3FIWA

Structure of sco0253, a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
173
Chain Sequence
KMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAEIDHESAFEAGLALITDGLVRHVDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of SCO0253, a Tetr-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription regulator
molecule keywords Putative tetR-family transcriptional regulator
total genus 56
structure length 173
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fiwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3fiwA02
1VFCA 3BG3A 1A6IA 2G3BA 2Y2ZA 2JMWA 3G1LA 1WI3A 3NPIA 3ON2A 2ECCA 1OCPA 4FISA 2M0CA 3L1PA 2K40A 2E2JJ 3ZQIA 5D1RA 5C4JJ 5M3MJ 3JRCA 4BY1J 1Y1WJ 3PM1A 2QKOA 1P7JA 3FK6A 3V6GA 5GPCA 3BQZA 5EZHA 5GPAA 4PXIA 2W53A 3D1NI 1GUUA 3MKLA 2GBYA 2LFBA 4B1RA 2Y9YA 2MG4A 5F27A 3HTHA 2DMPA 2EZHA 4UUSB 3A02A 5K7FA 1JUSA 2L9RA 1HDDC 3I4MJ 2XPWA 1NK3P 1JKPC 3HOVJ 1D5YA 2I10A 2FX0A 2HYTA 1NTCA 2RAEA 2E19A 1B8IA 3TW7A 4FE7A 1ETVA 3S14J 5H9TA 2DMUA 2D6YA 4M3FA 1ETKA 2LY9A 5IYCJ 5EYRA 1MSFC 1BA5A 3ANGA 2XGCA 3F1BA 3GTPJ 1ETWA 5E3NA 2G0EA 1MBFA 1F43A 3V78A 2P81A 2QF7A 1RKWA 3HKZN 1EF4A 3COLA 5C4YA 2EZKA 1ITYA 4QIWN 3GTJJ 4FCYA 4KWAA 1UMQA 5C44J 5EZGA 3EGQA 2VKVA 4I76A 4JKZA 3S17J 5CXGA 3QKXA 5IOYA 3Q0VA 2GUHA 4Y7NJ 2KT0A 4M6VA 4A3BJ 3ZQHA 3JRGA 4A3DJ 1VNDA 2R5ZA 3F0CA 3JRDA 3PO3J 3BTLA 3S1MJ 3S1QJ 3A03A 1FIAA 1DU6A 5FKKA 2UXIA 1Z0XA 5D18A 2M9HA 4A93J 4IHVA 3Q0UA 2XPUA 3S1NJ 2GFNA 4JL3A 2DA2A 4A3IJ 5M5XJ 1MSEC 4L5EA 1JT6A 3H3VK 2LK2A 3BQYA 2Y9ZA 2Y0SN 3VVXA 3T6NA 2DMTA 2R5ZB 3NI7A 2X48A 5J1RA 3AQTA 4XICA 2L0KA 1Y1VJ 3BR3A 3NNRA 1IDYA 1VI0A 3MVPA 1OJLA 2JA8J 3HGYA 1A5JA 1JJ6C 1F36A 3JRBA 4DZPA 5F0HA 4AC6A 2E1OA 3BRUA 2DA7A 3IH3A 1POGA 4ACIA 3HB9A 1NK2P 3RZDJ 4M3BA 3GEUA 3G1OA 4UUTA 3IV5A 3SJMA 4W1UA 1MH4A 1XC5A 3KKCA 2XRLA 5F0CA 3ZQLA 2CUFA 4A3GJ 3VW1A 2E2IJ 2WB1N 4IHYA 2XGEA 2NVTJ 2YVHA 2K9SA 2EH3A 4Y52J 2DTZA 2L7MP 3C2BA 4XRSG 1BW6A 3TW6A 2ID6A 5K7ZA 2LLKA 3VP5A 3VIBA 2HXOA 1JKQC 5J1UA 3ANPA 3LSRA 4D5CA 1OFCX 4XRMA 3VVZA 2RHAA 3HOUJ 2IAIA 2RASA 2XPVA 4C3HJ 1HLVA 3S2DJ 3H0GJ 2JA6J 3PPBA 5EEAA 3KNWA 1MBEA 3HTJA 2ECBA 1JT0A 2ZOZA 2N8GA 1YRNB 2LVSA 4A3KJ 2V57A 3NXCA 3S1RJ 1JTYA 4A3LJ 5D19A 4QSHA 2FQ4A 3HOWJ 2JA5J 5E3LA 5GP9A 1U9NA 3HBLA 1WGXA 2UXUA 5IYBJ 5EF6A 4MIMA 2R7ZJ 5E3OA 4HNVA 2R5YB 2XSDC 1WH7A 4DZJA 2YU9J 4BBRJ 2LP0A 3KZ9A 3BR2A 3S2HJ 1LFBA 1GVDA 2CQXA 1HF0A 3FIWA 4EEFG 5IPAA 4AC0A 3RD3A 1SANA 3FK7A 4AYBN 2MSYA 1I6HJ 3HTIA 2L7ZA 3PASA 3RQIA 3CDLA 4QTRA 2Q24A 4GFKA 2M2EA 4DYQA 1JJ8C 2K9NA 2ZOYA 5IYDJ 2G7LA 5IP6A 2R92J 3CWRA 2XGDA 2R93J 1BJZA 3BT9A 3GBGA 3JRFA 4X6AJ 2WGBA 3JRHA 1ZKGA 3SFIA 4B4CA 1YRNA 3TP3A 1X2MA 3S5RA 1B8IB 4C2MJ 3TEDA 1ZK8A 1LE8A 2OI8A 3K2AA 3AQSA 3GTGJ 2D5VA 2ELKA 4W97A 4D7NA 1X58A 1G2HA 2GM4A 1HDPA 2ZB9A 4FE4A 3DEWA 4V2GA 3KKDA 3SDGA 3O8GA 2EZIA 4LOCA 4A69C 3I4NJ 5EG0A 4V2FA 3NARA 5J1YA 1ZTRA 2UXOA 5F0FA 1I3QJ 4FTHA 3PO2J 2W48A 4ICHA 3M3YJ 3QBMA 3G56A 2CJJA 1ETOA 2KDZA 3GTOJ 3IH4A 1UI6A 1K83J 3MNLA 2FD5A 1WCMJ 2GENA 4M3DA 1S7EA 2M8GX 2CUEA 3VUQA 2FBQA 4MXMA 2JJ7A 5AQCA 2LTPA 1K61A 3LNQA 4A3MJ 2GLOA 3M4OJ 3VOXA 3OOUA 2Y30A 3ZQCA 3BTJA 4L62A 2DA3A 1IV6A 1IRZA 2B63J 1I50J 3C07A 4IEJA 2AO9A 2DA4A 1MBGA 1ENHA 1WH5A 3HOZJ 4MK6A 2QOPA 2HDDA 2CU7A 2ID3A 1DU0A 3JREA 3E7LA 3G1MA 1LE8B 3BHQA 3VPRA 1B72B 3HM5A 3Q0WA 1ORKA 2X6OA 3QPSA 2IU5A 3CJDA 4M3EA 2LKXA 4XK4A 5FGLA 3CCYA 4BKXA 3IH2A 2QCOA 2QWTA 4NN1A 2NX4A 1QVUA 5JLWA 1TWCJ 2HOAA 4MLOA 5JLXA 5E3MA 1U8BA 1AU7A 1MH3A 4GFBA 4A3JJ 4GCKA 3OIOA 1WPKA 1Q1VA 3IUVA 4BY7J 4D7MA 3VVYA 3LOCA 3HOYJ 1JKRC 1SFOJ 2ME0A 3WHBA 3DPJA 3ON4A 1RESA 2AHQA 2DA1A 1AHDP 4RDUA 4J19A 3HTAA 2JN6A 3TP0A 2OF7A 5FHPA 4AUXA 3RKQA 4MFEA 5M5WJ 5EGOA 2COBA 3O8HA 5K58A 3FRQA 2QTQA 3GZIA 1JGGA 2DA5A 2TRTA 5EG0B 4BBSJ 1RPWA 1MBJA 1JKOC 1UHSA 1Z77A 4GCTA 2LR8A 3HIMA 3BR5A 5FKOA 3LHQA 1JTXA 2XDNA 5F04A 3BCGA 4B3AA 5HSZA 4JX4A 3A01B 3MN2A 1UI5A 5CXIA 3BNIA 1GV5A 5FLMJ 3BTCA 1GDTA 2REKA 2R0QC 1IDZA 4RBOA 4C3JJ 2OPTA 2DMNA 3FKIJ 2IEKA 5J3LA 5BNGA 3BJBA 2OERA 2HOSA 1H89C 1XS9A 4I6ZA 2X9DA 2WAQN 2CRGA 4MO7A 4NDLA 3B81A 3NAUA 1QRYA 5M3FJ 2DG7A 1FJLA 3GTQJ 2NP3A 5F08A 4YZEA 3JRIA 1H8AC 2NVYJ 2H8RA 2ZCNA 4NELA 2NOGA 3P9TA 1RETA 3CRJA 3LSJA 2EZLA 3ZQFA 2ZCMA 2LD5A 1UG2A 5C3EJ 4HKUA 3LJLA 5CW8A 1RR7A 1ETXA 2NS7A 2F07A 1BL0A 3B6CA 1O4XA 3BR6A 2O7TA 4CYCB 3CMYA 3W6VA 3JRAA 4A3FJ 3LSGA 3HEFA 1IG7A 1TWGJ 3JSJA 1ZQ3P 2CQQA 3BG9A 4JP0A 2ZCXA 3GTKJ 1AKHB 1IGNA 3E7QA 5C4XJ 5EGOB 5EFYA 3S16J 1U78A 1ETQA 2O8KA 3BTIA 4DW6A 1SGMA 3S15J 3B6AA 1TWAJ 1H88C 2XB5A 1IJWC 3BG5A 2UXHA 2VI6A 2YUSA 2WUIA 4JX5A 1GT0C 4C3IJ 1ZR2A 3JR9A 5IP9J 3QPLA 1R9TJ 1FTZA 1BW5A 3DCFA 3O60A 4M3GA 2HYJA 1LFUP 1P7IA 2PMZN 1T56A 4DYCA 1MNMC 1U9OA 2EQRA 2DG8A 5IOZA 1HOMA 3VOKA 3CQZJ 4JNNA 2YS9A 9ANTA 1FEXA 3EUPA 5FJ8J 1E3OC 2NVQJ 2JWTA 2HXIA 2VPRA 3BR0A 3HOXJ 3RZOJ 2G7SA 4GFLA 4AF5A 5DS9A 1TC3C 2EBIA 1IC8A 3NRGA 2E2HJ 5HBUA 1B72A 2PZ9A 2HOTA 2DJNA 2NP5A 2ME6A 3OSFA 3FISA 1X2NA 1AKHA 2PBXA 1XG1A 3LWJA 1ETYA 4X1EA 5FKLA 2IBDA 2M34A 2UXPA 1W0TA 4ABZA 1JUPA 4DYRA 1HCRA 1PUFB 1FTTA 2JK3A 3QQAA 4UDSA 4CGRA 5HAWA 4IHXA 2L7FP 3LSPA 1APLC 1OCTC 2VKEA 2HQ5A 3VW2A 3WHCA 2HI3A 4CYCA 2O7OA 2JA7J 2DA6A 5K7HA 4GCLA 1TWFJ 4UUSA 2XB0X 2YVEA 2K9QA 1ZR4A 3BR1A 5F1JA 3VW0A 5DTDA 2DN0A 1GV2A 2TCTA 3OSGA 3HGGA 1JUMA 4XRSA 2NVXJ 5FKMA 4ME9A 2DMQA 3K7AJ 2FJ1A 2HKUA 4G12A 4A3CJ 2WV1A 5FLVA 5HODA 4D5FA 1T33A 1VF9A 2Y31A 3HE0A 3ZOBA 5M5YJ 3RH2A 3UKGA 1MBKA 1RKTA 4MFDA 5FMPA 3A01A 5DAJA 1FIPA 2MGQA 1IUFA 2NS8A 3Q3SA 2MW8A 5FKNA 3G7RA 2G7GA 5IP7J 4JX6A 2QIBA 4BXXJ 4S0HB 4XIDA 2VUMJ 1QPIA 1TWHJ 1ZGWA 1W0UA 1QVTA 3GTLJ 3GTMJ 3HDDA 3ZQGA 5EDNA 4JYKA 1PUFA 2O9LA 1MBHA 2H1KA 1CQTA 4IHWA 4A3EJ 2R5YA
chains in the Genus database with same CATH superfamily
1A6IA 1VQ6I 3G1LA 1WI3A 3NPIA 3ON2A 1KU7A 1KU2A 4HX7A 2LOOA 3JRCA 2OV7A 2A61A 4XRFA 3FK6A 4C30A 2E1MB 3F6VA 1T0FA 3D1NI 2W53A 3MKLA 4B1RA 5F27A 2MG4A 5LRSA 1X1DA 1LUJB 2DMPA 3EUKL 3A02A 3WE3A 5K7FA 1JUSA 1TT5B 2OTJI 1WJAA 2XPWA 1NK3P 1YW8A 5LLQA 1JKPC 4IXAA 2I10A 3UNGC 3BY6A 2E19A 4HLXA 3TW7A 3S14J 1PP8F 5H9TA 3LSKA 4AWXB 4M3FA 1EH8A 1I1GA 3D5SC 4GXOA 5IYCJ 5EYRA 1MSFC 4L9NA 3ANGA 3VB2A 2ESHA 2Y69H 1N25A 2STWA 2Q2EB 3BCBA 5FLXZ 1EF4A 4KDPA 1RKWA 2F5CA 3F8CA 1HKTA 5C4YA 4XKCA 1ITYA 4KWAA 5EZGA 3FM3A 1WHUA 4I76A 2PX9A 3EETA 3V7SA 1UB9A 5E1ZB 1XCVA 2LF8A 1V5GA 2UWMA 1EH7A 5IOYA 3WTYC 3QKXA 4Y7NJ 4BQNA 4M6VA 4ZTJA 2XAQA 1YW7A 4A3DJ 1YJ9I 4MHGA 3CJRB 3JRDA 2RDPA 4XN3A 1ZAOA 3S3MA 5FKKA 2OZ6A 2FF4A 1XB4A 3FMRA 1Z0XA 3K2ZA 1Y0UA 2M9HA 3FXOA 4BE0A 3CCSI 3ECOA 4IHVA 2GFNA 1XMAA 2KP6A 2FBIA 4L5EA 4HX4A 4LG0B 3VVXA 5BS6A 4HF1A 2Y0SA 4HBLA 2R5ZB 2GOMA 2XF7A 2E1CA 1J2XA 2L0KA 2E5ZA 1R5GA 2XASA 4XLPF 5E20A 2R7SA 2EIKH 4A6DA 1SVMA 5CVUA 1JJ6C 3ZN0A 2PEXA 1S72I 5A2QK 1PDNC 3MD2A 1S29A 1P4AA 1KQ0A 1R4MB 4DZPA 3S93A 4ENJA 3BPVA 2E1OA 1CF7B 2QM3A 3H3UA 4IF4A 1OCZH 3IH3A 3SWHA 1NK2P 3EUHA 3SJMA 4HQMA 4MTEA 2QVOA 1KZHA 1G3SA 1MH4A 3VOKA 4G6DA 2VXZA 4A3GJ 2Q2EA 4IHYA 2XGEA 1R00A 2NVTJ 4Y52J 2EH3A 3K70D 2DTZA 3GFLA 2L7MP 3K4BA 3M8EA 4WK8F 3MMYB 4U0YA 2ID6A 2E35A 3D0SA 3RYRA 4B44A 1J0RA 2QKMB 2VBZA 4D5CA 2FNPA 3DKWA 1N75A 1H0MA 1FYMA 3HOUJ 1IXSB 1B4AA 2EV6A 4EM2A 1MKMA 2K4BA 2R3SA 1HLVA 3I53A 1W5TA 5EEAA 3KNWA 2XC7A 2OAZA 1K4TA 2VOPA 4XNFA 3TBIA 3NXCA 4M6XA 5ICEA 3T1BA 4LITA 3MZHA 2WY7Q 5H2FC 4U9LA 1FPQA 2MH2A 2Q8KA 1M1EB 3K1PA 4P55A 4HPQA 4CCJA 4ZYHA 1D3YA 4B47A 1WGXA 1QO0D 5IYBJ 5LGUA 4L0ZB 4MIMA 4G9YA 5E3OA 4OD4A 2R5YB 4DZJA 4M9ZA 3QRFF 2FE3A 2J5PA 4S04A 3S2HJ 1LFBA 3DPLC 2CQXA 5FFZA 1HF0A 4IQ4A 3AG3H 2XKPA 2ZMEA 3LA2A 3GFJA 3M9AA 2ZJQF 3PUBA 3HTIA 3OIQA 2BXZA 2DO7A 1FMWA 3IAM2 3RKYA 4QTRA 2ZOYA 3HPHA 3HPGA 3N05A 2GA2A 4GFKA 1D0ZA 2XV4S 1YE9A 1LEBA 3BROA 3QYBA 1XSVA 2LNBA 3P5JA 3PFIA 5L3FA 1YTYA 3A4CA 1XSXA 2DFFA 1BJZA 1U5TA 2R7DA 2R93J 2DK5A 5HDGA 3JRFA 4X6AJ 1MJ9A 4NNJA 1L0OC 5KNLA 1EV7A 3TP3A 4OWRB 1QHGA 4HSTA 5GAHJ 2JA2A 3FXMA 4OINF 5FFXA 2OI8A 3QP5A 1J5YA 3U9GA 3KZYA 1U6GA 4IVNA 1IN5A 2HEOA 4BDYA 1X58A 2E1NA 1HDPA 2EINH 3F21A 3LL7A 3BZCA 4CICA 1IXCA 2NXNB 1ZRFA 5JHFA 5J1YA 4ZTFA 1S9HA 5F6FA 5F0FA 4LIUA 4X0GA 6PAXA 2BHZA 3QBMA 4PZJA 3S8PA 2KDZA 1FBUA 1UI6A 3U2RA 3HL2A 2FD5A 1K4SA 5HLIA 1WCMJ 4QLCU 2GENA 4IL6C 3WGGA 2CUEA 2FBQA 2OC6A 2X51A 2GZWA 5AQCA 2JRMA 4I0AA 4Q48A 2CW7A 2LTPA 1K61A 3LNQA 3WTUC 1LVAA 2GLOA 2VT3A 4PJMA 4CXFA 3M4OJ 4Q47A 2IT0A 2Q0OA 2BBYA 2DA3A 1WSUA 1UCRA 3HTUA 4PDKA 2EV0A 4AIKA 2ZMEB 3BPXA 4EJTA 3AAFA 3OL4A 2BZTA 3BG7A 2UZKA 3HOZJ 2QOPA 5ERIA 1XX5A 2CU7A 1DU0A 2CW8A 3JREA 3QP6A 3M1EA 1B72B 4H4KC 1XSDA 1XD7A 4FASD 1GHCA 2X6OA 2OU2A 4RS8A 2YU3A 3F8MA 2V9VA 2V9PA 4XKBA 3V8LA 4RB3C 3L9FA 4CSWA 2VL8A 4GCKA 1WPKA 2OBPA 4CCKA 1D0XA 2BOLA 3HSFA 5D6EA 4M71A 3VVYA 3RTRA 3LOCA 3KCCA 2RC4A 1SFOJ 3JSPA 2KIUA 4E7HA 2F5DA 5D8LB 4F92B 2YX7A 4KUMA 3LA3A 4J19A 1FLIA 2PFBA 2OF7A 3M07A 1KONA 5ILVA 1STZA 4OIPF 3DBLB 4G7OF 2CMPA 1QNTA 1R1TA 5EGOA 2HVSA 3SFZA 2P0WA 2PJRB 2R7UA 1YG2A 1RIOH 1BI1A 5EG0B 2Z33A 4BBSJ 1T2KA 1MBJA 1JKOC 2EA2A 1Y39A 4EM1A 2UXXA 4HV5A 3H5AA 3BR5A 4MEYF 5IY5H 1AWCA 2IS4A 1YS7A 3C2HA 2R7TA 3CUOA 2FBHA 2LSOA 4B3AA 3AL0C 5LRRA 1TT0A 5K5OA 2V6CA 1BI3A 4FT8A 5HDNA 2M87A 1VQKI 1GV5A 3GLXA 5FLMJ 2CGPA 3F8NA 3N4MA 2REKA 1B59A 3E1SA 3I58A 4C3JJ 1G6NA 2OPTA 2DMNA 3W2WA 3FKIJ 4RBOA 3M8JA 3IAS2 3CCQI 3GF2A 1B9NA 4ZYGA 1WQ2A 3QYEA 4CDGA 4HF0A 1XS9A 3TO9A 2ZSIB 2COMA 3GTQJ 5F08A 3F23A 1LDJA 4L5IA 2H8RA 2QYOA 3RKXA 4BL0B 5LHIA 5KK1A 3L2CA 2WV0A 4NELA 1U2WA 2AQFA 1Z67A 2ZXJA 4I7HA 1R23A 1FYLA 2LD5A 1UG2A 1XGOA 3S3OA 4EQQA 2LMDA 4XMYA 3B6CA 3BR6A 1TQIA 1VQ4I 4A3FJ 3LSGA 4XKVA 1T39A 3HEFA 1TWGJ 2QEXI 2MC3A 2AQEA 2KJCA 1FNNA 2L4AA 2ELJA 2OA4A 1P6RA 3S16J 3DF8A 2W1OA 5HS9A 2R7RA 2BW3B 3ZR8X 4M6YA 4UVCA 3T5XA 3S15J 1SGMA 2WBMA 2XB5A 2A69F 2YUSA 4UB8C 3BJAA 4E70A 2GXAA 1ZR2A 2QSGX 1W7PA 5IP9J 2UXNA 4HNUA 3CJNA 4YIIA 4A2UA 2OQGA 2PMZN 1T56A 2IGNA 5ILSA 1NG6A 1QHHD 1RI7A 4N4NB 5IOZA 4Z6YA 4PJLA 2VONA 3OYKA 4JNNA 2VE9A 2O8XA 5FJ8J 3RZOJ 2NVQJ 3BR0A 2G7SA 5E1XA 2CQKA 4HA8A 3RYPA 4KIBA 2M8EA 1OCRH 2HOTA 2BY2A 1ODDA 4IOAF 1LNWA 5DUKA 4WXCA 2DU9A 2MYSA 2EIMH 1XG1A 3HXLA 3LWJA 4LGWA 2R7WA 4X1EA 2KLOA 2NRAC 4ABZA 3JAMK 2DOEA 1Z9CA 2O6GE 1FOYA 1S3JA 1IRGA 5AIPA 2L5QA 2HQ5A 5TGTA 3WHCA 1BR1A 3C18A 5TJJA 1T08B 2HKOA 4GCLA 1X3WB 1R6RA 3WTZA 1FOKA 2K9QA 1ZR4A 2Q1ZB 1LB2A 4OAZA 1MMDA 1BIBA 5J47A 2DN0A 3SZGA 1JUMA 2K5CA 3LSTA 1FWZA 2DLLA 5FKMA 5HLGA 4DNCA 2HGCA 2DFEA 4B8XA 3BJ6A 4II2A 3H35A 3ZMTA 3OS1A 3JTHA 2XHKA 4OIQF 2H8WA 1W36D 3CP2A 3BZ6A 3ZOBA 4IQJA 2W7NA 1MBKA 1RKTA 4XN0A 3A01A 1XTAA 3FZVA 5JVGF 1IUFA 1QQIA 2L02A 2NS8A 2LKSA 3RQ4A 4XBFA 4O3MA 2LG4A 4E4HA 3D5RC 3ROUA 1J7KA 1NHAA 4BXXJ 1Y6IA 3DXJF 1XGSA 3NRVA 2KISA 4KISA 3HDDA 5HLHA 1MBHA 1CQTA 2ADUA 2O61A 2JSCA 2R7OA 1VFCA 4YIRX 2G3BA 1S7OA 2Y2ZA 3PFYA 4XLAA 2ECCA 1SVLA 1MIJA 2HPIA 2M0CA 2BY3A 5ICFA 3L1PA 2K40A 2M0MA 3ZQIA 2QSFX 5D1RA 2DYSH 3R6SA 3PM1A 4G7HF 2QKOA 4Q5SF 5GPCA 3BQZA 4BJ5C 4PXIA 2PMZA 2DJIA 3J80Z 3T8RA 4ETSA 1ZYRF 2EILH 4S05A 2CS3A 2MH9A 2L9RA 2QENA 3TDZC 3FXRA 2H6CA 2FX0A 3V42A 3JW4A 2RAEA 2CW0F 3KEOA 1U8RA 1F4KA 1ETVA 2MD0A 1OR7A 1I6XA 1W5SA 2QKLB 1IN6A 3EUAA 1BA5A 1JGSA 1WVRA 3GTPJ 4EM0B 2DXIA 1WJ5A 1Z6RA 2MLGA 1MBFA 1F43A 3V78A 4RGUA 2DFHA 2P81A 4XM3A 4U88A 4G94A 5L3DA 3MZYA 5CQGA 1VQNI 4FCYA 5C44J 1RZ4A 2D1VA 2OQRA 2K02A 1ONVA 1Z7UA 4ON0A 2VT2A 1RC9A 1U0JA 3OOPA 2XVCA 2Z1DA 3MKYB 2KHMA 2P6SA 4GCVA 3ZQHA 1Y8QB 4XKWA 2Z3YA 3F0CA 5BQTA 4CGZA 3PO3J 1JI8A 4U0VA 2V26A 1A6QA 2L01A 2QSHX 1FIAA 1DPUA 1D1BA 4YIFA 5FD6A 2ZCWA 4C2TA 4XLHA 5HS8A 4CO8A 3IRRA 5K1YA 1R58A 1QU3A 4A93J 4NB5A 2MABA 2XPUA 3Q0UA 3S1NJ 1XDUA 5D5VB 1WJEA 4NQWA 2XF6A 3BQYA 1BM9A 1ULYA 3KZZA 3T6NA 1EA3A 3DLLF 3F22A 4NHJA 5AIQA 3NI7A 1IN7A 2LC2A 1Y1VJ 1YIOA 5CPRB 3BR3A 4MQ9F 2Z5UA 1VI0A 1HC8A 1EJ9A 3MVPA 4IJAA 3CUQA 1A5JA 1UZCA 2NAZA 1F36A 3E6BA 3H92A 1J9IA 5F0HA 3G4SI 1IAWA 3BRUA 2DA7A 5J4VA 1POGA 1GXQA 1MJBA 3LQQA 3RZDJ 3G1OA 1PP7U 3L2UA 1WFXA 4W1UA 1OR7C 3L2RA 2NS0A 5GTIC 3L00A 4UVBA 3KKCA 2XRLA 1E3PA 2W24A 2EFOA 5E8IA 3AG1H 2H27A 3HJEA 4ESBA 3C2BA 1KU3A 1BW6A 2DT7B 5J6XA 3OR1C 5L3GA 2B9SA 1W4MA 2LLKA 2BVMA 1A31A 2DOFA 5FRNA 3VIBA 4BXUA 2QBYB 1YHQI 3ANPA 1FZPB 1X1PA 1OFCX 1T0FC 1LPQA 5LD2C 2IAIA 3K4LA 1SFXA 4BHPA 1Z05A 3S2DJ 3H0GJ 5B3SH 3PPBA 3HTJA 2IA1A 2ECBA 4EJVA 4IO9F 1JT0A 3MFKA 1IUYA 2ZOZA 2KZVA 4EGYA 3EDPA 4A3KJ 3CTAA 1ZG3A 4XL9A 5FRMA 3HG9A 3FWEA 2MA3A 4M9XA 2HQRA 4L9TA 2V9KA 1YOVB 2WC2A 3HIFA 2KRCA 4QSHA 1K79A 1TLHB 3QOEA 5L3CA 3M8FA 2QQ8A 5GP9A 1U9NA 3HBLA 5HNFA 3K10A 5EF6A 1BI0A 1HBXG 4HNVA 4BBRJ 3KZ9A 3BR2A 3SEZA 3OL3A 5KAFC 4LK0F 3ELKA 2VQLA 1SANA 3FK7A 1YJWI 1UFMA 3M7GA 4GYIA 1X1AA 2F5FA 1IN8A 2EV5A 1JJ8C 2K9NA 5D5UB 5IYDJ 1HSTA 1U5TC 5FD5A 1V3FA 3CWRA 2XGDA 1P92A 1HW2A 3BT9A 1UJ8A 3GBGA 1RUOA 3GZ6A 4IZZA 2C6YA 2UUZA 3H9JA 4RMNA 1OCCH 5JI6A 3SFIA 3OYCA 3VYRB 1TTYA 1J59A 1X2MA 4KT5C 3S5RA 1B8IB 5DDGA 2IA0A 4HNTA 3NEUA 3WG7H 2P6TA 4XLEA 2VQGA 4G6TB 4XR6A 3ZP5A 1EKEA 1HXDA 2ZB9A 4N4OB 4FE4A 4XONA 1D8KA 2L54A 3KLNA 4V2GA 4CCLA 2CUJA 4A69C 3FXUA 2FJI1 3F9KA 5EG0A 4V2FA 3NARA 1ZTRA 3EYYA 3G2BA 2HU9A 4PFOA 5BMZA 3PQKA 3ZMVA 4Y4RA 1Y8RB 4WCGA 3IH4A 5DYMA 3MNLA 3DFGA 2VASA 1QA6A 1BBYA 3VUQA 4MXMA 3LWFA 2JJ7A 4CCOA 3S3NA 1G3YA 4R79A 4A3MJ 4XOTA 3IWFA 3VOXA 3ASOH 2RNJA 2VN2A 2W25A 2V1XA 3OOUA 3SDBA 3CCRI 2R4GA 4BJ6C 1O3SA 1JHHA 3WTWC 2K85A 4L18B 4NC8A 4BDZA 2ZXIA 3CLOA 1BI2A 3WU0A 4KIFA 3V7RA 2NOJB 4PUSA 4F93B 2WAEA 3BHQA 2HS5A 1CGPA 2DT5A 1I27A 2KMUA 3Q0WA 3O2PE 3AFHA 4NC6A 3CJDA 3S32A 2VBXA 2QWTA 1U5TB 3BZKA 4E6KG 2NX4A 1REPC 1T98A 5JLWA 3DTKA 2HOAA 4HOBA 5JLXA 2P4WA 1TW3A 3R4KA 4RA2A 4A0YA 1U8BA 5DM7F 1AU7A 3OIOA 1YQAA 1Q1VA 2DYRH 3IUVA 2GA1A 3LMMA 1YX3A 2KRFA 2RV8A 1OISA 3WU2C 1G3WA 1YW9A 1DP7P 3N97A 2ME0A 3KETA 2HWVA 3WGIA 1JHFA 3DPJA 1OCOH 2F6CA 1AHDP 3FBNB 1X3ZB 3CCUI 4RDUA 3HTAA 3TP0A 3VSLA 2IS2A 4ENNA 2CYYA 1FOXA 3RKQA 3WODF 4QWQA 4KN4X 2DODA 1MDMB 1XN7A 2QTQA 2GIVA 2I8DA 2F5VA 1JGGA 2DA5A 1UHSA 4PSWA 1SFUA 2F4OB 2JVGA 3KEQA 1P9QC 3LHQA 4YELA 3HUGB 1JTXA 2BXYA 2XDNA 1T38A 4IPAA 1YLFA 4ICHA 1H9TA 3H9GA 3HYIA 3L09A 3MN2A 3DBHB 3BTCA 3W6JB 1VQPI 3WTVC 3GFMA 1FSHA 3L7WA 1S5LC 4CZZA 2PN6A 2ZY9A 4A6EA 4I6ZA 1BR4A 2WAQN 4MO7A 1UHMA 3NAUA 2DG7A 1FJLA 5LFAA 1ZHFA 2V79A 2RVCA 3QAHA 4D9JA 4P1WA 4OU0A 2E1MC 3KPHA 3LSJA 2CQ7A 1A36A 2PJPA 5C3EJ 3LJLA 4GYGA 4E7IA 1Q1HA 2ZXHA 2XROA 2YR2A 4IX7A 2F07A 3DP7A 1HSJA 3TQNA 1BL0A 2GXBA 2D45A 3JRAA 1R1UA 1ZQ3P 2ZCXA 1UG0A 3CP8A 3LSMA 1IGNA 5C4XJ 5EGOB 2KQRA 1ETQA 3KIOA 3PNTA 3WTTC 4ENMA 1FY7A 2H94A 1O7LA 3C1DA 4DQ2A 3E5QA 3BG5A 3A0HC 5HVQC 2WUIA 4DOZA 1GT0C 4V19K 4C3IJ 3FM5A 1ZGJA 4JBAA 1R9TJ 1FTZA 2L9VA 3DCFA 1VQOI 2X1DA 3F8FA 4F91B 2DI3A 3LSHA 4LJZF 1P7IA 5FB2A 1V54H 5CJ9A 4Q4ZF 5D8KB 2XAGA 1U9OA 2EQRA 1I3AA 2PI0A 3CMAI 3PJRA 4HRIA 1A35A 3CESA 2CFXA 1KQ9A 9ANTA 2HKXA 3PNYA 4LG0A 4GFLA 1N77A 1V5FA 3CO7C 1AA7A 3K1NA 5DS9A 3R0AA 3PQJA 1IC8A 1SAXA 3GMEA 5HBUA 1MMAA 3CO6C 2NP5A 1KYZA 3K4KA 2CV1A 3DPUA 2NVUB 4FETA 2XIGA 4M73A 5FKLA 2KDOA 2JVHA 2IBDA 1XMKA 2XSJC 3P9IA 1AOYA 1ZREA 2HFHA 2JK3A 2JTVA 5J8FA 4Y3OA 4ZYEA 3LSPA 2D1HA 3BDDA 1APLC 4DVYP 2VKEA 4AVZA 3MAJA 3I54A 4I0BA 1H9GA 2DPDA 3VW2A 2HI3A 3FXQA 4ZDLA 2JA7J 1TWFJ 2FSWA 2XB0X 3C2GA 2HVQA 5B5EC 3BR1A 5DD8A 2W84A 3QPTA 4UVAA 1ON2A 3HGGA 4IRHA 1IRFA 3OV8A 2DMQA 3WGHA 3JSOA 3U1DA 1W7PB 3GYHX 2HKUA 4G12A 4A3CJ 4HEA2 5FLVA 4PJNA 1DGRM 4B43A 4D5FA 3V8KA 2Y31A 4XLNF 3UKGA 4MFDA 2VC1A 5DAJA 1FIPA 4L5JA 1WJDA 5KVRA 3Q3SA 3I59B 2VKDA 3ZMSA 4CCMA 1UHWA 1I39A 2OZUA 4S0HB 4XIDA 1BC7C 4DBRA 3MQ0A 2VE8A 1W0UA 1ZGWA 3GW2A 2LBFA 3PUFA 5EDNA 4JYKA 3KP6A 2O9LA 4K2EA 2EA4A 2FA5A 1XMXA 2O5RA 2TDXA 3PSFA 2R5YA 2I5UA 1YITI 4M9SA 2JMWA 1N78A 4II3A 2Z16A 1OCPA 4DGWB 4FISA 2M3AA 2QUFA 2E2JJ 3AL0B 3ONQA 2IS6A 3CMMA 3GCMA 3DTIA 3E6MA 2VB6A 4QPOA 1D0YA 5EZHA 1GUUA 4CUGA 2Y9YA 5E17F 4XLCA 1ZH5A 3GEZA 4BGDA 3HTHA 3H5RA 3ABKH 1ON1A 5GTHC 5CVVA 2IGOA 4KICA 4PFPA 1Z7LA 3HOVJ 1D5YA 2PJRA 4N9IA 2Y48A 1NTCA 4MNUA 2ISZA 4I98B 4OIOF 5LGNA 2DMUA 2L9NA 2FRHA 2B3WA 3HOSA 3I0TA 3O6BB 5JHUA 2H09A 4BU2A 3F1BA 1MGTA 4U7DA 1ETWA 4LG3A 2BYVE 2BY0A 2G0EA 1ZLKA 3PSIA 2QF7A 2F5EA 3CF5F 3COLA 1LEAA 3RPQA 4RAYA 1IZ1A 4JK1X 3I4PA 4EJOA 4EV0A 3GTJJ 1RUNA 1UMQA 2O03A 1TNTA 3WG9A 2K7LA 2JQ7A 3E5XA 3EGQA 2VKVA 2CV0A 2HTJA 4OMYA 4ZDPA 3Q0VA 4EGZA 3JRGA 1VNDA 2R5ZA 4KFCA 3BTLA 4UB6C 2VJJA 5F1RA 3S1MJ 3A03A 1DU6A 3RPUD 5D18A 4WIBA 3RI4A 5EEGA 2LRDA 1S8NA 2HDWA 1OYWA 4A3IJ 5M5XJ 1MSEC 3FMSA 1G8XA 3J7YJ 1BOAA 1PJRA 3OYAA 3G6EI 1USSA 2ZJPF 2Y9ZA 3H9QA 2DMTA 1LFPA 4R8HA 2L2OA 2BY1A 2KKOA 3MCZA 2ZXWH 4M72A 4LFUA 4L9VA 3NNRA 2JA8J 2VC0A 2XAHA 2EWNA 4B48A 5KHDA 3HRTA 3JRBA 3ZN1A 1MMNA 3J80K 4EVIA 2KRHA 1MW7A 4OOIA 3HB9A 2PFVA 3LFUA 4M3BA 4UUTA 3IV5A 5J8CA 3OS2A 5ED4A 3GZ5A 3DPTA 4KMFA 5F0CA 4ZYAA 3VW1A 1FP2A 2CUFA 1OPCA 1Z91A 3DEUA 2B7EA 3ESWB 3PNVA 2E2IJ 2VPLA 4BYYA 1SD4A 2K9SA 2HZDA 2BHYA 2MFZA 5K7ZA 3Q9VA 5ICCA 3VP5A 2W82A 3FMQA 4N0BA 5J1UA 3LSRA 4XRMA 2Y75A 4BQQA 3VYSB 2NNYA 2RHAA 3VVZA 4IRIA 4B3XA 2RASA 4LLGF 3HKZA 3P9CA 4C3HJ 2JA6J 1W1WE 1SMTA 2L9SA 2W4SA 4RGRA 5D6FA 5DCMA 3C7JA 1PVEA 5IT3A 4WWCA 3FXLA 4IRVA 2LVSA 4LK1F 2X85A 1KA8A 3OYNA 4ZC3A 4PJ0C 4PSXA 1MNEA 3CDHA 1JTYA 5ILUA 3OYBA 4A3LJ 1F9NA 5D19A 4ZYDA 3HOWJ 3KYLA 2ICWG 4KN7X 2UXUA 5E8GA 4BEHB 1K78B 1K6YA 4BQOA 1KGSA 2X6XA 1WH7A 2NYXA 2YU9J 3FDYA 5B1AH 5IT9Z 3ISPA 3KE2A 5A2QZ 1Z3YA 2QLZA 1FC3A 2A5YB 3P9KA 2G7HA 3K4JA 1FBQA 3FIWA 2KIMA 4EEFG 3I71A 4AC0A 5IPAA 3EPZA 4IRGA 2FU4A 2MSYA 2XKOA 1FBSA 3CLQA 3PASA 1Z21A 3RQIA 2Q24A 1WI9A 5CVJA 4QPQA 4NUBA 5LEJA 1TQMA 1KQ8A 2Z2SB 3CC2I 5DEQA 3HOTA 3BJOA 1BN5A 1MNDA 1LVKA 2Z99A 2P5LC 1W36C 3B73A 1V4RA 4E7ZA 2HR3A 1PUEE 1QPMA 3KX2A 1ZK8A 4C2MJ 1LE8A 3QU6A 5LEKA 3K2AA 4HZFA 2WTEA 4LD5A 3OIPA 2ELKA 4NC7A 3KP4A 1P4XA 2ESNA 3CCMI 3MKZA 2GM4A 2HOEA 2QGUA 4E7SA 4BH9A 2CFOA 4F3QA 1D5VA 3CD6I 3E5UA 2IW5A 4HW0A 3O8GA 2EZIA 4H0EA 4LOCA 4ASNA 2R7QA 3HHGA 4BEHA 3J7ZI 1K78A 3EYIA 2WA0A 2ZFWA 4FX0A 3BG6A 2K9LA 3HZJA 1I3QJ 1D1AA 3SQNA 4AIJA 1QZZA 3G56A 2A3SA 4OAYA 4HG2A 3GTOJ 1K83J 1OYIA 5JVTA 1B9MA 2EPFA 3SEQA 1S7EA 2M8GX 2LBFB 1FP1D 4RLQA 1KYWA 2EB7A 4U87A 2HQAA 5GAGJ 3ASNH 2ZNZA 3BTJA 1IV6A 1JE8A 1Z1DA 1IRZA 1CF7A 4IEJA 2DA4A 1MBGA 2A68F 3OYDA 3RCOA 2M7AA 4Y33A 1WH5A 4HF2A 2X1EA 2ZO4A 3NWSA 1MD0A 2ELHA 3PIOF 2ID3A 1TP4A 2JPCA 3OWTA 3NS4A 3E7LA 3G1MA 5J4YA 1ZRDA 1YI2I 3ZPLA 5E1WA 3IC7A 4OD5A 4DJAA 1ORKA 3WU1B 3QPSA 1SC7A 1BOBA 1ZG1A 4P96A 1YS6A 3CZ6A 3AG2H 4M3EA 2LKXA 4IOCF 2HYFA 3CCYA 3DU6A 5DV5A 4BAYA 3SZPA 3ZMZA 1QVUA 4ENKA 1G3TA 1XGNA 1TWCJ 2KIQA 1TNSA 3G73A 1ZELA 1IW7F 1TZLA 1MH3A 2P7VB 3QODA 4LLLA 2KFDA 3V8JA 3I55I 4A3JJ 3COAC 4GFBA 4Z2YA 5D5WB 1DPRA 2E71A 2M1BA 1E3HA 4BNCA 1Z6TA 4BY7J 3V4GA 3CJQB 3K6GA 1I5ZA 3HOYJ 1JKRC 3HRUA 4A5MA 3FHNA 1Z3XA 1U3EM 2LYCA 4NQWB 1R4NB 4BACA 1T95A 3QU3A 4JQFA 3VOEA 4AUXA 3R61A 3GFIA 1F1ZA 4UV9A 4G7ZF 3K8PC 3K1MA 4MFEA 1BJAA 4UXNA 4MEXF 1IO2A 3FRQA 3GZIA 3ABTA 3HTSB 3E3VA 5EJCA 3OYEA 1SAUA 2X6YA 1Z77A 4GCTA 2LR8A 3CDIA 3HIMA 3S2WA 4PGGA 4C2MA 3BCGA 2LY2A 3BLYA 3A01B 2XGXA 3HSEA 3E6CC 3X2QH 2PBIA 1UI5A 5CXIA 1LKXA 3H1CA 1ZLJA 2ZSHB 4ZH4F 1GDTA 1SMYF 3I56I 4UNOA 2KZGA 1SVOA 2IEKA 2F4MB 2ZJ2A 5J3LA 4AIDA 1LQ1A 3BJBA 3ZQ7A 2OERA 2HOSA 3I5UA 3QYFA 3B81A 2L4MA 3IHUA 1QZEA 3K9TA 1ZG5A 3FHZA 2ZNYA 1LDDA 4J00A 2NP3A 1R5HA 4YZEA 1B1BA 3IUOA 3JRIA 2FQ3A 2ZCNA 2NVYJ 2DT6A 5JR3A 4C2UA 4LIVA 2NOGA 3P9TA 1LDKB 4P9UA 3BOQA 4MGRA 3ZQFA 3KYDB 5CW8A 1R22A 1BR2A 3PIPF 1ETXA 2NS7A 2XAJA 1SD6A 2O7TA 4I2OA 4Y15A 2CQQA 4RGSA 3I64A 3VDXA 5H20A 3E7QA 2KPMA 1U78A 5GAEJ 3CCEI 2O8KA 2IGKA 2EFWA 3BTIA 4D1QA 2XAUA 1TWAJ 3R0JA 1H88C 3GVAA 1ZRCA 3GXOA 4PJJA 2UV1A 2VI6A 4JX5A 1R71A 3KP3A 1IV8A 1P4WA 3QPLA 3LFKA 3SXYA 3O60A 2F4IA 2JZYA 4RGXA 1UELB 3RKWA 4M3GA 3SZTA 2HYJA 4YRVA 3MWMA 2RKHA 5D4SA 3W2AA 2DG8A 3ZGKA 4OIRF 1HOMA 3TOAA 3V7CA 2HDCA 1YIJI 2A5WA 3CQZJ 2YS9A 1FEXA 4HYEA 1FX7A 2V6EA 2JWTA 1A04A 3HOXJ 3BC8A 3VEPA 3J81Z 3AG4H 3KYCB 1D1CA 3OYMA 3IL2A 2V1UA 3ZCOA 2E2HJ 1B72A 2PZ9A 3NRGA 2DJNA 1HW1A 2ME6A 3OSFA 3FISA 2XRNA 2VIXA 1ETYA 2O3FA 1TW2A 1W0TA 1JUPA 1FOWA 1FTTA 1WRJA 2YVXA 4UDSA 4I09A 4CGRA 4IHXA 2L7FP 2Z9OA 3CUQC 4FQGA 1OCTC 4CHUA 3CUQB 4TV7A 4XOPA 1W5CC 3F72A 2VJ4A 3VYUB 2RNGA 5K7HA 5B1BH 3VFZA 4UUSA 3IKTA 1C0WA 1YYVA 1SD5A 1MZBA 4RB2C 3VW0A 5DTDA 5FO5A 4AVPA 1GV2A 5DCFA 3ZXSA 3HC7A 2A6EF 4XRSA 2NVXJ 1FSEA 3KFWX 4NBQA 4HLYA 2XAFA 4UUVA 4ME9A 4HQEA 4RLFA 3K7AJ 4UV8A 4BE2A 3VYTB 1R7JA 2RN7A 2GIZA 2WV1A 2STTA 5HODA 1T33A 3EQLF 2EIJH 2IRFG 1VF9A 3HRMA 3HE0A 2V1DA 3GWZA 5M5YJ 3RH2A 3BWGA 3DKYA 5FMPA 3OYJA 2ZMEC 2X4HA 4PGHA 1X1BA 5FKNA 3J7AO 1HA8A 1UAAA 4M74A 3G7RA 2HQNA 4XSZF 3DLAA 3PL8A 2BV6A 3CCVI 3FKJA 2QIBA 3SYTA 4UY8I 2VUMJ 2M7BA 3J7AY 1QPIA 1SD7A 1QVTA 2DTRA 3RSNA 3GTLJ 3GTMJ 3JAMZ 3ZRGA 2GWRA 1R49A 2LKPA 3FXKA 1X3UA 2H1KA 4IHWA 1YX5A 4JOMA 4N9HA 3ZMUA 4A3EJ 3BG3A 4P5OA 2EJRA 4AD9A 2Y0MA 4BS9A 1HKSA 4PK4A 1FYKA 2B1EA 4CZCA 2D2WA 4OMZA 5M3MJ 3IWZA 4GGGA 5CKTA 3D5LA 5C4JJ 1Y1WJ 4BY1J 1P7JA 3TO6A 3B02A 3V6GA 3M1CA 1E17A 5GPAA 4IKFA 3NWTA 4ANJA 2GBYA 2AXTC 1OQYA 2LFBA 5DCMB 2P5KA 1VZ0A 3OMYA 2GXGA 3FF5A 4UUSB 2EZHA 1R5ID 4BUPA 3WTSC 2QQBA 4HX8A 3KZIC 1HDDC 3ERMA 3I4MJ 2PLYA 5BPDA 1IF1A 2HYTA 2DQRA 2BVLA 3DEEA 1B8IA 2K3PA 4FE7A 2M30A 3TDUC 3TMOA 4F55A 2D6YA 1ETKA 5BOXA 4PCQA 2LY9A 1O3RA 1ERDA 2PQ8A 3KP7A 2XGCA 2CSOA 2WADA 3K4NA 2FOKA 2V4JC 4HAMA 5E3NA 5K5RA 2E7WA 3HKZN 4RAGA 1VTNC 2EZKA 1RRJA 2PMHA 4QIWN 1O3TA 2IA2A 3H5NA 1J75A 1IRXA 5J40A 4HDVA 3L2VA 3HHHA 5L3EA 2E5NA 4JKZA 4FX4A 3S17J 3E0JB 5CXGA 2GUHA 3OYGA 2KT0A 4A3BJ 4KJZA 3DKXA 3UR3C 2OD5A 2VODA 2RQQA 1WWXA 3S1QJ 5D4RA 1WJBA 2UXIA 3CF2A 1XPXA 4LMYA 2P5VA 1YFHA 1D8JA 3DU5A 3JCUC 3WTXC 2E34A 4JL3A 4EATA 2DA2A 1MMGA 2G9WA 1ACIA 1QZYA 3P7NA 1JT6A 3H3VK 2LK2A 2Y0SN 5DD4A 4KYWA 2CWEA 1X19A 2VKHA 5B66C 2X48A 5J1RA 3AQTA 4XICA 2HPMA 2JRTA 5KAIC 3LAJA 2CV2A 1IDYA 1OJLA 2ETHA 3HGYA 1R1VA 2HVRA 4O6JA 1P2FA 3VODA 3CCJI 2FMLA 3ERED 4ZDOA 3SHFA 4AC6A 3FX3A 2KL4A 4I01A 1F5TA 2XDVA 4ACIA 5E79C 1NG7A 3GEUA 1XCBA 2FXAA 4A0XA 1XGMA 4MQVA 2M4KA 1JXSA 1XC5A 2DQLA 3ABUA 3RIRA 3ZQLA 3DQVC 2WB1N 3T0YA 3ABMH 4Y17A 3MKWB 4E7JA 2W85A 4XRSG 1EH6A 5DUIA 3TW6A 3L2QA 1QBJA 4GDFA 2HXOA 2ZFUA 3R60A 1JKQC 4WXHA 3I9V2 1PYVA 2LDUA 3BCAA 4YG2F 1VQ7I 3LQRA 1VQ9I 4RB1A 1HW5A 2ZC2A 2CG4A 2XPVA 5IT9K 1X4PA 2CH0A 1LJ9A 4EMSA 3W6KB 5H6QA 1MBEA 2H1LA 1E0EA 2L7KA 2A2FX 2N8GA 4YFKF 3NQOA 3Q5FA 1YRNB 3Q9SA 1TQPA 2V57A 5E18F 2L3DA 3S1RJ 3LSIA 2FQ4A 5GADJ 3K70C 2JA5J 5E3LA 3WE2A 4J01A 2DCEA 5CYVA 3QOPA 2CQNA 3H0DA 2R7ZJ 5CLSA 2XSDC 1W7PD 2LP0A 2F2EA 3OY9A 3T8TA 1GVDA 2MLKA 5ICGA 3HUGA 3RD3A 2DW4A 2QBYA 2IXSA 3TL4X 5FROA 2YPRA 2NNNA 2GAUA 3U1KA 4AYBN 2FUG2 2IP2A 3ML6A 4A5NA 1DDNA 1I6HJ 2L7ZA 3CDLA 2M2EA 4DYQA 2QQ9A 2G7LA 1GLNA 1J09A 5IP6A 2R92J 2M5WA 2WGBA 1O7FA 2IVMA 4KMUX 4ESJA 2M45A 3JRHA 1ZKGA 2VBWA 2V7FA 2OCCH 4B4CA 2ZJRF 1DGWY 4BJTA 1YRNA 3G71I 4KIGA 3TEDA 3GO5A 2BE5F 3AQSA 3GTGJ 2D5VA 4RM2A 4W97A 4D7NA 4AM3A 3K4CA 1G2HA 1I1SA 3TOBA 4BHBA 4LLNA 3DEWA 2VJIA 3KKDA 3OYHA 3F3XA 1VQ5I 3SDGA 2F48A 2BGCA 3DTEA 4E7LA 1V55H 3IP4B 2K27A 3I4NJ 2R7XA 2OUMA 2YSRA 2E36A 3CC7I 2BEOA 2QQAA 5HDKA 1RR8C 3QWLA 2UXOA 2ACJA 2H6BA 2OJED 3FBIB 4F52A 5HLTA 4FTHA 2W48A 1NH3A 3W3CA 2P8TA 3M3YJ 3PO2J 1OLTA 1ETOA 2CJJA 3GLLA 5EEHA 2CO5A 5L3BA 2J5OA 2WAQA 1S7AA 4G8XA 2LY1A 4M3DA 2FMYA 4YFNF 2PMUA 4A12A 2K3FA 4WF2A 3VWBA 2WAFA 2RQPA 4RAZA 2PG4A 2VQHA 5LHHA 3VSKA 2X1CA 2Y30A 3ZQCA 4Y13A 4L62A 3REOA 4C9YA 3KLOA 3OYIA 2B63J 1I50J 1QGPA 4P9FA 2AO9A 1OKRA 3OYLA 3C07A 5LGTA 1K7AA 3CCLI 4U7BA 2JT1A 1O57A 1ENHA 3F6OA 4MK6A 3TKYA 2HDDA 3OYFA 3H3ZA 4FHTA 2AXLA 2FEZA 1WJFA 3IKVA 1E2XA 3LAPA 1LE8B 1ZN2A 3VPRA 1XDSA 5TISC 2ZBKA 3HM5A 4L9JA 4R1HA 2KIFA 4KITB 2VLAA 4KNYA 3DWLE 3U21A 2IU5A 4UHTA 4BHCA 4KT6A 1G4DA 2MC4A 4XK4A 5FGLA 1SFKA 2K86A 4BKXA 3IH2A 2QCOA 1BIAA 4NN1A 3ABLH 4MLOA 3DV8A 5E3MA 4XSXF 2QA4I 1VQ8I 4AYBA 2K4JA 2VOOA 3CJTB 4MTDA 4D7MA 4B09A 4EJUA 2E7XA 3E97A 3RJPA 4HV6A 2ZKZA 2EFNA 4GO1A 2IPQX 2A07F 4U9NA 2FNAA 2KJBA 3BP8A 3WHBA 2G7UA 3ON4A 1RESA 2AHQA 2DA1A 5LBQA 2GOXB 1SEUA 1OMIA 2JN6A 4RAFA 5FLXK 3GZNB 3KEYA 5HOOA 5FHPA 3K4MA 4ITVA 2IS1A 3H36A 5M5WJ 2COBA 3O8HA 5CVIA 5JFRA 5K58A 1X1CA 3ZQQA 4YFXF 2TRTA 2JUCA 5BPIA 1RPWA 1HQCA 3GUDA 2HNHA 1GVJA 2E60A 2RREA 4A0ZA 4KA4A 5FKOA 1L3LA 2IGMA 3I59A 3VTIA 2DPUA 5F04A 3RPUA 1IN4A 3ECHA 3ZMDA 4JX4A 5DM6F 5HSZA 4GRIA 3BNIA 2JSPA 5FGMA 2A6TA 2LH9A 1MJAA 2R0QC 1IDZA 4F7ZA 5BNGA 2X6WA 3HRSA 1H89C 4ZJZA 2X9DA 2CRGA 5D5XB 4NDLA 4LB5A 2BW3A 1DUXC 1FMVA 1QRYA 1RNLA 3J81K 5M3FJ 2K9MA 1H8AC 1FT9A 4XQFA 4L0YB 2JUGA 3W2VA 4BXFA 3K0LA 3A1YA 1HKQA 3KP5A 1RETA 2JPBA 1YJNI 4ESFA 3L2WA 1T8IA 2R7VA 3CRJA 2EZLA 2ZCMA 3G3ZA 1K6OA 3A0BC 2DDAA 4HKUA 2IJLA 1RR7A 2MD5A 3K69A 3OS0A 1GXPA 2VQCA 3OR2C 2VXDA 1O4XA 3KP2A 4CYCB 3CMYA 3W6VA 2HTSA 2A6HF 4CH7A 1IG7A 3FXJA 3RDIA 3JSJA 4JP0A 3BG9A 4EJWA 1MMSA 2FBKA 3GTKJ 1AKHB 4WX9A 4HDUA 5EFYA 1VQLI 5HS7A 5KCMA 4O5VA 4DW6A 1G59A 3B6AA 2QWWA 1DP3A 2X0LA 1IJWC 2LREA 2B0LA 2UXHA 2LF7A 2DBBA 4IHSA 3JR9A 3A2KA 3LA7A 2A05A 2XF5A 1BW5A 1V5EA 3MZ8A 4WXDA 3TO7A 4I99C 1LFUP 3EUHC 2HYGD 4DYCA 1MNMC 4XORA 4CA0A 2CUZA 1Y0NA 3EUPA 2VJ5A 2EFQA 1E3OC 4DBQA 2VPRA 2HXIA 1YO5C 2DOAA 1IXRC 4G6QA 4I02A 4AF5A 4HSRA 1TC3C 3E6DA 2EBIA 1BC8C 4DIQA 1S6LA 4AU7A 5HNHA 2DDBA 4CYDA 1X2NA 3MEXA 1VQMI 2WY8Q 1X4OA 1AKHA 2PBXA 3C3WA 2VBYA 4LB6B 2GQQA 2M34A 1SFEA 2W00A 2UXPA 4BE1A 4DYRA 5K5QA 1HCRA 1ZGAA 1PUFB 2DK8A 3QQAA 4D0PA 3F8BA 5HAWA 3CMEI 1O3QA 2OCEA 1TBXA 5AONA 3IRQA 2DAOA 4XLFA 4BQAA 4CYCA 1R36A 2O7OA 4RM3A 2DA6A 3DBRB 2P7CB 2YX4A 5CVRA 3GX4X 1OYYA 2YVEA 2O0YA 2OTLI 4AIHA 5F1JA 1USTA 1WJCA 4IHTA 2TCTA 3OSGA 1B6AA 1DQUA 2MBFA 1WKMA 2FOWA 4CCNA 2AS5F 5F64A 2DFIA 2WB1A 1TL8A 3QPHA 2FJ1A 2W57A 3CC4I 4RB0A 2EK5A 1ZARA 4ZZLA 1MDMA 3I3LA 1Y56A 1WZ2A 3TGNA 2V1NA 1T6SA 4ZZDA 3O3KA 3AKZA 2RGVA 3JTGA 2EFPA 2MGQA 2M4GA 2MW8A 4U0WA 2WWYA 2G7GA 1KU9A 3ULQB 2XUBA 5CQEA 5IP7J 4JX6A 2HZTA 2R7FA 1TWHJ 5TRDA 2ISYA 2QZ8A 3ZQGA 3HSRA 4E7KA 4YEJA 1PUFA 5H6RA 5LHGA 2YVHA
chains in the Genus database with same CATH topology
1VFCA 3BG3A 1A6IA 2G3BA 2Y2ZA 2JMWA 3G1LA 1WI3A 3NPIA 3ON2A 2ECCA 1OCPA 4FISA 2M0CA 3L1PA 2K40A 2E2JJ 3ZQIA 5D1RA 5C4JJ 5M3MJ 3JRCA 4BY1J 1Y1WJ 3PM1A 2QKOA 1P7JA 3FK6A 3V6GA 5GPCA 3BQZA 5EZHA 5GPAA 4PXIA 2W53A 3D1NI 1GUUA 3MKLA 2GBYA 2LFBA 4B1RA 2Y9YA 2MG4A 5F27A 3HTHA 2DMPA 2EZHA 4UUSB 3A02A 5K7FA 1JUSA 2L9RA 1HDDC 3I4MJ 2XPWA 1NK3P 1JKPC 3HOVJ 1D5YA 2I10A 2FX0A 2HYTA 1NTCA 2RAEA 2E19A 1B8IA 3TW7A 4FE7A 1ETVA 3S14J 5H9TA 2DMUA 2D6YA 4M3FA 1ETKA 2LY9A 5IYCJ 5EYRA 1MSFC 1BA5A 3ANGA 2XGCA 3F1BA 3GTPJ 1ETWA 5E3NA 2G0EA 1MBFA 1F43A 3V78A 2P81A 2QF7A 1RKWA 3HKZN 1EF4A 3COLA 5C4YA 2EZKA 1ITYA 4QIWN 3GTJJ 4FCYA 4KWAA 1UMQA 5C44J 5EZGA 3EGQA 2VKVA 4I76A 4JKZA 3S17J 5CXGA 3QKXA 5IOYA 3Q0VA 2GUHA 4Y7NJ 2KT0A 4M6VA 4A3BJ 3ZQHA 3JRGA 4A3DJ 1VNDA 2R5ZA 3F0CA 3JRDA 3PO3J 3BTLA 3S1MJ 3S1QJ 3A03A 1FIAA 1DU6A 5FKKA 2UXIA 1Z0XA 5D18A 2M9HA 4A93J 4IHVA 3Q0UA 2XPUA 3S1NJ 2GFNA 4JL3A 2DA2A 4A3IJ 5M5XJ 1MSEC 4L5EA 1JT6A 3H3VK 2LK2A 3BQYA 2Y9ZA 2Y0SN 3VVXA 3T6NA 2DMTA 2R5ZB 3NI7A 2X48A 5J1RA 3AQTA 4XICA 2L0KA 1Y1VJ 3BR3A 3NNRA 1IDYA 1VI0A 3MVPA 1OJLA 2JA8J 3HGYA 1A5JA 1JJ6C 1F36A 3JRBA 4DZPA 5F0HA 4AC6A 2E1OA 3BRUA 2DA7A 3IH3A 1POGA 4ACIA 3HB9A 1NK2P 3RZDJ 4M3BA 3GEUA 3G1OA 4UUTA 3IV5A 3SJMA 4W1UA 1MH4A 1XC5A 3KKCA 2XRLA 5F0CA 3ZQLA 2CUFA 4A3GJ 3VW1A 2E2IJ 2WB1N 4IHYA 2XGEA 2NVTJ 2YVHA 2K9SA 2EH3A 4Y52J 2DTZA 2L7MP 3C2BA 4XRSG 1BW6A 3TW6A 2ID6A 5K7ZA 2LLKA 3VP5A 3VIBA 2HXOA 1JKQC 5J1UA 3ANPA 3LSRA 4D5CA 1OFCX 4XRMA 3VVZA 2RHAA 3HOUJ 2IAIA 2RASA 2XPVA 4C3HJ 1HLVA 3S2DJ 3H0GJ 2JA6J 3PPBA 5EEAA 3KNWA 1MBEA 3HTJA 2ECBA 1JT0A 2ZOZA 2N8GA 1YRNB 2LVSA 4A3KJ 2V57A 3NXCA 3S1RJ 1JTYA 4A3LJ 5D19A 4QSHA 2FQ4A 3HOWJ 2JA5J 5E3LA 5GP9A 1U9NA 3HBLA 1WGXA 2UXUA 5IYBJ 5EF6A 4MIMA 2R7ZJ 5E3OA 4HNVA 2R5YB 2XSDC 1WH7A 4DZJA 2YU9J 4BBRJ 2LP0A 3KZ9A 3BR2A 3S2HJ 1LFBA 1GVDA 2CQXA 1HF0A 3FIWA 4EEFG 5IPAA 4AC0A 3RD3A 1SANA 3FK7A 4AYBN 2MSYA 1I6HJ 3HTIA 2L7ZA 3PASA 3RQIA 3CDLA 4QTRA 2Q24A 4GFKA 2M2EA 4DYQA 1JJ8C 2K9NA 2ZOYA 5IYDJ 2G7LA 5IP6A 2R92J 3CWRA 2XGDA 2R93J 1BJZA 3BT9A 3GBGA 3JRFA 4X6AJ 2WGBA 3JRHA 1ZKGA 3SFIA 4B4CA 1YRNA 3TP3A 1X2MA 3S5RA 1B8IB 4C2MJ 3TEDA 1ZK8A 1LE8A 2OI8A 3K2AA 3AQSA 3GTGJ 2D5VA 2ELKA 4W97A 4D7NA 1X58A 1G2HA 2GM4A 1HDPA 2ZB9A 4FE4A 3DEWA 4V2GA 3KKDA 3SDGA 3O8GA 2EZIA 4LOCA 4A69C 3I4NJ 5EG0A 4V2FA 3NARA 5J1YA 1ZTRA 2UXOA 5F0FA 1I3QJ 4FTHA 3PO2J 2W48A 4ICHA 3M3YJ 3QBMA 3G56A 2CJJA 1ETOA 2KDZA 3GTOJ 3IH4A 1UI6A 1K83J 3MNLA 2FD5A 1WCMJ 2GENA 4M3DA 1S7EA 2M8GX 2CUEA 3VUQA 2FBQA 4MXMA 2JJ7A 5AQCA 2LTPA 1K61A 3LNQA 4A3MJ 2GLOA 3M4OJ 3VOXA 3OOUA 2Y30A 3ZQCA 3BTJA 4L62A 2DA3A 1IV6A 1IRZA 2B63J 1I50J 3C07A 4IEJA 2AO9A 2DA4A 1MBGA 1ENHA 1WH5A 3HOZJ 4MK6A 2QOPA 2HDDA 2CU7A 2ID3A 1DU0A 3JREA 3E7LA 3G1MA 1LE8B 3BHQA 3VPRA 1B72B 3HM5A 3Q0WA 1ORKA 2X6OA 3QPSA 2IU5A 3CJDA 4M3EA 2LKXA 4XK4A 5FGLA 3CCYA 4BKXA 3IH2A 2QCOA 2QWTA 4NN1A 2NX4A 1QVUA 5JLWA 1TWCJ 2HOAA 4MLOA 5JLXA 5E3MA 1U8BA 1AU7A 1MH3A 4GFBA 4A3JJ 4GCKA 3OIOA 1WPKA 1Q1VA 3IUVA 4BY7J 4D7MA 3VVYA 3LOCA 3HOYJ 1JKRC 1SFOJ 2ME0A 3WHBA 3DPJA 3ON4A 1RESA 2AHQA 2DA1A 1AHDP 4RDUA 4J19A 3HTAA 2JN6A 3TP0A 2OF7A 5FHPA 4AUXA 3RKQA 4MFEA 5M5WJ 5EGOA 2COBA 3O8HA 5K58A 3FRQA 2QTQA 3GZIA 1JGGA 2DA5A 2TRTA 5EG0B 4BBSJ 1RPWA 1MBJA 1JKOC 1UHSA 1Z77A 4GCTA 2LR8A 3HIMA 3BR5A 5FKOA 3LHQA 1JTXA 2XDNA 5F04A 3BCGA 4B3AA 5HSZA 4JX4A 3A01B 3MN2A 1UI5A 5CXIA 3BNIA 1GV5A 5FLMJ 3BTCA 1GDTA 2REKA 2R0QC 1IDZA 4RBOA 4C3JJ 2OPTA 2DMNA 3FKIJ 2IEKA 5J3LA 5BNGA 3BJBA 2OERA 2HOSA 1H89C 1XS9A 4I6ZA 2X9DA 2WAQN 2CRGA 4MO7A 4NDLA 3B81A 3NAUA 1QRYA 5M3FJ 2DG7A 1FJLA 3GTQJ 2NP3A 5F08A 4YZEA 3JRIA 1H8AC 2NVYJ 2H8RA 2ZCNA 4NELA 2NOGA 3P9TA 1RETA 3CRJA 3LSJA 2EZLA 3ZQFA 2ZCMA 2LD5A 1UG2A 5C3EJ 4HKUA 3LJLA 5CW8A 1RR7A 1ETXA 2NS7A 2F07A 1BL0A 3B6CA 1O4XA 3BR6A 2O7TA 4CYCB 3CMYA 3W6VA 3JRAA 4A3FJ 3LSGA 3HEFA 1IG7A 1TWGJ 3JSJA 1ZQ3P 2CQQA 3BG9A 4JP0A 2ZCXA 3GTKJ 1AKHB 1IGNA 3E7QA 5C4XJ 5EGOB 5EFYA 3S16J 1U78A 1ETQA 2O8KA 3BTIA 4DW6A 1SGMA 3S15J 3B6AA 1TWAJ 1H88C 2XB5A 1IJWC 3BG5A 2UXHA 2VI6A 2YUSA 2WUIA 4JX5A 1GT0C 4C3IJ 1ZR2A 3JR9A 5IP9J 3QPLA 1R9TJ 1FTZA 1BW5A 3DCFA 3O60A 4M3GA 2HYJA 1LFUP 1P7IA 2PMZN 1T56A 4DYCA 1MNMC 1U9OA 2EQRA 2DG8A 5IOZA 1HOMA 3VOKA 3CQZJ 4JNNA 2YS9A 9ANTA 1FEXA 3EUPA 5FJ8J 1E3OC 2NVQJ 2JWTA 2HXIA 2VPRA 3BR0A 3HOXJ 3RZOJ 2G7SA 4GFLA 4AF5A 5DS9A 1TC3C 2EBIA 1IC8A 3NRGA 2E2HJ 5HBUA 1B72A 2PZ9A 2HOTA 2DJNA 2NP5A 2ME6A 3OSFA 3FISA 1X2NA 1AKHA 2PBXA 1XG1A 3LWJA 1ETYA 4X1EA 5FKLA 2IBDA 2M34A 2UXPA 1W0TA 4ABZA 1JUPA 4DYRA 1HCRA 1PUFB 1FTTA 2JK3A 3QQAA 4UDSA 4CGRA 5HAWA 4IHXA 2L7FP 3LSPA 1APLC 1OCTC 2VKEA 2HQ5A 3VW2A 3WHCA 2HI3A 4CYCA 2O7OA 2JA7J 2DA6A 5K7HA 4GCLA 1TWFJ 4UUSA 2XB0X 2YVEA 2K9QA 1ZR4A 3BR1A 5F1JA 3VW0A 5DTDA 2DN0A 1GV2A 2TCTA 3OSGA 3HGGA 1JUMA 4XRSA 2NVXJ 5FKMA 4ME9A 2DMQA 3K7AJ 2FJ1A 2HKUA 4G12A 4A3CJ 2WV1A 5FLVA 5HODA 4D5FA 1T33A 1VF9A 2Y31A 3HE0A 3ZOBA 5M5YJ 3RH2A 3UKGA 1MBKA 1RKTA 4MFDA 5FMPA 3A01A 5DAJA 1FIPA 2MGQA 1IUFA 2NS8A 3Q3SA 2MW8A 5FKNA 3G7RA 2G7GA 5IP7J 4JX6A 2QIBA 4BXXJ 4S0HB 4XIDA 2VUMJ 1QPIA 1TWHJ 1ZGWA 1W0UA 1QVTA 3GTLJ 3GTMJ 3HDDA 3ZQGA 5EDNA 4JYKA 1PUFA 2O9LA 1MBHA 2H1KA 1CQTA 4IHWA 4A3EJ 2R5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFC A;  3BG3 A;  1A6I A;  2G3B A;  2Y2Z A;  2JMW A;  3G1L A;  1WI3 A;  3NPI A;  3ON2 A;  2ECC A;  1OCP A;  4FIS A;  2M0C A;  3L1P A;  2K40 A;  2E2J J;  3ZQI A;  5D1R A;  5C4J J;  5M3M J;  3JRC A;  4BY1 J;  1Y1W J;  3PM1 A;  2QKO A;  1P7J A;  3FK6 A;  3V6G A;  5GPC A;  3BQZ A;  5EZH A;  5GPA A;  4PXI A;  2W53 A;  3D1N I;  1GUU A;  3MKL A;  2GBY A;  2LFB A;  4B1R A;  2Y9Y A;  2MG4 A;  5F27 A;  3HTH A;  2DMP A;  2EZH A;  4UUS B;  3A02 A;  5K7F A;  1JUS A;  2L9R A;  1HDD C;  3I4M J;  2XPW A;  1NK3 P;  1JKP C;  3HOV J;  1D5Y A;  2I10 A;  2FX0 A;  2HYT A;  1NTC A;  2RAE A;  2E19 A;  1B8I A;  3TW7 A;  4FE7 A;  1ETV A;  3S14 J;  5H9T A;  2DMU A;  2D6Y A;  4M3F A;  1ETK A;  2LY9 A;  5IYC J;  5EYR A;  1MSF C;  1BA5 A;  3ANG A;  2XGC A;  3F1B A;  3GTP J;  1ETW A;  5E3N A;  2G0E A;  1MBF A;  1F43 A;  3V78 A;  2P81 A;  2QF7 A;  1RKW A;  3HKZ N;  1EF4 A;  3COL A;  5C4Y A;  2EZK A;  1ITY A;  4QIW N;  3GTJ J;  4FCY A;  4KWA A;  1UMQ A;  5C44 J;  5EZG A;  3EGQ A;  2VKV A;  4I76 A;  4JKZ A;  3S17 J;  5CXG A;  3QKX A;  5IOY A;  3Q0V A;  2GUH A;  4Y7N J;  2KT0 A;  4M6V A;  4A3B J;  3ZQH A;  3JRG A;  4A3D J;  1VND A;  2R5Z A;  3F0C A;  3JRD A;  3PO3 J;  3BTL A;  3S1M J;  3S1Q J;  3A03 A;  1FIA A;  1DU6 A;  5FKK A;  2UXI A;  1Z0X A;  5D18 A;  2M9H A;  4A93 J;  4IHV A;  3Q0U A;  2XPU A;  3S1N J;  2GFN A;  4JL3 A;  2DA2 A;  4A3I J;  5M5X J;  1MSE C;  4L5E A;  1JT6 A;  3H3V K;  2LK2 A;  3BQY A;  2Y9Z A;  2Y0S N;  3VVX A;  3T6N A;  2DMT A;  2R5Z B;  3NI7 A;  2X48 A;  5J1R A;  3AQT A;  4XIC A;  2L0K A;  1Y1V J;  3BR3 A;  3NNR A;  1IDY A;  1VI0 A;  3MVP A;  1OJL A;  2JA8 J;  3HGY A;  1A5J A;  1JJ6 C;  1F36 A;  3JRB A;  4DZP A;  5F0H A;  4AC6 A;  2E1O A;  3BRU A;  2DA7 A;  3IH3 A;  1POG A;  4ACI A;  3HB9 A;  1NK2 P;  3RZD J;  4M3B A;  3GEU A;  3G1O A;  4UUT A;  3IV5 A;  3SJM A;  4W1U A;  1MH4 A;  1XC5 A;  3KKC A;  2XRL A;  5F0C A;  3ZQL A;  2CUF A;  4A3G J;  3VW1 A;  2E2I J;  2WB1 N;  4IHY A;  2XGE A;  2NVT J;  2YVH A;  2K9S A;  2EH3 A;  4Y52 J;  2DTZ A;  2L7M P;  3C2B A;  4XRS G;  1BW6 A;  3TW6 A;  2ID6 A;  5K7Z A;  2LLK A;  3VP5 A;  3VIB A;  2HXO A;  1JKQ C;  5J1U A;  3ANP A;  3LSR A;  4D5C A;  1OFC X;  4XRM A;  3VVZ A;  2RHA A;  3HOU J;  2IAI A;  2RAS A;  2XPV A;  4C3H J;  1HLV A;  3S2D J;  3H0G J;  2JA6 J;  3PPB A;  5EEA A;  3KNW A;  1MBE A;  3HTJ A;  2ECB A;  1JT0 A;  2ZOZ A;  2N8G A;  1YRN B;  2LVS A;  4A3K J;  2V57 A;  3NXC A;  3S1R J;  1JTY A;  4A3L J;  5D19 A;  4QSH A;  2FQ4 A;  3HOW J;  2JA5 J;  5E3L A;  5GP9 A;  1U9N A;  3HBL A;  1WGX A;  2UXU A;  5IYB J;  5EF6 A;  4MIM A;  2R7Z J;  5E3O A;  4HNV A;  2R5Y B;  2XSD C;  1WH7 A;  4DZJ A;  2YU9 J;  4BBR J;  2LP0 A;  3KZ9 A;  3BR2 A;  3S2H J;  1LFB A;  1GVD A;  2CQX A;  1HF0 A;  3FIW A;  4EEF G;  5IPA A;  4AC0 A;  3RD3 A;  1SAN A;  3FK7 A;  4AYB N;  2MSY A;  1I6H J;  3HTI A;  2L7Z A;  3PAS A;  3RQI A;  3CDL A;  4QTR A;  2Q24 A;  4GFK A;  2M2E A;  4DYQ A;  1JJ8 C;  2K9N A;  2ZOY A;  5IYD J;  2G7L A;  5IP6 A;  2R92 J;  3CWR A;  2XGD A;  2R93 J;  1BJZ A;  3BT9 A;  3GBG A;  3JRF A;  4X6A J;  2WGB A;  3JRH A;  1ZKG A;  3SFI A;  4B4C A;  1YRN A;  3TP3 A;  1X2M A;  3S5R A;  1B8I B;  4C2M J;  3TED A;  1ZK8 A;  1LE8 A;  2OI8 A;  3K2A A;  3AQS A;  3GTG J;  2D5V A;  2ELK A;  4W97 A;  4D7N A;  1X58 A;  1G2H A;  2GM4 A;  1HDP A;  2ZB9 A;  4FE4 A;  3DEW A;  4V2G A;  3KKD A;  3SDG A;  3O8G A;  2EZI A;  4LOC A;  4A69 C;  3I4N J;  5EG0 A;  4V2F A;  3NAR A;  5J1Y A;  1ZTR A;  2UXO A;  5F0F A;  1I3Q J;  4FTH A;  3PO2 J;  2W48 A;  4ICH A;  3M3Y J;  3QBM A;  3G56 A;  2CJJ A;  1ETO A;  2KDZ A;  3GTO J;  3IH4 A;  1UI6 A;  1K83 J;  3MNL A;  2FD5 A;  1WCM J;  2GEN A;  4M3D A;  1S7E A;  2M8G X;  2CUE A;  3VUQ A;  2FBQ A;  4MXM A;  2JJ7 A;  5AQC A;  2LTP A;  1K61 A;  3LNQ A;  4A3M J;  2GLO A;  3M4O J;  3VOX A;  3OOU A;  2Y30 A;  3ZQC A;  3BTJ A;  4L62 A;  2DA3 A;  1IV6 A;  1IRZ A;  2B63 J;  1I50 J;  3C07 A;  4IEJ A;  2AO9 A;  2DA4 A;  1MBG A;  1ENH A;  1WH5 A;  3HOZ J;  4MK6 A;  2QOP A;  2HDD A;  2CU7 A;  2ID3 A;  1DU0 A;  3JRE A;  3E7L A;  3G1M A;  1LE8 B;  3BHQ A;  3VPR A;  1B72 B;  3HM5 A;  3Q0W A;  1ORK A;  2X6O A;  3QPS A;  2IU5 A;  3CJD A;  4M3E A;  2LKX A;  4XK4 A;  5FGL A;  3CCY A;  4BKX A;  3IH2 A;  2QCO A;  2QWT A;  4NN1 A;  2NX4 A;  1QVU A;  5JLW A;  1TWC J;  2HOA A;  4MLO A;  5JLX A;  5E3M A;  1U8B A;  1AU7 A;  1MH3 A;  4GFB A;  4A3J J;  4GCK A;  3OIO A;  1WPK A;  1Q1V A;  3IUV A;  4BY7 J;  4D7M A;  3VVY A;  3LOC A;  3HOY J;  1JKR C;  1SFO J;  2ME0 A;  3WHB A;  3DPJ A;  3ON4 A;  1RES A;  2AHQ A;  2DA1 A;  1AHD P;  4RDU A;  4J19 A;  3HTA A;  2JN6 A;  3TP0 A;  2OF7 A;  5FHP A;  4AUX A;  3RKQ A;  4MFE A;  5M5W J;  5EGO A;  2COB A;  3O8H A;  5K58 A;  3FRQ A;  2QTQ A;  3GZI A;  1JGG A;  2DA5 A;  2TRT A;  5EG0 B;  4BBS J;  1RPW A;  1MBJ A;  1JKO C;  1UHS A;  1Z77 A;  4GCT A;  2LR8 A;  3HIM A;  3BR5 A;  5FKO A;  3LHQ A;  1JTX A;  2XDN A;  5F04 A;  3BCG A;  4B3A A;  5HSZ A;  4JX4 A;  3A01 B;  3MN2 A;  1UI5 A;  5CXI A;  3BNI A;  1GV5 A;  5FLM J;  3BTC A;  1GDT A;  2REK A;  2R0Q C;  1IDZ A;  4RBO A;  4C3J J;  2OPT A;  2DMN A;  3FKI J;  2IEK A;  5J3L A;  5BNG A;  3BJB A;  2OER A;  2HOS A;  1H89 C;  1XS9 A;  4I6Z A;  2X9D A;  2WAQ N;  2CRG A;  4MO7 A;  4NDL A;  3B81 A;  3NAU A;  1QRY A;  5M3F J;  2DG7 A;  1FJL A;  3GTQ J;  2NP3 A;  5F08 A;  4YZE A;  3JRI A;  1H8A C;  2NVY J;  2H8R A;  2ZCN A;  4NEL A;  2NOG A;  3P9T A;  1RET A;  3CRJ A;  3LSJ A;  2EZL A;  3ZQF A;  2ZCM A;  2LD5 A;  1UG2 A;  5C3E J;  4HKU A;  3LJL A;  5CW8 A;  1RR7 A;  1ETX A;  2NS7 A;  2F07 A;  1BL0 A;  3B6C A;  1O4X A;  3BR6 A;  2O7T A;  4CYC B;  3CMY A;  3W6V A;  3JRA A;  4A3F J;  3LSG A;  3HEF A;  1IG7 A;  1TWG J;  3JSJ A;  1ZQ3 P;  2CQQ A;  3BG9 A;  4JP0 A;  2ZCX A;  3GTK J;  1AKH B;  1IGN A;  3E7Q A;  5C4X J;  5EGO B;  5EFY A;  3S16 J;  1U78 A;  1ETQ A;  2O8K A;  3BTI A;  4DW6 A;  1SGM A;  3S15 J;  3B6A A;  1TWA J;  1H88 C;  2XB5 A;  1IJW C;  3BG5 A;  2UXH A;  2VI6 A;  2YUS A;  2WUI A;  4JX5 A;  1GT0 C;  4C3I J;  1ZR2 A;  3JR9 A;  5IP9 J;  3QPL A;  1R9T J;  1FTZ A;  1BW5 A;  3DCF A;  3O60 A;  4M3G A;  2HYJ A;  1LFU P;  1P7I A;  2PMZ N;  1T56 A;  4DYC A;  1MNM C;  1U9O A;  2EQR A;  2DG8 A;  5IOZ A;  1HOM A;  3VOK A;  3CQZ J;  4JNN A;  2YS9 A;  9ANT A;  1FEX A;  3EUP A;  5FJ8 J;  1E3O C;  2NVQ J;  2JWT A;  2HXI A;  2VPR A;  3BR0 A;  3HOX J;  3RZO J;  2G7S A;  4GFL A;  4AF5 A;  5DS9 A;  1TC3 C;  2EBI A;  1IC8 A;  3NRG A;  2E2H J;  5HBU A;  1B72 A;  2PZ9 A;  2HOT A;  2DJN A;  2NP5 A;  2ME6 A;  3OSF A;  3FIS A;  1X2N A;  1AKH A;  2PBX A;  1XG1 A;  3LWJ A;  1ETY A;  4X1E A;  5FKL A;  2IBD A;  2M34 A;  2UXP A;  1W0T A;  4ABZ A;  1JUP A;  4DYR A;  1HCR A;  1PUF B;  1FTT A;  2JK3 A;  3QQA A;  4UDS A;  4CGR A;  5HAW A;  4IHX A;  2L7F P;  3LSP A;  1APL C;  1OCT C;  2VKE A;  2HQ5 A;  3VW2 A;  3WHC A;  2HI3 A;  4CYC A;  2O7O A;  2JA7 J;  2DA6 A;  5K7H A;  4GCL A;  1TWF J;  4UUS A;  2XB0 X;  2YVE A;  2K9Q A;  1ZR4 A;  3BR1 A;  5F1J A;  3VW0 A;  5DTD A;  2DN0 A;  1GV2 A;  2TCT A;  3OSG A;  3HGG A;  1JUM A;  4XRS A;  2NVX J;  5FKM A;  4ME9 A;  2DMQ A;  3K7A J;  2FJ1 A;  2HKU A;  4G12 A;  4A3C J;  2WV1 A;  5FLV A;  5HOD A;  4D5F A;  1T33 A;  1VF9 A;  2Y31 A;  3HE0 A;  3ZOB A;  5M5Y J;  3RH2 A;  3UKG A;  1MBK A;  1RKT A;  4MFD A;  5FMP A;  3A01 A;  5DAJ A;  1FIP A;  2MGQ A;  1IUF A;  2NS8 A;  3Q3S A;  2MW8 A;  5FKN A;  3G7R A;  2G7G A;  5IP7 J;  4JX6 A;  2QIB A;  4BXX J;  4S0H B;  4XID A;  2VUM J;  1QPI A;  1TWH J;  1ZGW A;  1W0U A;  1QVT A;  3GTL J;  3GTM J;  3HDD A;  3ZQG A;  5EDN A;  4JYK A;  1PUF A;  2O9L A;  1MBH A;  2H1K A;  1CQT A;  4IHW A;  4A3E J;  2R5Y A; 
#chains in the Genus database with same CATH topology
 1A6I A;  1VQ6 I;  3G1L A;  1WI3 A;  3NPI A;  3ON2 A;  1KU7 A;  1KU2 A;  4HX7 A;  2LOO A;  3JRC A;  2OV7 A;  2A61 A;  4XRF A;  3FK6 A;  4C30 A;  2E1M B;  3F6V A;  1T0F A;  3D1N I;  2W53 A;  3MKL A;  4B1R A;  5F27 A;  2MG4 A;  5LRS A;  1X1D A;  1LUJ B;  2DMP A;  3EUK L;  3A02 A;  3WE3 A;  5K7F A;  1JUS A;  1TT5 B;  2OTJ I;  1WJA A;  2XPW A;  1NK3 P;  1YW8 A;  5LLQ A;  1JKP C;  4IXA A;  2I10 A;  3UNG C;  3BY6 A;  2E19 A;  4HLX A;  3TW7 A;  3S14 J;  1PP8 F;  5H9T A;  3LSK A;  4AWX B;  4M3F A;  1EH8 A;  1I1G A;  3D5S C;  4GXO A;  5IYC J;  5EYR A;  1MSF C;  4L9N A;  3ANG A;  3VB2 A;  2ESH A;  2Y69 H;  1N25 A;  2STW A;  2Q2E B;  3BCB A;  5FLX Z;  1EF4 A;  4KDP A;  1RKW A;  2F5C A;  3F8C A;  1HKT A;  5C4Y A;  4XKC A;  1ITY A;  4KWA A;  5EZG A;  3FM3 A;  1WHU A;  4I76 A;  2PX9 A;  3EET A;  3V7S A;  1UB9 A;  5E1Z B;  1XCV A;  2LF8 A;  1V5G A;  2UWM A;  1EH7 A;  5IOY A;  3WTY C;  3QKX A;  4Y7N J;  4BQN A;  4M6V A;  4ZTJ A;  2XAQ A;  1YW7 A;  4A3D J;  1YJ9 I;  4MHG A;  3CJR B;  3JRD A;  2RDP A;  4XN3 A;  1ZAO A;  3S3M A;  5FKK A;  2OZ6 A;  2FF4 A;  1XB4 A;  3FMR A;  1Z0X A;  3K2Z A;  1Y0U A;  2M9H A;  3FXO A;  4BE0 A;  3CCS I;  3ECO A;  4IHV A;  2GFN A;  1XMA A;  2KP6 A;  2FBI A;  4L5E A;  4HX4 A;  4LG0 B;  3VVX A;  5BS6 A;  4HF1 A;  2Y0S A;  4HBL A;  2R5Z B;  2GOM A;  2XF7 A;  2E1C A;  1J2X A;  2L0K A;  2E5Z A;  1R5G A;  2XAS A;  4XLP F;  5E20 A;  2R7S A;  2EIK H;  4A6D A;  1SVM A;  5CVU A;  1JJ6 C;  3ZN0 A;  2PEX A;  1S72 I;  5A2Q K;  1PDN C;  3MD2 A;  1S29 A;  1P4A A;  1KQ0 A;  1R4M B;  4DZP A;  3S93 A;  4ENJ A;  3BPV A;  2E1O A;  1CF7 B;  2QM3 A;  3H3U A;  4IF4 A;  1OCZ H;  3IH3 A;  3SWH A;  1NK2 P;  3EUH A;  3SJM A;  4HQM A;  4MTE A;  2QVO A;  1KZH A;  1G3S A;  1MH4 A;  3VOK A;  4G6D A;  2VXZ A;  4A3G J;  2Q2E A;  4IHY A;  2XGE A;  1R00 A;  2NVT J;  4Y52 J;  2EH3 A;  3K70 D;  2DTZ A;  3GFL A;  2L7M P;  3K4B A;  3M8E A;  4WK8 F;  3MMY B;  4U0Y A;  2ID6 A;  2E35 A;  3D0S A;  3RYR A;  4B44 A;  1J0R A;  2QKM B;  2VBZ A;  4D5C A;  2FNP A;  3DKW A;  1N75 A;  1H0M A;  1FYM A;  3HOU J;  1IXS B;  1B4A A;  2EV6 A;  4EM2 A;  1MKM A;  2K4B A;  2R3S A;  1HLV A;  3I53 A;  1W5T A;  5EEA A;  3KNW A;  2XC7 A;  2OAZ A;  1K4T A;  2VOP A;  4XNF A;  3TBI A;  3NXC A;  4M6X A;  5ICE A;  3T1B A;  4LIT A;  3MZH A;  2WY7 Q;  5H2F C;  4U9L A;  1FPQ A;  2MH2 A;  2Q8K A;  1M1E B;  3K1P A;  4P55 A;  4HPQ A;  4CCJ A;  4ZYH A;  1D3Y A;  4B47 A;  1WGX A;  1QO0 D;  5IYB J;  5LGU A;  4L0Z B;  4MIM A;  4G9Y A;  5E3O A;  4OD4 A;  2R5Y B;  4DZJ A;  4M9Z A;  3QRF F;  2FE3 A;  2J5P A;  4S04 A;  3S2H J;  1LFB A;  3DPL C;  2CQX A;  5FFZ A;  1HF0 A;  4IQ4 A;  3AG3 H;  2XKP A;  2ZME A;  3LA2 A;  3GFJ A;  3M9A A;  2ZJQ F;  3PUB A;  3HTI A;  3OIQ A;  2BXZ A;  2DO7 A;  1FMW A;  3IAM 2;  3RKY A;  4QTR A;  2ZOY A;  3HPH A;  3HPG A;  3N05 A;  2GA2 A;  4GFK A;  1D0Z A;  2XV4 S;  1YE9 A;  1LEB A;  3BRO A;  3QYB A;  1XSV A;  2LNB A;  3P5J A;  3PFI A;  5L3F A;  1YTY A;  3A4C A;  1XSX A;  2DFF A;  1BJZ A;  1U5T A;  2R7D A;  2R93 J;  2DK5 A;  5HDG A;  3JRF A;  4X6A J;  1MJ9 A;  4NNJ A;  1L0O C;  5KNL A;  1EV7 A;  3TP3 A;  4OWR B;  1QHG A;  4HST A;  5GAH J;  2JA2 A;  3FXM A;  4OIN F;  5FFX A;  2OI8 A;  3QP5 A;  1J5Y A;  3U9G A;  3KZY A;  1U6G A;  4IVN A;  1IN5 A;  2HEO A;  4BDY A;  1X58 A;  2E1N A;  1HDP A;  2EIN H;  3F21 A;  3LL7 A;  3BZC A;  4CIC A;  1IXC A;  2NXN B;  1ZRF A;  5JHF A;  5J1Y A;  4ZTF A;  1S9H A;  5F6F A;  5F0F A;  4LIU A;  4X0G A;  6PAX A;  2BHZ A;  3QBM A;  4PZJ A;  3S8P A;  2KDZ A;  1FBU A;  1UI6 A;  3U2R A;  3HL2 A;  2FD5 A;  1K4S A;  5HLI A;  1WCM J;  4QLC U;  2GEN A;  4IL6 C;  3WGG A;  2CUE A;  2FBQ A;  2OC6 A;  2X51 A;  2GZW A;  5AQC A;  2JRM A;  4I0A A;  4Q48 A;  2CW7 A;  2LTP A;  1K61 A;  3LNQ A;  3WTU C;  1LVA A;  2GLO A;  2VT3 A;  4PJM A;  4CXF A;  3M4O J;  4Q47 A;  2IT0 A;  2Q0O A;  2BBY A;  2DA3 A;  1WSU A;  1UCR A;  3HTU A;  4PDK A;  2EV0 A;  4AIK A;  2ZME B;  3BPX A;  4EJT A;  3AAF A;  3OL4 A;  2BZT A;  3BG7 A;  2UZK A;  3HOZ J;  2QOP A;  5ERI A;  1XX5 A;  2CU7 A;  1DU0 A;  2CW8 A;  3JRE A;  3QP6 A;  3M1E A;  1B72 B;  4H4K C;  1XSD A;  1XD7 A;  4FAS D;  1GHC A;  2X6O A;  2OU2 A;  4RS8 A;  2YU3 A;  3F8M A;  2V9V A;  2V9P A;  4XKB A;  3V8L A;  4RB3 C;  3L9F A;  4CSW A;  2VL8 A;  4GCK A;  1WPK A;  2OBP A;  4CCK A;  1D0X A;  2BOL A;  3HSF A;  5D6E A;  4M71 A;  3VVY A;  3RTR A;  3LOC A;  3KCC A;  2RC4 A;  1SFO J;  3JSP A;  2KIU A;  4E7H A;  2F5D A;  5D8L B;  4F92 B;  2YX7 A;  4KUM A;  3LA3 A;  4J19 A;  1FLI A;  2PFB A;  2OF7 A;  3M07 A;  1KON A;  5ILV A;  1STZ A;  4OIP F;  3DBL B;  4G7O F;  2CMP A;  1QNT A;  1R1T A;  5EGO A;  2HVS A;  3SFZ A;  2P0W A;  2PJR B;  2R7U A;  1YG2 A;  1RIO H;  1BI1 A;  5EG0 B;  2Z33 A;  4BBS J;  1T2K A;  1MBJ A;  1JKO C;  2EA2 A;  1Y39 A;  4EM1 A;  2UXX A;  4HV5 A;  3H5A A;  3BR5 A;  4MEY F;  5IY5 H;  1AWC A;  2IS4 A;  1YS7 A;  3C2H A;  2R7T A;  3CUO A;  2FBH A;  2LSO A;  4B3A A;  3AL0 C;  5LRR A;  1TT0 A;  5K5O A;  2V6C A;  1BI3 A;  4FT8 A;  5HDN A;  2M87 A;  1VQK I;  1GV5 A;  3GLX A;  5FLM J;  2CGP A;  3F8N A;  3N4M A;  2REK A;  1B59 A;  3E1S A;  3I58 A;  4C3J J;  1G6N A;  2OPT A;  2DMN A;  3W2W A;  3FKI J;  4RBO A;  3M8J A;  3IAS 2;  3CCQ I;  3GF2 A;  1B9N A;  4ZYG A;  1WQ2 A;  3QYE A;  4CDG A;  4HF0 A;  1XS9 A;  3TO9 A;  2ZSI B;  2COM A;  3GTQ J;  5F08 A;  3F23 A;  1LDJ A;  4L5I A;  2H8R A;  2QYO A;  3RKX A;  4BL0 B;  5LHI A;  5KK1 A;  3L2C A;  2WV0 A;  4NEL A;  1U2W A;  2AQF A;  1Z67 A;  2ZXJ A;  4I7H A;  1R23 A;  1FYL A;  2LD5 A;  1UG2 A;  1XGO A;  3S3O A;  4EQQ A;  2LMD A;  4XMY A;  3B6C A;  3BR6 A;  1TQI A;  1VQ4 I;  4A3F J;  3LSG A;  4XKV A;  1T39 A;  3HEF A;  1TWG J;  2QEX I;  2MC3 A;  2AQE A;  2KJC A;  1FNN A;  2L4A A;  2ELJ A;  2OA4 A;  1P6R A;  3S16 J;  3DF8 A;  2W1O A;  5HS9 A;  2R7R A;  2BW3 B;  3ZR8 X;  4M6Y A;  4UVC A;  3T5X A;  3S15 J;  1SGM A;  2WBM A;  2XB5 A;  2A69 F;  2YUS A;  4UB8 C;  3BJA A;  4E70 A;  2GXA A;  1ZR2 A;  2QSG X;  1W7P A;  5IP9 J;  2UXN A;  4HNU A;  3CJN A;  4YII A;  4A2U A;  2OQG A;  2PMZ N;  1T56 A;  2IGN A;  5ILS A;  1NG6 A;  1QHH D;  1RI7 A;  4N4N B;  5IOZ A;  4Z6Y A;  4PJL A;  2VON A;  3OYK A;  4JNN A;  2VE9 A;  2O8X A;  5FJ8 J;  3RZO J;  2NVQ J;  3BR0 A;  2G7S A;  5E1X A;  2CQK A;  4HA8 A;  3RYP A;  4KIB A;  2M8E A;  1OCR H;  2HOT A;  2BY2 A;  1ODD A;  4IOA F;  1LNW A;  5DUK A;  4WXC A;  2DU9 A;  2MYS A;  2EIM H;  1XG1 A;  3HXL A;  3LWJ A;  4LGW A;  2R7W A;  4X1E A;  2KLO A;  2NRA C;  4ABZ A;  3JAM K;  2DOE A;  1Z9C A;  2O6G E;  1FOY A;  1S3J A;  1IRG A;  5AIP A;  2L5Q A;  2HQ5 A;  5TGT A;  3WHC A;  1BR1 A;  3C18 A;  5TJJ A;  1T08 B;  2HKO A;  4GCL A;  1X3W B;  1R6R A;  3WTZ A;  1FOK A;  2K9Q A;  1ZR4 A;  2Q1Z B;  1LB2 A;  4OAZ A;  1MMD A;  1BIB A;  5J47 A;  2DN0 A;  3SZG A;  1JUM A;  2K5C A;  3LST A;  1FWZ A;  2DLL A;  5FKM A;  5HLG A;  4DNC A;  2HGC A;  2DFE A;  4B8X A;  3BJ6 A;  4II2 A;  3H35 A;  3ZMT A;  3OS1 A;  3JTH A;  2XHK A;  4OIQ F;  2H8W A;  1W36 D;  3CP2 A;  3BZ6 A;  3ZOB A;  4IQJ A;  2W7N A;  1MBK A;  1RKT A;  4XN0 A;  3A01 A;  1XTA A;  3FZV A;  5JVG F;  1IUF A;  1QQI A;  2L02 A;  2NS8 A;  2LKS A;  3RQ4 A;  4XBF A;  4O3M A;  2LG4 A;  4E4H A;  3D5R C;  3ROU A;  1J7K A;  1NHA A;  4BXX J;  1Y6I A;  3DXJ F;  1XGS A;  3NRV A;  2KIS A;  4KIS A;  3HDD A;  5HLH A;  1MBH A;  1CQT A;  2ADU A;  2O61 A;  2JSC A;  2R7O A;  1VFC A;  4YIR X;  2G3B A;  1S7O A;  2Y2Z A;  3PFY A;  4XLA A;  2ECC A;  1SVL A;  1MIJ A;  2HPI A;  2M0C A;  2BY3 A;  5ICF A;  3L1P A;  2K40 A;  2M0M A;  3ZQI A;  2QSF X;  5D1R A;  2DYS H;  3R6S A;  3PM1 A;  4G7H F;  2QKO A;  4Q5S F;  5GPC A;  3BQZ A;  4BJ5 C;  4PXI A;  2PMZ A;  2DJI A;  3J80 Z;  3T8R A;  4ETS A;  1ZYR F;  2EIL H;  4S05 A;  2CS3 A;  2MH9 A;  2L9R A;  2QEN A;  3TDZ C;  3FXR A;  2H6C A;  2FX0 A;  3V42 A;  3JW4 A;  2RAE A;  2CW0 F;  3KEO A;  1U8R A;  1F4K A;  1ETV A;  2MD0 A;  1OR7 A;  1I6X A;  1W5S A;  2QKL B;  1IN6 A;  3EUA A;  1BA5 A;  1JGS A;  1WVR A;  3GTP J;  4EM0 B;  2DXI A;  1WJ5 A;  1Z6R A;  2MLG A;  1MBF A;  1F43 A;  3V78 A;  4RGU A;  2DFH A;  2P81 A;  4XM3 A;  4U88 A;  4G94 A;  5L3D A;  3MZY A;  5CQG A;  1VQN I;  4FCY A;  5C44 J;  1RZ4 A;  2D1V A;  2OQR A;  2K02 A;  1ONV A;  1Z7U A;  4ON0 A;  2VT2 A;  1RC9 A;  1U0J A;  3OOP A;  2XVC A;  2Z1D A;  3MKY B;  2KHM A;  2P6S A;  4GCV A;  3ZQH A;  1Y8Q B;  4XKW A;  2Z3Y A;  3F0C A;  5BQT A;  4CGZ A;  3PO3 J;  1JI8 A;  4U0V A;  2V26 A;  1A6Q A;  2L01 A;  2QSH X;  1FIA A;  1DPU A;  1D1B A;  4YIF A;  5FD6 A;  2ZCW A;  4C2T A;  4XLH A;  5HS8 A;  4CO8 A;  3IRR A;  5K1Y A;  1R58 A;  1QU3 A;  4A93 J;  4NB5 A;  2MAB A;  2XPU A;  3Q0U A;  3S1N J;  1XDU A;  5D5V B;  1WJE A;  4NQW A;  2XF6 A;  3BQY A;  1BM9 A;  1ULY A;  3KZZ A;  3T6N A;  1EA3 A;  3DLL F;  3F22 A;  4NHJ A;  5AIQ A;  3NI7 A;  1IN7 A;  2LC2 A;  1Y1V J;  1YIO A;  5CPR B;  3BR3 A;  4MQ9 F;  2Z5U A;  1VI0 A;  1HC8 A;  1EJ9 A;  3MVP A;  4IJA A;  3CUQ A;  1A5J A;  1UZC A;  2NAZ A;  1F36 A;  3E6B A;  3H92 A;  1J9I A;  5F0H A;  3G4S I;  1IAW A;  3BRU A;  2DA7 A;  5J4V A;  1POG A;  1GXQ A;  1MJB A;  3LQQ A;  3RZD J;  3G1O A;  1PP7 U;  3L2U A;  1WFX A;  4W1U A;  1OR7 C;  3L2R A;  2NS0 A;  5GTI C;  3L00 A;  4UVB A;  3KKC A;  2XRL A;  1E3P A;  2W24 A;  2EFO A;  5E8I A;  3AG1 H;  2H27 A;  3HJE A;  4ESB A;  3C2B A;  1KU3 A;  1BW6 A;  2DT7 B;  5J6X A;  3OR1 C;  5L3G A;  2B9S A;  1W4M A;  2LLK A;  2BVM A;  1A31 A;  2DOF A;  5FRN A;  3VIB A;  4BXU A;  2QBY B;  1YHQ I;  3ANP A;  1FZP B;  1X1P A;  1OFC X;  1T0F C;  1LPQ A;  5LD2 C;  2IAI A;  3K4L A;  1SFX A;  4BHP A;  1Z05 A;  3S2D J;  3H0G J;  5B3S H;  3PPB A;  3HTJ A;  2IA1 A;  2ECB A;  4EJV A;  4IO9 F;  1JT0 A;  3MFK A;  1IUY A;  2ZOZ A;  2KZV A;  4EGY A;  3EDP A;  4A3K J;  3CTA A;  1ZG3 A;  4XL9 A;  5FRM A;  3HG9 A;  3FWE A;  2MA3 A;  4M9X A;  2HQR A;  4L9T A;  2V9K A;  1YOV B;  2WC2 A;  3HIF A;  2KRC A;  4QSH A;  1K79 A;  1TLH B;  3QOE A;  5L3C A;  3M8F A;  2QQ8 A;  5GP9 A;  1U9N A;  3HBL A;  5HNF A;  3K10 A;  5EF6 A;  1BI0 A;  1HBX G;  4HNV A;  4BBR J;  3KZ9 A;  3BR2 A;  3SEZ A;  3OL3 A;  5KAF C;  4LK0 F;  3ELK A;  2VQL A;  1SAN A;  3FK7 A;  1YJW I;  1UFM A;  3M7G A;  4GYI A;  1X1A A;  2F5F A;  1IN8 A;  2EV5 A;  1JJ8 C;  2K9N A;  5D5U B;  5IYD J;  1HST A;  1U5T C;  5FD5 A;  1V3F A;  3CWR A;  2XGD A;  1P92 A;  1HW2 A;  3BT9 A;  1UJ8 A;  3GBG A;  1RUO A;  3GZ6 A;  4IZZ A;  2C6Y A;  2UUZ A;  3H9J A;  4RMN A;  1OCC H;  5JI6 A;  3SFI A;  3OYC A;  3VYR B;  1TTY A;  1J59 A;  1X2M A;  4KT5 C;  3S5R A;  1B8I B;  5DDG A;  2IA0 A;  4HNT A;  3NEU A;  3WG7 H;  2P6T A;  4XLE A;  2VQG A;  4G6T B;  4XR6 A;  3ZP5 A;  1EKE A;  1HXD A;  2ZB9 A;  4N4O B;  4FE4 A;  4XON A;  1D8K A;  2L54 A;  3KLN A;  4V2G A;  4CCL A;  2CUJ A;  4A69 C;  3FXU A;  2FJI 1;  3F9K A;  5EG0 A;  4V2F A;  3NAR A;  1ZTR A;  3EYY A;  3G2B A;  2HU9 A;  4PFO A;  5BMZ A;  3PQK A;  3ZMV A;  4Y4R A;  1Y8R B;  4WCG A;  3IH4 A;  5DYM A;  3MNL A;  3DFG A;  2VAS A;  1QA6 A;  1BBY A;  3VUQ A;  4MXM A;  3LWF A;  2JJ7 A;  4CCO A;  3S3N A;  1G3Y A;  4R79 A;  4A3M J;  4XOT A;  3IWF A;  3VOX A;  3ASO H;  2RNJ A;  2VN2 A;  2W25 A;  2V1X A;  3OOU A;  3SDB A;  3CCR I;  2R4G A;  4BJ6 C;  1O3S A;  1JHH A;  3WTW C;  2K85 A;  4L18 B;  4NC8 A;  4BDZ A;  2ZXI A;  3CLO A;  1BI2 A;  3WU0 A;  4KIF A;  3V7R A;  2NOJ B;  4PUS A;  4F93 B;  2WAE A;  3BHQ A;  2HS5 A;  1CGP A;  2DT5 A;  1I27 A;  2KMU A;  3Q0W A;  3O2P E;  3AFH A;  4NC6 A;  3CJD A;  3S32 A;  2VBX A;  2QWT A;  1U5T B;  3BZK A;  4E6K G;  2NX4 A;  1REP C;  1T98 A;  5JLW A;  3DTK A;  2HOA A;  4HOB A;  5JLX A;  2P4W A;  1TW3 A;  3R4K A;  4RA2 A;  4A0Y A;  1U8B A;  5DM7 F;  1AU7 A;  3OIO A;  1YQA A;  1Q1V A;  2DYR H;  3IUV A;  2GA1 A;  3LMM A;  1YX3 A;  2KRF A;  2RV8 A;  1OIS A;  3WU2 C;  1G3W A;  1YW9 A;  1DP7 P;  3N97 A;  2ME0 A;  3KET A;  2HWV A;  3WGI A;  1JHF A;  3DPJ A;  1OCO H;  2F6C A;  1AHD P;  3FBN B;  1X3Z B;  3CCU I;  4RDU A;  3HTA A;  3TP0 A;  3VSL A;  2IS2 A;  4ENN A;  2CYY A;  1FOX A;  3RKQ A;  3WOD F;  4QWQ A;  4KN4 X;  2DOD A;  1MDM B;  1XN7 A;  2QTQ A;  2GIV A;  2I8D A;  2F5V A;  1JGG A;  2DA5 A;  1UHS A;  4PSW A;  1SFU A;  2F4O B;  2JVG A;  3KEQ A;  1P9Q C;  3LHQ A;  4YEL A;  3HUG B;  1JTX A;  2BXY A;  2XDN A;  1T38 A;  4IPA A;  1YLF A;  4ICH A;  1H9T A;  3H9G A;  3HYI A;  3L09 A;  3MN2 A;  3DBH B;  3BTC A;  3W6J B;  1VQP I;  3WTV C;  3GFM A;  1FSH A;  3L7W A;  1S5L C;  4CZZ A;  2PN6 A;  2ZY9 A;  4A6E A;  4I6Z A;  1BR4 A;  2WAQ N;  4MO7 A;  1UHM A;  3NAU A;  2DG7 A;  1FJL A;  5LFA A;  1ZHF A;  2V79 A;  2RVC A;  3QAH A;  4D9J A;  4P1W A;  4OU0 A;  2E1M C;  3KPH A;  3LSJ A;  2CQ7 A;  1A36 A;  2PJP A;  5C3E J;  3LJL A;  4GYG A;  4E7I A;  1Q1H A;  2ZXH A;  2XRO A;  2YR2 A;  4IX7 A;  2F07 A;  3DP7 A;  1HSJ A;  3TQN A;  1BL0 A;  2GXB A;  2D45 A;  3JRA A;  1R1U A;  1ZQ3 P;  2ZCX A;  1UG0 A;  3CP8 A;  3LSM A;  1IGN A;  5C4X J;  5EGO B;  2KQR A;  1ETQ A;  3KIO A;  3PNT A;  3WTT C;  4ENM A;  1FY7 A;  2H94 A;  1O7L A;  3C1D A;  4DQ2 A;  3E5Q A;  3BG5 A;  3A0H C;  5HVQ C;  2WUI A;  4DOZ A;  1GT0 C;  4V19 K;  4C3I J;  3FM5 A;  1ZGJ A;  4JBA A;  1R9T J;  1FTZ A;  2L9V A;  3DCF A;  1VQO I;  2X1D A;  3F8F A;  4F91 B;  2DI3 A;  3LSH A;  4LJZ F;  1P7I A;  5FB2 A;  1V54 H;  5CJ9 A;  4Q4Z F;  5D8K B;  2XAG A;  1U9O A;  2EQR A;  1I3A A;  2PI0 A;  3CMA I;  3PJR A;  4HRI A;  1A35 A;  3CES A;  2CFX A;  1KQ9 A;  9ANT A;  2HKX A;  3PNY A;  4LG0 A;  4GFL A;  1N77 A;  1V5F A;  3CO7 C;  1AA7 A;  3K1N A;  5DS9 A;  3R0A A;  3PQJ A;  1IC8 A;  1SAX A;  3GME A;  5HBU A;  1MMA A;  3CO6 C;  2NP5 A;  1KYZ A;  3K4K A;  2CV1 A;  3DPU A;  2NVU B;  4FET A;  2XIG A;  4M73 A;  5FKL A;  2KDO A;  2JVH A;  2IBD A;  1XMK A;  2XSJ C;  3P9I A;  1AOY A;  1ZRE A;  2HFH A;  2JK3 A;  2JTV A;  5J8F A;  4Y3O A;  4ZYE A;  3LSP A;  2D1H A;  3BDD A;  1APL C;  4DVY P;  2VKE A;  4AVZ A;  3MAJ A;  3I54 A;  4I0B A;  1H9G A;  2DPD A;  3VW2 A;  2HI3 A;  3FXQ A;  4ZDL A;  2JA7 J;  1TWF J;  2FSW A;  2XB0 X;  3C2G A;  2HVQ A;  5B5E C;  3BR1 A;  5DD8 A;  2W84 A;  3QPT A;  4UVA A;  1ON2 A;  3HGG A;  4IRH A;  1IRF A;  3OV8 A;  2DMQ A;  3WGH A;  3JSO A;  3U1D A;  1W7P B;  3GYH X;  2HKU A;  4G12 A;  4A3C J;  4HEA 2;  5FLV A;  4PJN A;  1DGR M;  4B43 A;  4D5F A;  3V8K A;  2Y31 A;  4XLN F;  3UKG A;  4MFD A;  2VC1 A;  5DAJ A;  1FIP A;  4L5J A;  1WJD A;  5KVR A;  3Q3S A;  3I59 B;  2VKD A;  3ZMS A;  4CCM A;  1UHW A;  1I39 A;  2OZU A;  4S0H B;  4XID A;  1BC7 C;  4DBR A;  3MQ0 A;  2VE8 A;  1W0U A;  1ZGW A;  3GW2 A;  2LBF A;  3PUF A;  5EDN A;  4JYK A;  3KP6 A;  2O9L A;  4K2E A;  2EA4 A;  2FA5 A;  1XMX A;  2O5R A;  2TDX A;  3PSF A;  2R5Y A;  2I5U A;  1YIT I;  4M9S A;  2JMW A;  1N78 A;  4II3 A;  2Z16 A;  1OCP A;  4DGW B;  4FIS A;  2M3A A;  2QUF A;  2E2J J;  3AL0 B;  3ONQ A;  2IS6 A;  3CMM A;  3GCM A;  3DTI A;  3E6M A;  2VB6 A;  4QPO A;  1D0Y A;  5EZH A;  1GUU A;  4CUG A;  2Y9Y A;  5E17 F;  4XLC A;  1ZH5 A;  3GEZ A;  4BGD A;  3HTH A;  3H5R A;  3ABK H;  1ON1 A;  5GTH C;  5CVV A;  2IGO A;  4KIC A;  4PFP A;  1Z7L A;  3HOV J;  1D5Y A;  2PJR A;  4N9I A;  2Y48 A;  1NTC A;  4MNU A;  2ISZ A;  4I98 B;  4OIO F;  5LGN A;  2DMU A;  2L9N A;  2FRH A;  2B3W A;  3HOS A;  3I0T A;  3O6B B;  5JHU A;  2H09 A;  4BU2 A;  3F1B A;  1MGT A;  4U7D A;  1ETW A;  4LG3 A;  2BYV E;  2BY0 A;  2G0E A;  1ZLK A;  3PSI A;  2QF7 A;  2F5E A;  3CF5 F;  3COL A;  1LEA A;  3RPQ A;  4RAY A;  1IZ1 A;  4JK1 X;  3I4P A;  4EJO A;  4EV0 A;  3GTJ J;  1RUN A;  1UMQ A;  2O03 A;  1TNT A;  3WG9 A;  2K7L A;  2JQ7 A;  3E5X A;  3EGQ A;  2VKV A;  2CV0 A;  2HTJ A;  4OMY A;  4ZDP A;  3Q0V A;  4EGZ A;  3JRG A;  1VND A;  2R5Z A;  4KFC A;  3BTL A;  4UB6 C;  2VJJ A;  5F1R A;  3S1M J;  3A03 A;  1DU6 A;  3RPU D;  5D18 A;  4WIB A;  3RI4 A;  5EEG A;  2LRD A;  1S8N A;  2HDW A;  1OYW A;  4A3I J;  5M5X J;  1MSE C;  3FMS A;  1G8X A;  3J7Y J;  1BOA A;  1PJR A;  3OYA A;  3G6E I;  1USS A;  2ZJP F;  2Y9Z A;  3H9Q A;  2DMT A;  1LFP A;  4R8H A;  2L2O A;  2BY1 A;  2KKO A;  3MCZ A;  2ZXW H;  4M72 A;  4LFU A;  4L9V A;  3NNR A;  2JA8 J;  2VC0 A;  2XAH A;  2EWN A;  4B48 A;  5KHD A;  3HRT A;  3JRB A;  3ZN1 A;  1MMN A;  3J80 K;  4EVI A;  2KRH A;  1MW7 A;  4OOI A;  3HB9 A;  2PFV A;  3LFU A;  4M3B A;  4UUT A;  3IV5 A;  5J8C A;  3OS2 A;  5ED4 A;  3GZ5 A;  3DPT A;  4KMF A;  5F0C A;  4ZYA A;  3VW1 A;  1FP2 A;  2CUF A;  1OPC A;  1Z91 A;  3DEU A;  2B7E A;  3ESW B;  3PNV A;  2E2I J;  2VPL A;  4BYY A;  1SD4 A;  2K9S A;  2HZD A;  2BHY A;  2MFZ A;  5K7Z A;  3Q9V A;  5ICC A;  3VP5 A;  2W82 A;  3FMQ A;  4N0B A;  5J1U A;  3LSR A;  4XRM A;  2Y75 A;  4BQQ A;  3VYS B;  2NNY A;  2RHA A;  3VVZ A;  4IRI A;  4B3X A;  2RAS A;  4LLG F;  3HKZ A;  3P9C A;  4C3H J;  2JA6 J;  1W1W E;  1SMT A;  2L9S A;  2W4S A;  4RGR A;  5D6F A;  5DCM A;  3C7J A;  1PVE A;  5IT3 A;  4WWC A;  3FXL A;  4IRV A;  2LVS A;  4LK1 F;  2X85 A;  1KA8 A;  3OYN A;  4ZC3 A;  4PJ0 C;  4PSX A;  1MNE A;  3CDH A;  1JTY A;  5ILU A;  3OYB A;  4A3L J;  1F9N A;  5D19 A;  4ZYD A;  3HOW J;  3KYL A;  2ICW G;  4KN7 X;  2UXU A;  5E8G A;  4BEH B;  1K78 B;  1K6Y A;  4BQO A;  1KGS A;  2X6X A;  1WH7 A;  2NYX A;  2YU9 J;  3FDY A;  5B1A H;  5IT9 Z;  3ISP A;  3KE2 A;  5A2Q Z;  1Z3Y A;  2QLZ A;  1FC3 A;  2A5Y B;  3P9K A;  2G7H A;  3K4J A;  1FBQ A;  3FIW A;  2KIM A;  4EEF G;  3I71 A;  4AC0 A;  5IPA A;  3EPZ A;  4IRG A;  2FU4 A;  2MSY A;  2XKO A;  1FBS A;  3CLQ A;  3PAS A;  1Z21 A;  3RQI A;  2Q24 A;  1WI9 A;  5CVJ A;  4QPQ A;  4NUB A;  5LEJ A;  1TQM A;  1KQ8 A;  2Z2S B;  3CC2 I;  5DEQ A;  3HOT A;  3BJO A;  1BN5 A;  1MND A;  1LVK A;  2Z99 A;  2P5L C;  1W36 C;  3B73 A;  1V4R A;  4E7Z A;  2HR3 A;  1PUE E;  1QPM A;  3KX2 A;  1ZK8 A;  4C2M J;  1LE8 A;  3QU6 A;  5LEK A;  3K2A A;  4HZF A;  2WTE A;  4LD5 A;  3OIP A;  2ELK A;  4NC7 A;  3KP4 A;  1P4X A;  2ESN A;  3CCM I;  3MKZ A;  2GM4 A;  2HOE A;  2QGU A;  4E7S A;  4BH9 A;  2CFO A;  4F3Q A;  1D5V A;  3CD6 I;  3E5U A;  2IW5 A;  4HW0 A;  3O8G A;  2EZI A;  4H0E A;  4LOC A;  4ASN A;  2R7Q A;  3HHG A;  4BEH A;  3J7Z I;  1K78 A;  3EYI A;  2WA0 A;  2ZFW A;  4FX0 A;  3BG6 A;  2K9L A;  3HZJ A;  1I3Q J;  1D1A A;  3SQN A;  4AIJ A;  1QZZ A;  3G56 A;  2A3S A;  4OAY A;  4HG2 A;  3GTO J;  1K83 J;  1OYI A;  5JVT A;  1B9M A;  2EPF A;  3SEQ A;  1S7E A;  2M8G X;  2LBF B;  1FP1 D;  4RLQ A;  1KYW A;  2EB7 A;  4U87 A;  2HQA A;  5GAG J;  3ASN H;  2ZNZ A;  3BTJ A;  1IV6 A;  1JE8 A;  1Z1D A;  1IRZ A;  1CF7 A;  4IEJ A;  2DA4 A;  1MBG A;  2A68 F;  3OYD A;  3RCO A;  2M7A A;  4Y33 A;  1WH5 A;  4HF2 A;  2X1E A;  2ZO4 A;  3NWS A;  1MD0 A;  2ELH A;  3PIO F;  2ID3 A;  1TP4 A;  2JPC A;  3OWT A;  3NS4 A;  3E7L A;  3G1M A;  5J4Y A;  1ZRD A;  1YI2 I;  3ZPL A;  5E1W A;  3IC7 A;  4OD5 A;  4DJA A;  1ORK A;  3WU1 B;  3QPS A;  1SC7 A;  1BOB A;  1ZG1 A;  4P96 A;  1YS6 A;  3CZ6 A;  3AG2 H;  4M3E A;  2LKX A;  4IOC F;  2HYF A;  3CCY A;  3DU6 A;  5DV5 A;  4BAY A;  3SZP A;  3ZMZ A;  1QVU A;  4ENK A;  1G3T A;  1XGN A;  1TWC J;  2KIQ A;  1TNS A;  3G73 A;  1ZEL A;  1IW7 F;  1TZL A;  1MH3 A;  2P7V B;  3QOD A;  4LLL A;  2KFD A;  3V8J A;  3I55 I;  4A3J J;  3COA C;  4GFB A;  4Z2Y A;  5D5W B;  1DPR A;  2E71 A;  2M1B A;  1E3H A;  4BNC A;  1Z6T A;  4BY7 J;  3V4G A;  3CJQ B;  3K6G A;  1I5Z A;  3HOY J;  1JKR C;  3HRU A;  4A5M A;  3FHN A;  1Z3X A;  1U3E M;  2LYC A;  4NQW B;  1R4N B;  4BAC A;  1T95 A;  3QU3 A;  4JQF A;  3VOE A;  4AUX A;  3R61 A;  3GFI A;  1F1Z A;  4UV9 A;  4G7Z F;  3K8P C;  3K1M A;  4MFE A;  1BJA A;  4UXN A;  4MEX F;  1IO2 A;  3FRQ A;  3GZI A;  3ABT A;  3HTS B;  3E3V A;  5EJC A;  3OYE A;  1SAU A;  2X6Y A;  1Z77 A;  4GCT A;  2LR8 A;  3CDI A;  3HIM A;  3S2W A;  4PGG A;  4C2M A;  3BCG A;  2LY2 A;  3BLY A;  3A01 B;  2XGX A;  3HSE A;  3E6C C;  3X2Q H;  2PBI A;  1UI5 A;  5CXI A;  1LKX A;  3H1C A;  1ZLJ A;  2ZSH B;  4ZH4 F;  1GDT A;  1SMY F;  3I56 I;  4UNO A;  2KZG A;  1SVO A;  2IEK A;  2F4M B;  2ZJ2 A;  5J3L A;  4AID A;  1LQ1 A;  3BJB A;  3ZQ7 A;  2OER A;  2HOS A;  3I5U A;  3QYF A;  3B81 A;  2L4M A;  3IHU A;  1QZE A;  3K9T A;  1ZG5 A;  3FHZ A;  2ZNY A;  1LDD A;  4J00 A;  2NP3 A;  1R5H A;  4YZE A;  1B1B A;  3IUO A;  3JRI A;  2FQ3 A;  2ZCN A;  2NVY J;  2DT6 A;  5JR3 A;  4C2U A;  4LIV A;  2NOG A;  3P9T A;  1LDK B;  4P9U A;  3BOQ A;  4MGR A;  3ZQF A;  3KYD B;  5CW8 A;  1R22 A;  1BR2 A;  3PIP F;  1ETX A;  2NS7 A;  2XAJ A;  1SD6 A;  2O7T A;  4I2O A;  4Y15 A;  2CQQ A;  4RGS A;  3I64 A;  3VDX A;  5H20 A;  3E7Q A;  2KPM A;  1U78 A;  5GAE J;  3CCE I;  2O8K A;  2IGK A;  2EFW A;  3BTI A;  4D1Q A;  2XAU A;  1TWA J;  3R0J A;  1H88 C;  3GVA A;  1ZRC A;  3GXO A;  4PJJ A;  2UV1 A;  2VI6 A;  4JX5 A;  1R71 A;  3KP3 A;  1IV8 A;  1P4W A;  3QPL A;  3LFK A;  3SXY A;  3O60 A;  2F4I A;  2JZY A;  4RGX A;  1UEL B;  3RKW A;  4M3G A;  3SZT A;  2HYJ A;  4YRV A;  3MWM A;  2RKH A;  5D4S A;  3W2A A;  2DG8 A;  3ZGK A;  4OIR F;  1HOM A;  3TOA A;  3V7C A;  2HDC A;  1YIJ I;  2A5W A;  3CQZ J;  2YS9 A;  1FEX A;  4HYE A;  1FX7 A;  2V6E A;  2JWT A;  1A04 A;  3HOX J;  3BC8 A;  3VEP A;  3J81 Z;  3AG4 H;  3KYC B;  1D1C A;  3OYM A;  3IL2 A;  2V1U A;  3ZCO A;  2E2H J;  1B72 A;  2PZ9 A;  3NRG A;  2DJN A;  1HW1 A;  2ME6 A;  3OSF A;  3FIS A;  2XRN A;  2VIX A;  1ETY A;  2O3F A;  1TW2 A;  1W0T A;  1JUP A;  1FOW A;  1FTT A;  1WRJ A;  2YVX A;  4UDS A;  4I09 A;  4CGR A;  4IHX A;  2L7F P;  2Z9O A;  3CUQ C;  4FQG A;  1OCT C;  4CHU A;  3CUQ B;  4TV7 A;  4XOP A;  1W5C C;  3F72 A;  2VJ4 A;  3VYU B;  2RNG A;  5K7H A;  5B1B H;  3VFZ A;  4UUS A;  3IKT A;  1C0W A;  1YYV A;  1SD5 A;  1MZB A;  4RB2 C;  3VW0 A;  5DTD A;  5FO5 A;  4AVP A;  1GV2 A;  5DCF A;  3ZXS A;  3HC7 A;  2A6E F;  4XRS A;  2NVX J;  1FSE A;  3KFW X;  4NBQ A;  4HLY A;  2XAF A;  4UUV A;  4ME9 A;  4HQE A;  4RLF A;  3K7A J;  4UV8 A;  4BE2 A;  3VYT B;  1R7J A;  2RN7 A;  2GIZ A;  2WV1 A;  2STT A;  5HOD A;  1T33 A;  3EQL F;  2EIJ H;  2IRF G;  1VF9 A;  3HRM A;  3HE0 A;  2V1D A;  3GWZ A;  5M5Y J;  3RH2 A;  3BWG A;  3DKY A;  5FMP A;  3OYJ A;  2ZME C;  2X4H A;  4PGH A;  1X1B A;  5FKN A;  3J7A O;  1HA8 A;  1UAA A;  4M74 A;  3G7R A;  2HQN A;  4XSZ F;  3DLA A;  3PL8 A;  2BV6 A;  3CCV I;  3FKJ A;  2QIB A;  3SYT A;  4UY8 I;  2VUM J;  2M7B A;  3J7A Y;  1QPI A;  1SD7 A;  1QVT A;  2DTR A;  3RSN A;  3GTL J;  3GTM J;  3JAM Z;  3ZRG A;  2GWR A;  1R49 A;  2LKP A;  3FXK A;  1X3U A;  2H1K A;  4IHW A;  1YX5 A;  4JOM A;  4N9H A;  3ZMU A;  4A3E J;  3BG3 A;  4P5O A;  2EJR A;  4AD9 A;  2Y0M A;  4BS9 A;  1HKS A;  4PK4 A;  1FYK A;  2B1E A;  4CZC A;  2D2W A;  4OMZ A;  5M3M J;  3IWZ A;  4GGG A;  5CKT A;  3D5L A;  5C4J J;  1Y1W J;  4BY1 J;  1P7J A;  3TO6 A;  3B02 A;  3V6G A;  3M1C A;  1E17 A;  5GPA A;  4IKF A;  3NWT A;  4ANJ A;  2GBY A;  2AXT C;  1OQY A;  2LFB A;  5DCM B;  2P5K A;  1VZ0 A;  3OMY A;  2GXG A;  3FF5 A;  4UUS B;  2EZH A;  1R5I D;  4BUP A;  3WTS C;  2QQB A;  4HX8 A;  3KZI C;  1HDD C;  3ERM A;  3I4M J;  2PLY A;  5BPD A;  1IF1 A;  2HYT A;  2DQR A;  2BVL A;  3DEE A;  1B8I A;  2K3P A;  4FE7 A;  2M30 A;  3TDU C;  3TMO A;  4F55 A;  2D6Y A;  1ETK A;  5BOX A;  4PCQ A;  2LY9 A;  1O3R A;  1ERD A;  2PQ8 A;  3KP7 A;  2XGC A;  2CSO A;  2WAD A;  3K4N A;  2FOK A;  2V4J C;  4HAM A;  5E3N A;  5K5R A;  2E7W A;  3HKZ N;  4RAG A;  1VTN C;  2EZK A;  1RRJ A;  2PMH A;  4QIW N;  1O3T A;  2IA2 A;  3H5N A;  1J75 A;  1IRX A;  5J40 A;  4HDV A;  3L2V A;  3HHH A;  5L3E A;  2E5N A;  4JKZ A;  4FX4 A;  3S17 J;  3E0J B;  5CXG A;  2GUH A;  3OYG A;  2KT0 A;  4A3B J;  4KJZ A;  3DKX A;  3UR3 C;  2OD5 A;  2VOD A;  2RQQ A;  1WWX A;  3S1Q J;  5D4R A;  1WJB A;  2UXI A;  3CF2 A;  1XPX A;  4LMY A;  2P5V A;  1YFH A;  1D8J A;  3DU5 A;  3JCU C;  3WTX C;  2E34 A;  4JL3 A;  4EAT A;  2DA2 A;  1MMG A;  2G9W A;  1ACI A;  1QZY A;  3P7N A;  1JT6 A;  3H3V K;  2LK2 A;  2Y0S N;  5DD4 A;  4KYW A;  2CWE A;  1X19 A;  2VKH A;  5B66 C;  2X48 A;  5J1R A;  3AQT A;  4XIC A;  2HPM A;  2JRT A;  5KAI C;  3LAJ A;  2CV2 A;  1IDY A;  1OJL A;  2ETH A;  3HGY A;  1R1V A;  2HVR A;  4O6J A;  1P2F A;  3VOD A;  3CCJ I;  2FML A;  3ERE D;  4ZDO A;  3SHF A;  4AC6 A;  3FX3 A;  2KL4 A;  4I01 A;  1F5T A;  2XDV A;  4ACI A;  5E79 C;  1NG7 A;  3GEU A;  1XCB A;  2FXA A;  4A0X A;  1XGM A;  4MQV A;  2M4K A;  1JXS A;  1XC5 A;  2DQL A;  3ABU A;  3RIR A;  3ZQL A;  3DQV C;  2WB1 N;  3T0Y A;  3ABM H;  4Y17 A;  3MKW B;  4E7J A;  2W85 A;  4XRS G;  1EH6 A;  5DUI A;  3TW6 A;  3L2Q A;  1QBJ A;  4GDF A;  2HXO A;  2ZFU A;  3R60 A;  1JKQ C;  4WXH A;  3I9V 2;  1PYV A;  2LDU A;  3BCA A;  4YG2 F;  1VQ7 I;  3LQR A;  1VQ9 I;  4RB1 A;  1HW5 A;  2ZC2 A;  2CG4 A;  2XPV A;  5IT9 K;  1X4P A;  2CH0 A;  1LJ9 A;  4EMS A;  3W6K B;  5H6Q A;  1MBE A;  2H1L A;  1E0E A;  2L7K A;  2A2F X;  2N8G A;  4YFK F;  3NQO A;  3Q5F A;  1YRN B;  3Q9S A;  1TQP A;  2V57 A;  5E18 F;  2L3D A;  3S1R J;  3LSI A;  2FQ4 A;  5GAD J;  3K70 C;  2JA5 J;  5E3L A;  3WE2 A;  4J01 A;  2DCE A;  5CYV A;  3QOP A;  2CQN A;  3H0D A;  2R7Z J;  5CLS A;  2XSD C;  1W7P D;  2LP0 A;  2F2E A;  3OY9 A;  3T8T A;  1GVD A;  2MLK A;  5ICG A;  3HUG A;  3RD3 A;  2DW4 A;  2QBY A;  2IXS A;  3TL4 X;  5FRO A;  2YPR A;  2NNN A;  2GAU A;  3U1K A;  4AYB N;  2FUG 2;  2IP2 A;  3ML6 A;  4A5N A;  1DDN A;  1I6H J;  2L7Z A;  3CDL A;  2M2E A;  4DYQ A;  2QQ9 A;  2G7L A;  1GLN A;  1J09 A;  5IP6 A;  2R92 J;  2M5W A;  2WGB A;  1O7F A;  2IVM A;  4KMU X;  4ESJ A;  2M45 A;  3JRH A;  1ZKG A;  2VBW A;  2V7F A;  2OCC H;  4B4C A;  2ZJR F;  1DGW Y;  4BJT A;  1YRN A;  3G71 I;  4KIG A;  3TED A;  3GO5 A;  2BE5 F;  3AQS A;  3GTG J;  2D5V A;  4RM2 A;  4W97 A;  4D7N A;  4AM3 A;  3K4C A;  1G2H A;  1I1S A;  3TOB A;  4BHB A;  4LLN A;  3DEW A;  2VJI A;  3KKD A;  3OYH A;  3F3X A;  1VQ5 I;  3SDG A;  2F48 A;  2BGC A;  3DTE A;  4E7L A;  1V55 H;  3IP4 B;  2K27 A;  3I4N J;  2R7X A;  2OUM A;  2YSR A;  2E36 A;  3CC7 I;  2BEO A;  2QQA A;  5HDK A;  1RR8 C;  3QWL A;  2UXO A;  2ACJ A;  2H6B A;  2OJE D;  3FBI B;  4F52 A;  5HLT A;  4FTH A;  2W48 A;  1NH3 A;  3W3C A;  2P8T A;  3M3Y J;  3PO2 J;  1OLT A;  1ETO A;  2CJJ A;  3GLL A;  5EEH A;  2CO5 A;  5L3B A;  2J5O A;  2WAQ A;  1S7A A;  4G8X A;  2LY1 A;  4M3D A;  2FMY A;  4YFN F;  2PMU A;  4A12 A;  2K3F A;  4WF2 A;  3VWB A;  2WAF A;  2RQP A;  4RAZ A;  2PG4 A;  2VQH A;  5LHH A;  3VSK A;  2X1C A;  2Y30 A;  3ZQC A;  4Y13 A;  4L62 A;  3REO A;  4C9Y A;  3KLO A;  3OYI A;  2B63 J;  1I50 J;  1QGP A;  4P9F A;  2AO9 A;  1OKR A;  3OYL A;  3C07 A;  5LGT A;  1K7A A;  3CCL I;  4U7B A;  2JT1 A;  1O57 A;  1ENH A;  3F6O A;  4MK6 A;  3TKY A;  2HDD A;  3OYF A;  3H3Z A;  4FHT A;  2AXL A;  2FEZ A;  1WJF A;  3IKV A;  1E2X A;  3LAP A;  1LE8 B;  1ZN2 A;  3VPR A;  1XDS A;  5TIS C;  2ZBK A;  3HM5 A;  4L9J A;  4R1H A;  2KIF A;  4KIT B;  2VLA A;  4KNY A;  3DWL E;  3U21 A;  2IU5 A;  4UHT A;  4BHC A;  4KT6 A;  1G4D A;  2MC4 A;  4XK4 A;  5FGL A;  1SFK A;  2K86 A;  4BKX A;  3IH2 A;  2QCO A;  1BIA A;  4NN1 A;  3ABL H;  4MLO A;  3DV8 A;  5E3M A;  4XSX F;  2QA4 I;  1VQ8 I;  4AYB A;  2K4J A;  2VOO A;  3CJT B;  4MTD A;  4D7M A;  4B09 A;  4EJU A;  2E7X A;  3E97 A;  3RJP A;  4HV6 A;  2ZKZ A;  2EFN A;  4GO1 A;  2IPQ X;  2A07 F;  4U9N A;  2FNA A;  2KJB A;  3BP8 A;  3WHB A;  2G7U A;  3ON4 A;  1RES A;  2AHQ A;  2DA1 A;  5LBQ A;  2GOX B;  1SEU A;  1OMI A;  2JN6 A;  4RAF A;  5FLX K;  3GZN B;  3KEY A;  5HOO A;  5FHP A;  3K4M A;  4ITV A;  2IS1 A;  3H36 A;  5M5W J;  2COB A;  3O8H A;  5CVI A;  5JFR A;  5K58 A;  1X1C A;  3ZQQ A;  4YFX F;  2TRT A;  2JUC A;  5BPI A;  1RPW A;  1HQC A;  3GUD A;  2HNH A;  1GVJ A;  2E60 A;  2RRE A;  4A0Z A;  4KA4 A;  5FKO A;  1L3L A;  2IGM A;  3I59 A;  3VTI A;  2DPU A;  5F04 A;  3RPU A;  1IN4 A;  3ECH A;  3ZMD A;  4JX4 A;  5DM6 F;  5HSZ A;  4GRI A;  3BNI A;  2JSP A;  5FGM A;  2A6T A;  2LH9 A;  1MJA A;  2R0Q C;  1IDZ A;  4F7Z A;  5BNG A;  2X6W A;  3HRS A;  1H89 C;  4ZJZ A;  2X9D A;  2CRG A;  5D5X B;  4NDL A;  4LB5 A;  2BW3 A;  1DUX C;  1FMV A;  1QRY A;  1RNL A;  3J81 K;  5M3F J;  2K9M A;  1H8A C;  1FT9 A;  4XQF A;  4L0Y B;  2JUG A;  3W2V A;  4BXF A;  3K0L A;  3A1Y A;  1HKQ A;  3KP5 A;  1RET A;  2JPB A;  1YJN I;  4ESF A;  3L2W A;  1T8I A;  2R7V A;  3CRJ A;  2EZL A;  2ZCM A;  3G3Z A;  1K6O A;  3A0B C;  2DDA A;  4HKU A;  2IJL A;  1RR7 A;  2MD5 A;  3K69 A;  3OS0 A;  1GXP A;  2VQC A;  3OR2 C;  2VXD A;  1O4X A;  3KP2 A;  4CYC B;  3CMY A;  3W6V A;  2HTS A;  2A6H F;  4CH7 A;  1IG7 A;  3FXJ A;  3RDI A;  3JSJ A;  4JP0 A;  3BG9 A;  4EJW A;  1MMS A;  2FBK A;  3GTK J;  1AKH B;  4WX9 A;  4HDU A;  5EFY A;  1VQL I;  5HS7 A;  5KCM A;  4O5V A;  4DW6 A;  1G59 A;  3B6A A;  2QWW A;  1DP3 A;  2X0L A;  1IJW C;  2LRE A;  2B0L A;  2UXH A;  2LF7 A;  2DBB A;  4IHS A;  3JR9 A;  3A2K A;  3LA7 A;  2A05 A;  2XF5 A;  1BW5 A;  1V5E A;  3MZ8 A;  4WXD A;  3TO7 A;  4I99 C;  1LFU P;  3EUH C;  2HYG D;  4DYC A;  1MNM C;  4XOR A;  4CA0 A;  2CUZ A;  1Y0N A;  3EUP A;  2VJ5 A;  2EFQ A;  1E3O C;  4DBQ A;  2VPR A;  2HXI A;  1YO5 C;  2DOA A;  1IXR C;  4G6Q A;  4I02 A;  4AF5 A;  4HSR A;  1TC3 C;  3E6D A;  2EBI A;  1BC8 C;  4DIQ A;  1S6L A;  4AU7 A;  5HNH A;  2DDB A;  4CYD A;  1X2N A;  3MEX A;  1VQM I;  2WY8 Q;  1X4O A;  1AKH A;  2PBX A;  3C3W A;  2VBY A;  4LB6 B;  2GQQ A;  2M34 A;  1SFE A;  2W00 A;  2UXP A;  4BE1 A;  4DYR A;  5K5Q A;  1HCR A;  1ZGA A;  1PUF B;  2DK8 A;  3QQA A;  4D0P A;  3F8B A;  5HAW A;  3CME I;  1O3Q A;  2OCE A;  1TBX A;  5AON A;  3IRQ A;  2DAO A;  4XLF A;  4BQA A;  4CYC A;  1R36 A;  2O7O A;  4RM3 A;  2DA6 A;  3DBR B;  2P7C B;  2YX4 A;  5CVR A;  3GX4 X;  1OYY A;  2YVE A;  2O0Y A;  2OTL I;  4AIH A;  5F1J A;  1UST A;  1WJC A;  4IHT A;  2TCT A;  3OSG A;  1B6A A;  1DQU A;  2MBF A;  1WKM A;  2FOW A;  4CCN A;  2AS5 F;  5F64 A;  2DFI A;  2WB1 A;  1TL8 A;  3QPH A;  2FJ1 A;  2W57 A;  3CC4 I;  4RB0 A;  2EK5 A;  1ZAR A;  4ZZL A;  1MDM A;  3I3L A;  1Y56 A;  1WZ2 A;  3TGN A;  2V1N A;  1T6S A;  4ZZD A;  3O3K A;  3AKZ A;  2RGV A;  3JTG A;  2EFP A;  2MGQ A;  2M4G A;  2MW8 A;  4U0W A;  2WWY A;  2G7G A;  1KU9 A;  3ULQ B;  2XUB A;  5CQE A;  5IP7 J;  4JX6 A;  2HZT A;  2R7F A;  1TWH J;  5TRD A;  2ISY A;  2QZ8 A;  3ZQG A;  3HSR A;  4E7K A;  4YEJ A;  1PUF A;  5H6R A;  5LHG A;  2YVH A; 
#chains in the Genus database with same CATH homology
 1VFC A;  3BG3 A;  1A6I A;  2G3B A;  2Y2Z A;  2JMW A;  3G1L A;  1WI3 A;  3NPI A;  3ON2 A;  2ECC A;  1OCP A;  4FIS A;  2M0C A;  3L1P A;  2K40 A;  2E2J J;  3ZQI A;  5D1R A;  5C4J J;  5M3M J;  3JRC A;  4BY1 J;  1Y1W J;  3PM1 A;  2QKO A;  1P7J A;  3FK6 A;  3V6G A;  5GPC A;  3BQZ A;  5EZH A;  5GPA A;  4PXI A;  2W53 A;  3D1N I;  1GUU A;  3MKL A;  2GBY A;  2LFB A;  4B1R A;  2Y9Y A;  2MG4 A;  5F27 A;  3HTH A;  2DMP A;  2EZH A;  4UUS B;  3A02 A;  5K7F A;  1JUS A;  2L9R A;  1HDD C;  3I4M J;  2XPW A;  1NK3 P;  1JKP C;  3HOV J;  1D5Y A;  2I10 A;  2FX0 A;  2HYT A;  1NTC A;  2RAE A;  2E19 A;  1B8I A;  3TW7 A;  4FE7 A;  1ETV A;  3S14 J;  5H9T A;  2DMU A;  2D6Y A;  4M3F A;  1ETK A;  2LY9 A;  5IYC J;  5EYR A;  1MSF C;  1BA5 A;  3ANG A;  2XGC A;  3F1B A;  3GTP J;  1ETW A;  5E3N A;  2G0E A;  1MBF A;  1F43 A;  3V78 A;  2P81 A;  2QF7 A;  1RKW A;  3HKZ N;  1EF4 A;  3COL A;  5C4Y A;  2EZK A;  1ITY A;  4QIW N;  3GTJ J;  4FCY A;  4KWA A;  1UMQ A;  5C44 J;  5EZG A;  3EGQ A;  2VKV A;  4I76 A;  4JKZ A;  3S17 J;  5CXG A;  3QKX A;  5IOY A;  3Q0V A;  2GUH A;  4Y7N J;  2KT0 A;  4M6V A;  4A3B J;  3ZQH A;  3JRG A;  4A3D J;  1VND A;  2R5Z A;  3F0C A;  3JRD A;  3PO3 J;  3BTL A;  3S1M J;  3S1Q J;  3A03 A;  1FIA A;  1DU6 A;  5FKK A;  2UXI A;  1Z0X A;  5D18 A;  2M9H A;  4A93 J;  4IHV A;  3Q0U A;  2XPU A;  3S1N J;  2GFN A;  4JL3 A;  2DA2 A;  4A3I J;  5M5X J;  1MSE C;  4L5E A;  1JT6 A;  3H3V K;  2LK2 A;  3BQY A;  2Y9Z A;  2Y0S N;  3VVX A;  3T6N A;  2DMT A;  2R5Z B;  3NI7 A;  2X48 A;  5J1R A;  3AQT A;  4XIC A;  2L0K A;  1Y1V J;  3BR3 A;  3NNR A;  1IDY A;  1VI0 A;  3MVP A;  1OJL A;  2JA8 J;  3HGY A;  1A5J A;  1JJ6 C;  1F36 A;  3JRB A;  4DZP A;  5F0H A;  4AC6 A;  2E1O A;  3BRU A;  2DA7 A;  3IH3 A;  1POG A;  4ACI A;  3HB9 A;  1NK2 P;  3RZD J;  4M3B A;  3GEU A;  3G1O A;  4UUT A;  3IV5 A;  3SJM A;  4W1U A;  1MH4 A;  1XC5 A;  3KKC A;  2XRL A;  5F0C A;  3ZQL A;  2CUF A;  4A3G J;  3VW1 A;  2E2I J;  2WB1 N;  4IHY A;  2XGE A;  2NVT J;  2YVH A;  2K9S A;  2EH3 A;  4Y52 J;  2DTZ A;  2L7M P;  3C2B A;  4XRS G;  1BW6 A;  3TW6 A;  2ID6 A;  5K7Z A;  2LLK A;  3VP5 A;  3VIB A;  2HXO A;  1JKQ C;  5J1U A;  3ANP A;  3LSR A;  4D5C A;  1OFC X;  4XRM A;  3VVZ A;  2RHA A;  3HOU J;  2IAI A;  2RAS A;  2XPV A;  4C3H J;  1HLV A;  3S2D J;  3H0G J;  2JA6 J;  3PPB A;  5EEA A;  3KNW A;  1MBE A;  3HTJ A;  2ECB A;  1JT0 A;  2ZOZ A;  2N8G A;  1YRN B;  2LVS A;  4A3K J;  2V57 A;  3NXC A;  3S1R J;  1JTY A;  4A3L J;  5D19 A;  4QSH A;  2FQ4 A;  3HOW J;  2JA5 J;  5E3L A;  5GP9 A;  1U9N A;  3HBL A;  1WGX A;  2UXU A;  5IYB J;  5EF6 A;  4MIM A;  2R7Z J;  5E3O A;  4HNV A;  2R5Y B;  2XSD C;  1WH7 A;  4DZJ A;  2YU9 J;  4BBR J;  2LP0 A;  3KZ9 A;  3BR2 A;  3S2H J;  1LFB A;  1GVD A;  2CQX A;  1HF0 A;  3FIW A;  4EEF G;  5IPA A;  4AC0 A;  3RD3 A;  1SAN A;  3FK7 A;  4AYB N;  2MSY A;  1I6H J;  3HTI A;  2L7Z A;  3PAS A;  3RQI A;  3CDL A;  4QTR A;  2Q24 A;  4GFK A;  2M2E A;  4DYQ A;  1JJ8 C;  2K9N A;  2ZOY A;  5IYD J;  2G7L A;  5IP6 A;  2R92 J;  3CWR A;  2XGD A;  2R93 J;  1BJZ A;  3BT9 A;  3GBG A;  3JRF A;  4X6A J;  2WGB A;  3JRH A;  1ZKG A;  3SFI A;  4B4C A;  1YRN A;  3TP3 A;  1X2M A;  3S5R A;  1B8I B;  4C2M J;  3TED A;  1ZK8 A;  1LE8 A;  2OI8 A;  3K2A A;  3AQS A;  3GTG J;  2D5V A;  2ELK A;  4W97 A;  4D7N A;  1X58 A;  1G2H A;  2GM4 A;  1HDP A;  2ZB9 A;  4FE4 A;  3DEW A;  4V2G A;  3KKD A;  3SDG A;  3O8G A;  2EZI A;  4LOC A;  4A69 C;  3I4N J;  5EG0 A;  4V2F A;  3NAR A;  5J1Y A;  1ZTR A;  2UXO A;  5F0F A;  1I3Q J;  4FTH A;  3PO2 J;  2W48 A;  4ICH A;  3M3Y J;  3QBM A;  3G56 A;  2CJJ A;  1ETO A;  2KDZ A;  3GTO J;  3IH4 A;  1UI6 A;  1K83 J;  3MNL A;  2FD5 A;  1WCM J;  2GEN A;  4M3D A;  1S7E A;  2M8G X;  2CUE A;  3VUQ A;  2FBQ A;  4MXM A;  2JJ7 A;  5AQC A;  2LTP A;  1K61 A;  3LNQ A;  4A3M J;  2GLO A;  3M4O J;  3VOX A;  3OOU A;  2Y30 A;  3ZQC A;  3BTJ A;  4L62 A;  2DA3 A;  1IV6 A;  1IRZ A;  2B63 J;  1I50 J;  3C07 A;  4IEJ A;  2AO9 A;  2DA4 A;  1MBG A;  1ENH A;  1WH5 A;  3HOZ J;  4MK6 A;  2QOP A;  2HDD A;  2CU7 A;  2ID3 A;  1DU0 A;  3JRE A;  3E7L A;  3G1M A;  1LE8 B;  3BHQ A;  3VPR A;  1B72 B;  3HM5 A;  3Q0W A;  1ORK A;  2X6O A;  3QPS A;  2IU5 A;  3CJD A;  4M3E A;  2LKX A;  4XK4 A;  5FGL A;  3CCY A;  4BKX A;  3IH2 A;  2QCO A;  2QWT A;  4NN1 A;  2NX4 A;  1QVU A;  5JLW A;  1TWC J;  2HOA A;  4MLO A;  5JLX A;  5E3M A;  1U8B A;  1AU7 A;  1MH3 A;  4GFB A;  4A3J J;  4GCK A;  3OIO A;  1WPK A;  1Q1V A;  3IUV A;  4BY7 J;  4D7M A;  3VVY A;  3LOC A;  3HOY J;  1JKR C;  1SFO J;  2ME0 A;  3WHB A;  3DPJ A;  3ON4 A;  1RES A;  2AHQ A;  2DA1 A;  1AHD P;  4RDU A;  4J19 A;  3HTA A;  2JN6 A;  3TP0 A;  2OF7 A;  5FHP A;  4AUX A;  3RKQ A;  4MFE A;  5M5W J;  5EGO A;  2COB A;  3O8H A;  5K58 A;  3FRQ A;  2QTQ A;  3GZI A;  1JGG A;  2DA5 A;  2TRT A;  5EG0 B;  4BBS J;  1RPW A;  1MBJ A;  1JKO C;  1UHS A;  1Z77 A;  4GCT A;  2LR8 A;  3HIM A;  3BR5 A;  5FKO A;  3LHQ A;  1JTX A;  2XDN A;  5F04 A;  3BCG A;  4B3A A;  5HSZ A;  4JX4 A;  3A01 B;  3MN2 A;  1UI5 A;  5CXI A;  3BNI A;  1GV5 A;  5FLM J;  3BTC A;  1GDT A;  2REK A;  2R0Q C;  1IDZ A;  4RBO A;  4C3J J;  2OPT A;  2DMN A;  3FKI J;  2IEK A;  5J3L A;  5BNG A;  3BJB A;  2OER A;  2HOS A;  1H89 C;  1XS9 A;  4I6Z A;  2X9D A;  2WAQ N;  2CRG A;  4MO7 A;  4NDL A;  3B81 A;  3NAU A;  1QRY A;  5M3F J;  2DG7 A;  1FJL A;  3GTQ J;  2NP3 A;  5F08 A;  4YZE A;  3JRI A;  1H8A C;  2NVY J;  2H8R A;  2ZCN A;  4NEL A;  2NOG A;  3P9T A;  1RET A;  3CRJ A;  3LSJ A;  2EZL A;  3ZQF A;  2ZCM A;  2LD5 A;  1UG2 A;  5C3E J;  4HKU A;  3LJL A;  5CW8 A;  1RR7 A;  1ETX A;  2NS7 A;  2F07 A;  1BL0 A;  3B6C A;  1O4X A;  3BR6 A;  2O7T A;  4CYC B;  3CMY A;  3W6V A;  3JRA A;  4A3F J;  3LSG A;  3HEF A;  1IG7 A;  1TWG J;  3JSJ A;  1ZQ3 P;  2CQQ A;  3BG9 A;  4JP0 A;  2ZCX A;  3GTK J;  1AKH B;  1IGN A;  3E7Q A;  5C4X J;  5EGO B;  5EFY A;  3S16 J;  1U78 A;  1ETQ A;  2O8K A;  3BTI A;  4DW6 A;  1SGM A;  3S15 J;  3B6A A;  1TWA J;  1H88 C;  2XB5 A;  1IJW C;  3BG5 A;  2UXH A;  2VI6 A;  2YUS A;  2WUI A;  4JX5 A;  1GT0 C;  4C3I J;  1ZR2 A;  3JR9 A;  5IP9 J;  3QPL A;  1R9T J;  1FTZ A;  1BW5 A;  3DCF A;  3O60 A;  4M3G A;  2HYJ A;  1LFU P;  1P7I A;  2PMZ N;  1T56 A;  4DYC A;  1MNM C;  1U9O A;  2EQR A;  2DG8 A;  5IOZ A;  1HOM A;  3VOK A;  3CQZ J;  4JNN A;  2YS9 A;  9ANT A;  1FEX A;  3EUP A;  5FJ8 J;  1E3O C;  2NVQ J;  2JWT A;  2HXI A;  2VPR A;  3BR0 A;  3HOX J;  3RZO J;  2G7S A;  4GFL A;  4AF5 A;  5DS9 A;  1TC3 C;  2EBI A;  1IC8 A;  3NRG A;  2E2H J;  5HBU A;  1B72 A;  2PZ9 A;  2HOT A;  2DJN A;  2NP5 A;  2ME6 A;  3OSF A;  3FIS A;  1X2N A;  1AKH A;  2PBX A;  1XG1 A;  3LWJ A;  1ETY A;  4X1E A;  5FKL A;  2IBD A;  2M34 A;  2UXP A;  1W0T A;  4ABZ A;  1JUP A;  4DYR A;  1HCR A;  1PUF B;  1FTT A;  2JK3 A;  3QQA A;  4UDS A;  4CGR A;  5HAW A;  4IHX A;  2L7F P;  3LSP A;  1APL C;  1OCT C;  2VKE A;  2HQ5 A;  3VW2 A;  3WHC A;  2HI3 A;  4CYC A;  2O7O A;  2JA7 J;  2DA6 A;  5K7H A;  4GCL A;  1TWF J;  4UUS A;  2XB0 X;  2YVE A;  2K9Q A;  1ZR4 A;  3BR1 A;  5F1J A;  3VW0 A;  5DTD A;  2DN0 A;  1GV2 A;  2TCT A;  3OSG A;  3HGG A;  1JUM A;  4XRS A;  2NVX J;  5FKM A;  4ME9 A;  2DMQ A;  3K7A J;  2FJ1 A;  2HKU A;  4G12 A;  4A3C J;  2WV1 A;  5FLV A;  5HOD A;  4D5F A;  1T33 A;  1VF9 A;  2Y31 A;  3HE0 A;  3ZOB A;  5M5Y J;  3RH2 A;  3UKG A;  1MBK A;  1RKT A;  4MFD A;  5FMP A;  3A01 A;  5DAJ A;  1FIP A;  2MGQ A;  1IUF A;  2NS8 A;  3Q3S A;  2MW8 A;  5FKN A;  3G7R A;  2G7G A;  5IP7 J;  4JX6 A;  2QIB A;  4BXX J;  4S0H B;  4XID A;  2VUM J;  1QPI A;  1TWH J;  1ZGW A;  1W0U A;  1QVT A;  3GTL J;  3GTM J;  3HDD A;  3ZQG A;  5EDN A;  4JYK A;  1PUF A;  2O9L A;  1MBH A;  2H1K A;  1CQT A;  4IHW A;  4A3E J;  2R5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...