4NQWA 3K1PA 2G0EA 3DV8A 4XN3A 2AXTC 2A61A 3CUQA 4NC6A 3FXQA 2VKDA 1IC8A 2P5VA 2DQLA 1HW5A 4EGYA 3VDXA 3U1DA 2VB6A 2UXUA 1J0RA 3DEEA 3M8JA 1V5FA 3ML6A 4IEJA 4CO8A 3K4NA 3IL2A 3DEUA 2GLOA 3FMSA 1F4KA 3VODA 1JKRC 1E17A 5FHPA 1S8NA 2HZTA 2Q2EA 2R7OA 1ITYA 3K6GA 2WV1A 4DYRA 2VE8A 3M9AA 4YRVA 3AL0B 1K61A 2HKOA 2RREA 2XSJC 1DGWY 4EM1A 5EF6A 2D1VA 3I4MJ 1J09A 5F08A 4Y33A 2FUG2 3ABLH 5C44J 4LITA 2FJI1 2XF5A 4LJZF 3SEQA 3VPRA 5ICGA 1YW9A 3C07A 3LSIA 4I09A 3PASA 1PYVA 1IUFA 2K40A 5HDKA 2G3BA 3I58A 2HQRA 3GVAA 5H20A 1GVDA 2V4JC 3IP4B 5EEAA 2L9RA 4E7JA 1XMAA 1FC3A 1IF1A 3NPIA 1VQ5I 4ENKA 4A3FJ 2L0KA 1F43A 2K9SA 4JP0A 5L3BA 3O3KA 2G7GA 4UDSA 2HQ5A 4WCGA 2P8TA 3G7RA 2KHMA 3OS2A 1AOYA 1S7AA 2HQNA 3EQLF 4S0HB 1R7JA 2FBQA 2CW7A 2DTRA 3RTRA 3H3ZA 2EH3A 2O9LA 4DQ2A 2DPDA 4HRIA 1H9GA 1EH7A 5AIQA 3ZQ7A 3RQIA 5GPCA 1TLHB 2ETHA 2BHZA 4XQFA 2DA7A 3DTIA 4E7ZA 1YYVA 2RN7A 1UI6A 2JJ7A 1MMAA 4RGSA 3L2CA 3MKWB 1KQ9A 3OV8A 4HX4A 3ZMUA 1OYWA 5JLWA 2KDZA 4PGHA 3GZ5A 3QOPA 3S32A 3S5RA 3MEXA 5CYVA 4Y17A 2DMNA 1ETYA 2DI3A 2O03A 3M1CA 1IV8A 2FBKA 4A3LJ 1XG1A 1WI9A 1FIPA 2IA0A 2GIZA 2Q2EB 4IF4A 3EUHA 5F04A 1T56A 3QAHA 1F1ZA 4KT5C 2DMPA 3AG2H 5M3FJ 3A1YA 5BOXA 1UHSA 1KGSA 4JK1X 3MWMA 4B1RA 2A3SA 2V1XA 3WTWC 1Z9CA 2GXBA 2Y9YA 3KEQA 4BEHA 3KP5A 3REOA 1V3FA 2BW3B 1MNEA 3OYBA 4GFKA 4AUXA 3OYKA 4BAYA 4OIRF 4XN0A 3SHFA 3AAFA 3E6CC 2X4HA 1LKXA 2VC0A 3AFHA 3W6KB 1T8IA 3FKIJ 1XCVA 2W00A 2LY1A 2HYJA 1B9NA 3BZ6A 2OD5A 5EDNA 3HTJA 2IW5A 5E20A 4I7HA 1WJCA 3OSGA 1T08B 4HEA2 3T8TA 4A0XA 2OCEA 2H1KA 5BS6A 2EWNA 4A6EA 4BNCA 5D5VB 3BY6A 1TQMA 3I4PA 1EF4A 4M6XA 3WGIA 2YVXA 4FE7A 2A6EF 5D5WB 3LSPA 5J6XA 2LKXA 3S3NA 1BI3A 1I3QJ 2YSRA 2IGMA 1UZCA 3K69A 1FP2A 4A3JJ 1TQPA 1JKOC 1X1PA 2PLYA 2LBFB 3CC2I 4YIRX 2CS3A 3J80K 4OIQF 2E35A 2LVSA 2E7XA 1J59A 4L0ZB 2A6HF 3JRFA 3FBIB 3COLA 3B6AA 3HOTA 1H8AC 4BY7J 4CCNA 3BNIA 1R22A 1QPIA 1QHHD 4MLOA 2EZLA 2GA2A 3P9KA 5KCMA 1QRYA 2PI0A 2LMDA 2P0WA 1XGSA 3DBLB 1XS9A 4FX4A 5FB2A 3IAS2 3VVZA 3FM3A 3ERED 2JRTA 3OYGA 3EYIA 4G8XA 4ZYGA 4A3KJ 2JA8J 2OC6A 3ECOA 1MH3A 2G7SA 2CUZA 1SD7A 3PNVA 4U7BA 5H9TA 2DK8A 4U0VA 4P9FA 4A3BJ 1T39A 4C9YA 3M7GA 3OS0A 2D6YA 3ON4A 1WFXA 3WE2A 1FTZA 5CXIA 5E17F 2FNPA 3H5NA 2ZSIB 3KEYA 1CGPA 1B8IA 1KYWA 3I53A 2RHAA 1R23A 2ELJA 3EYYA 3GO5A 2E71A 3FM5A 3Q0UA 1FIAA 3GTJJ 3SJMA 3AQSA 3N4MA 3AG1H 4HX7A 1FMWA 4CSWA 4G6TB 2Z99A 2QENA 3KP6A 3VW0A 3EDPA 2LFBA 3W2WA 1UMQA 1B9MA 2IAIA 2JT1A 2L9VA 3OR2C 4N9IA 4Y7NJ 3HOSA 4CYCA 4OINF 2R5ZB 3HHHA 1ZQ3P 4HV6A 5HODA 2DTZA 1DGRM 3NAUA 4HAMA 2NOGA 4XMYA 3FMRA 4RLFA 2EIMH 5DCMB 2HKUA 2AXLA 3VSKA 3HRUA 1T6SA 1MMDA 2VONA 4A3GJ 2MC3A 2QM3A 4ESFA 4E70A 2D5VA 1S7EA 2X1DA 3LAJA 2R7UA 2VT2A 1XN7A 3MVPA 3EPZA 4M3FA 4DOZA 3NS4A 4XKCA 3V8LA 5AIPA 3S2WA 3QWLA 4HSTA 3BCGA 3GF2A 2R7WA 4OIOF 5D1RA 2WY8Q 1YS6A 2ZJQF 3BJ6A 5KVRA 1ZGWA 4DZJA 3M3YJ 4C3JJ 4BXXJ 3FXLA 3BR2A 2VI6A 3I64A 5IT3A 2Y2ZA 1TWCJ 1DP3A 4XKVA 1YJWI 2DU9A 2E36A 2H8RA 1K78A 2DK5A 3JAMK 5DDGA 4HDUA 2OQGA 2M1BA 4HKUA 4IVNA 4OAZA 1LNWA 3BG3A 2E7WA 2HFHA 2QA4I 2DYRH 3DPTA 1RUOA 1IN4A 2GZWA 2JRMA 3K2AA 4XRMA 2X1EA 4PCQA 1O3QA 3QYBA 2IGNA 3E1SA 3H0GJ 4D7NA 3UKGA 4B48A 1JUPA 2CO5A 4XOTA 3BPXA 4BQNA 4HDVA 3LWFA 3GFMA 4K2EA 3TBIA 1FEXA 2KP6A 2GWRA 2G7UA 3HGGA 3ZQQA 4A0ZA 1ON2A 1VI0A 4BUPA 3LSTA 4UUSA 4AVPA 2REKA 2OJED 4P1WA 4BGDA 4E7KA 4AM3A 1PJRA 3PJRA 5LHGA 3FF5A 4X6AJ 3MZ8A 3GTMJ 3FXUA 3QP5A 1XMKA 2ZJPF 2XAJA 5FFXA 3PO3J 4Y3OA 3SZTA 1VQOI 3WTVC 4G6QA 5CW8A 5ICEA 2XGXA 1HOMA 3SXYA 4KJZA 3CD6I 2VOOA 2L02A 4U0YA 2OZUA 4HBLA 1E3HA 2B9SA 1REPC 2VC1A 2XGDA 3T8RA 3G56A 2HXIA 4ITVA 3TO9A 4B4CA 4EJUA 4XRSA 2V6CA 1W5SA 5LLQA 5FLVA 2K3PA 3HPGA 2X1CA 2DA4A 4BKXA 3NRGA 2WAQA 1ZR2A 1GHCA 2XAQA 3AG4H 3K9TA 2R7XA 3TDUC 2JVHA 4A5MA 3RKWA 2IVMA 3BTIA 2JWTA 4E7LA 1TWGJ 1BOBA 1XTAA 4RB0A 4BYYA 2DODA 1KYZA 3PPBA 3C3WA 1XDUA 3IH2A 1FTTA 1O7FA 3VEPA 3SWHA 2NVYJ 1FOKA 2DDAA 3IKVA 3QU3A 2M0MA 3G3ZA 1MNMC 5D8KB 4FCYA 1ZRDA 3DFGA 2JPBA 4J01A 1X4PA 2FA5A 1I1SA 1KQ8A 2JN6A 2CW8A 2X85A 2E1NA 1QGPA 1W1WE 1X19A 2XAFA 2HNHA 5M3MJ 3MZYA 2CUFA 4LLLA 2OUMA 5DEQA 1WJDA 4YFKF 3W3CA 3ASOH 2JPCA 3GFJA 3G73A 1ZH5A 3CJDA 1MNDA 3F8NA 1P2FA 3WODF 2LF8A 4BBRJ 2YVEA 4QPOA 1HLVA 1SD6A 1Z7UA 3VIBA 1S6LA 5B1BH 2W82A 4RGUA 2IA1A 3ANGA 3VUQA 3OIOA 4Y15A 3SDBA 3FXKA 3PSFA 2X6XA 2XRLA 2EILH 5FLMJ 3SZGA 2DFIA 2L7FP 4R79A 3RKQA 1VQ4I 5L3FA 2L54A 1ZLJA 3TGNA 3K7AJ 4G6DA 4CUGA 2LREA 3ZOBA 3PO2J 1YFHA 5DTDA 3RH2A 1JTXA 5BMZA 4Q5SF 2FQ4A 4A6DA 3S1MJ 1DUXC 3QYFA 1BW5A 3S3MA 3LSMA 5E3LA 4D5FA 2BXZA 3DKWA 1SD4A 2BHYA 2BY3A 4BE1A 5FGMA 4KISA 2DT5A 3MNLA 4HNTA 2O5RA 1Z0XA 2Y30A 2F5FA 1D1CA 2OU2A 2FF4A 1KZHA 4EEFG 5K58A 1UCRA 3UR3C 5DAJA 2ZKZA 1BR4A 4CZZA 4UV8A 4IQJA 2PJRB 3QPSA 1ETKA 3X2QH 3S3OA 1RETA 3MKLA 3FX3A 1Z3XA 2ZY9A 3KLNA 3CCVI 1TNSA 3L2WA 1TT0A 1VF9A 1BR2A 2LNBA 2VQCA 4EGZA 2MLGA 3SDGA 1PP7U 3R61A 2MH2A 4IXAA 4FETA 4C3HJ 2ECCA 4MQVA 1DU0A 2RAEA 3CF5F 5HNHA 5J4YA 2HU9A 2QQBA 1MBJA 3C7JA 4MNUA 3KX2A 3HOUJ 3ANPA 2GOXB 2F48A 2DA2A 1XMXA 3IH3A 3A0HC 2F6CA 2M30A 1XCBA 4RAZA 5DCFA 5E3NA 4Q4ZF 3H3VK 3PFYA 1FOYA 3O60A 3CCSI 4JX4A 1TL8A 1FT9A 4R8HA 1ORKA 1J2XA 1O57A 1B59A 3GW2A 1LDKB 3DLLF 1V54H 1GUUA 1YX3A 4EVIA 1X3ZB 1EA3A 1L0OC 2DBBA 4WK8F 1NHAA 2IJLA 3NI7A 1RR7A 2MA3A 2DA3A 4ON0A 2VL8A 1IN6A 2NVUB 4RAFA 4QLCU 4WIBA 2WA0A 3JREA 3LSGA 3L00A 4M3DA 2G7LA 2EZHA 4DBQA 3GTQJ 3VOKA 2Y31A 4BE2A 3L7WA 4KMFA 2KJBA 4JQFA 5F1RA 2D1HA 4M74A 5IT9Z 4ZDLA 2N8GA 3CMYA 1B72A 5J4VA 3BHQA 4J19A 1BW6A 1Z6TA 2MH9A 3EUKL 5JR3A 3GMEA 1HSTA 1USSA 2ZNYA 3SFZA 4L5JA 4LG0B 2DO7A 2DT7B 1E2XA 1NH3A 2QYOA 5CVJA 2R7VA 1IXCA 3BCAA 3E5QA 2NOJB 4D0PA 4W1UA 3R0JA 2K9NA 3MQ0A 4FASD 3I59B 2VJJA 5J1YA 1H0MA 1KQ0A 3MZHA 2A69F 2R7SA 4AD9A 3J7YJ 1APLC 4FQGA 4B43A 4DJAA 3DKYA 4NNJA 3I3LA 5J1RA 4BBSJ 2DOEA 2NS8A 5FROA 5FJ8J 3ON2A 4A5NA 2J5PA 4BQOA 2VKHA 2R7ZJ 4QPQA 1T98A 4A69C 4LLNA 2CUEA 3ZMTA 4P96A 2EFPA 3KZYA 1FOWA 2W25A 3FK7A 3LSKA 1HCRA 2IEKA 2R7TA 3M8FA 1LEBA 1EH8A 1R1VA 3S16J 3U2RA 2VLAA 2YR2A 1S7OA 2IRFG 4G7OF 1YHQI 2GQQA 4N4NB 3VFZA 5HS8A 2BY2A 4PK4A 2Z16A 1IAWA 4ZH4F 4F92B 2BOLA 1PUEE 3FWEA 4ZZDA 2GXAA 2EBIA 1TT5B 1M1EB 1OISA 2EPFA 4HA8A 5CVUA 2KZGA 5L3CA 1BI2A 2Y0SA 1YITI 4IJAA 1B6AA 4MK6A 3RYRA 4A3DJ 5GAEJ 2DYSH 1A5JA 3KKDA 3NEUA 3BC8A 1TWAJ 1E3OC 4I76A 2ZFUA 3QP6A 2HGCA 2CQXA 3IKTA 3RI4A 2M8GX 3DPLC 4DYQA 1MSFC 2ZCNA 3QPLA 2PMUA 1BJZA 2KIUA 2MFZA 4C30A 2W57A 2XKPA 4LMYA 5GP9A 3T6NA 3CUOA 3BQYA 2IS4A 1YO5C 1AKHA 3Q3SA 1OKRA 2KRCA 3HTIA 2VBZA 4Y4RA 4CDGA 1D5VA 3PM1A 3S1NJ 1V4RA 2VOPA 2HS5A 2DT6A 2RNJA 4BEHB 4NBQA 1ZAOA 5M5XJ 3CC4I 2CMPA 3HTUA 4XIDA 3HBLA 3LQRA 5E8IA 4JX6A 5GADJ 3HL2A 1JGSA 2A6TA 1HDDC 2RNGA 5J3LA 1SFEA 5H6QA 3OS1A 2V9KA 2BVLA 2A5WA 3A03A 1QO0D 5CXGA 2TCTA 4G7HF 3D0SA 4UB6C 3B73A 2KIMA 5CVRA 4H0EA 3KP7A 2K27A 1UELB 2L4AA 3FXMA 2BZTA 4LLGF 4ME9A 3VW2A 1RUNA 3CCLI 1P92A 5CLSA 1KU2A 2ECBA 2ZJ2A 3EUHC 3KLOA 1FMVA 2XC7A 3FHZA 3IH4A 1XX5A 2NNNA 3LNQA 1P4WA 3QPHA 5FD5A 5H2FC 5EEHA 3K4CA 2XGCA 2GENA 5GTHC 4QWQA 3H3UA 4B44A 1OJLA 1MW7A 4MEXF 5DM7F 1R5HA 2A05A 2W48A 3HKZA 3L1PA 1VQPI 2MGQA 4RGRA 1JHHA 1SAXA 2RQPA 2X6YA 3ISPA 5KK1A 5ICCA 1Y39A 3HOWJ 1MH4A 4RDUA 1Y56A 4BHBA 2E5NA 4HF2A 2EB7A 4OOIA 3JRIA 3KE2A 1WJFA 2LY9A 4UXNA 5B5EC 2F5CA 4O3MA 2OV7A 1RC9A 4Z2YA 1STZA 3SYTA 3S14J 5A2QZ 1UB9A 1XSDA 2HVQA 2VBXA 4DVYP 3D5SC 1JUMA 2RC4A 3UNGC 2VBYA 3OOUA 4U9LA 2WY7Q 1O3TA 1WJ5A 3E0JB 2QSHX 1J5YA 3K70C 1GLNA 1LE8A 1ETQA 5FLXZ 3OMYA 3U21A 4BL0B 2OI8A 2A07F 2PBXA 2P7CB 4IQ4A 3BLYA 4JBAA 3Q0VA 2EFOA 5LGUA 5C3EJ 2O7TA 1C0WA 5F0HA 4FISA 2MD0A 4IZZA 5IOYA 3CCYA 3OYCA 1GDTA 1ZHFA 2QVOA 1WHUA 2LD5A 3F6VA 2E2IJ 4I0AA 4ENNA 1U78A 2DFFA 2XSDC 2DCEA 3K4LA 4CCJA 2GFNA 1UG2A 5FKOA 3RKYA 3A01B 2ESNA 3KEOA 2L7ZA 1R36A 1D0ZA 4Q47A 3HZJA 1IUYA 1ETVA 4LIVA 2M7BA 5C4YA 2JA6J 2J5OA 2ID6A 4NN1A 3LWJA 3R6SA 3BR3A 4A93J 3LSHA 4LOCA 1IRGA 3S17J 4YG2F 4IHXA 3F6OA 4OMYA 3JSOA 3HRTA 3NNRA 3AL0C 3OSFA 2KZVA 4M6YA 2WADA 1ZGAA 4CYCB 4HX8A 3G4SI 2LC2A 4PGGA 5L3EA 2E1CA 4RB1A 2IGKA 4HPQA 4XONA 2NRAC 2FXAA 1G3SA 2K5CA 3F9KA 3HDDA 1BJAA 2ISYA 1O4XA 1XSXA 2W24A 5LHIA 3R4KA 2L01A 3JCUC 4YELA 4HLXA 4KNYA 1AA7A 1WQ2A 3V8KA 2JQ7A 3F1BA 3SFIA 2VT3A 2BYVE 1SVMA 2V26A 2OA4A 2XUBA 1TNTA 2XHKA 2D45A 1MSEC 2PEXA 3O2PE 2ZMEC 4HQMA 2YU9J 1LUJB 3TW7A 1Y8RB 1RNLA 3CCEI 1OPCA 2MABA 4I01A 2DMUA 3WTZA 2VUMJ 3CCJI 3QRFF 1K7AA 3JW4A 1YIJI 5DUIA 4OIPF 2DOAA 4A3CJ 4IO9F 5KAIC 3IV5A 1LB2A 4KN7X 1BN5A 4XLAA 5M5YJ 1WH7A 1DP7P 1NTCA 3QQAA 1WJEA 3A02A 2P4WA 1O3RA 2X0LA 2V1DA 5B66C 2E60A 3I59A 4GXOA 2UXXA 2QZ8A 4KIFA 2KKOA 2P81A 1A6IA 1QQIA 3QOEA 3FXJA 4LGWA 1G3WA 1JKQC 4JL3A 5TISC 2UXIA 3G2BA 1FPQA 4RGXA 1FP1D 2XKOA 4NUBA 2LBFA 5LEJA 5EZHA 2OTLI 4M9XA 4GCKA 2NP5A 2B3WA 2DA1A 1X2NA 1WWXA 2HYTA 4XLFA 1YW8A 3E5XA 2EA4A 3CLQA 1YJNI 1WSUA 3GTLJ 4U9NA 2LP0A 3TOAA 3RKXA 3V7CA 2R7FA 1BIBA 4ZTJA 1YRNB 3I0TA 3ZQCA 2DG8A 1SMYF 2FBIA 2XIGA 3IRRA 2XF7A 2L9SA 5LBQA 1OR7A 4A3IJ 1VQKI 4RAYA 1KU7A 2X9DA 2A5YB 3CDLA 3I54A 1T38A 3K4JA 4ENMA 4KWAA 2ZNZA 5HLGA 4PJJA 5AONA 2BW3A 2DOFA 2HPIA 4XSXF 2BVMA 4HF1A 4DBRA 1YRNA 5IP6A 1D5YA 3TMOA 2B0LA 4EJOA 1UG0A 2W84A 3E6BA 2P7VB 2V7FA 5DCMA 1LQ1A 1WCMJ 1NG7A 1VQ9I 2BBYA 1G4DA 4G7ZF 1U2WA 1SMTA 3F22A 1K79A 1LPQA 2HOAA 1VTNC 5JVGF 2F2EA 3HB9A 2ZCMA 1X58A 3H36A 4E7SA 5JFRA 2K7LA 5E8GA 1YE9A 5EFYA 3GCMA 1EV7A 1XB4A 4WXCA 3BZCA 4CHUA 1ULYA 5D4RA 2CJJA 4LK1F 4ASNA 3ZQIA 6PAXA 1MMNA 4B3AA 5DUKA 3HOZJ 1VQ6I 2EFQA 1X4OA 2Z1DA 2HVRA 2NS0A 1D1AA 1OYIA 3LFKA 1SFXA 4KICA 4DIQA 1B8IB 4Y52J 2W4SA 1IXSB 3FISA 2PJRA 3HOVJ 1RI7A 5DM6F 4P55A 4XLEA 4U88A 4KT6A 5DYMA 3HKZN 1JI8A 2X51A 4ZYHA 1Z7LA 2KL4A 1YOVB 2KJCA 4XLHA 3V42A 2YVHA 3ESWB 3BCBA 2RVCA 1ZLKA 1GV5A 4X1EA 3K1MA 1MKMA 4Q48A 3CJQB 4B09A 4CGZA 1CF7B 4B47A 1U6GA 1MIJA 4AU7A 2HTJA 2PMZA 4IHTA 4LK0F 4AWXB 1G2HA 2K4JA 2QKMB 3E7QA 1T0FA 4GYIA 4D7MA 2PFVA 2GBYA 3ZRGA 1WI3A 5F64A 1Z77A 5FKMA 4CZCA 1Z05A 1IZ1A 3OWTA 3ASNH 5DD4A 4L0YB 3GFLA 1TZLA 2L7KA 3HXLA 3I9V2 4S04A 1YQAA 2KFDA 2WV0A 2H09A 2FSWA 1FWZA 1F9NA 2CH0A 5IYDJ 2WB1N 1HXDA 3WU0A 1G3TA 2VXZA 3Q5FA 3DU5A 2BEOA 4ZYEA 2ELHA 4ZDPA 2R5YB 3MD2A 3S2DJ 4JNNA 1QU3A 1P4XA 4EV0A 2O0YA 2OBPA 3OYJA 3DEWA 3V6GA 2K9LA 1J9IA 4NQWB 4M9ZA 2I8DA 2JTVA 2E1MB 2KMUA 4GCVA 4L9NA 1JT0A 2HR3A 2WTEA 2O8XA 3TKYA 4MTEA 5IYBJ 4F52A 3AQTA 3PNYA 2M0CA 3SEZA 3BG9A 2MLKA 3JSJA 5ERIA 4IX7A 1MJ9A 2B7EA 3IWZA 1T2KA 4RS8A 2IP2A 2PJPA 4IHSA 2UXOA 1JUSA 3IRQA 3E3VA 3ZCOA 1WH5A 5LGTA 4NELA 4NB5A 1MBEA 3FKJA 2JZYA 2DG7A 3DQVC 2ICWG 1HKSA 4EM0B 4ICHA 2TRTA 2DJIA 3DBRB 3G1LA 3ZMZA 2QKLB 3GLLA 3VOXA 3U9GA 4EQQA 1G8XA 2X48A 4UNOA 4UY8I 3HSFA 3HUGA 1ODDA 3P9IA 2XROA 3GZ6A 2DMQA 3QKXA 2QWWA 2LKSA 3KP2A 3VSLA 2JA5J 4CYDA 5LHHA 2QOPA 4IHWA 1Y1VJ 1NK2P 4V19K 1RESA 1L3LA 5HDNA 3GEZA 4KIBA 3RD3A 4PFPA 1HW1A 1RPWA 5LRSA 2DAOA 1MDMB 4UUSB 1QVUA 5JI6A 2WGBA 3H0DA 5FKKA 4UVAA 1OQYA 5CPRB 1I39A 4WXHA 1YJ9I 3DU6A 3J7AY 2M9HA 2OTJI 4PSXA 4HOBA 4C3IJ 1DPUA 3GFIA 1XGMA 2QQ9A 3ABTA 4YEJA 3CQZJ 1KU3A 2WAQN 5CJ9A 4LB6B 2O3FA 3H9QA 4II2A 1YG2A 2WBMA 3FRQA 2FMYA 4PFOA 4I98B 4FTHA 3WTSC 4L62A 4ENJA 3PIOF 3A4CA 2QF7A 1WJBA 3BP8A 1KONA 3K10A 5DD8A 2R7RA 3GTOJ 4ACIA 1QZYA 4GFLA 1K78B 1TC3C 1P7IA 4XK4A 5EJCA 2QWTA 3M8EA 2FBHA 5EEGA 2ZCXA 3HC7A 2VQLA 5EG0B 1TTYA 1Q1HA 2FOKA 5ILSA 3GZIA 1RZ4A 3IAM2 3CCMI 1VQ8I 5ICFA 1R1TA 4LIUA 5JHFA 2YPRA 3C2GA 2WUIA 3NQOA 3OYNA 3EGQA 1J7KA 3S8PA 2BE5F 4C2UA 5IY5H 3OR1C 3K4MA 2JUCA 1SFUA 1ETWA 3MN2A 3BTJA 3CUQB 4DZPA 4HNUA 1BC8C 3GTKJ 1QZZA 1SFKA 1U9NA 1V5EA 1W7PD 2MW8A 1I50J 1Y0UA 1W7PA 2HKXA 2Z2SB 1DQUA 4KUMA 1U8BA 4KDPA 2VN2A 3ZR8X 5FKLA 4UB8C 1H9TA 2FX0A 3ZMVA 2R5ZA 9ANTA 2YUSA 3JRHA 1B1BA 4F7ZA 5BPDA 3CDIA 3Q9VA 4KA4A 3HIMA 4KIGA 4DGWB 2R5YA 1LFBA 4HSRA 1ACIA 4E7IA 3QU6A 4RM3A 2VPRA 3CCRI 1DDNA 4CA0A 2V1UA 2HDWA 4PDKA 4L9VA 3JRGA 1ZRFA 3I4NJ 4CICA 4GRIA 4R1HA 4G94A 1ERDA 3WGHA 2LKPA 3DPUA 3KZZA 5K1YA 5J47A 1U5TB 3LFUA 5DS9A 4IRIA 2L4MA 3RPQA 2PZ9A 3EETA 5BNGA 3AG3H 3TL4X 4BHCA 1MJBA 3G6EI 3GTPJ 5LFAA 4LG3A 3DTEA 5B1AH 1LDDA 2LLKA 2DW4A 2NVXJ 2PG4A 3O6BB 4HLYA 4LFUA 2QSGX 3RZDJ 3KNWA 2V57A 1TP4A 1GXPA 2MSYA 5GAHJ 4I02A 3ABUA 1D8KA 5D4SA 3G1MA 1D0XA 5K5QA 5J1UA 3RYPA 3ZN0A 1NG6A 4EATA 3GXOA 1BIAA 5TGTA 4G12A 3D5RC 4HG2A 4IRHA 4C2TA 3F8FA 3PNTA 1FOXA 1ZK8A 2CU7A 3B02A 1FX7A 4KMUX 3J7AO 1Y8QB 1ZN2A 3DF8A 4IKFA 4MEYF 2PBIA 2W85A 1GT0C 3BDDA 2HPMA 1T33A 2COBA 4PJNA 3JTGA 3CZ6A 5J8CA 1U3EM 2NS7A 4M6VA 2FE3A 1ZREA 4JKZA 2F4MB 3RCOA 2LK2A 4LD5A 1ZG5A 1PDNC 3GBGA 2IT0A 3KYCB 4AC6A 2L9NA 4BJ6C 5HLHA 2UWMA 3WHCA 2VJ4A 1FSEA 4J00A 3KCCA 3NRVA 2ZMEB 1D8JA 4KN4X 1BC7C 2HOTA 2UV1A 3BJBA 4S05A 2EV5A 2VKEA 1XGNA 3V7SA 2B1EA 1JJ8C 2ADUA 5L3GA 3HM5A 3OOPA 1N25A 3LAPA 4GGGA 3I5UA 4AIHA 4TV7A 2IBDA 2ID3A 2JK3A 4FX0A 1U8RA 5ILUA 2VPLA 3VYRB 2MC4A 4MXMA 3PUBA 1W4MA 3I55I 2VQHA 3ECHA 2WC2A 3N97A 1IG7A 3TO6A 4BQQA 4F93B 1XDSA 2Z5UA 3TOBA 4ESJA 1Z3YA 2I10A 2F07A 4OU0A 1BI1A 5FRNA 1FNNA 4CGRA 1ON1A 1HF0A 2R93J 2R0QC 3A01A 1UHMA 4PUSA 3KP3A 1IRXA 1USTA 5K7HA 1B4AA 4A2UA 2HDDA 2O8KA 4D1QA 3K70D 3HJEA 3L09A 1H89C 1FYKA 2ZOYA 2EFNA 2M87A 3CJNA 4UV9A 4C2MA 4ZZLA 5EG0A 1A6QA 1BR1A 1RKTA 3LQQA 3MKZA 3VYSB 3CRJA 3BWGA 3WU2C 4PJ0C 3J80Z 3HOYJ 2RDPA 2HZDA 1LE8B 1U5TC 4XNFA 1N77A 3K4BA 4IRVA 3WU1B 4NHJA 4BDYA 2DA5A 1O3SA 2PN6A 2F5DA 2OCCH 1S5LC 1AU7A 2OPTA 1SVLA 4IL6C 4HF0A 1LDJA 3VW1A 3BPVA 1ENHA 2ZJRF 2A68F 2IS1A 2PMZN 1X1DA 5HBUA 2KDOA 3J81K 2EA2A 3WTTC 2KIQA 1W0UA 2CUJA 4N9HA 3SZPA 2CWEA 5F0CA 1HKQA 5K5RA 2GUHA 3ZQGA 3FDYA 4I2OA 3HYIA 2EK5A 3F8MA 1WVRA 3RPUA 3RPUD 1HBXG 4U0WA 4F55A 3MKYB 2K02A 3C2BA 2F4IA 3BG6A 5CQEA 2LRDA 3ZMSA 3KP4A 1Z21A 4MFEA 4BDZA 1OR7C 3G71I 4JYKA 3IC7A 1UAAA 4ZYAA 4BHPA 3P9TA 4HYEA 1T0FC 1VFCA 1RR8C 2HQAA 1IN5A 1X1CA 3PFIA 1BI0A 5D6FA 2MD5A 2DLLA 3HHGA 1ZRCA 4O6JA 2K86A 4A3EJ 4UVBA 1IDYA 3FIWA 1LVAA 3AKZA 2QEXI 1OMIA 2ME0A 3TO7A 4OD5A 5F27A 3OYMA 2QKOA 3CTAA 3ZPLA 3V7RA 3N05A 1EJ9A 2GXGA 4GO1A 1QHGA 4I0BA 4EM2A 2H6BA 1F5TA 3LL7A 1YIOA 2BXYA 1UFMA 4YZEA 5FFZA 2Z3YA 4E7HA 2PMHA 4GCLA 5ED4A 4RLQA 3NXCA 4XKBA 1S72I 1ZR4A 4XBFA 5LRRA 5CKTA 4FT8A 2FRHA 2V79A 5FRMA 3K4KA 4UHTA 1LFUP 3VOEA 4II3A 2P5KA 4XLNF 4QIWN 3OYHA 3TP3A 2JSPA 1R58A 2ZCWA 2QCOA 2Q24A 2E5ZA 3SQNA 3S1QJ 2L3DA 3WE3A 2NYXA 4ZC3A 3WTYC 4CCOA 3GX4X 5LD2C 1K6YA 1WPKA 2ZMEA 1R5GA 2ZFWA 3RQ4A 3HG9A 1SANA 2CQKA 3O8HA 1AWCA 2ACJA 2K9MA 2M5WA 4BU2A 2CW0F 5L3DA 4V2GA 2R7QA 3LA7A 2PFBA 3GLXA 2L7MP 2P5LC 3NWTA 2VKVA 2Q0OA 3CMAI 2DJNA 2FOWA 3CP2A 1HW2A 4EMSA 2IU5A 1E0EA 1A36A 1Z6RA 4ESBA 2NAZA 3CJRB 2CV1A 1SAUA 3G1OA 5HVQC 5C4JJ 5F1JA 3CF2A 3KYLA 2ZC2A 2LH9A 1XC5A 3WTUC 3GZNB 2XPWA 3WGGA 3OY9A 4N4OB 4AIJA 2IPQX 2IXSA 3LMMA 1CF7A 5HDGA 1ETXA 2OERA 1IO2A 2DMTA 3PUFA 4BJ5C 3FZVA 2QSFX 1I1GA 1ONVA 1G59A 1BL0A 2QGUA 3H9GA 3TQNA 1EKEA 4XLCA 2PX9A 2GM4A 5FLXK 1X2MA 1WGXA 5E1XA 3K0LA 2BGCA 4OMZA 5JHUA 5LGNA 2HXOA 3E7LA 5TRDA 3LA2A 2V6EA 1Z91A 2XAGA 5F0FA 4BQAA 2O7OA 4E6KG 1SD5A 2K3FA 3IUOA 2JA7J 3F21A 1K6OA 2V9VA 4XKWA 5A2QK 2Y9ZA 3F23A 1NK3P 2E34A 5IPAA 4PJLA 3VP5A 5E18F 4WX9A 3NWSA 3PQJA 2V9PA 4MIMA 5D8LB 1KA8A 3BTCA 1U9OA 2KQRA 4L9JA 2HOSA 3JRCA 3TP0A 5BPIA 1TWHJ 4FHTA 2F4OB 3OYAA 3NARA 3H9JA 1IXRC 2E1OA 3D1NI 1WRJA 3LJLA 2FMLA 2H1LA 3RJPA 1K4SA 2LR8A 2W1OA 2LG4A 2VASA 3CMMA 2JMWA 4JOMA 1GXQA 3V8JA 2O6GE 2W7NA 4XSZF 4XOPA 5EGOB 1V5GA 5TJJA 1W7PB 4DW6A 2FJ1A 2HDCA 1R71A 3ZQLA 1WJAA 2GOMA 1TQIA 1SVOA 3JTHA 4WXDA 3ONQA 4MQ9F 3DKXA 1OLTA 4F3QA 2KLOA 1FJLA 3R0AA 2M45A 5M5WJ 1J75A 5GTIC 4KYWA 1QBJA 3KKCA 1ZELA 3C18A 2LYCA 2XPVA 1SC7A 5E1ZB 2UXNA 1IN7A 2F5EA 2L2OA 3Q9SA 3GTGJ 1JHFA 1P6RA 4WF2A 3I71A 2EIKH 3ZN1A 3IHUA 1MD0A 4GCTA 2KIFA 1IW7F 1HC8A 3BR6A 4PZJA
chains in the Genus database with same CATH topology
1B72A 1JKRC 4J19A 3BHQA 1BW6A 1MBEA 5FHPA 2DG7A 1IDZA 1ITYA 4ICHA 4M3BA 2WV1A 2TRTA 2XB5A 3G1LA 4DYRA 3VOXA 1K61A 4W1UA 2X48A 5EF6A 3I4MJ 2K9NA 5F08A 5J1YA 5C44J 3QKXA 2DMQA 1RKWA 2JA5J 1OCPA 3VPRA 1APLC 2QOPA 3C07A 4IHWA 1Y1VJ 3PASA 1MBGA 1NK2P 2K40A 1IUFA 5E3MA 2G3BA 1UI5A 1RESA 5D19A 1GVDA 5J1RA 4BBSJ 3RD3A 2NS8A 5EEAA 2L9RA 5FJ8J 3ON2A 1RPWA 1JTYA 5K7FA 2QTQA 3NPIA 4UUSB 4A3FJ 2R7ZJ 1QVUA 2L0KA 2WGBA 3LSJA 4A69C 1F43A 2CUEA 2K9SA 4JP0A 2G7GA 5FKKA 4UDSA 2HQ5A 4D5CA 3G7RA 2M9HA 3FK7A 4C3IJ 4QTRA 4NDLA 4S0HB 1HCRA 2IEKA 2FBQA 2EH3A 2O9LA 3CQZJ 2WAQN 3VVYA 2UXHA 3S16J 3FRQA 3RQIA 3HGYA 5GPCA 4FTHA 3TEDA 2DA7A 1UI6A 2JJ7A 4L62A 2EBIA 5JLWA 2KDZA 2QF7A 3S5RA 2W53A 2DMNA 3GTOJ 4ACIA 1ETYA 4MK6A 4A3DJ 4GFLA 2DA6A 1TC3C 1A5JA 1P7IA 4XK4A 2ZOZA 4A3LJ 3KKDA 1XG1A 2QWTA 1FIPA 1TWAJ 1E3OC 2ZCXA 4I76A 5EG0B 5F04A 1T56A 3GZIA 3JRDA 2CQXA 3F0CA 1MSFC 2M8GX 2XGEA 4DYQA 2UXPA 2ZCNA 2M34A 3QPLA 2DMPA 5M3FJ 1BJZA 1PUFA 1UHSA 5GP9A 3T6NA 2WUIA 4I6ZA 3BQYA 4B1RA 3EGQA 1AKHA 3Q3SA 2Y9YA 4W97A 1ETWA 3MN2A 3LOCA 3HTIA 3BTJA 3ZQFA 4DZPA 4GFKA 3PM1A 3S1NJ 4AUXA 3GTKJ 2K9QA 1U9NA 2MW8A 1I50J 5M5XJ 3ZQHA 1U8BA 4XIDA 3FKIJ 3HBLA 2HYJA 5EDNA 5FKLA 3HTJA 2FX0A 4JX6A 2R5ZA 1HDDC 9ANTA 5J3LA 2YUSA 3JRHA 3OSGA 2AO9A 2QIBA 2H1KA 3HTAA 3HIMA 2R5YA 1LFBA 1EF4A 1MBHA 3A03A 4FE7A 2VPRA 5CXGA 3LSPA 2TCTA 3LSRA 2LKXA 3I4NJ 3JRAA 3JRGA 4MFDA 1I3QJ 2ELKA 4A3JJ 1SGMA 1JKOC 3VW2A 4ME9A 5AQCA 2ECBA 2CQQA 1H88C 5DS9A 3O8GA 2LVSA 5D18A 2PZ9A 3IH4A 5BNGA 3GTPJ 5HSZA 3JRFA 3LNQA 2NVTJ 3COLA 1R9TJ 3B6AA 1H8AC 4BY7J 3BNIA 2LLKA 2NVXJ 4V2FA 1GV2A 1QPIA 3BR1A 2XGCA 4MLOA 2EZLA 2GENA 3RZDJ 1QRYA 4AYBN 3KNWA 2V57A 1OJLA 1XS9A 2MSYA 1SFOJ 2W48A 3L1PA 4L5EA 2MGQA 3G1MA 3VVZA 5J1UA 3IUVA 3HOWJ 1MH4A 4RDUA 1JJ6C 2JA8J 4A3KJ 2ME6A 3HOXJ 1MH3A 2G7SA 3JRIA 5H9TA 2LY9A 4A3BJ 4G12A 2D6YA 1QVTA 3ON4A 5CXIA 4XICA 1FTZA 4JKZA 5IOZA 1ZK8A 2CU7A 3S14J 1DU6A 1B8IA 2LTPA 4JX5A 1GT0C 3KZ9A 1JUMA 2RHAA 1T33A 3OOUA 2COBA 3Q0UA 5IP9J 1FIAA 3GTJJ 3SJMA 4M3EA 5FMPA 3Q0WA 2NS7A 4M6VA 1LE8A 2EZKA 3AQSA 1ETQA 1IRZA 2OI8A 2LK2A 2HI3A 2PBXA 3VW0A 5JLXA 2LFBA 2M2EA 2ZB9A 4C2MJ 1UMQA 3GBGA 2IAIA 2XB0X 4Y7NJ 3Q0VA 4AC6A 5C3EJ 2O7TA 3WHCA 2OF7A 4CYCA 5F0HA 4FISA 5IOYA 2R5ZB 3CCYA 1ZQ3P 5HODA 2DTZA 1GDTA 3NAUA 4IHVA 2NOGA 1K83J 2HOTA 3BJBA 2LD5A 2VKEA 2E2IJ 1P7JA 4A3MJ 1U78A 1JJ8C 1W0TA 2XSDC 3HM5A 2HKUA 2N8GA 5IYCJ 4A3GJ 3S15J 2GFNA 1UG2A 2D5VA 5FKOA 3A01B 3GEUA 1S7EA 3FK6A 2IBDA 2ID3A 2JK3A 2L7ZA 1ETVA 3MVPA 5C4YA 4M3FA 2JA6J 4MXMA 2ID6A 4NELA 3LWJA 4NN1A 3BCGA 3BR3A 1IG7A 5D1RA 4A93J 4QSHA 4LOCA 3S17J 4IHXA 1ZGWA 4DZJA 2I10A 1AKHB 2F07A 3M3YJ 4C3JJ 4CGRA 4BXXJ 2XDNA 3BR2A 1HF0A 2R93J 3NNRA 4DYCA 2R0QC 2VI6A 3A01A 1JGGA 2Y2ZA 1TWCJ 3OSFA 1PUFB 5K7HA 3HTHA 5EZGA 2E2HJ 2HDDA 4CYCB 2H8RA 2O8KA 1JT6A 3BG5A 1H89C 2ZOYA 4AF5A 5EG0A 5EYRA 1RKTA 3CRJA 3BTLA 3HDDA 4HKUA 3BG3A 3HOYJ 1O4XA 5IP7J 1LE8B 3EUPA 2DA5A 1AU7A 3F1BA 2OPTA 3K2AA 4XRMA 3SFIA 2R92J 3VW1A 4AC0A 1ENHA 2PMZN 5HBUA 3H0GJ 4D7NA 3UKGA 1JUPA 1W0UA 1MSEC 5F0CA 3BR5A 2YU9J 1CQTA 4ABZA 3TW7A 2E19A 1FEXA 4BY1J 2GUHA 2DMUA 2VUMJ 3ZQGA 3HGGA 3LHQA 3BR0A 1VI0A 2AHQA 3HEFA 4UUSA 3QBMA 2REKA 3BRUA 4A3CJ 3IV5A 4RBOA 3C2BA 3RZOJ 3JRBA 4GFBA 4X6AJ 5M5YJ 1WH7A 3JR9A 3GTMJ 3VVXA 1NTCA 3QQAA 5K7ZA 3A02A 3M4OJ 1I6HJ 1ZTRA 4MFEA 2XPUA 4JYKA 4M3GA 3P9TA 1VFCA 3PO3J 2P81A 1A6IA 5CW8A 1JKQC 4JL3A 2Y0SN 2UXIA 1HOMA 4A3EJ 1IDYA 3FIWA 4GCKA 5EZHA 1IGNA 2ME0A 2NP5A 2XGDA 1Q1VA 3TW6A 2DA1A 5C4XJ 1IV6A 1X2NA 2HYTA 1B72B 3G56A 2HXIA 5F27A 4B4CA 4XRSA 3GTLJ 2QKOA 2CRGA 2LP0A 4UUTA 3S2HJ 5FLVA 2DA4A 4BKXA 5E3OA 2EQRA 3DCFA 1ZR2A 3ZQCA 1YRNB 3NRGA 2DG8A 4YZEA 4GCLA 3NXCA 4PXIA 2E2JJ 4A3IJ 3BTIA 2JWTA 1ZR4A 2X9DA 1TWGJ 4IHYA 1MBKA 3PPBA 3CDLA 1LFUP 3IH2A 1FTTA 4KWAA 2NVYJ 4QIWN 3TP3A 1MNMC 2B63J 4FCYA 3WHBA 2QCOA 2Q24A 2JN6A 1MBFA 3BQZA 3S1QJ 2NP3A 1YRNA 3W6VA 5IP6A 5M3MJ 1D5YA 2CUFA 1WPKA 3CWRA 1BA5A 1SANA 3O8HA 5EGOA 2NVQJ 3CJDA 1JKPC 3BT9A 1WCMJ 4V2GA 4BBRJ 3S1RJ 2YVEA 1HLVA 3VIBA 2L7MP 2VKVA 2DJNA 3ANGA 3VUQA 2X6OA 2HOAA 3HB9A 2ZCMA 1X58A 3OIOA 2IU5A 5HAWA 2XRLA 5FLMJ 5EFYA 3G1OA 2L7FP 5C4JJ 3RKQA 5F1JA 3HE0A 2CJJA 3ZQIA 3HOZJ 4B3AA 2NX4A 3K7AJ 1XC5A 2XPWA 1ZKGA 3ZOBA 3PO2J 3RH2A 2DN0A 5DTDA 1JTXA 2FQ4A 1ETXA 1Y1WJ 3S1MJ 2OERA 2DMTA 1BW5A 1B8IB 4Y52J 3FISA 3HOVJ 5E3LA 4D5FA 3HKZN 2MG4A 3MNLA 5FGLA 1BL0A 1VNDA 1Z0XA 2Y30A 2YVHA 5K58A 4EEFG 2GM4A 1X2MA 2YS9A 1OFCX 1GV5A 1WGXA 4X1EA 3V78A 2HXOA 3E7LA 5DAJA 2FD5A 5F0FA 3QPSA 1ETKA 2O7OA 1G2HA 1RETA 3MKLA 2EZIA 3DPJA 2JA7J 3E7QA 2Y9ZA 4D7MA 1NK3P 2GBYA 1VF9A 1OCTC 3B6CA 5IPAA 3VP5A 1WI3A 3SDGA 1TWFJ 4MIMA 1Z77A 5FKMA 4FE4A 4C3HJ 3BTCA 1U9OA 2ECCA 1DU0A 2RAEA 3JRCA 2HOSA 5FKNA 3TP0A 1TWHJ 2RASA 3B81A 2KT0A 1MBJA 4HNVA 3NARA 2E1OA 3D1NI 3HOUJ 3ANPA 1F36A 3LJLA 2DA2A 3IH3A 1ETOA 5IYDJ 2WB1N 2LR8A 5E3NA 3H3VK 2JMWA 1POGA 2R5YB 3S2DJ 1AHDP 1HDPA 5EGOB 3O60A 4JNNA 4MO7A 4DW6A 2FJ1A 4JX4A 4XRSG 3ZQLA 1IJWC 1ORKA 1FJLA 3DEWA 3V6GA 5M5WJ 5GPAA 2G0EA 1JT0A 3KKCA 1GUUA 2XPVA 3NI7A 1RR7A 3AQTA 5IYBJ 2DA3A 1IC8A 2M0CA 3BG9A 3JREA 3JSJA 3LSGA 4M3DA 2G7LA 2EZHA 3GTGJ 2UXUA 3GTQJ 3VOKA 2Y31A 2UXOA 4IEJA 4GCTA 1JUSA 2GLOA 1WH5A 3CMYA 3BR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B72 A;  1JKR C;  4J19 A;  3BHQ A;  1BW6 A;  1MBE A;  5FHP A;  2DG7 A;  1IDZ A;  1ITY A;  4ICH A;  4M3B A;  2WV1 A;  2TRT A;  2XB5 A;  3G1L A;  4DYR A;  3VOX A;  1K61 A;  4W1U A;  2X48 A;  5EF6 A;  3I4M J;  2K9N A;  5F08 A;  5J1Y A;  5C44 J;  3QKX A;  2DMQ A;  1RKW A;  2JA5 J;  1OCP A;  3VPR A;  1APL C;  2QOP A;  3C07 A;  4IHW A;  1Y1V J;  3PAS A;  1MBG A;  1NK2 P;  2K40 A;  1IUF A;  5E3M A;  2G3B A;  1UI5 A;  1RES A;  5D19 A;  1GVD A;  5J1R A;  4BBS J;  3RD3 A;  2NS8 A;  5EEA A;  2L9R A;  5FJ8 J;  3ON2 A;  1RPW A;  1JTY A;  5K7F A;  2QTQ A;  3NPI A;  4UUS B;  4A3F J;  2R7Z J;  1QVU A;  2L0K A;  2WGB A;  3LSJ A;  4A69 C;  1F43 A;  2CUE A;  2K9S A;  4JP0 A;  2G7G A;  5FKK A;  4UDS A;  2HQ5 A;  4D5C A;  3G7R A;  2M9H A;  3FK7 A;  4C3I J;  4QTR A;  4NDL A;  4S0H B;  1HCR A;  2IEK A;  2FBQ A;  2EH3 A;  2O9L A;  3CQZ J;  2WAQ N;  3VVY A;  2UXH A;  3S16 J;  3FRQ A;  3RQI A;  3HGY A;  5GPC A;  4FTH A;  3TED A;  2DA7 A;  1UI6 A;  2JJ7 A;  4L62 A;  2EBI A;  5JLW A;  2KDZ A;  2QF7 A;  3S5R A;  2W53 A;  2DMN A;  3GTO J;  4ACI A;  1ETY A;  4MK6 A;  4A3D J;  4GFL A;  2DA6 A;  1TC3 C;  1A5J A;  1P7I A;  4XK4 A;  2ZOZ A;  4A3L J;  3KKD A;  1XG1 A;  2QWT A;  1FIP A;  1TWA J;  1E3O C;  2ZCX A;  4I76 A;  5EG0 B;  5F04 A;  1T56 A;  3GZI A;  3JRD A;  2CQX A;  3F0C A;  1MSF C;  2M8G X;  2XGE A;  4DYQ A;  2UXP A;  2ZCN A;  2M34 A;  3QPL A;  2DMP A;  5M3F J;  1BJZ A;  1PUF A;  1UHS A;  5GP9 A;  3T6N A;  2WUI A;  4I6Z A;  3BQY A;  4B1R A;  3EGQ A;  1AKH A;  3Q3S A;  2Y9Y A;  4W97 A;  1ETW A;  3MN2 A;  3LOC A;  3HTI A;  3BTJ A;  3ZQF A;  4DZP A;  4GFK A;  3PM1 A;  3S1N J;  4AUX A;  3GTK J;  2K9Q A;  1U9N A;  2MW8 A;  1I50 J;  5M5X J;  3ZQH A;  1U8B A;  4XID A;  3FKI J;  3HBL A;  2HYJ A;  5EDN A;  5FKL A;  3HTJ A;  2FX0 A;  4JX6 A;  2R5Z A;  1HDD C;  9ANT A;  5J3L A;  2YUS A;  3JRH A;  3OSG A;  2AO9 A;  2QIB A;  2H1K A;  3HTA A;  3HIM A;  2R5Y A;  1LFB A;  1EF4 A;  1MBH A;  3A03 A;  4FE7 A;  2VPR A;  5CXG A;  3LSP A;  2TCT A;  3LSR A;  2LKX A;  3I4N J;  3JRA A;  3JRG A;  4MFD A;  1I3Q J;  2ELK A;  4A3J J;  1SGM A;  1JKO C;  3VW2 A;  4ME9 A;  5AQC A;  2ECB A;  2CQQ A;  1H88 C;  5DS9 A;  3O8G A;  2LVS A;  5D18 A;  2PZ9 A;  3IH4 A;  5BNG A;  3GTP J;  5HSZ A;  3JRF A;  3LNQ A;  2NVT J;  3COL A;  1R9T J;  3B6A A;  1H8A C;  4BY7 J;  3BNI A;  2LLK A;  2NVX J;  4V2F A;  1GV2 A;  1QPI A;  3BR1 A;  2XGC A;  4MLO A;  2EZL A;  2GEN A;  3RZD J;  1QRY A;  4AYB N;  3KNW A;  2V57 A;  1OJL A;  1XS9 A;  2MSY A;  1SFO J;  2W48 A;  3L1P A;  4L5E A;  2MGQ A;  3G1M A;  3VVZ A;  5J1U A;  3IUV A;  3HOW J;  1MH4 A;  4RDU A;  1JJ6 C;  2JA8 J;  4A3K J;  2ME6 A;  3HOX J;  1MH3 A;  2G7S A;  3JRI A;  5H9T A;  2LY9 A;  4A3B J;  4G12 A;  2D6Y A;  1QVT A;  3ON4 A;  5CXI A;  4XIC A;  1FTZ A;  4JKZ A;  5IOZ A;  1ZK8 A;  2CU7 A;  3S14 J;  1DU6 A;  1B8I A;  2LTP A;  4JX5 A;  1GT0 C;  3KZ9 A;  1JUM A;  2RHA A;  1T33 A;  3OOU A;  2COB A;  3Q0U A;  5IP9 J;  1FIA A;  3GTJ J;  3SJM A;  4M3E A;  5FMP A;  3Q0W A;  2NS7 A;  4M6V A;  1LE8 A;  2EZK A;  3AQS A;  1ETQ A;  1IRZ A;  2OI8 A;  2LK2 A;  2HI3 A;  2PBX A;  3VW0 A;  5JLX A;  2LFB A;  2M2E A;  2ZB9 A;  4C2M J;  1UMQ A;  3GBG A;  2IAI A;  2XB0 X;  4Y7N J;  3Q0V A;  4AC6 A;  5C3E J;  2O7T A;  3WHC A;  2OF7 A;  4CYC A;  5F0H A;  4FIS A;  5IOY A;  2R5Z B;  3CCY A;  1ZQ3 P;  5HOD A;  2DTZ A;  1GDT A;  3NAU A;  4IHV A;  2NOG A;  1K83 J;  2HOT A;  3BJB A;  2LD5 A;  2VKE A;  2E2I J;  1P7J A;  4A3M J;  1U78 A;  1JJ8 C;  1W0T A;  2XSD C;  3HM5 A;  2HKU A;  2N8G A;  5IYC J;  4A3G J;  3S15 J;  2GFN A;  1UG2 A;  2D5V A;  5FKO A;  3A01 B;  3GEU A;  1S7E A;  3FK6 A;  2IBD A;  2ID3 A;  2JK3 A;  2L7Z A;  1ETV A;  3MVP A;  5C4Y A;  4M3F A;  2JA6 J;  4MXM A;  2ID6 A;  4NEL A;  3LWJ A;  4NN1 A;  3BCG A;  3BR3 A;  1IG7 A;  5D1R A;  4A93 J;  4QSH A;  4LOC A;  3S17 J;  4IHX A;  1ZGW A;  4DZJ A;  2I10 A;  1AKH B;  2F07 A;  3M3Y J;  4C3J J;  4CGR A;  4BXX J;  2XDN A;  3BR2 A;  1HF0 A;  2R93 J;  3NNR A;  4DYC A;  2R0Q C;  2VI6 A;  3A01 A;  1JGG A;  2Y2Z A;  1TWC J;  3OSF A;  1PUF B;  5K7H A;  3HTH A;  5EZG A;  2E2H J;  2HDD A;  4CYC B;  2H8R A;  2O8K A;  1JT6 A;  3BG5 A;  1H89 C;  2ZOY A;  4AF5 A;  5EG0 A;  5EYR A;  1RKT A;  3CRJ A;  3BTL A;  3HDD A;  4HKU A;  3BG3 A;  3HOY J;  1O4X A;  5IP7 J;  1LE8 B;  3EUP A;  2DA5 A;  1AU7 A;  3F1B A;  2OPT A;  3K2A A;  4XRM A;  3SFI A;  2R92 J;  3VW1 A;  4AC0 A;  1ENH A;  2PMZ N;  5HBU A;  3H0G J;  4D7N A;  3UKG A;  1JUP A;  1W0U A;  1MSE C;  5F0C A;  3BR5 A;  2YU9 J;  1CQT A;  4ABZ A;  3TW7 A;  2E19 A;  1FEX A;  4BY1 J;  2GUH A;  2DMU A;  2VUM J;  3ZQG A;  3HGG A;  3LHQ A;  3BR0 A;  1VI0 A;  2AHQ A;  3HEF A;  4UUS A;  3QBM A;  2REK A;  3BRU A;  4A3C J;  3IV5 A;  4RBO A;  3C2B A;  3RZO J;  3JRB A;  4GFB A;  4X6A J;  5M5Y J;  1WH7 A;  3JR9 A;  3GTM J;  3VVX A;  1NTC A;  3QQA A;  5K7Z A;  3A02 A;  3M4O J;  1I6H J;  1ZTR A;  4MFE A;  2XPU A;  4JYK A;  4M3G A;  3P9T A;  1VFC A;  3PO3 J;  2P81 A;  1A6I A;  5CW8 A;  1JKQ C;  4JL3 A;  2Y0S N;  2UXI A;  1HOM A;  4A3E J;  1IDY A;  3FIW A;  4GCK A;  5EZH A;  1IGN A;  2ME0 A;  2NP5 A;  2XGD A;  1Q1V A;  3TW6 A;  2DA1 A;  5C4X J;  1IV6 A;  1X2N A;  2HYT A;  1B72 B;  3G56 A;  2HXI A;  5F27 A;  4B4C A;  4XRS A;  3GTL J;  2QKO A;  2CRG A;  2LP0 A;  4UUT A;  3S2H J;  5FLV A;  2DA4 A;  4BKX A;  5E3O A;  2EQR A;  3DCF A;  1ZR2 A;  3ZQC A;  1YRN B;  3NRG A;  2DG8 A;  4YZE A;  4GCL A;  3NXC A;  4PXI A;  2E2J J;  4A3I J;  3BTI A;  2JWT A;  1ZR4 A;  2X9D A;  1TWG J;  4IHY A;  1MBK A;  3PPB A;  3CDL A;  1LFU P;  3IH2 A;  1FTT A;  4KWA A;  2NVY J;  4QIW N;  3TP3 A;  1MNM C;  2B63 J;  4FCY A;  3WHB A;  2QCO A;  2Q24 A;  2JN6 A;  1MBF A;  3BQZ A;  3S1Q J;  2NP3 A;  1YRN A;  3W6V A;  5IP6 A;  5M3M J;  1D5Y A;  2CUF A;  1WPK A;  3CWR A;  1BA5 A;  1SAN A;  3O8H A;  5EGO A;  2NVQ J;  3CJD A;  1JKP C;  3BT9 A;  1WCM J;  4V2G A;  4BBR J;  3S1R J;  2YVE A;  1HLV A;  3VIB A;  2L7M P;  2VKV A;  2DJN A;  3ANG A;  3VUQ A;  2X6O A;  2HOA A;  3HB9 A;  2ZCM A;  1X58 A;  3OIO A;  2IU5 A;  5HAW A;  2XRL A;  5FLM J;  5EFY A;  3G1O A;  2L7F P;  5C4J J;  3RKQ A;  5F1J A;  3HE0 A;  2CJJ A;  3ZQI A;  3HOZ J;  4B3A A;  2NX4 A;  3K7A J;  1XC5 A;  2XPW A;  1ZKG A;  3ZOB A;  3PO2 J;  3RH2 A;  2DN0 A;  5DTD A;  1JTX A;  2FQ4 A;  1ETX A;  1Y1W J;  3S1M J;  2OER A;  2DMT A;  1BW5 A;  1B8I B;  4Y52 J;  3FIS A;  3HOV J;  5E3L A;  4D5F A;  3HKZ N;  2MG4 A;  3MNL A;  5FGL A;  1BL0 A;  1VND A;  1Z0X A;  2Y30 A;  2YVH A;  5K58 A;  4EEF G;  2GM4 A;  1X2M A;  2YS9 A;  1OFC X;  1GV5 A;  1WGX A;  4X1E A;  3V78 A;  2HXO A;  3E7L A;  5DAJ A;  2FD5 A;  5F0F A;  3QPS A;  1ETK A;  2O7O A;  1G2H A;  1RET A;  3MKL A;  2EZI A;  3DPJ A;  2JA7 J;  3E7Q A;  2Y9Z A;  4D7M A;  1NK3 P;  2GBY A;  1VF9 A;  1OCT C;  3B6C A;  5IPA A;  3VP5 A;  1WI3 A;  3SDG A;  1TWF J;  4MIM A;  1Z77 A;  5FKM A;  4FE4 A;  4C3H J;  3BTC A;  1U9O A;  2ECC A;  1DU0 A;  2RAE A;  3JRC A;  2HOS A;  5FKN A;  3TP0 A;  1TWH J;  2RAS A;  3B81 A;  2KT0 A;  1MBJ A;  4HNV A;  3NAR A;  2E1O A;  3D1N I;  3HOU J;  3ANP A;  1F36 A;  3LJL A;  2DA2 A;  3IH3 A;  1ETO A;  5IYD J;  2WB1 N;  2LR8 A;  5E3N A;  3H3V K;  2JMW A;  1POG A;  2R5Y B;  3S2D J;  1AHD P;  1HDP A;  5EGO B;  3O60 A;  4JNN A;  4MO7 A;  4DW6 A;  2FJ1 A;  4JX4 A;  4XRS G;  3ZQL A;  1IJW C;  1ORK A;  1FJL A;  3DEW A;  3V6G A;  5M5W J;  5GPA A;  2G0E A;  1JT0 A;  3KKC A;  1GUU A;  2XPV A;  3NI7 A;  1RR7 A;  3AQT A;  5IYB J;  2DA3 A;  1IC8 A;  2M0C A;  3BG9 A;  3JRE A;  3JSJ A;  3LSG A;  4M3D A;  2G7L A;  2EZH A;  3GTG J;  2UXU A;  3GTQ J;  3VOK A;  2Y31 A;  2UXO A;  4IEJ A;  4GCT A;  1JUS A;  2GLO A;  1WH5 A;  3CMY A;  3BR6 A; 
#chains in the Genus database with same CATH topology
 1HQC A;  1FBS A;  1ZGJ A;  5HS9 A;  3CO6 C;  1IDZ A;  2G7H A;  1VZ0 A;  2WAE A;  3E6D A;  4RAG A;  4M3B A;  4Z6Y A;  3T1B A;  2XB5 A;  2ZXH A;  3KIO A;  2E1M C;  2MYS A;  5CVI A;  1VQN I;  4GYG A;  1OCR H;  1E3P A;  3HRS A;  1RKW A;  2LSO A;  1OCP A;  3F3X A;  5KAF C;  3E5U A;  3KFW X;  2LDU A;  1MBG A;  4YFX F;  2EIJ H;  4HZF A;  3F72 A;  4XRF A;  5E3M A;  1UI5 A;  5D19 A;  2YX7 A;  1U0J A;  4B8X A;  1T95 A;  3CUQ C;  1JTY A;  3CJT B;  5K7F A;  2QTQ A;  1A31 A;  5K5O A;  2GA1 A;  3LSJ A;  1OYY A;  2DDB A;  1R4M B;  2XAU A;  3P9C A;  4GDF A;  4AYB A;  4D5C A;  1WZ2 A;  4QTR A;  2OQR A;  4NDL A;  4XL9 A;  4P9U A;  1FBQ A;  3QPT A;  3A0B C;  3R60 A;  5GAG J;  3ABK H;  3ROU A;  3T0Y A;  2HEO A;  2CSO A;  2CV2 A;  2R7D A;  5HNF A;  2UXH A;  3VVY A;  3BOQ A;  3MMY B;  3JSP A;  3COA C;  1D1B A;  1R6R A;  5E1W A;  3HGY A;  4EJV A;  1U5T A;  3TED A;  2H27 A;  4CCL A;  3H5A A;  3KPH A;  2YX4 A;  1YS7 A;  5F6F A;  3CCU I;  2VQG A;  3DBH B;  2VE9 A;  4A0Y A;  4MGR A;  2W53 A;  1FY7 A;  1XD7 A;  2XVC A;  3VWB A;  3P5J A;  1JXS A;  1FYL A;  2DA6 A;  2HYF A;  2ZOZ A;  3A2K A;  2WAF A;  4L5I A;  4IRG A;  2Y48 A;  2EV0 A;  3WG9 A;  2ISZ A;  4AVZ A;  3JRD A;  3F0C A;  2XGE A;  3W2V A;  4EJW A;  2M34 A;  2UXP A;  4H4K C;  2I5U A;  3K2Z A;  1PUF A;  1BOA A;  3C2H A;  4I6Z A;  1S3J A;  4BAC A;  1W36 C;  2KRH A;  4M73 A;  2R3S A;  2ZXI A;  4W97 A;  1I3A A;  3LOC A;  3ZQF A;  1X3U A;  3M1E A;  4DNC A;  3RIR A;  2K9Q A;  2VJ5 A;  4RB3 C;  4N0B A;  5BQT A;  1TW2 A;  4L18 B;  3GUD A;  1HSJ A;  2ZSH B;  3ZQH A;  2HTS A;  2FEZ A;  3ERM A;  1BM9 A;  2ZXJ A;  3HRM A;  5D6E A;  2AO9 A;  2QIB A;  2KRF A;  3HTA A;  4KFC A;  3L9F A;  3ELK A;  3GWZ A;  1MBH A;  1D3Y A;  2IGO A;  1XPX A;  2STT A;  3OL3 A;  4M9S A;  4PSW A;  3ULQ B;  3LSR A;  4BS9 A;  1SGM A;  3JRA A;  4MFD A;  2ELK A;  4G9Y A;  3HIF A;  2DQR A;  4XOR A;  2XAH A;  2K85 A;  2M3A A;  2EV6 A;  5AQC A;  2D2W A;  1Y6I A;  2CQQ A;  1H88 C;  2CFO A;  3O8G A;  1V55 H;  3BJA A;  5D18 A;  4EJT A;  3E6M A;  1YX5 A;  3KYD B;  5HSZ A;  3JAM Z;  2NVT J;  4ZDO A;  2Y0M A;  1R9T J;  4V2F A;  1GV2 A;  3OYF A;  2RGV A;  3BR1 A;  1X1B A;  2XF6 A;  1I6X A;  3DLA A;  4AYB N;  4U7D A;  2H94 A;  2IS2 A;  2FNA A;  4IOC F;  1ZG3 A;  1SFO J;  3FHN A;  2A2F X;  2O61 A;  2AS5 F;  5E79 C;  4L5E A;  4ZJZ A;  1SEU A;  3F8B A;  3IUV A;  2MBF A;  3PIP F;  3HTS B;  1R00 A;  1MDM A;  2EFW A;  2L5Q A;  1JJ6 C;  1GVJ A;  2ME6 A;  2DFH A;  3HOX J;  1QNT A;  2GAU A;  2ESH A;  3TDZ C;  2JUG A;  1QVT A;  3HPH A;  4AIK A;  4XIC A;  5IOZ A;  2STW A;  1DU6 A;  5LEK A;  4P5O A;  2LTP A;  2LY2 A;  2V1N A;  4JX5 A;  3VB2 A;  3OYL A;  2DPU A;  2C6Y A;  3KZ9 A;  1LJ9 A;  2K4B A;  4HQE A;  3W2A A;  5IP9 J;  2RV8 A;  4M3E A;  3P7N A;  5FMP A;  3Q0W A;  2XDV A;  2VOD A;  2EZK A;  3GYH X;  2BY1 A;  1IRZ A;  4YIF A;  2HI3 A;  3WG7 H;  5JLX A;  2WB1 A;  3HUG B;  2M2E A;  2ZB9 A;  4C2M J;  5J8F A;  3CC7 I;  3U1K A;  3L2V A;  1TW3 A;  2XB0 X;  1MGT A;  3H1C A;  1HKT A;  3HSE A;  2OF7 A;  2CQN A;  3K1N A;  4ZTF A;  2UUZ A;  5HLT A;  1LEA A;  2ZO4 A;  4IHV A;  1K83 J;  3KZI C;  3MAJ A;  1PP8 F;  1P7J A;  3H35 A;  4A3M J;  1MZB A;  1W0T A;  5IYC J;  3CME I;  3S15 J;  3BRO A;  3BJO A;  3W6J B;  3RSN A;  2FQ3 A;  1MMG A;  3GEU A;  3FK6 A;  1FBU A;  1OCO H;  2CG4 A;  2Q1Z B;  1XGO A;  2HOE A;  1IRF A;  4CXF A;  2EJR A;  1VQL I;  1N75 A;  2Y75 A;  4U87 A;  4QSH A;  1MMS A;  4B3X A;  5HOO A;  2QQA A;  1A04 A;  1AKH B;  2UZK A;  2XDN A;  4DYC A;  1R1U A;  1JGG A;  2Y69 H;  4XM3 A;  2VBW A;  2FU4 A;  3DXJ F;  1PUF B;  1S29 A;  3DP7 A;  3HTH A;  5EZG A;  2VIX A;  2E2H J;  2R4G A;  4CH7 A;  5KNL A;  1JT6 A;  3BG5 A;  4RB2 C;  2F5V A;  4AF5 A;  1VQ7 I;  3OIP A;  5EYR A;  5D5U B;  1FLI A;  3BTL A;  1P9Q C;  1QPM A;  2RKH A;  1BBY A;  4F91 B;  5HLI A;  2IA2 A;  3FBN B;  5IP7 J;  2P6T A;  3ABM H;  3E97 A;  4I99 C;  4RMN A;  3VYU B;  4BE0 A;  3EUP A;  2Z9O A;  2XV4 S;  1R49 A;  4M71 A;  3QYE A;  2KPM A;  1HA8 A;  4KIT B;  2M4K A;  3FMQ A;  1OCZ H;  2P6S A;  2R92 J;  3D5L A;  2CQ7 A;  2HWV A;  4AC0 A;  4ANJ A;  4BH9 A;  2AQF A;  1LFP A;  2G9W A;  3HSR A;  3OIQ A;  4OD4 A;  1UJ8 A;  1Y0N A;  3BR5 A;  3MFK A;  1WKM A;  4ABZ A;  1CQT A;  2E19 A;  4BY1 J;  4IOA F;  3WTX C;  3LHQ A;  3BR0 A;  1G3Y A;  2AHQ A;  3HEF A;  4AID A;  4BJT A;  3QBM A;  3BRU A;  3ZP5 A;  3DWL E;  2Q8K A;  4NC8 A;  4RBO A;  3PL8 A;  2BY0 A;  3J7Z I;  3JRB A;  4GFB A;  3RZO J;  1P4A A;  3JR9 A;  3ZGK A;  3VVX A;  2AQE A;  5IT9 K;  2CYY A;  5K7Z A;  3M4O J;  3PSI A;  1I6H J;  1ZTR A;  1YI2 I;  2PQ8 A;  1FYM A;  2QBY A;  3C1D A;  3ZMD A;  2XPU A;  3OYE A;  4A12 A;  1RRJ A;  3EUA A;  2OZ6 A;  3DTK A;  4M3G A;  1ZAR A;  3OL4 A;  3BG7 A;  5B3S H;  4BXF A;  2KIS A;  2VJI A;  2Y0S N;  4LB5 A;  2COM A;  1FSH A;  4LG0 A;  2GIV A;  1IGN A;  1QZE A;  1DPR A;  3M07 A;  1Q1V A;  3TW6 A;  3V4G A;  5C4X J;  1IV6 A;  1B72 B;  4E4H A;  1TBX A;  3CO7 C;  4ZYD A;  2QLZ A;  4CCK A;  2CRG A;  2IS6 A;  2XRN A;  3KET A;  4UUT A;  3S2H J;  2YU3 A;  5E3O A;  2EQR A;  3DCF A;  5FD6 A;  5HS7 A;  1MJA A;  1Z1D A;  2NXN B;  2EIN H;  2QQ8 A;  1A35 A;  1D0Y A;  4HW0 A;  2H8W A;  1I27 A;  1X1A A;  2M8E A;  3K8P C;  2M7A A;  1IN8 A;  4XR6 A;  2JVG A;  2E2J J;  1PVE A;  4PXI A;  1UHW A;  2DXI A;  4IHY A;  1MBK A;  3H5R A;  2CGP A;  1LVK A;  4RA2 A;  3OYD A;  1N78 A;  3L2Q A;  2DFE A;  2B63 J;  3VYT B;  3WHB A;  1MBF A;  3BQZ A;  2NP3 A;  2HYG D;  2VXD A;  1QA6 A;  3W6V A;  1ZYR F;  3F8C A;  3IWF A;  4OAY A;  5CVV A;  1I5Z A;  4MHG A;  2NNY A;  3FXR A;  1YTY A;  1YLF A;  3OYI A;  4Y13 A;  2BV6 A;  3CWR A;  1BA5 A;  1FZP B;  3BZK A;  3PQK A;  5EGO A;  2NVQ J;  1JKP C;  3BT9 A;  2CV0 A;  1O7L A;  3S1R J;  3H92 A;  1K4T A;  3ZXS A;  3CP8 A;  3CLO A;  5JVT A;  4MTD A;  4WWC A;  2X6O A;  1W5C C;  1JE8 A;  4UVC A;  2X6W A;  3LA3 A;  4YII A;  4BXU A;  5HAW A;  3CDH A;  2WWY A;  3HE0 A;  2JSC A;  3T5X A;  1S9H A;  4CCM A;  2NX4 A;  1ZKG A;  2ZXW H;  3L2U A;  2DN0 A;  3CCQ I;  1Z67 A;  1Y1W J;  1KU9 A;  1R5I D;  3FXO A;  1X3W B;  1R4N B;  1W5T A;  2QBY B;  1VQM I;  5KHD A;  1YW7 A;  1RIO H;  4RM2 A;  2MG4 A;  4L9T A;  1W36 D;  5FGL A;  2XAS A;  2CFX A;  1VND A;  3QOD A;  3L2R A;  2LF7 A;  2YS9 A;  1OFC X;  3V78 A;  4M72 A;  5D5X B;  4D9J A;  1OCC H;  5H6R A;  2OAZ A;  4X0G A;  4ETS A;  4OWR B;  2FD5 A;  5J40 A;  5CQG A;  2EZI A;  3DPJ A;  3S93 A;  2H6C A;  4PJM A;  4YFN F;  2LOO A;  1OCT C;  3B6C A;  2M4G A;  3J81 Z;  3I56 I;  1TWF J;  5ILV A;  1EH6 A;  2JA2 A;  2ZBK A;  4FE4 A;  4O5V A;  2TDX A;  5FKN A;  2HVS A;  2RAS A;  1G6N A;  2KT0 A;  4XLP F;  3B81 A;  4HNV A;  3CES A;  1F36 A;  1ETO A;  4HV5 A;  2QUF A;  4NC7 A;  5FO5 A;  1ZG1 A;  5DV5 A;  1POG A;  1AHD P;  1HDP A;  3RDI A;  4MO7 A;  4XRS G;  1XSV A;  1IJW C;  3VTI A;  4UUV A;  2RQQ A;  2Z33 A;  3MCZ A;  5GPA A;  4IPA A;  4NQW A;  3K1P A;  2G0E A;  3DV8 A;  4XN3 A;  2AXT C;  2A61 A;  3CUQ A;  4NC6 A;  3FXQ A;  2VKD A;  1IC8 A;  2P5V A;  2DQL A;  1HW5 A;  4EGY A;  3VDX A;  3U1D A;  2VB6 A;  2UXU A;  1J0R A;  3DEE A;  3M8J A;  1V5F A;  3ML6 A;  4IEJ A;  4CO8 A;  3K4N A;  3IL2 A;  3DEU A;  2GLO A;  3FMS A;  1F4K A;  3VOD A;  1JKR C;  1E17 A;  5FHP A;  1S8N A;  2HZT A;  2Q2E A;  2R7O A;  1ITY A;  3K6G A;  2WV1 A;  4DYR A;  2VE8 A;  3M9A A;  4YRV A;  3AL0 B;  1K61 A;  2HKO A;  2RRE A;  2XSJ C;  1DGW Y;  4EM1 A;  5EF6 A;  2D1V A;  3I4M J;  1J09 A;  5F08 A;  4Y33 A;  2FUG 2;  3ABL H;  5C44 J;  4LIT A;  2FJI 1;  2XF5 A;  4LJZ F;  3SEQ A;  3VPR A;  5ICG A;  1YW9 A;  3C07 A;  3LSI A;  4I09 A;  3PAS A;  1PYV A;  1IUF A;  2K40 A;  5HDK A;  2G3B A;  3I58 A;  2HQR A;  3GVA A;  5H20 A;  1GVD A;  2V4J C;  3IP4 B;  5EEA A;  2L9R A;  4E7J A;  1XMA A;  1FC3 A;  1IF1 A;  3NPI A;  1VQ5 I;  4ENK A;  4A3F J;  2L0K A;  1F43 A;  2K9S A;  4JP0 A;  5L3B A;  3O3K A;  2G7G A;  4UDS A;  2HQ5 A;  4WCG A;  2P8T A;  3G7R A;  2KHM A;  3OS2 A;  1AOY A;  1S7A A;  2HQN A;  3EQL F;  4S0H B;  1R7J A;  2FBQ A;  2CW7 A;  2DTR A;  3RTR A;  3H3Z A;  2EH3 A;  2O9L A;  4DQ2 A;  2DPD A;  4HRI A;  1H9G A;  1EH7 A;  5AIQ A;  3ZQ7 A;  3RQI A;  5GPC A;  1TLH B;  2ETH A;  2BHZ A;  4XQF A;  2DA7 A;  3DTI A;  4E7Z A;  1YYV A;  2RN7 A;  1UI6 A;  2JJ7 A;  1MMA A;  4RGS A;  3L2C A;  3MKW B;  1KQ9 A;  3OV8 A;  4HX4 A;  3ZMU A;  1OYW A;  5JLW A;  2KDZ A;  4PGH A;  3GZ5 A;  3QOP A;  3S32 A;  3S5R A;  3MEX A;  5CYV A;  4Y17 A;  2DMN A;  1ETY A;  2DI3 A;  2O03 A;  3M1C A;  1IV8 A;  2FBK A;  4A3L J;  1XG1 A;  1WI9 A;  1FIP A;  2IA0 A;  2GIZ A;  2Q2E B;  4IF4 A;  3EUH A;  5F04 A;  1T56 A;  3QAH A;  1F1Z A;  4KT5 C;  2DMP A;  3AG2 H;  5M3F J;  3A1Y A;  5BOX A;  1UHS A;  1KGS A;  4JK1 X;  3MWM A;  4B1R A;  2A3S A;  2V1X A;  3WTW C;  1Z9C A;  2GXB A;  2Y9Y A;  3KEQ A;  4BEH A;  3KP5 A;  3REO A;  1V3F A;  2BW3 B;  1MNE A;  3OYB A;  4GFK A;  4AUX A;  3OYK A;  4BAY A;  4OIR F;  4XN0 A;  3SHF A;  3AAF A;  3E6C C;  2X4H A;  1LKX A;  2VC0 A;  3AFH A;  3W6K B;  1T8I A;  3FKI J;  1XCV A;  2W00 A;  2LY1 A;  2HYJ A;  1B9N A;  3BZ6 A;  2OD5 A;  5EDN A;  3HTJ A;  2IW5 A;  5E20 A;  4I7H A;  1WJC A;  3OSG A;  1T08 B;  4HEA 2;  3T8T A;  4A0X A;  2OCE A;  2H1K A;  5BS6 A;  2EWN A;  4A6E A;  4BNC A;  5D5V B;  3BY6 A;  1TQM A;  3I4P A;  1EF4 A;  4M6X A;  3WGI A;  2YVX A;  4FE7 A;  2A6E F;  5D5W B;  3LSP A;  5J6X A;  2LKX A;  3S3N A;  1BI3 A;  1I3Q J;  2YSR A;  2IGM A;  1UZC A;  3K69 A;  1FP2 A;  4A3J J;  1TQP A;  1JKO C;  1X1P A;  2PLY A;  2LBF B;  3CC2 I;  4YIR X;  2CS3 A;  3J80 K;  4OIQ F;  2E35 A;  2LVS A;  2E7X A;  1J59 A;  4L0Z B;  2A6H F;  3JRF A;  3FBI B;  3COL A;  3B6A A;  3HOT A;  1H8A C;  4BY7 J;  4CCN A;  3BNI A;  1R22 A;  1QPI A;  1QHH D;  4MLO A;  2EZL A;  2GA2 A;  3P9K A;  5KCM A;  1QRY A;  2PI0 A;  2LMD A;  2P0W A;  1XGS A;  3DBL B;  1XS9 A;  4FX4 A;  5FB2 A;  3IAS 2;  3VVZ A;  3FM3 A;  3ERE D;  2JRT A;  3OYG A;  3EYI A;  4G8X A;  4ZYG A;  4A3K J;  2JA8 J;  2OC6 A;  3ECO A;  1MH3 A;  2G7S A;  2CUZ A;  1SD7 A;  3PNV A;  4U7B A;  5H9T A;  2DK8 A;  4U0V A;  4P9F A;  4A3B J;  1T39 A;  4C9Y A;  3M7G A;  3OS0 A;  2D6Y A;  3ON4 A;  1WFX A;  3WE2 A;  1FTZ A;  5CXI A;  5E17 F;  2FNP A;  3H5N A;  2ZSI B;  3KEY A;  1CGP A;  1B8I A;  1KYW A;  3I53 A;  2RHA A;  1R23 A;  2ELJ A;  3EYY A;  3GO5 A;  2E71 A;  3FM5 A;  3Q0U A;  1FIA A;  3GTJ J;  3SJM A;  3AQS A;  3N4M A;  3AG1 H;  4HX7 A;  1FMW A;  4CSW A;  4G6T B;  2Z99 A;  2QEN A;  3KP6 A;  3VW0 A;  3EDP A;  2LFB A;  3W2W A;  1UMQ A;  1B9M A;  2IAI A;  2JT1 A;  2L9V A;  3OR2 C;  4N9I A;  4Y7N J;  3HOS A;  4CYC A;  4OIN F;  2R5Z B;  3HHH A;  1ZQ3 P;  4HV6 A;  5HOD A;  2DTZ A;  1DGR M;  3NAU A;  4HAM A;  2NOG A;  4XMY A;  3FMR A;  4RLF A;  2EIM H;  5DCM B;  2HKU A;  2AXL A;  3VSK A;  3HRU A;  1T6S A;  1MMD A;  2VON A;  4A3G J;  2MC3 A;  2QM3 A;  4ESF A;  4E70 A;  2D5V A;  1S7E A;  2X1D A;  3LAJ A;  2R7U A;  2VT2 A;  1XN7 A;  3MVP A;  3EPZ A;  4M3F A;  4DOZ A;  3NS4 A;  4XKC A;  3V8L A;  5AIP A;  3S2W A;  3QWL A;  4HST A;  3BCG A;  3GF2 A;  2R7W A;  4OIO F;  5D1R A;  2WY8 Q;  1YS6 A;  2ZJQ F;  3BJ6 A;  5KVR A;  1ZGW A;  4DZJ A;  3M3Y J;  4C3J J;  4BXX J;  3FXL A;  3BR2 A;  2VI6 A;  3I64 A;  5IT3 A;  2Y2Z A;  1TWC J;  1DP3 A;  4XKV A;  1YJW I;  2DU9 A;  2E36 A;  2H8R A;  1K78 A;  2DK5 A;  3JAM K;  5DDG A;  4HDU A;  2OQG A;  2M1B A;  4HKU A;  4IVN A;  4OAZ A;  1LNW A;  3BG3 A;  2E7W A;  2HFH A;  2QA4 I;  2DYR H;  3DPT A;  1RUO A;  1IN4 A;  2GZW A;  2JRM A;  3K2A A;  4XRM A;  2X1E A;  4PCQ A;  1O3Q A;  3QYB A;  2IGN A;  3E1S A;  3H0G J;  4D7N A;  3UKG A;  4B48 A;  1JUP A;  2CO5 A;  4XOT A;  3BPX A;  4BQN A;  4HDV A;  3LWF A;  3GFM A;  4K2E A;  3TBI A;  1FEX A;  2KP6 A;  2GWR A;  2G7U A;  3HGG A;  3ZQQ A;  4A0Z A;  1ON2 A;  1VI0 A;  4BUP A;  3LST A;  4UUS A;  4AVP A;  2REK A;  2OJE D;  4P1W A;  4BGD A;  4E7K A;  4AM3 A;  1PJR A;  3PJR A;  5LHG A;  3FF5 A;  4X6A J;  3MZ8 A;  3GTM J;  3FXU A;  3QP5 A;  1XMK A;  2ZJP F;  2XAJ A;  5FFX A;  3PO3 J;  4Y3O A;  3SZT A;  1VQO I;  3WTV C;  4G6Q A;  5CW8 A;  5ICE A;  2XGX A;  1HOM A;  3SXY A;  4KJZ A;  3CD6 I;  2VOO A;  2L02 A;  4U0Y A;  2OZU A;  4HBL A;  1E3H A;  2B9S A;  1REP C;  2VC1 A;  2XGD A;  3T8R A;  3G56 A;  2HXI A;  4ITV A;  3TO9 A;  4B4C A;  4EJU A;  4XRS A;  2V6C A;  1W5S A;  5LLQ A;  5FLV A;  2K3P A;  3HPG A;  2X1C A;  2DA4 A;  4BKX A;  3NRG A;  2WAQ A;  1ZR2 A;  1GHC A;  2XAQ A;  3AG4 H;  3K9T A;  2R7X A;  3TDU C;  2JVH A;  4A5M A;  3RKW A;  2IVM A;  3BTI A;  2JWT A;  4E7L A;  1TWG J;  1BOB A;  1XTA A;  4RB0 A;  4BYY A;  2DOD A;  1KYZ A;  3PPB A;  3C3W A;  1XDU A;  3IH2 A;  1FTT A;  1O7F A;  3VEP A;  3SWH A;  2NVY J;  1FOK A;  2DDA A;  3IKV A;  3QU3 A;  2M0M A;  3G3Z A;  1MNM C;  5D8K B;  4FCY A;  1ZRD A;  3DFG A;  2JPB A;  4J01 A;  1X4P A;  2FA5 A;  1I1S A;  1KQ8 A;  2JN6 A;  2CW8 A;  2X85 A;  2E1N A;  1QGP A;  1W1W E;  1X19 A;  2XAF A;  2HNH A;  5M3M J;  3MZY A;  2CUF A;  4LLL A;  2OUM A;  5DEQ A;  1WJD A;  4YFK F;  3W3C A;  3ASO H;  2JPC A;  3GFJ A;  3G73 A;  1ZH5 A;  3CJD A;  1MND A;  3F8N A;  1P2F A;  3WOD F;  2LF8 A;  4BBR J;  2YVE A;  4QPO A;  1HLV A;  1SD6 A;  1Z7U A;  3VIB A;  1S6L A;  5B1B H;  2W82 A;  4RGU A;  2IA1 A;  3ANG A;  3VUQ A;  3OIO A;  4Y15 A;  3SDB A;  3FXK A;  3PSF A;  2X6X A;  2XRL A;  2EIL H;  5FLM J;  3SZG A;  2DFI A;  2L7F P;  4R79 A;  3RKQ A;  1VQ4 I;  5L3F A;  2L54 A;  1ZLJ A;  3TGN A;  3K7A J;  4G6D A;  4CUG A;  2LRE A;  3ZOB A;  3PO2 J;  1YFH A;  5DTD A;  3RH2 A;  1JTX A;  5BMZ A;  4Q5S F;  2FQ4 A;  4A6D A;  3S1M J;  1DUX C;  3QYF A;  1BW5 A;  3S3M A;  3LSM A;  5E3L A;  4D5F A;  2BXZ A;  3DKW A;  1SD4 A;  2BHY A;  2BY3 A;  4BE1 A;  5FGM A;  4KIS A;  2DT5 A;  3MNL A;  4HNT A;  2O5R A;  1Z0X A;  2Y30 A;  2F5F A;  1D1C A;  2OU2 A;  2FF4 A;  1KZH A;  4EEF G;  5K58 A;  1UCR A;  3UR3 C;  5DAJ A;  2ZKZ A;  1BR4 A;  4CZZ A;  4UV8 A;  4IQJ A;  2PJR B;  3QPS A;  1ETK A;  3X2Q H;  3S3O A;  1RET A;  3MKL A;  3FX3 A;  1Z3X A;  2ZY9 A;  3KLN A;  3CCV I;  1TNS A;  3L2W A;  1TT0 A;  1VF9 A;  1BR2 A;  2LNB A;  2VQC A;  4EGZ A;  2MLG A;  3SDG A;  1PP7 U;  3R61 A;  2MH2 A;  4IXA A;  4FET A;  4C3H J;  2ECC A;  4MQV A;  1DU0 A;  2RAE A;  3CF5 F;  5HNH A;  5J4Y A;  2HU9 A;  2QQB A;  1MBJ A;  3C7J A;  4MNU A;  3KX2 A;  3HOU J;  3ANP A;  2GOX B;  2F48 A;  2DA2 A;  1XMX A;  3IH3 A;  3A0H C;  2F6C A;  2M30 A;  1XCB A;  4RAZ A;  5DCF A;  5E3N A;  4Q4Z F;  3H3V K;  3PFY A;  1FOY A;  3O60 A;  3CCS I;  4JX4 A;  1TL8 A;  1FT9 A;  4R8H A;  1ORK A;  1J2X A;  1O57 A;  1B59 A;  3GW2 A;  1LDK B;  3DLL F;  1V54 H;  1GUU A;  1YX3 A;  4EVI A;  1X3Z B;  1EA3 A;  1L0O C;  2DBB A;  4WK8 F;  1NHA A;  2IJL A;  3NI7 A;  1RR7 A;  2MA3 A;  2DA3 A;  4ON0 A;  2VL8 A;  1IN6 A;  2NVU B;  4RAF A;  4QLC U;  4WIB A;  2WA0 A;  3JRE A;  3LSG A;  3L00 A;  4M3D A;  2G7L A;  2EZH A;  4DBQ A;  3GTQ J;  3VOK A;  2Y31 A;  4BE2 A;  3L7W A;  4KMF A;  2KJB A;  4JQF A;  5F1R A;  2D1H A;  4M74 A;  5IT9 Z;  4ZDL A;  2N8G A;  3CMY A;  1B72 A;  5J4V A;  3BHQ A;  4J19 A;  1BW6 A;  1Z6T A;  2MH9 A;  3EUK L;  5JR3 A;  3GME A;  1HST A;  1USS A;  2ZNY A;  3SFZ A;  4L5J A;  4LG0 B;  2DO7 A;  2DT7 B;  1E2X A;  1NH3 A;  2QYO A;  5CVJ A;  2R7V A;  1IXC A;  3BCA A;  3E5Q A;  2NOJ B;  4D0P A;  4W1U A;  3R0J A;  2K9N A;  3MQ0 A;  4FAS D;  3I59 B;  2VJJ A;  5J1Y A;  1H0M A;  1KQ0 A;  3MZH A;  2A69 F;  2R7S A;  4AD9 A;  3J7Y J;  1APL C;  4FQG A;  4B43 A;  4DJA A;  3DKY A;  4NNJ A;  3I3L A;  5J1R A;  4BBS J;  2DOE A;  2NS8 A;  5FRO A;  5FJ8 J;  3ON2 A;  4A5N A;  2J5P A;  4BQO A;  2VKH A;  2R7Z J;  4QPQ A;  1T98 A;  4A69 C;  4LLN A;  2CUE A;  3ZMT A;  4P96 A;  2EFP A;  3KZY A;  1FOW A;  2W25 A;  3FK7 A;  3LSK A;  1HCR A;  2IEK A;  2R7T A;  3M8F A;  1LEB A;  1EH8 A;  1R1V A;  3S16 J;  3U2R A;  2VLA A;  2YR2 A;  1S7O A;  2IRF G;  4G7O F;  1YHQ I;  2GQQ A;  4N4N B;  3VFZ A;  5HS8 A;  2BY2 A;  4PK4 A;  2Z16 A;  1IAW A;  4ZH4 F;  4F92 B;  2BOL A;  1PUE E;  3FWE A;  4ZZD A;  2GXA A;  2EBI A;  1TT5 B;  1M1E B;  1OIS A;  2EPF A;  4HA8 A;  5CVU A;  2KZG A;  5L3C A;  1BI2 A;  2Y0S A;  1YIT I;  4IJA A;  1B6A A;  4MK6 A;  3RYR A;  4A3D J;  5GAE J;  2DYS H;  1A5J A;  3KKD A;  3NEU A;  3BC8 A;  1TWA J;  1E3O C;  4I76 A;  2ZFU A;  3QP6 A;  2HGC A;  2CQX A;  3IKT A;  3RI4 A;  2M8G X;  3DPL C;  4DYQ A;  1MSF C;  2ZCN A;  3QPL A;  2PMU A;  1BJZ A;  2KIU A;  2MFZ A;  4C30 A;  2W57 A;  2XKP A;  4LMY A;  5GP9 A;  3T6N A;  3CUO A;  3BQY A;  2IS4 A;  1YO5 C;  1AKH A;  3Q3S A;  1OKR A;  2KRC A;  3HTI A;  2VBZ A;  4Y4R A;  4CDG A;  1D5V A;  3PM1 A;  3S1N J;  1V4R A;  2VOP A;  2HS5 A;  2DT6 A;  2RNJ A;  4BEH B;  4NBQ A;  1ZAO A;  5M5X J;  3CC4 I;  2CMP A;  3HTU A;  4XID A;  3HBL A;  3LQR A;  5E8I A;  4JX6 A;  5GAD J;  3HL2 A;  1JGS A;  2A6T A;  1HDD C;  2RNG A;  5J3L A;  1SFE A;  5H6Q A;  3OS1 A;  2V9K A;  2BVL A;  2A5W A;  3A03 A;  1QO0 D;  5CXG A;  2TCT A;  4G7H F;  3D0S A;  4UB6 C;  3B73 A;  2KIM A;  5CVR A;  4H0E A;  3KP7 A;  2K27 A;  1UEL B;  2L4A A;  3FXM A;  2BZT A;  4LLG F;  4ME9 A;  3VW2 A;  1RUN A;  3CCL I;  1P92 A;  5CLS A;  1KU2 A;  2ECB A;  2ZJ2 A;  3EUH C;  3KLO A;  1FMV A;  2XC7 A;  3FHZ A;  3IH4 A;  1XX5 A;  2NNN A;  3LNQ A;  1P4W A;  3QPH A;  5FD5 A;  5H2F C;  5EEH A;  3K4C A;  2XGC A;  2GEN A;  5GTH C;  4QWQ A;  3H3U A;  4B44 A;  1OJL A;  1MW7 A;  4MEX F;  5DM7 F;  1R5H A;  2A05 A;  2W48 A;  3HKZ A;  3L1P A;  1VQP I;  2MGQ A;  4RGR A;  1JHH A;  1SAX A;  2RQP A;  2X6Y A;  3ISP A;  5KK1 A;  5ICC A;  1Y39 A;  3HOW J;  1MH4 A;  4RDU A;  1Y56 A;  4BHB A;  2E5N A;  4HF2 A;  2EB7 A;  4OOI A;  3JRI A;  3KE2 A;  1WJF A;  2LY9 A;  4UXN A;  5B5E C;  2F5C A;  4O3M A;  2OV7 A;  1RC9 A;  4Z2Y A;  1STZ A;  3SYT A;  3S14 J;  5A2Q Z;  1UB9 A;  1XSD A;  2HVQ A;  2VBX A;  4DVY P;  3D5S C;  1JUM A;  2RC4 A;  3UNG C;  2VBY A;  3OOU A;  4U9L A;  2WY7 Q;  1O3T A;  1WJ5 A;  3E0J B;  2QSH X;  1J5Y A;  3K70 C;  1GLN A;  1LE8 A;  1ETQ A;  5FLX Z;  3OMY A;  3U21 A;  4BL0 B;  2OI8 A;  2A07 F;  2PBX A;  2P7C B;  4IQ4 A;  3BLY A;  4JBA A;  3Q0V A;  2EFO A;  5LGU A;  5C3E J;  2O7T A;  1C0W A;  5F0H A;  4FIS A;  2MD0 A;  4IZZ A;  5IOY A;  3CCY A;  3OYC A;  1GDT A;  1ZHF A;  2QVO A;  1WHU A;  2LD5 A;  3F6V A;  2E2I J;  4I0A A;  4ENN A;  1U78 A;  2DFF A;  2XSD C;  2DCE A;  3K4L A;  4CCJ A;  2GFN A;  1UG2 A;  5FKO A;  3RKY A;  3A01 B;  2ESN A;  3KEO A;  2L7Z A;  1R36 A;  1D0Z A;  4Q47 A;  3HZJ A;  1IUY A;  1ETV A;  4LIV A;  2M7B A;  5C4Y A;  2JA6 J;  2J5O A;  2ID6 A;  4NN1 A;  3LWJ A;  3R6S A;  3BR3 A;  4A93 J;  3LSH A;  4LOC A;  1IRG A;  3S17 J;  4YG2 F;  4IHX A;  3F6O A;  4OMY A;  3JSO A;  3HRT A;  3NNR A;  3AL0 C;  3OSF A;  2KZV A;  4M6Y A;  2WAD A;  1ZGA A;  4CYC B;  4HX8 A;  3G4S I;  2LC2 A;  4PGG A;  5L3E A;  2E1C A;  4RB1 A;  2IGK A;  4HPQ A;  4XON A;  2NRA C;  2FXA A;  1G3S A;  2K5C A;  3F9K A;  3HDD A;  1BJA A;  2ISY A;  1O4X A;  1XSX A;  2W24 A;  5LHI A;  3R4K A;  2L01 A;  3JCU C;  4YEL A;  4HLX A;  4KNY A;  1AA7 A;  1WQ2 A;  3V8K A;  2JQ7 A;  3F1B A;  3SFI A;  2VT3 A;  2BYV E;  1SVM A;  2V26 A;  2OA4 A;  2XUB A;  1TNT A;  2XHK A;  2D45 A;  1MSE C;  2PEX A;  3O2P E;  2ZME C;  4HQM A;  2YU9 J;  1LUJ B;  3TW7 A;  1Y8R B;  1RNL A;  3CCE I;  1OPC A;  2MAB A;  4I01 A;  2DMU A;  3WTZ A;  2VUM J;  3CCJ I;  3QRF F;  1K7A A;  3JW4 A;  1YIJ I;  5DUI A;  4OIP F;  2DOA A;  4A3C J;  4IO9 F;  5KAI C;  3IV5 A;  1LB2 A;  4KN7 X;  1BN5 A;  4XLA A;  5M5Y J;  1WH7 A;  1DP7 P;  1NTC A;  3QQA A;  1WJE A;  3A02 A;  2P4W A;  1O3R A;  2X0L A;  2V1D A;  5B66 C;  2E60 A;  3I59 A;  4GXO A;  2UXX A;  2QZ8 A;  4KIF A;  2KKO A;  2P81 A;  1A6I A;  1QQI A;  3QOE A;  3FXJ A;  4LGW A;  1G3W A;  1JKQ C;  4JL3 A;  5TIS C;  2UXI A;  3G2B A;  1FPQ A;  4RGX A;  1FP1 D;  2XKO A;  4NUB A;  2LBF A;  5LEJ A;  5EZH A;  2OTL I;  4M9X A;  4GCK A;  2NP5 A;  2B3W A;  2DA1 A;  1X2N A;  1WWX A;  2HYT A;  4XLF A;  1YW8 A;  3E5X A;  2EA4 A;  3CLQ A;  1YJN I;  1WSU A;  3GTL J;  4U9N A;  2LP0 A;  3TOA A;  3RKX A;  3V7C A;  2R7F A;  1BIB A;  4ZTJ A;  1YRN B;  3I0T A;  3ZQC A;  2DG8 A;  1SMY F;  2FBI A;  2XIG A;  3IRR A;  2XF7 A;  2L9S A;  5LBQ A;  1OR7 A;  4A3I J;  1VQK I;  4RAY A;  1KU7 A;  2X9D A;  2A5Y B;  3CDL A;  3I54 A;  1T38 A;  3K4J A;  4ENM A;  4KWA A;  2ZNZ A;  5HLG A;  4PJJ A;  5AON A;  2BW3 A;  2DOF A;  2HPI A;  4XSX F;  2BVM A;  4HF1 A;  4DBR A;  1YRN A;  5IP6 A;  1D5Y A;  3TMO A;  2B0L A;  4EJO A;  1UG0 A;  2W84 A;  3E6B A;  2P7V B;  2V7F A;  5DCM A;  1LQ1 A;  1WCM J;  1NG7 A;  1VQ9 I;  2BBY A;  1G4D A;  4G7Z F;  1U2W A;  1SMT A;  3F22 A;  1K79 A;  1LPQ A;  2HOA A;  1VTN C;  5JVG F;  2F2E A;  3HB9 A;  2ZCM A;  1X58 A;  3H36 A;  4E7S A;  5JFR A;  2K7L A;  5E8G A;  1YE9 A;  5EFY A;  3GCM A;  1EV7 A;  1XB4 A;  4WXC A;  3BZC A;  4CHU A;  1ULY A;  5D4R A;  2CJJ A;  4LK1 F;  4ASN A;  3ZQI A;  6PAX A;  1MMN A;  4B3A A;  5DUK A;  3HOZ J;  1VQ6 I;  2EFQ A;  1X4O A;  2Z1D A;  2HVR A;  2NS0 A;  1D1A A;  1OYI A;  3LFK A;  1SFX A;  4KIC A;  4DIQ A;  1B8I B;  4Y52 J;  2W4S A;  1IXS B;  3FIS A;  2PJR A;  3HOV J;  1RI7 A;  5DM6 F;  4P55 A;  4XLE A;  4U88 A;  4KT6 A;  5DYM A;  3HKZ N;  1JI8 A;  2X51 A;  4ZYH A;  1Z7L A;  2KL4 A;  1YOV B;  2KJC A;  4XLH A;  3V42 A;  2YVH A;  3ESW B;  3BCB A;  2RVC A;  1ZLK A;  1GV5 A;  4X1E A;  3K1M A;  1MKM A;  4Q48 A;  3CJQ B;  4B09 A;  4CGZ A;  1CF7 B;  4B47 A;  1U6G A;  1MIJ A;  4AU7 A;  2HTJ A;  2PMZ A;  4IHT A;  4LK0 F;  4AWX B;  1G2H A;  2K4J A;  2QKM B;  3E7Q A;  1T0F A;  4GYI A;  4D7M A;  2PFV A;  2GBY A;  3ZRG A;  1WI3 A;  5F64 A;  1Z77 A;  5FKM A;  4CZC A;  1Z05 A;  1IZ1 A;  3OWT A;  3ASN H;  5DD4 A;  4L0Y B;  3GFL A;  1TZL A;  2L7K A;  3HXL A;  3I9V 2;  4S04 A;  1YQA A;  2KFD A;  2WV0 A;  2H09 A;  2FSW A;  1FWZ A;  1F9N A;  2CH0 A;  5IYD J;  2WB1 N;  1HXD A;  3WU0 A;  1G3T A;  2VXZ A;  3Q5F A;  3DU5 A;  2BEO A;  4ZYE A;  2ELH A;  4ZDP A;  2R5Y B;  3MD2 A;  3S2D J;  4JNN A;  1QU3 A;  1P4X A;  4EV0 A;  2O0Y A;  2OBP A;  3OYJ A;  3DEW A;  3V6G A;  2K9L A;  1J9I A;  4NQW B;  4M9Z A;  2I8D A;  2JTV A;  2E1M B;  2KMU A;  4GCV A;  4L9N A;  1JT0 A;  2HR3 A;  2WTE A;  2O8X A;  3TKY A;  4MTE A;  5IYB J;  4F52 A;  3AQT A;  3PNY A;  2M0C A;  3SEZ A;  3BG9 A;  2MLK A;  3JSJ A;  5ERI A;  4IX7 A;  1MJ9 A;  2B7E A;  3IWZ A;  1T2K A;  4RS8 A;  2IP2 A;  2PJP A;  4IHS A;  2UXO A;  1JUS A;  3IRQ A;  3E3V A;  3ZCO A;  1WH5 A;  5LGT A;  4NEL A;  4NB5 A;  1MBE A;  3FKJ A;  2JZY A;  2DG7 A;  3DQV C;  2ICW G;  1HKS A;  4EM0 B;  4ICH A;  2TRT A;  2DJI A;  3DBR B;  3G1L A;  3ZMZ A;  2QKL B;  3GLL A;  3VOX A;  3U9G A;  4EQQ A;  1G8X A;  2X48 A;  4UNO A;  4UY8 I;  3HSF A;  3HUG A;  1ODD A;  3P9I A;  2XRO A;  3GZ6 A;  2DMQ A;  3QKX A;  2QWW A;  2LKS A;  3KP2 A;  3VSL A;  2JA5 J;  4CYD A;  5LHH A;  2QOP A;  4IHW A;  1Y1V J;  1NK2 P;  4V19 K;  1RES A;  1L3L A;  5HDN A;  3GEZ A;  4KIB A;  3RD3 A;  4PFP A;  1HW1 A;  1RPW A;  5LRS A;  2DAO A;  1MDM B;  4UUS B;  1QVU A;  5JI6 A;  2WGB A;  3H0D A;  5FKK A;  4UVA A;  1OQY A;  5CPR B;  1I39 A;  4WXH A;  1YJ9 I;  3DU6 A;  3J7A Y;  2M9H A;  2OTJ I;  4PSX A;  4HOB A;  4C3I J;  1DPU A;  3GFI A;  1XGM A;  2QQ9 A;  3ABT A;  4YEJ A;  3CQZ J;  1KU3 A;  2WAQ N;  5CJ9 A;  4LB6 B;  2O3F A;  3H9Q A;  4II2 A;  1YG2 A;  2WBM A;  3FRQ A;  2FMY A;  4PFO A;  4I98 B;  4FTH A;  3WTS C;  4L62 A;  4ENJ A;  3PIO F;  3A4C A;  2QF7 A;  1WJB A;  3BP8 A;  1KON A;  3K10 A;  5DD8 A;  2R7R A;  3GTO J;  4ACI A;  1QZY A;  4GFL A;  1K78 B;  1TC3 C;  1P7I A;  4XK4 A;  5EJC A;  2QWT A;  3M8E A;  2FBH A;  5EEG A;  2ZCX A;  3HC7 A;  2VQL A;  5EG0 B;  1TTY A;  1Q1H A;  2FOK A;  5ILS A;  3GZI A;  1RZ4 A;  3IAM 2;  3CCM I;  1VQ8 I;  5ICF A;  1R1T A;  4LIU A;  5JHF A;  2YPR A;  3C2G A;  2WUI A;  3NQO A;  3OYN A;  3EGQ A;  1J7K A;  3S8P A;  2BE5 F;  4C2U A;  5IY5 H;  3OR1 C;  3K4M A;  2JUC A;  1SFU A;  1ETW A;  3MN2 A;  3BTJ A;  3CUQ B;  4DZP A;  4HNU A;  1BC8 C;  3GTK J;  1QZZ A;  1SFK A;  1U9N A;  1V5E A;  1W7P D;  2MW8 A;  1I50 J;  1Y0U A;  1W7P A;  2HKX A;  2Z2S B;  1DQU A;  4KUM A;  1U8B A;  4KDP A;  2VN2 A;  3ZR8 X;  5FKL A;  4UB8 C;  1H9T A;  2FX0 A;  3ZMV A;  2R5Z A;  9ANT A;  2YUS A;  3JRH A;  1B1B A;  4F7Z A;  5BPD A;  3CDI A;  3Q9V A;  4KA4 A;  3HIM A;  4KIG A;  4DGW B;  2R5Y A;  1LFB A;  4HSR A;  1ACI A;  4E7I A;  3QU6 A;  4RM3 A;  2VPR A;  3CCR I;  1DDN A;  4CA0 A;  2V1U A;  2HDW A;  4PDK A;  4L9V A;  3JRG A;  1ZRF A;  3I4N J;  4CIC A;  4GRI A;  4R1H A;  4G94 A;  1ERD A;  3WGH A;  2LKP A;  3DPU A;  3KZZ A;  5K1Y A;  5J47 A;  1U5T B;  3LFU A;  5DS9 A;  4IRI A;  2L4M A;  3RPQ A;  2PZ9 A;  3EET A;  5BNG A;  3AG3 H;  3TL4 X;  4BHC A;  1MJB A;  3G6E I;  3GTP J;  5LFA A;  4LG3 A;  3DTE A;  5B1A H;  1LDD A;  2LLK A;  2DW4 A;  2NVX J;  2PG4 A;  3O6B B;  4HLY A;  4LFU A;  2QSG X;  3RZD J;  3KNW A;  2V57 A;  1TP4 A;  1GXP A;  2MSY A;  5GAH J;  4I02 A;  3ABU A;  1D8K A;  5D4S A;  3G1M A;  1D0X A;  5K5Q A;  5J1U A;  3RYP A;  3ZN0 A;  1NG6 A;  4EAT A;  3GXO A;  1BIA A;  5TGT A;  4G12 A;  3D5R C;  4HG2 A;  4IRH A;  4C2T A;  3F8F A;  3PNT A;  1FOX A;  1ZK8 A;  2CU7 A;  3B02 A;  1FX7 A;  4KMU X;  3J7A O;  1Y8Q B;  1ZN2 A;  3DF8 A;  4IKF A;  4MEY F;  2PBI A;  2W85 A;  1GT0 C;  3BDD A;  2HPM A;  1T33 A;  2COB A;  4PJN A;  3JTG A;  3CZ6 A;  5J8C A;  1U3E M;  2NS7 A;  4M6V A;  2FE3 A;  1ZRE A;  4JKZ A;  2F4M B;  3RCO A;  2LK2 A;  4LD5 A;  1ZG5 A;  1PDN C;  3GBG A;  2IT0 A;  3KYC B;  4AC6 A;  2L9N A;  4BJ6 C;  5HLH A;  2UWM A;  3WHC A;  2VJ4 A;  1FSE A;  4J00 A;  3KCC A;  3NRV A;  2ZME B;  1D8J A;  4KN4 X;  1BC7 C;  2HOT A;  2UV1 A;  3BJB A;  4S05 A;  2EV5 A;  2VKE A;  1XGN A;  3V7S A;  2B1E A;  1JJ8 C;  2ADU A;  5L3G A;  3HM5 A;  3OOP A;  1N25 A;  3LAP A;  4GGG A;  3I5U A;  4AIH A;  4TV7 A;  2IBD A;  2ID3 A;  2JK3 A;  4FX0 A;  1U8R A;  5ILU A;  2VPL A;  3VYR B;  2MC4 A;  4MXM A;  3PUB A;  1W4M A;  3I55 I;  2VQH A;  3ECH A;  2WC2 A;  3N97 A;  1IG7 A;  3TO6 A;  4BQQ A;  4F93 B;  1XDS A;  2Z5U A;  3TOB A;  4ESJ A;  1Z3Y A;  2I10 A;  2F07 A;  4OU0 A;  1BI1 A;  5FRN A;  1FNN A;  4CGR A;  1ON1 A;  1HF0 A;  2R93 J;  2R0Q C;  3A01 A;  1UHM A;  4PUS A;  3KP3 A;  1IRX A;  1UST A;  5K7H A;  1B4A A;  4A2U A;  2HDD A;  2O8K A;  4D1Q A;  3K70 D;  3HJE A;  3L09 A;  1H89 C;  1FYK A;  2ZOY A;  2EFN A;  2M87 A;  3CJN A;  4UV9 A;  4C2M A;  4ZZL A;  5EG0 A;  1A6Q A;  1BR1 A;  1RKT A;  3LQQ A;  3MKZ A;  3VYS B;  3CRJ A;  3BWG A;  3WU2 C;  4PJ0 C;  3J80 Z;  3HOY J;  2RDP A;  2HZD A;  1LE8 B;  1U5T C;  4XNF A;  1N77 A;  3K4B A;  4IRV A;  3WU1 B;  4NHJ A;  4BDY A;  2DA5 A;  1O3S A;  2PN6 A;  2F5D A;  2OCC H;  1S5L C;  1AU7 A;  2OPT A;  1SVL A;  4IL6 C;  4HF0 A;  1LDJ A;  3VW1 A;  3BPV A;  1ENH A;  2ZJR F;  2A68 F;  2IS1 A;  2PMZ N;  1X1D A;  5HBU A;  2KDO A;  3J81 K;  2EA2 A;  3WTT C;  2KIQ A;  1W0U A;  2CUJ A;  4N9H A;  3SZP A;  2CWE A;  5F0C A;  1HKQ A;  5K5R A;  2GUH A;  3ZQG A;  3FDY A;  4I2O A;  3HYI A;  2EK5 A;  3F8M A;  1WVR A;  3RPU A;  3RPU D;  1HBX G;  4U0W A;  4F55 A;  3MKY B;  2K02 A;  3C2B A;  2F4I A;  3BG6 A;  5CQE A;  2LRD A;  3ZMS A;  3KP4 A;  1Z21 A;  4MFE A;  4BDZ A;  1OR7 C;  3G71 I;  4JYK A;  3IC7 A;  1UAA A;  4ZYA A;  4BHP A;  3P9T A;  4HYE A;  1T0F C;  1VFC A;  1RR8 C;  2HQA A;  1IN5 A;  1X1C A;  3PFI A;  1BI0 A;  5D6F A;  2MD5 A;  2DLL A;  3HHG A;  1ZRC A;  4O6J A;  2K86 A;  4A3E J;  4UVB A;  1IDY A;  3FIW A;  1LVA A;  3AKZ A;  2QEX I;  1OMI A;  2ME0 A;  3TO7 A;  4OD5 A;  5F27 A;  3OYM A;  2QKO A;  3CTA A;  3ZPL A;  3V7R A;  3N05 A;  1EJ9 A;  2GXG A;  4GO1 A;  1QHG A;  4I0B A;  4EM2 A;  2H6B A;  1F5T A;  3LL7 A;  1YIO A;  2BXY A;  1UFM A;  4YZE A;  5FFZ A;  2Z3Y A;  4E7H A;  2PMH A;  4GCL A;  5ED4 A;  4RLQ A;  3NXC A;  4XKB A;  1S72 I;  1ZR4 A;  4XBF A;  5LRR A;  5CKT A;  4FT8 A;  2FRH A;  2V79 A;  5FRM A;  3K4K A;  4UHT A;  1LFU P;  3VOE A;  4II3 A;  2P5K A;  4XLN F;  4QIW N;  3OYH A;  3TP3 A;  2JSP A;  1R58 A;  2ZCW A;  2QCO A;  2Q24 A;  2E5Z A;  3SQN A;  3S1Q J;  2L3D A;  3WE3 A;  2NYX A;  4ZC3 A;  3WTY C;  4CCO A;  3GX4 X;  5LD2 C;  1K6Y A;  1WPK A;  2ZME A;  1R5G A;  2ZFW A;  3RQ4 A;  3HG9 A;  1SAN A;  2CQK A;  3O8H A;  1AWC A;  2ACJ A;  2K9M A;  2M5W A;  4BU2 A;  2CW0 F;  5L3D A;  4V2G A;  2R7Q A;  3LA7 A;  2PFB A;  3GLX A;  2L7M P;  2P5L C;  3NWT A;  2VKV A;  2Q0O A;  3CMA I;  2DJN A;  2FOW A;  3CP2 A;  1HW2 A;  4EMS A;  2IU5 A;  1E0E A;  1A36 A;  1Z6R A;  4ESB A;  2NAZ A;  3CJR B;  2CV1 A;  1SAU A;  3G1O A;  5HVQ C;  5C4J J;  5F1J A;  3CF2 A;  3KYL A;  2ZC2 A;  2LH9 A;  1XC5 A;  3WTU C;  3GZN B;  2XPW A;  3WGG A;  3OY9 A;  4N4O B;  4AIJ A;  2IPQ X;  2IXS A;  3LMM A;  1CF7 A;  5HDG A;  1ETX A;  2OER A;  1IO2 A;  2DMT A;  3PUF A;  4BJ5 C;  3FZV A;  2QSF X;  1I1G A;  1ONV A;  1G59 A;  1BL0 A;  2QGU A;  3H9G A;  3TQN A;  1EKE A;  4XLC A;  2PX9 A;  2GM4 A;  5FLX K;  1X2M A;  1WGX A;  5E1X A;  3K0L A;  2BGC A;  4OMZ A;  5JHU A;  5LGN A;  2HXO A;  3E7L A;  5TRD A;  3LA2 A;  2V6E A;  1Z91 A;  2XAG A;  5F0F A;  4BQA A;  2O7O A;  4E6K G;  1SD5 A;  2K3F A;  3IUO A;  2JA7 J;  3F21 A;  1K6O A;  2V9V A;  4XKW A;  5A2Q K;  2Y9Z A;  3F23 A;  1NK3 P;  2E34 A;  5IPA A;  4PJL A;  3VP5 A;  5E18 F;  4WX9 A;  3NWS A;  3PQJ A;  2V9P A;  4MIM A;  5D8L B;  1KA8 A;  3BTC A;  1U9O A;  2KQR A;  4L9J A;  2HOS A;  3JRC A;  3TP0 A;  5BPI A;  1TWH J;  4FHT A;  2F4O B;  3OYA A;  3NAR A;  3H9J A;  1IXR C;  2E1O A;  3D1N I;  1WRJ A;  3LJL A;  2FML A;  2H1L A;  3RJP A;  1K4S A;  2LR8 A;  2W1O A;  2LG4 A;  2VAS A;  3CMM A;  2JMW A;  4JOM A;  1GXQ A;  3V8J A;  2O6G E;  2W7N A;  4XSZ F;  4XOP A;  5EGO B;  1V5G A;  5TJJ A;  1W7P B;  4DW6 A;  2FJ1 A;  2HDC A;  1R71 A;  3ZQL A;  1WJA A;  2GOM A;  1TQI A;  1SVO A;  3JTH A;  4WXD A;  3ONQ A;  4MQ9 F;  3DKX A;  1OLT A;  4F3Q A;  2KLO A;  1FJL A;  3R0A A;  2M45 A;  5M5W J;  1J75 A;  5GTI C;  4KYW A;  1QBJ A;  3KKC A;  1ZEL A;  3C18 A;  2LYC A;  2XPV A;  1SC7 A;  5E1Z B;  2UXN A;  1IN7 A;  2F5E A;  2L2O A;  3Q9S A;  3GTG J;  1JHF A;  1P6R A;  4WF2 A;  3I71 A;  2EIK H;  3ZN1 A;  3IHU A;  1MD0 A;  4GCT A;  2KIF A;  1IW7 F;  1HC8 A;  3BR6 A;  4PZJ A; 
#chains in the Genus database with same CATH homology
 1B72 A;  1JKR C;  4J19 A;  3BHQ A;  1BW6 A;  1MBE A;  5FHP A;  2DG7 A;  1IDZ A;  1ITY A;  4ICH A;  4M3B A;  2WV1 A;  2TRT A;  2XB5 A;  3G1L A;  4DYR A;  3VOX A;  1K61 A;  4W1U A;  2X48 A;  5EF6 A;  3I4M J;  2K9N A;  5F08 A;  5J1Y A;  5C44 J;  3QKX A;  2DMQ A;  1RKW A;  2JA5 J;  1OCP A;  3VPR A;  1APL C;  2QOP A;  3C07 A;  4IHW A;  1Y1V J;  3PAS A;  1MBG A;  1NK2 P;  2K40 A;  1IUF A;  5E3M A;  2G3B A;  1UI5 A;  1RES A;  5D19 A;  1GVD A;  5J1R A;  4BBS J;  3RD3 A;  2NS8 A;  5EEA A;  2L9R A;  5FJ8 J;  3ON2 A;  1RPW A;  1JTY A;  5K7F A;  2QTQ A;  3NPI A;  4UUS B;  4A3F J;  2R7Z J;  1QVU A;  2L0K A;  2WGB A;  3LSJ A;  4A69 C;  1F43 A;  2CUE A;  2K9S A;  4JP0 A;  2G7G A;  5FKK A;  4UDS A;  2HQ5 A;  4D5C A;  3G7R A;  2M9H A;  3FK7 A;  4C3I J;  4QTR A;  4NDL A;  4S0H B;  1HCR A;  2IEK A;  2FBQ A;  2EH3 A;  2O9L A;  3CQZ J;  2WAQ N;  3VVY A;  2UXH A;  3S16 J;  3FRQ A;  3RQI A;  3HGY A;  5GPC A;  4FTH A;  3TED A;  2DA7 A;  1UI6 A;  2JJ7 A;  4L62 A;  2EBI A;  5JLW A;  2KDZ A;  2QF7 A;  3S5R A;  2W53 A;  2DMN A;  3GTO J;  4ACI A;  1ETY A;  4MK6 A;  4A3D J;  4GFL A;  2DA6 A;  1TC3 C;  1A5J A;  1P7I A;  4XK4 A;  2ZOZ A;  4A3L J;  3KKD A;  1XG1 A;  2QWT A;  1FIP A;  1TWA J;  1E3O C;  2ZCX A;  4I76 A;  5EG0 B;  5F04 A;  1T56 A;  3GZI A;  3JRD A;  2CQX A;  3F0C A;  1MSF C;  2M8G X;  2XGE A;  4DYQ A;  2UXP A;  2ZCN A;  2M34 A;  3QPL A;  2DMP A;  5M3F J;  1BJZ A;  1PUF A;  1UHS A;  5GP9 A;  3T6N A;  2WUI A;  4I6Z A;  3BQY A;  4B1R A;  3EGQ A;  1AKH A;  3Q3S A;  2Y9Y A;  4W97 A;  1ETW A;  3MN2 A;  3LOC A;  3HTI A;  3BTJ A;  3ZQF A;  4DZP A;  4GFK A;  3PM1 A;  3S1N J;  4AUX A;  3GTK J;  2K9Q A;  1U9N A;  2MW8 A;  1I50 J;  5M5X J;  3ZQH A;  1U8B A;  4XID A;  3FKI J;  3HBL A;  2HYJ A;  5EDN A;  5FKL A;  3HTJ A;  2FX0 A;  4JX6 A;  2R5Z A;  1HDD C;  9ANT A;  5J3L A;  2YUS A;  3JRH A;  3OSG A;  2AO9 A;  2QIB A;  2H1K A;  3HTA A;  3HIM A;  2R5Y A;  1LFB A;  1EF4 A;  1MBH A;  3A03 A;  4FE7 A;  2VPR A;  5CXG A;  3LSP A;  2TCT A;  3LSR A;  2LKX A;  3I4N J;  3JRA A;  3JRG A;  4MFD A;  1I3Q J;  2ELK A;  4A3J J;  1SGM A;  1JKO C;  3VW2 A;  4ME9 A;  5AQC A;  2ECB A;  2CQQ A;  1H88 C;  5DS9 A;  3O8G A;  2LVS A;  5D18 A;  2PZ9 A;  3IH4 A;  5BNG A;  3GTP J;  5HSZ A;  3JRF A;  3LNQ A;  2NVT J;  3COL A;  1R9T J;  3B6A A;  1H8A C;  4BY7 J;  3BNI A;  2LLK A;  2NVX J;  4V2F A;  1GV2 A;  1QPI A;  3BR1 A;  2XGC A;  4MLO A;  2EZL A;  2GEN A;  3RZD J;  1QRY A;  4AYB N;  3KNW A;  2V57 A;  1OJL A;  1XS9 A;  2MSY A;  1SFO J;  2W48 A;  3L1P A;  4L5E A;  2MGQ A;  3G1M A;  3VVZ A;  5J1U A;  3IUV A;  3HOW J;  1MH4 A;  4RDU A;  1JJ6 C;  2JA8 J;  4A3K J;  2ME6 A;  3HOX J;  1MH3 A;  2G7S A;  3JRI A;  5H9T A;  2LY9 A;  4A3B J;  4G12 A;  2D6Y A;  1QVT A;  3ON4 A;  5CXI A;  4XIC A;  1FTZ A;  4JKZ A;  5IOZ A;  1ZK8 A;  2CU7 A;  3S14 J;  1DU6 A;  1B8I A;  2LTP A;  4JX5 A;  1GT0 C;  3KZ9 A;  1JUM A;  2RHA A;  1T33 A;  3OOU A;  2COB A;  3Q0U A;  5IP9 J;  1FIA A;  3GTJ J;  3SJM A;  4M3E A;  5FMP A;  3Q0W A;  2NS7 A;  4M6V A;  1LE8 A;  2EZK A;  3AQS A;  1ETQ A;  1IRZ A;  2OI8 A;  2LK2 A;  2HI3 A;  2PBX A;  3VW0 A;  5JLX A;  2LFB A;  2M2E A;  2ZB9 A;  4C2M J;  1UMQ A;  3GBG A;  2IAI A;  2XB0 X;  4Y7N J;  3Q0V A;  4AC6 A;  5C3E J;  2O7T A;  3WHC A;  2OF7 A;  4CYC A;  5F0H A;  4FIS A;  5IOY A;  2R5Z B;  3CCY A;  1ZQ3 P;  5HOD A;  2DTZ A;  1GDT A;  3NAU A;  4IHV A;  2NOG A;  1K83 J;  2HOT A;  3BJB A;  2LD5 A;  2VKE A;  2E2I J;  1P7J A;  4A3M J;  1U78 A;  1JJ8 C;  1W0T A;  2XSD C;  3HM5 A;  2HKU A;  2N8G A;  5IYC J;  4A3G J;  3S15 J;  2GFN A;  1UG2 A;  2D5V A;  5FKO A;  3A01 B;  3GEU A;  1S7E A;  3FK6 A;  2IBD A;  2ID3 A;  2JK3 A;  2L7Z A;  1ETV A;  3MVP A;  5C4Y A;  4M3F A;  2JA6 J;  4MXM A;  2ID6 A;  4NEL A;  3LWJ A;  4NN1 A;  3BCG A;  3BR3 A;  1IG7 A;  5D1R A;  4A93 J;  4QSH A;  4LOC A;  3S17 J;  4IHX A;  1ZGW A;  4DZJ A;  2I10 A;  1AKH B;  2F07 A;  3M3Y J;  4C3J J;  4CGR A;  4BXX J;  2XDN A;  3BR2 A;  1HF0 A;  2R93 J;  3NNR A;  4DYC A;  2R0Q C;  2VI6 A;  3A01 A;  1JGG A;  2Y2Z A;  1TWC J;  3OSF A;  1PUF B;  5K7H A;  3HTH A;  5EZG A;  2E2H J;  2HDD A;  4CYC B;  2H8R A;  2O8K A;  1JT6 A;  3BG5 A;  1H89 C;  2ZOY A;  4AF5 A;  5EG0 A;  5EYR A;  1RKT A;  3CRJ A;  3BTL A;  3HDD A;  4HKU A;  3BG3 A;  3HOY J;  1O4X A;  5IP7 J;  1LE8 B;  3EUP A;  2DA5 A;  1AU7 A;  3F1B A;  2OPT A;  3K2A A;  4XRM A;  3SFI A;  2R92 J;  3VW1 A;  4AC0 A;  1ENH A;  2PMZ N;  5HBU A;  3H0G J;  4D7N A;  3UKG A;  1JUP A;  1W0U A;  1MSE C;  5F0C A;  3BR5 A;  2YU9 J;  1CQT A;  4ABZ A;  3TW7 A;  2E19 A;  1FEX A;  4BY1 J;  2GUH A;  2DMU A;  2VUM J;  3ZQG A;  3HGG A;  3LHQ A;  3BR0 A;  1VI0 A;  2AHQ A;  3HEF A;  4UUS A;  3QBM A;  2REK A;  3BRU A;  4A3C J;  3IV5 A;  4RBO A;  3C2B A;  3RZO J;  3JRB A;  4GFB A;  4X6A J;  5M5Y J;  1WH7 A;  3JR9 A;  3GTM J;  3VVX A;  1NTC A;  3QQA A;  5K7Z A;  3A02 A;  3M4O J;  1I6H J;  1ZTR A;  4MFE A;  2XPU A;  4JYK A;  4M3G A;  3P9T A;  1VFC A;  3PO3 J;  2P81 A;  1A6I A;  5CW8 A;  1JKQ C;  4JL3 A;  2Y0S N;  2UXI A;  1HOM A;  4A3E J;  1IDY A;  3FIW A;  4GCK A;  5EZH A;  1IGN A;  2ME0 A;  2NP5 A;  2XGD A;  1Q1V A;  3TW6 A;  2DA1 A;  5C4X J;  1IV6 A;  1X2N A;  2HYT A;  1B72 B;  3G56 A;  2HXI A;  5F27 A;  4B4C A;  4XRS A;  3GTL J;  2QKO A;  2CRG A;  2LP0 A;  4UUT A;  3S2H J;  5FLV A;  2DA4 A;  4BKX A;  5E3O A;  2EQR A;  3DCF A;  1ZR2 A;  3ZQC A;  1YRN B;  3NRG A;  2DG8 A;  4YZE A;  4GCL A;  3NXC A;  4PXI A;  2E2J J;  4A3I J;  3BTI A;  2JWT A;  1ZR4 A;  2X9D A;  1TWG J;  4IHY A;  1MBK A;  3PPB A;  3CDL A;  1LFU P;  3IH2 A;  1FTT A;  4KWA A;  2NVY J;  4QIW N;  3TP3 A;  1MNM C;  2B63 J;  4FCY A;  3WHB A;  2QCO A;  2Q24 A;  2JN6 A;  1MBF A;  3BQZ A;  3S1Q J;  2NP3 A;  1YRN A;  3W6V A;  5IP6 A;  5M3M J;  1D5Y A;  2CUF A;  1WPK A;  3CWR A;  1BA5 A;  1SAN A;  3O8H A;  5EGO A;  2NVQ J;  3CJD A;  1JKP C;  3BT9 A;  1WCM J;  4V2G A;  4BBR J;  3S1R J;  2YVE A;  1HLV A;  3VIB A;  2L7M P;  2VKV A;  2DJN A;  3ANG A;  3VUQ A;  2X6O A;  2HOA A;  3HB9 A;  2ZCM A;  1X58 A;  3OIO A;  2IU5 A;  5HAW A;  2XRL A;  5FLM J;  5EFY A;  3G1O A;  2L7F P;  5C4J J;  3RKQ A;  5F1J A;  3HE0 A;  2CJJ A;  3ZQI A;  3HOZ J;  4B3A A;  2NX4 A;  3K7A J;  1XC5 A;  2XPW A;  1ZKG A;  3ZOB A;  3PO2 J;  3RH2 A;  2DN0 A;  5DTD A;  1JTX A;  2FQ4 A;  1ETX A;  1Y1W J;  3S1M J;  2OER A;  2DMT A;  1BW5 A;  1B8I B;  4Y52 J;  3FIS A;  3HOV J;  5E3L A;  4D5F A;  3HKZ N;  2MG4 A;  3MNL A;  5FGL A;  1BL0 A;  1VND A;  1Z0X A;  2Y30 A;  2YVH A;  5K58 A;  4EEF G;  2GM4 A;  1X2M A;  2YS9 A;  1OFC X;  1GV5 A;  1WGX A;  4X1E A;  3V78 A;  2HXO A;  3E7L A;  5DAJ A;  2FD5 A;  5F0F A;  3QPS A;  1ETK A;  2O7O A;  1G2H A;  1RET A;  3MKL A;  2EZI A;  3DPJ A;  2JA7 J;  3E7Q A;  2Y9Z A;  4D7M A;  1NK3 P;  2GBY A;  1VF9 A;  1OCT C;  3B6C A;  5IPA A;  3VP5 A;  1WI3 A;  3SDG A;  1TWF J;  4MIM A;  1Z77 A;  5FKM A;  4FE4 A;  4C3H J;  3BTC A;  1U9O A;  2ECC A;  1DU0 A;  2RAE A;  3JRC A;  2HOS A;  5FKN A;  3TP0 A;  1TWH J;  2RAS A;  3B81 A;  2KT0 A;  1MBJ A;  4HNV A;  3NAR A;  2E1O A;  3D1N I;  3HOU J;  3ANP A;  1F36 A;  3LJL A;  2DA2 A;  3IH3 A;  1ETO A;  5IYD J;  2WB1 N;  2LR8 A;  5E3N A;  3H3V K;  2JMW A;  1POG A;  2R5Y B;  3S2D J;  1AHD P;  1HDP A;  5EGO B;  3O60 A;  4JNN A;  4MO7 A;  4DW6 A;  2FJ1 A;  4JX4 A;  4XRS G;  3ZQL A;  1IJW C;  1ORK A;  1FJL A;  3DEW A;  3V6G A;  5M5W J;  5GPA A;  2G0E A;  1JT0 A;  3KKC A;  1GUU A;  2XPV A;  3NI7 A;  1RR7 A;  3AQT A;  5IYB J;  2DA3 A;  1IC8 A;  2M0C A;  3BG9 A;  3JRE A;  3JSJ A;  3LSG A;  4M3D A;  2G7L A;  2EZH A;  3GTG J;  2UXU A;  3GTQ J;  3VOK A;  2Y31 A;  2UXO A;  4IEJ A;  4GCT A;  1JUS A;  2GLO A;  1WH5 A;  3CMY A;  3BR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...