3FIWA

Structure of sco0253, a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
173
Chain Sequence
KMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAEIDHESAFEAGLALITDGLVRHVDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative tetR-family transcriptional regulator
publication title Structure of SCO0253, a Tetr-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
total genus 56
structure length 173
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fiwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3fiwA02
2KDZA 3F1BA 1JTYA 5EG0A 3JRGA 2Y31A 2R0QC 2NOGA 3EGQA 5C4XJ 2XGEA 4W1UA 3LHQA 5FLVA 1X58A 1NK2P 2O7TA 1APLC 2EBIA 3S17J 3NNRA 3BR3A 5F0CA 4JNNA 4D7MA 5BNGA 2JK3A 5DS9A 2YS9A 5C44J 2N8GA 2YUSA 3ZOBA 3FKIJ 1ZR4A 5DAJA 2LD5A 1F36A 2VPRA 4RDUA 5M3MJ 1HDPA 2LR8A 4QSHA 3OSGA 1VI0A 2L0KA 2E2JJ 2GM4A 2NVTJ 2EZLA 3GTKJ 4MFDA 2CUFA 5IP6A 3JRBA 5E3OA 4LOCA 2HKUA 1BA5A 1ORKA 2WGBA 3RH2A 1OCPA 2XPVA 4JP0A 4QTRA 3RD3A 1OJLA 1IC8A 3E7QA 3FK7A 3GZIA 1Y1WJ 2G3BA 3CDLA 2JN6A 2JMWA 1JT0A 5FKNA 2LTPA 3WHBA 5F04A 2ZCXA 1H88C 4A3CJ 4B1RA 2LVSA 2M34A 2R5YB 4IHWA 4BKXA 1GDTA 4DYQA 2ZOZA 2G0EA 3M3YJ 4X6AJ 5FKMA 5D18A 1JKRC 3G7RA 1LFBA 1B8IB 4EEFG 3H0GJ 3C07A 2X9DA 3ON4A 3VP5A 2R5YA 4FCYA 1MBJA 2QCOA 1ETQA 2NP5A 3FK6A 2Y30A 1W0TA 5HAWA 3BG5A 3BR6A 3KZ9A 3HBLA 2M9HA 1ETKA 1JGGA 2OERA 1B8IA 5J1YA 2G7GA 2UXPA 1U9NA 2RASA 3RQIA 5J1RA 3RZOJ 3JRAA 1FTZA 1JT6A 1UG2A 2Y9YA 4MLOA 3LJLA 2QF7A 2QIBA 2JA5J 1FIAA 4D5CA 4MK6A 5FGLA 1JJ6C 1ITYA 2Y9ZA 3HKZN 2IU5A 3LSGA 5FJ8J 3JREA 1UHSA 1MH4A 3HOUJ 1IRZA 5F0HA 3FIWA 3Q0WA 1K61A 1I6HJ 3RKQA 2GLOA 4GFBA 4HKUA 3NRGA 4ACIA 4C3HJ 3C2BA 1JUMA 3S1NJ 1B72B 2NVYJ 1AKHB 2DN0A 1TWHJ 1XS9A 2DG7A 2REKA 3BT9A 5M3FJ 3NARA 4QIWN 2DMUA 4IEJA 1QVUA 2HOAA 3ZQCA 1LFUP 5C4YA 4M6VA 2X6OA 3T6NA 1YRNB 5EYRA 4XK4A 1IDZA 4XIDA 1B72A 3M4OJ 3S2HJ 3E7LA 5GP9A 5D1RA 4BBSJ 2K9QA 1CQTA 1OFCX 1TWCJ 3HOWJ 3V78A 1ENHA 3OOUA 1AU7A 2FJ1A 1YRNA 2F07A 3G1LA 2NX4A 5F0FA 3B6AA 5CW8A 3GTGJ 4NELA 3VW0A 1IV6A 1UMQA 2MG4A 2H1KA 2R7ZJ 1I50J 1BJZA 3O8GA 4M3GA 2LY9A 5IOZA 3S1RJ 3K2AA 4A3LJ 3AQTA 3ANPA 3GTPJ 3CQZJ 2XPWA 3HOZJ 3QKXA 5EEAA 3A03A 3VIBA 1VNDA 4FE7A 2M8GX 1ETVA 5J3LA 4MFEA 3HTHA 5F27A 2LFBA 1VF9A 2E2HJ 4GCTA 1RESA 3GTQJ 4A3BJ 3G1OA 3VUQA 3WHCA 2ZCMA 4YZEA 2HQ5A 3JRIA 2RHAA 3F0CA 4M3EA 3VW1A 2ZOYA 2FBQA 2Y2ZA 2PBXA 3DEWA 3TW7A 3QPSA 1GT0C 2L9RA 5JLXA 1JUSA 2R5ZB 3PM1A 4XICA 5IP7J 3BNIA 3DPJA 3I4MJ 2R93J 5K58A 3NXCA 5IYBJ 1U9OA 2XGDA 1ETWA 3NAUA 5E3LA 4DYRA 3HE0A 1TWAJ 2ECCA 4X1EA 3VVZA 2NS8A 2R5ZA 3ZQHA 3HOVJ 1O4XA 3UKGA 2CU7A 2JWTA 1FTTA 2LP0A 3COLA 2K40A 3SDGA 1RETA 3JRFA 2YVHA 1MBEA 2GUHA 3BCGA 2XPUA 3BR1A 1ETXA 5HSZA 1GUUA 3BTJA 4A3JJ 2IEKA 3HOXJ 5IYCJ 2KT0A 3A02A 1QRYA 3ZQGA 4JL3A 5F1JA 3VVXA 4UDSA 2JA7J 1SFOJ 3GTOJ 1FEXA 3VOXA 3CJDA 1HLVA 2IBDA 5FLMJ 2ME6A 3TEDA 4ICHA 3KNWA 1EF4A 2NS7A 4M3DA 3DCFA 1OCTC 2G7LA 5AQCA 2GBYA 3RZDJ 1TWGJ 1ZGWA 1MBFA 1NK3P 4DZPA 2FX0A 5FKLA 2HXIA 4BXXJ 3MVPA 1JUPA 2VI6A 4AC0A 1DU0A 3S1MJ 1AHDP 1BW5A 2E1OA 2L7ZA 3TP0A 2QOPA 3S2DJ 4PXIA 1IUFA 1HOMA 2Q24A 3IUVA 2HYTA 2DA7A 4XRSG 3HTAA 2AHQA 2DJNA 3S15J 3H3VK 1WCMJ 2AO9A 3HEFA 5CXGA 2EH3A 2MGQA 2PMZN 1RKTA 2XGCA 3MNLA 2LKXA 2VUMJ 2FD5A 2CUEA 3BTCA 3ZQIA 4GCKA 4DW6A 3HOYJ 4AC6A 2IAIA 1X2NA 3IH3A 2DMTA 2D6YA 2HOTA 3HDDA 4DYCA 3VOKA 3ZQFA 3CMYA 1E3OC 1TWFJ 5D19A 4L5EA 2TCTA 5K7HA 1W0UA 3Q0UA 4I6ZA 2ID3A 4JYKA 3B6CA 5M5YJ 3HGGA 1K83J 3BG3A 4V2GA 3JRHA 5HBUA 3GTLJ 2UXHA 3ZQLA 2HDDA 4A93J 3BJBA 4C3IJ 2JA8J 1GV5A 4CGRA 3TW6A 2EQRA 5C3EJ 4A3KJ 5IYDJ 2QWTA 2FQ4A 3BQYA 3PO2J 2K9SA 3CCYA 1AKHA 3LSJA 4V2FA 1DU6A 1IGNA 2HOSA 4W97A 1X2MA 1UI5A 1RKWA 2ZB9A 3FISA 3QPLA 2Y0SN 4BY7J 3NI7A 2DMPA 2ECBA 1XC5A 3AQSA 2GENA 3EUPA 4A3MJ 2HYJA 1MSEC 2XSDC 1RR7A 1GV2A 1Q1VA 2X48A 4L62A 4BBRJ 3NPIA 2DA1A 3ANGA 3OSFA 4MO7A 4Y52J 2L7MP 3VVYA 4JX6A 1U78A 1MBGA 5EZGA 2ELKA 3K7AJ 3S1QJ 3B81A 1POGA 1P7JA 3SFIA 3HM5A 1PUFB 1MBKA 3CRJA 4GFLA 2K9NA 4NN1A 2QTQA 1QPIA 9ANTA 5EZHA 1ZK8A 2DA5A 2O8KA 3D1NI 4C3JJ 1MNMC 4C2MJ 3V6GA 4B3AA 2QKOA 1T56A 1PUFA 4IHYA 1RPWA 2DA4A 4FTHA 5H9TA 2E19A 2MW8A 2EZKA 2GFNA 1MBHA 4GCLA 1BW6A 1ZR2A 4UUTA 1ZTRA 3O8HA 4D7NA 2W53A 4KWAA 2DA2A 3A01B 4Y7NJ 1Z77A 4AYBN 1HDDC 5M5WJ 3HGYA 2M2EA 2V57A 1F43A 1P7IA 5FHPA 4A3DJ 1I3QJ 2W48A 1HCRA 5M5XJ 3A01A 1ZKGA 1JTXA 3BR0A 3IV5A 3G56A 4B4CA 2R92J 1JKQC 2PZ9A 1R9TJ 3VW2A 3I4NJ 2OF7A 1WH7A 5J1UA 1ETYA 3S5RA 2UXOA 5EFYA 4RBOA 2UXUA 3KKDA 1JKPC 1SGMA 5DTDA 3SJMA 3S16J 2ID6A 2DA3A 4J19A 2TRTA 3O60A 3GEUA 3BTIA 2JJ7A 3PO3J 1XG1A 4JX5A 3OIOA 1G2HA 2CQQA 4XRMA 4BY1J 1IJWC 3ON2A 2G7SA 3TP3A 4A3IJ 2EZIA 4A3FJ 3GBGA 1D5YA 4MIMA 1GVDA 1T33A 5GPAA 1BL0A 2H8RA 3IH2A 2M0CA 3Q0VA 4DZJA 2ME0A 2OI8A 5C4JJ 3FRQA 3W6VA 3P9TA 4IHXA 2CRGA 2COBA 3Q3SA 3BTLA 4M3BA 2WV1A 2LK2A 2WUIA 2CJJA 2DTZA 1TC3C 4S0HB 2NP3A 3PASA 1SANA 2OPTA 3BR5A 4M3FA 4A3GJ 1ETOA 1JKOC 3JRCA 3LNQA 2NVXJ 4AUXA 2CQXA 2P81A 3QQAA 1WGXA 3BG9A 1H8AC 1WPKA 2O7OA 2HXOA 1WH5A 5EF6A 2WB1N 3IH4A 4A69C 5F08A 2B63J 1S7EA 2LLKA 5HODA 1JJ8C 2YU9J 3HIMA 1MSFC 5E3NA 3HTIA 4GFKA 2UXIA 5E3MA 5IPAA 3LOCA 3L1PA 1LE8B 3MN2A 4XRSA 1A6IA 2MSYA 4NDLA 5K7ZA 5FKOA 3HTJA 2VKVA 3LWJA 1NTCA 1LE8A 1IG7A 2XB0X 1Z0XA 3MKLA 5JLWA 2XDNA 5FMPA 2DMNA 2RAEA 1FJLA 3GTMJ 4I76A 4JX4A 2DG8A 4JKZA 2XB5A 4CYCB 2D5VA 2NVQJ 2O9LA 4FISA 1QVTA 3PPBA 2E2IJ 3GTJJ 4ABZA 1H89C 1Y1VJ 1UI6A 5EGOB 3S14J 5K7FA 5GPCA 4IHVA 3VPRA 4HNVA 4AF5A 2JA6J 4CYCA 2ZCNA 4D5FA 2YVEA 3BR2A 4FE4A 2HI3A 3JR9A 1ZQ3P 3HB9A 3QBMA 2EZHA 2L7FP 5IOYA 5EDNA 2I10A 5EGOA 2XRLA 3BQZA 1U8BA 4UUSB 1VFCA 1HF0A 3G1MA 3JSJA 4MXMA 4G12A 2VKEA 3KKCA 3LSRA 4ME9A 2WAQN 3BRUA 1WI3A 5EG0B 1FIPA 3CWRA 2DMQA 5FKKA 1IDYA 5IP9J 3JRDA 3BHQA 3LSPA 5CXIA 2DA6A 4UUSA 1MH3A 1A5JA 4A3EJ
chains in the Genus database with same CATH superfamily
4XORA 1VTNC 2ZC2A 1FP1D 2K5CA 4A0YA 5EG0A 3PQJA 2Y31A 2NOGA 3N97A 3I59B 2XGEA 4W1UA 3MKZA 3G73A 5FFZA 4M6XA 3BR3A 3NNRA 2IA0A 5CVIA 1TL8A 4D7MA 5BNGA 5IT3A 2VL8A 2JK3A 2X6YA 2YUSA 1I6XA 2IS6A 5K1YA 4ITVA 3FHNA 2F48A 1F36A 3CZ6A 4CO8A 5M3MJ 1HSJA 2LR8A 3OSGA 2ZBKA 2X0LA 1BI2A 4LGWA 3ZRGA 2YSRA 4JBAA 5CPRB 2CUFA 4BDZA 2KRHA 4LOCA 1W36D 1BA5A 4H4KC 1S6LA 2WGBA 4PK4A 3VYRB 1IC8A 4GCVA 4PJLA 4DIQA 2O6GE 3GZIA 2G3BA 3J7ZI 2X1DA 3DLAA 3TOBA 4IRIA 1I1GA 1RZ4A 2V1UA 2DK8A 4S04A 1IW7F 2K27A 1WJBA 5GADJ 2LTPA 3F21A 5CJ9A 1DPRA 4A3CJ 1LVKA 2LVSA 2M34A 2Z99A 4CZZA 3W6KB 2ZOZA 3W2AA 3IHUA 1K4TA 1YLFA 4BE2A 2STWA 1LFBA 3G7RA 1B8IB 4EEFG 3M8EA 2GQQA 4BJTA 2DI3A 2R5YA 5CVRA 2NP5A 2XV4S 3K9TA 4U9LA 2M5WA 2L4MA 1RNLA 1MZBA 1PVEA 3DPUA 1K78B 1ETKA 1AA7A 3ZXSA 2OERA 4L5IA 2XF7A 2DDAA 1TP4A 1X1PA 4UHTA 4B48A 4PSWA 4RMNA 3RZOJ 1FTZA 3H9JA 1J2XA 2Y9YA 4RLQA 2KZGA 4XLAA 3TQNA 3W2VA 3DBLB 3LJLA 3K70C 2QF7A 3CDIA 3VODA 1FIAA 2JA5J 2HQRA 3CJNA 5KCMA 3K0LA 3LSGA 4XKCA 2ZFWA 3FXKA 5FD6A 1IAWA 3HOUJ 4ZJZA 1T95A 3OV8A 4OINF 2GLOA 2JUCA 4Z6YA 4ON0A 1B9NA 4LFUA 4HF1A 1TWHJ 1XS9A 1P92A 4G6QA 4NNJA 3ZQCA 3BDDA 5C4YA 4MEYF 1FSEA 3F9KA 3T6NA 3L2UA 1SFXA 4KN7X 1XSVA 2X1EA 2E34A 3OYLA 1A5JA 2VBYA 1IDZA 1B72A 3KP2A 3E7LA 4RAGA 4LMYA 1L3LA 4BBSJ 1CQTA 1TWCJ 3E3VA 1O7LA 2E60A 1ENHA 1H9TA 4WXDA 4U0YA 5KHDA 1AU7A 2ZNZA 1S3JA 4HRIA 4ENKA 2QKLB 4YEJA 4C2UA 2XAGA 3HRUA 2DBBA 2ISYA 3GTGJ 2P5KA 5CYVA 3VW0A 1W7PD 1YE9A 2WADA 1UMQA 3E5XA 3EPZA 5GAEJ 2R7ZJ 3ONQA 4M3GA 3AG2H 2VB6A 2B9SA 3K2AA 3ZN0A 3AQTA 5K5OA 3HOTA 1SAUA 1UB9A 2MD0A 3FXJA 3FXQA 4RS8A 5E79C 3F23A 3HOZJ 2V9VA 3QKXA 5DEQA 3VIBA 4XN0A 2XIGA 2LH9A 4FE7A 4WX9A 3ZPLA 2ZXWH 3GZNB 2M8GX 2Z5UA 1ZG1A 3LSTA 2E2HJ 3RKWA 4GCTA 3GTQJ 1H9GA 4A3BJ 4YZEA 2KL4A 2D2WA 3PNVA 3RPQA 5TRDA 2FBQA 2PBXA 3TW7A 2KJCA 3QPSA 3DF8A 1GT0C 1A31A 2HR3A 5JLXA 1MMDA 4XNFA 1NG7A 4XICA 3BNIA 4Z2YA 3DPJA 2KISA 3GMEA 4RM3A 4N4NB 5K58A 2YVXA 2A6EF 3DKWA 3NAUA 3ABLH 2ECCA 4XKBA 1IV8A 1MMAA 2R5ZA 3ZQHA 4XN3A 3BJ6A 2A6HF 4CHUA 3LQQA 2CU7A 3F3XA 1A6QA 2BGCA 1TBXA 3LAJA 1WJFA 1Z67A 1RETA 2YVHA 3H1CA 2OU2A 1D0ZA 1FOWA 3TDUC 1GUUA 4WXCA 3HOXJ 2BY3A 4DVYP 1YI2I 4C2MA 1J5YA 3HPGA 4ESBA 1HW2A 2B1EA 2IPQX 3JCUC 4QLCU 4UDSA 5HLTA 2RQQA 2E35A 4ENJA 3DU6A 3CJDA 4LLGF 4KT6A 1U3EM 1O7FA 3DBHB 1MMNA 2NS7A 3QYFA 4M3DA 3DCFA 4EMSA 3RZDJ 1TWGJ 1ZGWA 1T6SA 1G3TA 2P6TA 2QQ8A 5J8FA 1Z91A 1FZPB 2HXIA 4BXXJ 3MVPA 4AC0A 3TO6A 4KDPA 1OCRH 2PEXA 2E1OA 1ZREA 2QOPA 4M72A 4D0PA 1MIJA 2Q24A 2RGVA 3FXMA 3SQNA 5AONA 1I5ZA 3GCMA 4EM0B 3H3VK 2AO9A 2JQ7A 5K5QA 3DBRB 2PQ8A 3HUGA 2R7TA 4II3A 4BUPA 3VYUB 1KONA 2W24A 2DMTA 2D6YA 1FYMA 2XAHA 3REOA 1O3QA 4DYCA 3F8CA 3CMEI 3ZQFA 3CC7I 1ZYRF 4BS9A 4CZCA 4UUVA 2V6EA 3B73A 2FBHA 1BI1A 1W7PB 3PUBA 4XLNF 5LRRA 2PMZA 2ID3A 4JYKA 3B6CA 4PJ0C 5M5YJ 2XGXA 1K83J 4LG3A 1ZRFA 5H6QA 1QZEA 2JA8J 2L9VA 1G3SA 2QWTA 1R1UA 2A5YB 2PFBA 3JAMZ 3FXOA 4BAYA 1AKHA 1UCRA 1GHCA 1YTYA 1X2MA 1ZRDA 1QNTA 3E0JB 3SXYA 2E71A 1RKWA 2MYSA 1JXSA 3QPLA 3NI7A 4M74A 3BG7A 3BOQA 2QVOA 3EUPA 5D5WB 2XSDC 2PFVA 2X48A 4L62A 3FMQA 1FSHA 1U0JA 3GF2A 3OSFA 5DUIA 3LSIA 1SD4A 2DYRH 4B47A 1SFEA 1SMYF 2LYCA 3M9AA 1FP2A 3QYBA 1U78A 2F5FA 4B43A 2OQRA 4M9XA 1WJEA 1MGTA 1D1AA 4WF2A 1POGA 4YIFA 3SFIA 1CF7B 1S29A 3O6BB 1R6RA 4GYIA 1KU9A 1XDUA 3HM5A 4BDYA 5EEGA 3VB2A 3PSIA 3H35A 1MJ9A 1ZK8A 3TKYA 4Y33A 3D1NI 5BPIA 3FWEA 1MNMC 1V3FA 1V5GA 4B3AA 2D45A 2QKOA 5K5RA 3V6GA 4HW0A 1G3YA 1Z6RA 1PUFA 2DJIA 2VE9A 1W5TA 5IY5H 2V79A 3NWTA 4EJVA 2CV2A 5H9TA 2E19A 5JR3A 2VC1A 2Z9OA 3HG9A 1UHMA 3WU0A 4U9NA 5J8CA 4GCLA 1ZHFA 1ZR2A 3K1PA 4D7NA 2W53A 2PX9A 3RPUD 2NNYA 2KIMA 4YRVA 1WKMA 4Y7NJ 5LHHA 1HDDC 4N0BA 1REPC 3CDHA 2VOPA 2W57A 3HGYA 1BI3A 1X3UA 2M2EA 4CICA 3MZ8A 4RLFA 3VYTB 5FHPA 4A3DJ 3MMYB 5M5XJ 2GIZA 5HDNA 2GZWA 4JOMA 1JTXA 2JZYA 3PIOF 3G56A 2EFOA 2Q2EB 2R92J 3GUDA 1R9TJ 3I4NJ 3N05A 2E1NA 2GIVA 2H1LA 2F6CA 3V4GA 2Q1ZB 3BZCA 2EIMH 3LWFA 5H20A 5J1UA 2DFIA 3RKXA 4AYBA 1F5TA 2CV1A 3S5RA 3KKDA 2UXUA 1RUOA 1R49A 3SJMA 4F55A 3MKWB 2O03A 3K4MA 3KEYA 1OMIA 1PJRA 3J81Z 1S8NA 4HDUA 3PO3J 3FMSA 1G3WA 3LA2A 3OS1A 3PSFA 3P7NA 4XRMA 4YFKF 2QKMB 3ON2A 3FZVA 3TP3A 4KT5C 4XBFA 2W25A 4GRIA 4MEXF 1ULYA 4BE1A 1IO2A 5CVUA 3R0AA 2DDBA 2FU4A 2O5RA 4WXHA 2DO7A 2C6YA 5GPAA 1HW5A 3FXRA 4CH7A 1BL0A 3HZJA 2M0CA 3Q0VA 5HDGA 2QBYA 2OI8A 2V4JC 3H3UA 2OTJI 2CRGA 3WU2C 3Q3SA 4MTDA 2A61A 4J01A 2JVHA 3F8FA 2FF4A 2NP3A 3R6SA 2WUIA 2G7UA 3BR5A 4QWQA 1ETOA 3JRCA 3G6EI 3WGHA 3JTGA 3ZQ7A 4UXNA 4XLPF 2P81A 5J47A 3QQAA 5HLHA 3BG9A 1WPKA 2CV0A 2O7OA 2HXOA 1WH5A 2WB1N 2VXDA 2ZJQF 2DT5A 5HLIA 1T08B 3PJRA 2XC7A 4I09A 5E3NA 1BIBA 4L9NA 4A3EJ 2UXIA 4OU0A 2NOJB 1LUJB 3CCJI 1SVMA 2M30A 4JQFA 3MZYA 3QOPA 3L1PA 4BXUA 2ZJRF 3EYIA 4XRSA 1A6IA 1XX5A 2ZSHB 4FQGA 4NHJA 1D5VA 4NDLA 4BJ5C 3S3OA 2KKOA 5FKOA 2QGUA 2HVQA 3CJQB 4NQWA 1W4MA 3OOPA 1TW2A 4XOTA 5ED4A 1IRGA 2XB0X 1NG6A 2LBFA 4R8HA 5DCFA 2KRCA 5KK1A 2VQLA 3HHGA 3ECHA 1TZLA 2FXAA 3GTMJ 4JX4A 2R7XA 2GXBA 5HVQC 4IF4A 4CYCB 2M7BA 5LFAA 1IRFA 3P9KA 2RN7A 2O9LA 2NVQJ 3C3WA 3JAMK 1KYWA 4S05A 1MMGA 2L7KA 3ESWB 4LG0B 5LGTA 3S14J 4E7ZA 5K7FA 2L3DA 5GPCA 4HF2A 3M1EA 1ZGAA 3CLQA 3LFUA 2JA6J 4D9JA 2E1MB 2ZCNA 4D5FA 3BR2A 4KA4A 1ZQ3P 1WI9A 2EZHA 3WU1B 5EDNA 3QPTA 5DCMB 2IW5A 1RI7A 4UUSB 3MKYB 2OUMA 1ONVA 2CGPA 4G12A 3JSJA 3KKCA 2WAQN 2DMQA 2ZNYA 1IDYA 3H5NA 3BHQA 4KIGA 2Y0MA 4LIVA 5CXIA 3OWTA 2KDZA 1SD5A 3LHQA 5FLVA 4OIOF 2EBIA 2W00A 3BZ6A 5F0CA 2ZJ2A 4JNNA 3QRFF 3FF5A 3DEEA 3I5UA 1EA3A 3I59A 2P5LC 2N8GA 5ERIA 1SEUA 3IC7A 2RNGA 1M1EB 1NHAA 4AIHA 2LOOA 2IGNA 2LD5A 1ZR4A 5DAJA 1WSUA 2VPRA 4QSHA 4F7ZA 4Y3OA 1D1BA 3KLNA 1VI0A 2L0KA 2E2JJ 3GTKJ 3CP8A 4C30A 2F5CA 2O0YA 2GXGA 2HWVA 3ERED 2HKUA 4XRFA 4HX7A 2DW4A 1C0WA 3K1MA 1OCPA 5LHIA 4QTRA 3RD3A 3K2ZA 1WJAA 1IN8A 2KDOA 3K10A 3ZP5A 2CWEA 3CDLA 2W7NA 3H0DA 4A0ZA 5GTIC 2JTVA 1YJ9I 3OYKA 1WFXA 3WHBA 2ZCXA 1H88C 3CCSI 4B1RA 1TNSA 4BKXA 2H94A 2YU3A 4E6KG 3AG1H 1X1CA 3BJOA 4F52A 3M3YJ 3ABUA 2CUJA 3J81K 2QZ8A 5D18A 1JKRC 4UV8A 3C07A 2X9DA 3IUOA 3VP5A 2QCOA 1R58A 2PN6A 1SAXA 2Y30A 3OYJA 2DPUA 3HL2A 1ZN2A 3BG5A 3OYDA 4UY8I 1JGGA 1GXPA 1B8IA 1EV7A 4HNTA 2RASA 3RQIA 2YX7A 2HFHA 3J7YJ 3JRAA 1BR1A 3CJTB 1YIJI 2QIBA 4PJMA 2WTEA 3RTRA 4IX7A 2Z3YA 2FNPA 3OYBA 3RI4A 3HKZN 2BBYA 5FJ8J 1T39A 1JHHA 3DTEA 4LIUA 1MH4A 3TGNA 5F0HA 3FIWA 3Q0WA 3RYPA 1K61A 4RAYA 2XKOA 3SEZA 2STTA 3L2VA 3NRGA 3ERMA 4FETA 1JUMA 4ZDPA 4C3HJ 3S1NJ 3KP3A 4LB5A 2REKA 2BOLA 3GFIA 1TT5B 3UNGC 4L9TA 3V8LA 4QIWN 2DMUA 4IEJA 2WAEA 3VWBA 3BP8A 5KAIC 1B1BA 5L3GA 2CYYA 3KP7A 4F93B 3L2WA 4HSTA 1R7JA 5GP9A 2F4IA 2BHZA 1OFCX 1Y56A 4ZH4F 3T0YA 3V78A 1QGPA 3OOUA 2FJ1A 3RKYA 3AFHA 4NC8A 3JW4A 3ABTA 2W82A 2QLZA 4RAFA 5F0FA 3ASOH 2HPMA 3ABKH 3B6AA 3CCRI 3ISPA 1OPCA 3OY9A 1BJZA 3O8GA 2VOOA 1LB2A 1UZCA 1PYVA 3S1RJ 3ANPA 2LC2A 2IGKA 3TDZC 3AG3H 3BC8A 1BC8C 4WCGA 4NB5A 3MWMA 2BW3B 5HLGA 5JVTA 1USTA 4ZZLA 2HOEA 2YPRA 3E5QA 1U8RA 2EFNA 3H92A 1R4NB 3SWHA 1RESA 3Q9VA 1B59A 3QODA 2ZCMA 2HQ5A 4P9FA 3JRIA 2YX4A 4CCLA 2RHAA 2ZOYA 2BVMA 1SVLA 2DU9A 1ON2A 3DEWA 5F64A 1BR4A 4BEHA 4O5VA 3FKJA 2X51A 3PM1A 2X6XA 4L0YB 1B9MA 4KFCA 1YX5A 2KFDA 3NXCA 1U9OA 2FA5A 5E8GA 2XGDA 1JE8A 4J00A 4GXOA 4M71A 1YS6A 4KMFA 2PJPA 1OR7C 1TWAJ 2GOXB 3MFKA 1XCVA 2DOEA 2E7XA 2V26A 1KU7A 1SD7A 1YYVA 2Z1DA 2Y48A 4DOZA 4X0GA 2LP0A 3COLA 4IL6C 2K40A 2R3SA 3SDGA 4P96A 2L9SA 3JRFA 5BMZA 3GEZA 2GUHA 4HF0A 2LKSA 3BR1A 1WWXA 5HSZA 2KQRA 5IYCJ 3H5RA 1HC8A 1KU2A 2KT0A 1MJAA 1STZA 2AXLA 2KHMA 5F1JA 1T0FC 4EJOA 2JA7J 2DK5A 1TQIA 4M6YA 3VOXA 5L3EA 4U7BA 2HQNA 2L2OA 5AQCA 2RC4A 3S8PA 2DOFA 5JFRA 5E18F 1R22A 5E1ZB 1Y0NA 4MTEA 2MC4A 3CESA 2BEOA 5CKTA 4EJWA 1YOVB 3K1NA 1AHDP 3S2WA 4PXIA 3K4JA 3IUVA 2HYTA 2OQGA 4N4OB 3GW2A 3MQ0A 1WCMJ 3LL7A 2KIUA 3HSFA 2VE8A 2GAUA 2MGQA 4BACA 4CCOA 1RKTA 4B44A 2EILH 1X3ZB 3ZQIA 5H2FC 4GCKA 3HOYJ 3IRQA 1X2NA 3E6DA 1FX7A 2K02A 3R60A 4G9YA 1UAAA 1N75A 5B5EC 1OCZH 3T5XA 1XSDA 1XSXA 4FT8A 4G8XA 2M1BA 3WE2A 2VJIA 1WHUA 5D19A 4L5EA 3H5AA 1W0UA 2P5VA 2XASA 4I6ZA 4E7IA 1BOBA 4ZTFA 4NUBA 3HGGA 3TBIA 5J4YA 3I0TA 4V2GA 2UXHA 1UELB 4DBQA 2JSCA 1Z21A 3ZQLA 2UWMA 3HXLA 3DTKA 4C3IJ 1SD6A 1GV5A 1W7PA 4UNOA 2COMA 3TW6A 1LEBA 4CGRA 3ZMDA 2FRHA 4IQJA 5FFXA 3CCYA 4L9JA 2WBMA 1VQLI 1DU6A 4V2FA 1IGNA 2D1HA 4W97A 1UI5A 3OR2C 2ZB9A 1SVOA 2QUFA 4ZYAA 4BY7J 1IN7A 3AQSA 1XD7A 2HYJA 1MSEC 3VTIA 4G7OF 1TT0A 3I4PA 1VQKI 3NRVA 3GX4X 1OQYA 4E7LA 1EH7A 1KYZA 2XAUA 3KFWX 1A35A 5DM6F 2AXTC 2K86A 4JX6A 5TISC 1XMXA 1TLHB 1MBGA 2ETHA 5EZGA 3FX3A 2ELKA 3BG6A 5HS9A 4Q4ZF 3S1QJ 1YJWI 1U5TB 5D5XB 1P7JA 1X4PA 1R1TA 3RIRA 1GLNA 4P9UA 1J9IA 1MBKA 3CRJA 4GFLA 2K9NA 1K6YA 4FX0A 2QTQA 3ZMZA 9ANTA 1P2FA 2E36A 5EZHA 3OYCA 2QSFX 2LY2A 4ZYDA 3AL0C 2O8KA 2CUZA 1X3WB 5E17F 1T56A 4UVBA 4AM3A 1RPWA 3ZR8X 2F5DA 2DA4A 3I64A 2VQCA 1LFPA 4FTHA 2DT7B 1QHHD 3BCBA 4PFPA 2EZKA 3K4BA 1MBHA 2MH2A 1BW6A 2QQ9A 1OISA 2R7FA 1X1BA 3O8HA 4UUTA 3WTWC 2DA2A 3A01B 1HW1A 3OMYA 2P0WA 3WTZA 4MGRA 1ACIA 1F43A 3DV8A 2W48A 3K8PC 2L02A 2JRTA 1ZKGA 3T8RA 1TW3A 2BY1A 2WWYA 5FROA 2BYVE 2NNNA 2HVSA 5CLSA 4BHBA 1EJ9A 2PZ9A 4LITA 1G59A 1BN5A 5ICCA 5GAHJ 4BE0A 3X2QH 2E5ZA 1V5EA 3RJPA 1JKPC 1SGMA 1FBUA 2IA1A 5CVJA 3WTXC 4ZC3A 2XAFA 1P6RA 3FBIB 2DQLA 2GOMA 2ID6A 3QYEA 4J19A 2TRTA 1N77A 1P4WA 3CCVI 2JJ7A 1BOAA 2A3SA 3E6CC 1XG1A 3I54A 4JX5A 2AS5F 5D6FA 4A5MA 1IJWC 3TO9A 4U0VA 4CCJA 4OMZA 3RQ4A 4A3IJ 2IXSA 3DWLE 3GFLA 1D5YA 1VQ5I 4MIMA 2ICWG 1T33A 3GZ6A 3Q5FA 2ZFUA 3NWSA 1FLIA 2EFPA 1X19A 4DZJA 3GO5A 5C4JJ 5D6EA 5D8LB 3K4LA 1K79A 3P9TA 2QSGX 4XL9A 4LD5A 4M3BA 2I5UA 2LK2A 5L3BA 1TC3C 2W84A 1XGNA 4HQMA 1K7AA 4A3GJ 4RM2A 1ZELA 4PFOA 3OS0A 3OIQA 1Y8QB 1GXQA 3CCMI 1ZH5A 4IXAA 3Q9SA 2HVRA 3OYHA 4AIKA 1XN7A 2KPMA 2KMUA 4A69C 5HODA 3F8MA 2YU9J 3HIMA 4ZZDA 5HS8A 1QHGA 2JPCA 2MA3A 4KYWA 2MH9A 2OV7A 5IPAA 3LOCA 2V9KA 1LE8B 4WK8F 5AIPA 3HJEA 1IN4A 5TJJA 1B6AA 3UR3C 3SYTA 5K7ZA 3HTJA 5JHUA 5HS7A 4HBLA 1NTCA 2R7QA 2P6SA 1ZG5A 4EM1A 5FLXZ 3AG4H 1IXRC 1IG7A 3MKLA 3LSMA 5JLWA 2DMNA 3WG9A 4R1HA 4XLEA 4ZYGA 3OS2A 1FJLA 1KU3A 1OCOH 3KEQA 4I76A 2IS1A 4JKZA 2XB5A 1FT9A 2D5VA 4PZJA 2A69F 4AWXB 5E20A 2Y0SA 3K6GA 2DXIA 1H89C 1JHFA 1Y1VJ 2E1CA 4M9SA 5EGOB 2ZMEB 1Y8RB 4IHVA 4WIBA 4CYCA 3G4SI 3RPUA 3ELKA 1MDMB 4RGSA 1QO0D 3HB9A 2NVUB 2L7FP 3QPHA 4LG0A 3CMAI 2I10A 2XRLA 4LK0F 3I58A 4MQ9F 1HF0A 3KLOA 2VASA 1KA8A 3G1MA 4MXMA 2VKEA 3LSRA 4ME9A 1FIPA 4E7SA 1XMAA 1SFUA 3E1SA 4I01A 2OJED 3DPLC 2VIXA 2VONA 1YJNI 4UUSA 2EJRA 1XPXA 1FOKA 1P4XA 2CW7A 3F1BA 2XUBA 2IGMA 1W36C 4O6JA 3JRGA 4PGGA 2R7WA 1F4KA 2V1XA 4CYDA 5LGUA 4K2EA 1OYWA 2BXYA 3TL4X 1T38A 2V9PA 1LDKB 2HQAA 1X58A 1J75A 1APLC 4HNUA 2E7WA 4U0WA 1PDNC 2WAQA 4ESJA 3VEPA 1EH6A 2JSPA 3B02A 3WE3A 3CC2I 5DS9A 5C44J 3ULQB 4IRVA 3I71A 2KIFA 4I0AA 3EUAA 5D4RA 5FRMA 3FKIJ 4I7HA 1HKSA 2DQRA 2VPLA 1HDPA 3V7CA 1V54H 2Z33A 2IS4A 2EZLA 4MFDA 3JRBA 5L3DA 5E3OA 3WGGA 3CMMA 2AQEA 3DTIA 5DDGA 2H27A 4KNYA 3ECOA 1UFMA 4ESFA 1ORKA 2EB7A 3DKXA 1OJLA 1FMVA 2CSOA 2HS5A 2PBIA 1MW7A 3U1KA 3CUOA 3FXUA 5FKNA 1FC3A 5F04A 4KICA 4XLCA 4IHWA 1TQPA 2LF8A 1ZG3A 5E1WA 1PP7U 3S3NA 2BHYA 3H3ZA 2G0EA 4PJNA 4X6AJ 2LF7A 2VKHA 5FKMA 2CQ7A 2K3PA 2HPIA 2KIQA 4U87A 1XGMA 2JA2A 1ZARA 4AVZA 5E8IA 3BROA 3OYNA 3MD2A 1QZZA 3BR6A 4UB6C 3WGIA 3QOEA 3KZ9A 2BV6A 2M9HA 3HBLA 4ENNA 4B3XA 5J1YA 5CVVA 1VZ0A 2P7CB 4I2OA 3ZMSA 2G7GA 1U9NA 3PQKA 1DGWY 5J1RA 2L9NA 3SZPA 4MLOA 5FGLA 5FD5A 1JJ6C 2Y9ZA 3KYLA 2IP2A 1I39A 3HOSA 3E6MA 4AVPA 1UHSA 3VSKA 3S3MA 2OTLI 3KZIC 3H36A 2PLYA 1Z1DA 3K4NA 3KIOA 3BZKA 3LA7A 1I3AA 3RKQA 1I6HJ 1H0MA 4GFBA 4HKUA 3CUQB 1AKHB 1W5SA 2NVYJ 4FHTA 2DG7A 2OA4A 3CC4I 5IT9Z 1PUEE 2QYOA 1LEAA 2HOAA 1LFUP 2PJRB 2RVCA 3HKZA 1YRNB 5EYRA 3DPTA 4RA2A 2QSHX 4XM3A 3CCUI 4E7KA 4XIDA 1Z9CA 3DKYA 3S2HJ 1K6OA 3K70D 5D1RA 4HSRA 1G8XA 4N9HA 3HOWJ 4YELA 2L4AA 4FASD 3CP2A 1YFHA 3CD6I 1BJAA 2L01A 3G1LA 4KITB 3RSNA 3T1BA 1N25A 5CW8A 4NELA 3IWZA 2ESNA 2MG4A 2H1KA 1I50J 1QQIA 2LY9A 3GFMA 2FMLA 2HNHA 2EINH 5FLXK 5B1AH 3C2GA 3KPHA 3WTVC 3GTPJ 3CQZJ 5FO5A 2XPWA 2NRAC 5EEAA 3A03A 2HZTA 4L5JA 1VNDA 2CW8A 3KZYA 4PGHA 2QA4I 4IKFA 5HOOA 5J3LA 4MFEA 5HDKA 3HTHA 1FNNA 4H0EA 3G1OA 3WHCA 2A05A 1J0RA 2PI0A 3F8BA 3F0CA 2BE5F 3I3LA 1D8JA 4ANJA 2PMHA 2Y2ZA 2B3WA 4Q5SF 2HYFA 2L9RA 2ZXHA 3M1CA 1YQAA 4A6DA 3WTSC 3A1YA 4GYGA 3WG7H 1W1WE 3I4MJ 2BVLA 1J09A 1BI0A 2XHKA 3I9V2 2FBKA 2R7SA 5IYBJ 3GYHX 4TV7A 1ETWA 3JSPA 3HE0A 4DYRA 5ILSA 2DCEA 4X1EA 2FOWA 3MZHA 1F9NA 3HOVJ 1EKEA 4BJ6C 5ICFA 1FTTA 3U2RA 2R7OA 1RIOH 4BYYA 3DXJF 5H6RA 3A0HC 1R1VA 3C7JA 3BCGA 2XPUA 1IN6A 1ETXA 4XMYA 2IVMA 3BTJA 3QAHA 4A3JJ 2IS2A 2HKXA 3M07A 1FOXA 4EVIA 3A02A 4UV9A 1QRYA 1OCCH 4JL3A 3OYIA 3VVXA 5ICGA 1R5ID 2LREA 1XCBA 1R5GA 5DD4A 2IBDA 5FLMJ 2ELJA 2MBFA 1KQ9A 4ICHA 3L2RA 3KNWA 1QU3A 1OCTC 2G7LA 2H8WA 2GBYA 4BHPA 1FYLA 1MBFA 2MABA 1IF1A 4DZPA 3K4KA 4IOAF 2E5NA 5FRNA 3D5SC 1BBYA 1DU0A 2H09A 3W6JB 1WJDA 4L18B 2L7ZA 3TP0A 3KCCA 1ZLKA 4AIJA 3S2DJ 4PJJA 1HOMA 1FYKA 2DA7A 3WTYC 4XRSG 3HTAA 2DJNA 2EH3A 3KYDB 5D5UB 2DPDA 2ISZA 1D1CA 2XGCA 4RGRA 3W3CA 2VUMJ 3MNLA 2FD5A 2CUEA 3OL4A 3N4MA 2M87A 2IAIA 3IH3A 1K78A 4ASNA 3HDDA 3VOKA 5DV5A 1Y6IA 2R4GA 3CMYA 1E3OC 1QA6A 2EA4A 4U88A 3O3KA 3HTUA 2HKOA 2L54A 5K7HA 3ZMTA 3EUKL 2V7FA 4A93J 3BJBA 4PUSA 3IL2A 5C3EJ 4A3KJ 3R61A 2NYXA 5IYDJ 2EV5A 2FQ4A 1VQ9I 3PO2J 3OYAA 2HOSA 4KUMA 5KVRA 1FMWA 4DGWB 3FISA 1MD0A 3HC7A 3PNTA 2CQKA 3AKZA 2CFXA 3BJAA 3CLOA 1Z05A 1GV2A 1Q1VA 3L09A 1PP8F 2O8XA 3NPIA 4IRHA 3HYIA 3ANGA 5B3SH 4HZFA 3OYMA 4EGZA 1VQMI 2DT6A 4MO7A 5IT9K 5E1XA 2L7MP 3VDXA 1T8IA 4XLHA 2DODA 4IO9F 3D5RC 3LAPA 3ZCOA 3L9FA 5CQEA 3S93A 3QU3A 4FX4A 4LB6B 3ZGKA 4RGUA 4CCNA 4EV0A 2UUZA 4BQAA 3F72A 2DFHA 3HRSA 4AU7A 3O2PE 3W2WA 1U5TA 1IXCA 2DA5A 3V7SA 2HU9A 3V8JA 1QBJA 4C3JJ 3FM3A 4C2MJ 3FDYA 5F6FA 1UG0A 3P9CA 4IHYA 4OD5A 3BPXA 1Q1HA 2FOKA 2K9MA 2LG4A 4BQNA 1VQ6I 2DFFA 4HG2A 2PMUA 1T98A 3BPVA 3ROUA 4I99C 2FQ3A 5M5WJ 2ZSIB 1MNDA 3SEQA 1Z7UA 1Y0UA 4BQOA 1OLTA 1P7IA 3HRMA 1I3QJ 1FBQA 3A01A 2RREA 3G2BA 4G6TB 2K85A 4B4CA 4RB0A 1XDSA 3VW2A 2F5EA 4L9VA 1RR8C 2NXNB 2GXAA 2EPFA 1FOYA 2WV0A 1AOYA 3CO6C 1JGSA 1DP7P 3L2CA 3LSKA 2UXOA 5EFYA 2NS0A 4RBOA 3HSEA 2ADUA 3S16J 1Z7LA 3EDPA 5KNLA 4RB2C 5LD2C 5BPDA 2DA3A 4LJZF 3IAS2 2NAZA 4EJUA 3O60A 3BTIA 4G6DA 4II2A 3OIOA 1G2HA 2JUGA 3A4CA 3DFGA 2G7SA 4WWCA 2ZXIA 4A6EA 2EA2A 1O3SA 3JSOA 3RDIA 2XRNA 2QM3A 1LNWA 2RKHA 4PSXA 4XSZF 2KRFA 1S7OA 2DFEA 1I27A 2K7LA 2V6CA 2ME0A 2Z2SB 4Y13A 1DP3A 1X1DA 2FE3A 1LKXA 1WZ2A 2B0LA 3H9QA 4A12A 1HKTA 4IHXA 3BLYA 2COBA 3I56I 3BTLA 2IRFG 2WV1A 2A2FX 2CJJA 3PASA 1R36A 4HV6A 4Y17A 4S0HB 1SANA 2OPTA 1ON1A 3DP7A 4M3FA 5LRSA 1JKOC 2LKPA 5CQGA 3LNQA 2VQHA 2NVXJ 2FUG2 4AUXA 5ILVA 3J80K 1LQ1A 4ENMA 1SC7A 2VLAA 1H8AC 3KP4A 1ZRCA 5EF6A 3EETA 3IH4A 3IRRA 3H9GA 4RAZA 4HAMA 3P9IA 2LLKA 1JJ8C 1MSFC 3G3ZA 4OIQF 3HTIA 3FMRA 1KQ0A 1D0XA 4KISA 3CF5F 3MN2A 2EV0A 1YW7A 3D5LA 3HHHA 4OAYA 5EEHA 5GTHC 3ML6A 1FPQA 3AAFA 2VKVA 3LWJA 1B4AA 1HKQA 1D3YA 2GA1A 4BGDA 4G7ZF 3GLLA 1LE8A 1USSA 1Z0XA 5FMPA 2XDNA 2HDCA 1NH3A 3CO7C 1LDJA 4I02A 3QP5A 4IOCF 2WC2A 2JRMA 4EM2A 1QVTA 3PPBA 2E2IJ 3GTJJ 4ABZA 1RC9A 2XVCA 4IVNA 3IAM2 4D1QA 1UI6A 3NS4A 2OBPA 3VPRA 4BL0B 4HNVA 4AF5A 2CFOA 2Y75A 3FBNB 1QPMA 1ZAOA 3VSLA 5BOXA 2YVEA 4FE4A 3QBMA 4ZDOA 5IOYA 1CF7A 5EGOA 3BQZA 1U8BA 2ZMEA 4DQ2A 5L3CA 1VFCA 2VN2A 1MJBA 1YX3A 1TQMA 1E2XA 2R7VA 1MDMA 5DD8A 3NQOA 5EG0B 2Y69H 5JI6A 3R4KA 5FKKA 2A07F 3JRDA 2LMDA 2GWRA 1E3PA 5FB2A 1WJ5A 2JVGA 1MH3A 3K4CA 2O3FA 4RB3C 1Z6TA 1R00A 3COAC 4EGYA 1XGSA 1JTYA 3C1DA 4BEHB 4C9YA 1F1ZA 2R0QC 3EGQA 4DNCA 5C4XJ 1CGPA 3IKTA 1T2KA 1NK2P 2O7TA 1E17A 2XDVA 3S17J 2A68F 4L0ZB 3BWGA 4XSXF 2UXNA 2YS9A 3HSRA 2M4GA 2EV6A 4HYEA 3ZOBA 3CF2A 1VQPI 1R5HA 1OYYA 4HOBA 4N9IA 4RDUA 2XSJC 4E7HA 3EUHA 4E4HA 4GDFA 2Q2EA 2VJ4A 2GM4A 2NVTJ 5IP6A 3F6OA 2XROA 3J7AO 2RNJA 4V19K 2M45A 2ESHA 3TMOA 1E3HA 4C2TA 1RUNA 1W5CC 3RH2A 2XPVA 4JP0A 3L00A 4PDKA 3PL8A 3TOAA 5D4SA 3E7QA 3FK7A 5F1RA 4YFNF 1Y1WJ 1DUXC 2JN6A 2CW0F 5J6XA 2JMWA 2H6BA 1JT0A 3CCQI 3BY6A 2OC6A 4XR6A 2R5YB 1YHQI 2CS3A 2H6CA 1GDTA 4DYQA 5A2QZ 3QWLA 2WAFA 2XAQA 3H0GJ 3OR1C 3ON4A 4FCYA 2ZCWA 1MBJA 3E5UA 5D8KB 1ETQA 3V7RA 3FK6A 1WVRA 1W0TA 5HAWA 2LNBA 4Y15A 2HYGD 4ZDLA 2RDPA 1IXSB 3GXOA 4P55A 4BNCA 2UXPA 2EIKH 3GLXA 2YR2A 1S7AA 2ACJA 3VOEA 4BQQA 2JPBA 2HDWA 5EJCA 1JT6A 1UG2A 3U9GA 4F92B 2R7RA 4A5NA 2CQNA 4MK6A 4D5CA 3OYEA 5J40A 1RRJA 2HEOA 4Y4RA 3SZTA 4ZYHA 1ITYA 3ABMH 1D8KA 4CCKA 1LDDA 3OL3A 2Q0OA 2IU5A 2K3FA 2P8TA 3JREA 1V4RA 1YS7A 1HSTA 1N78A 1IRZA 1XGOA 2J5PA 4HLXA 2MLGA 2B7EA 2WB1A 4ACIA 3ASNH 3C2BA 1O57A 1B72B 2BZTA 3LFKA 2DN0A 4UVAA 4YIRX 6PAXA 3BT9A 4NBQA 5M3FJ 4P5OA 3NARA 5AIQA 1QVUA 1KZHA 3CCEI 1DDNA 4M6VA 2X6OA 3F22A 4U7DA 4YIIA 1A36A 5BQTA 2W85A 4HEA2 4XK4A 1UHWA 3KZZA 3CUQA 3M4OJ 1R71A 2K9QA 2M3AA 1G6NA 2VJ5A 2PJRA 1OYIA 3OYGA 2AQFA 1YRNA 2F07A 4YG2F 2XAJA 2NX4A 2HGCA 1XTAA 3KETA 2PG4A 2F2EA 5TGTA 1IV6A 5LEKA 4OOIA 1WQ2A 4LK1F 1QZYA 5B1BH 5IOZA 2VXZA 4GO1A 4A3LJ 1R4MB 2MFZA 4CA0A 1MNEA 1Z3YA 2K4BA 5DCMA 1U5TC 5B66C 4OAZA 4JK1X 3QP6A 3WTTC 1ETVA 2K4JA 3OIPA 1DPUA 5F27A 2LFBA 1VF9A 2X1CA 3VUQA 3I53A 3JTHA 4M3EA 3VW1A 2UXXA 4HX4A 2VQGA 3PFYA 4HX8A 2TDXA 1G4DA 1JUSA 4OIRF 2QEXI 2R5ZB 5IP7J 3MCZA 3HTSB 3M7GA 2G9WA 1Z3XA 2OD5A 2R93J 2FJI1 3P5JA 3SFZA 2DAOA 4BHCA 4I0BA 5E3LA 2VBZA 2EFWA 4OD4A 4IZZA 4XLFA 2NS8A 2F4MB 2L5QA 3VVZA 3GWZA 1O4XA 3UKGA 4OWRB 2JWTA 2ZKZA 1LJ9A 1OR7A 1S72I 1D0YA 1MBEA 2X4HA 3KP5A 3QU6A 1YIOA 2HTSA 2XKPA 1BC7C 3KE2A 2IEKA 2O61A 3KEOA 3ZQQA 1BR2A 1EH8A 3LA3A 4M73A 4RGXA 3ZQGA 4YFXF 5HNHA 1I1SA 2DOAA 1SFOJ 3GTOJ 1FEXA 2D1VA 1HLVA 4CXFA 2FNAA 2X6WA 2ME6A 3TEDA 2M0MA 2R7UA 1ERDA 1EF4A 1T0FA 2IA2A 4QPQA 2LDUA 1HXDA 2FX0A 1NK3P 5FKLA 3IKVA 1JUPA 4I98B 2K9LA 2VI6A 3L7WA 5LEJA 3S1MJ 5JHFA 3E97A 3HUGB 2FBIA 4KIBA 1BW5A 3C2HA 3IWFA 1IUFA 3F8NA 2AHQA 3S15J 3EYYA 2A6TA 3HEFA 5CXGA 1L0OC 2PMZN 2QQAA 1SMTA 2CMPA 2LKXA 3BTCA 4F3QA 2VBWA 3F6VA 2FMYA 4DW6A 1GVJA 4KIFA 1KQ8A 4AC6A 2HOTA 5DM7F 1YW9A 1FWZA 5A2QK 1U6GA 4CUGA 2JT1A 2KJBA 1TWFJ 3L2QA 1YG2A 1Y39A 5DUKA 2TCTA 1HA8A 3Q0UA 4XKWA 2FEZA 3RCOA 3VFZA 3BG3A 2XF5A 3JRHA 5HBUA 1TNTA 4IRGA 4DJAA 3GTLJ 2HDDA 3BCAA 4KN4X 1DGRM 3FXLA 2ELHA 1S5LC 2ZXJA 1P4AA 2CO5A 2IT0A 3CJRB 1DQUA 2FSWA 2EQRA 2J5OA 4UB8C 1MKMA 3I55I 3BQYA 5D5VB 5BS6A 2K9SA 5LGNA 4IHTA 3U1DA 3FM5A 3LSJA 3GZ5A 1VQNI 4CGZA 3KP6A 4KMUX 3PFIA 2Y0SN 4KJZA 2DMPA 4AD9A 2ECBA 1XC5A 4E70A 2GENA 3FHZA 2G7HA 4A3MJ 3SHFA 2QENA 1WJCA 2ZO4A 1RR7A 1A04A 3K69A 3LQRA 3NEUA 2DA1A 4BBRJ 5LHGA 1VQ4I 2OZUA 3WODF 3KYCB 4Y52J 3E6BA 3IP4B 3WTUC 1JI8A 2ZY9A 3VVYA 4CCMA 4Q47A 3TO7A 3DLLF 1E0EA 3DQVC 3K7AJ 3B81A 4BH9A 4XONA 4DBRA 2VODA 2CH0A 2ZMEC 2LRDA 1SFKA 2RQPA 4IPAA 4IQ4A 1PUFB 3S32A 4NN1A 2W4SA 1QPIA 5JVGF 2Q8KA 3A0BC 3HPHA 2OZ6A 2BW3A 1LVAA 1FBSA 4R79A 1BM9A 3M8FA 4ZYEA 4HA8A 4B09A 3A2KA 1U2WA 4A0XA 4O3MA 2VKDA 2IJLA 4UVCA 2MW8A 2GFNA 3R0JA 4ETSA 2MD5A 1HBXG 4LLLA 1O3RA 4BXFA 1AWCA 1ZTRA 4KWAA 4Q48A 1YO5C 3PUFA 5FGMA 4E7JA 2WY7Q 2VT2A 4G94A 2HZDA 1Z77A 4AYBN 3PNYA 4CDGA 4BU2A 3DU5A 4HPQA 2V57A 2GA2A 3HIFA 3J7AY 1HCRA 5ILUA 1VQ7I 2VT3A 1V5FA 3BR0A 4QPOA 4EQQA 3IV5A 2WY8Q 3EUHC 4MHGA 3SDBA 1JKQC 1IUYA 2OF7A 1J59A 1ZLJA 2DTRA 1WH7A 3LSHA 1ETYA 3D0SA 5KAFC 1OKRA 4P1WA 2WA0A 2VJJA 5DTDA 1V55H 2QQBA 1XB4A 5GAGJ 3GVAA 2P7VB 3GEUA 2UZKA 2QWWA 2CQQA 4BY1J 1MMSA 4MQVA 2BY2A 2X85A 5DYMA 3V42A 2M4KA 2QBYB 2EZIA 4XQFA 5ICEA 4A3FJ 3GBGA 4OMYA 1BIAA 3J80Z 3C18A 2Z16A 1WRJA 5J4VA 2F5VA 4GGGA 1GVDA 4RB1A 4IJAA 2M8EA 1K4SA 2KP6A 2H8RA 3RYRA 2VBXA 1HQCA 3IH2A 4B8XA 2OCCH 1ODDA 3FRQA 3W6VA 1UJ8A 3ZMVA 3LMMA 4OIPF 1YW8A 2DTZA 3ZN1A 4AIDA 4IHSA 3CTAA 1VQOI 1YITI 1KGSA 3VYSB 2LY1A 1O3TA 2EFQA 2CQXA 2R7DA 2UV1A 2BY0A 2LSOA 2MLKA 3GFJA 3T8TA 1WGXA 4MNUA 2CG4A 4LLNA 4ZTJA 3CCLI 3HRTA 3U21A 5F08A 3G71I 2B63J 1S7EA 3PIPF 4PCQA 4HQEA 2OCEA 5LLQA 4EJTA 4GFKA 1S9HA 1XMKA 5E3MA 2V1DA 2I8DA 2F4OB 1J7KA 1LPQA 2W1OA 4NQWB 1P9QC 3DEUA 4HLYA 2DYSH 2MSYA 1IRXA 1IN5A 2P4WA 4A2UA 2LBFB 4XOPA 3CUQC 2IGOA 2BXZA 3M8JA 3SZGA 3V8KA 3EQLF 5HNFA 1TTYA 5L3FA 4HV5A 2EWNA 4M9ZA 2RAEA 1IZ1A 2A5WA 2XF6A 2DG8A 2RV8A 2KLOA 4FISA 4CSWA 3MAJA 1VQ8I 2MC3A 4XKVA 2EIJH 2KZVA 2M7AA 4NC6A 4EATA 2E1MC 3JR9A 2DLLA 2HI3A 2ZJPF 4G7HF 3AL0B 2EK5A 2HTJA 4HDVA 1FY7A 1X4OA 3KX2A 1X1AA 2VC0A 3ZMUA 2V1NA 3BRUA 3MEXA 1WI3A 4NC7A 3CWRA 1R23A 5IP9J 3LSPA 2DA6A 4F91B 2OAZA 5LBQA 3OYFA 1ZGJA
chains in the Genus database with same CATH topology
2KDZA 3F1BA 1JTYA 5EG0A 3JRGA 2Y31A 2R0QC 2NOGA 3EGQA 5C4XJ 2XGEA 4W1UA 3LHQA 5FLVA 1X58A 1NK2P 2O7TA 1APLC 2EBIA 3S17J 3NNRA 3BR3A 5F0CA 4JNNA 4D7MA 5BNGA 2JK3A 5DS9A 2YS9A 5C44J 2N8GA 2YUSA 3ZOBA 3FKIJ 1ZR4A 5DAJA 2LD5A 1F36A 2VPRA 4RDUA 5M3MJ 1HDPA 2LR8A 4QSHA 3OSGA 1VI0A 2L0KA 2E2JJ 2GM4A 2NVTJ 2EZLA 3GTKJ 4MFDA 2CUFA 5IP6A 3JRBA 5E3OA 4LOCA 2HKUA 1BA5A 1ORKA 2WGBA 3RH2A 1OCPA 2XPVA 4JP0A 4QTRA 3RD3A 1OJLA 1IC8A 3E7QA 3FK7A 3GZIA 1Y1WJ 2G3BA 3CDLA 2JN6A 2JMWA 1JT0A 5FKNA 2LTPA 3WHBA 5F04A 2ZCXA 1H88C 4A3CJ 4B1RA 2LVSA 2M34A 2R5YB 4IHWA 4BKXA 1GDTA 4DYQA 2ZOZA 2G0EA 3M3YJ 4X6AJ 5FKMA 5D18A 1JKRC 3G7RA 1LFBA 1B8IB 4EEFG 3H0GJ 3C07A 2X9DA 3ON4A 3VP5A 2R5YA 4FCYA 1MBJA 2QCOA 1ETQA 2NP5A 3FK6A 2Y30A 1W0TA 5HAWA 3BG5A 3BR6A 3KZ9A 3HBLA 2M9HA 1ETKA 1JGGA 2OERA 1B8IA 5J1YA 2G7GA 2UXPA 1U9NA 2RASA 3RQIA 5J1RA 3RZOJ 3JRAA 1FTZA 1JT6A 1UG2A 2Y9YA 4MLOA 3LJLA 2QF7A 2QIBA 2JA5J 1FIAA 4D5CA 4MK6A 5FGLA 1JJ6C 1ITYA 2Y9ZA 3HKZN 2IU5A 3LSGA 5FJ8J 3JREA 1UHSA 1MH4A 3HOUJ 1IRZA 5F0HA 3FIWA 3Q0WA 1K61A 1I6HJ 3RKQA 2GLOA 4GFBA 4HKUA 3NRGA 4ACIA 4C3HJ 3C2BA 1JUMA 3S1NJ 1B72B 2NVYJ 1AKHB 2DN0A 1TWHJ 1XS9A 2DG7A 2REKA 3BT9A 5M3FJ 3NARA 4QIWN 2DMUA 4IEJA 1QVUA 2HOAA 3ZQCA 1LFUP 5C4YA 4M6VA 2X6OA 3T6NA 1YRNB 5EYRA 4XK4A 1IDZA 4XIDA 1B72A 3M4OJ 3S2HJ 3E7LA 5GP9A 5D1RA 4BBSJ 2K9QA 1CQTA 1OFCX 1TWCJ 3HOWJ 3V78A 1ENHA 3OOUA 1AU7A 2FJ1A 1YRNA 2F07A 3G1LA 2NX4A 5F0FA 3B6AA 5CW8A 3GTGJ 4NELA 3VW0A 1IV6A 1UMQA 2MG4A 2H1KA 2R7ZJ 1I50J 1BJZA 3O8GA 4M3GA 2LY9A 5IOZA 3S1RJ 3K2AA 4A3LJ 3AQTA 3ANPA 3GTPJ 3CQZJ 2XPWA 3HOZJ 3QKXA 5EEAA 3A03A 3VIBA 1VNDA 4FE7A 2M8GX 1ETVA 5J3LA 4MFEA 3HTHA 5F27A 2LFBA 1VF9A 2E2HJ 4GCTA 1RESA 3GTQJ 4A3BJ 3G1OA 3VUQA 3WHCA 2ZCMA 4YZEA 2HQ5A 3JRIA 2RHAA 3F0CA 4M3EA 3VW1A 2ZOYA 2FBQA 2Y2ZA 2PBXA 3DEWA 3TW7A 3QPSA 1GT0C 2L9RA 5JLXA 1JUSA 2R5ZB 3PM1A 4XICA 5IP7J 3BNIA 3DPJA 3I4MJ 2R93J 5K58A 3NXCA 5IYBJ 1U9OA 2XGDA 1ETWA 3NAUA 5E3LA 4DYRA 3HE0A 1TWAJ 2ECCA 4X1EA 3VVZA 2NS8A 2R5ZA 3ZQHA 3HOVJ 1O4XA 3UKGA 2CU7A 2JWTA 1FTTA 2LP0A 3COLA 2K40A 3SDGA 1RETA 3JRFA 2YVHA 1MBEA 2GUHA 3BCGA 2XPUA 3BR1A 1ETXA 5HSZA 1GUUA 3BTJA 4A3JJ 2IEKA 3HOXJ 5IYCJ 2KT0A 3A02A 1QRYA 3ZQGA 4JL3A 5F1JA 3VVXA 4UDSA 2JA7J 1SFOJ 3GTOJ 1FEXA 3VOXA 3CJDA 1HLVA 2IBDA 5FLMJ 2ME6A 3TEDA 4ICHA 3KNWA 1EF4A 2NS7A 4M3DA 3DCFA 1OCTC 2G7LA 5AQCA 2GBYA 3RZDJ 1TWGJ 1ZGWA 1MBFA 1NK3P 4DZPA 2FX0A 5FKLA 2HXIA 4BXXJ 3MVPA 1JUPA 2VI6A 4AC0A 1DU0A 3S1MJ 1AHDP 1BW5A 2E1OA 2L7ZA 3TP0A 2QOPA 3S2DJ 4PXIA 1IUFA 1HOMA 2Q24A 3IUVA 2HYTA 2DA7A 4XRSG 3HTAA 2AHQA 2DJNA 3S15J 3H3VK 1WCMJ 2AO9A 3HEFA 5CXGA 2EH3A 2MGQA 2PMZN 1RKTA 2XGCA 3MNLA 2LKXA 2VUMJ 2FD5A 2CUEA 3BTCA 3ZQIA 4GCKA 4DW6A 3HOYJ 4AC6A 2IAIA 1X2NA 3IH3A 2DMTA 2D6YA 2HOTA 3HDDA 4DYCA 3VOKA 3ZQFA 3CMYA 1E3OC 1TWFJ 5D19A 4L5EA 2TCTA 5K7HA 1W0UA 3Q0UA 4I6ZA 2ID3A 4JYKA 3B6CA 5M5YJ 3HGGA 1K83J 3BG3A 4V2GA 3JRHA 5HBUA 3GTLJ 2UXHA 3ZQLA 2HDDA 4A93J 3BJBA 4C3IJ 2JA8J 1GV5A 4CGRA 3TW6A 2EQRA 5C3EJ 4A3KJ 5IYDJ 2QWTA 2FQ4A 3BQYA 3PO2J 2K9SA 3CCYA 1AKHA 3LSJA 4V2FA 1DU6A 1IGNA 2HOSA 4W97A 1X2MA 1UI5A 1RKWA 2ZB9A 3FISA 3QPLA 2Y0SN 4BY7J 3NI7A 2DMPA 2ECBA 1XC5A 3AQSA 2GENA 3EUPA 4A3MJ 2HYJA 1MSEC 2XSDC 1RR7A 1GV2A 1Q1VA 2X48A 4L62A 4BBRJ 3NPIA 2DA1A 3ANGA 3OSFA 4MO7A 4Y52J 2L7MP 3VVYA 4JX6A 1U78A 1MBGA 5EZGA 2ELKA 3K7AJ 3S1QJ 3B81A 1POGA 1P7JA 3SFIA 3HM5A 1PUFB 1MBKA 3CRJA 4GFLA 2K9NA 4NN1A 2QTQA 1QPIA 9ANTA 5EZHA 1ZK8A 2DA5A 2O8KA 3D1NI 4C3JJ 1MNMC 4C2MJ 3V6GA 4B3AA 2QKOA 1T56A 1PUFA 4IHYA 1RPWA 2DA4A 4FTHA 5H9TA 2E19A 2MW8A 2EZKA 2GFNA 1MBHA 4GCLA 1BW6A 1ZR2A 4UUTA 1ZTRA 3O8HA 4D7NA 2W53A 4KWAA 2DA2A 3A01B 4Y7NJ 1Z77A 4AYBN 1HDDC 5M5WJ 3HGYA 2M2EA 2V57A 1F43A 1P7IA 5FHPA 4A3DJ 1I3QJ 2W48A 1HCRA 5M5XJ 3A01A 1ZKGA 1JTXA 3BR0A 3IV5A 3G56A 4B4CA 2R92J 1JKQC 2PZ9A 1R9TJ 3VW2A 3I4NJ 2OF7A 1WH7A 5J1UA 1ETYA 3S5RA 2UXOA 5EFYA 4RBOA 2UXUA 3KKDA 1JKPC 1SGMA 5DTDA 3SJMA 3S16J 2ID6A 2DA3A 4J19A 2TRTA 3O60A 3GEUA 3BTIA 2JJ7A 3PO3J 1XG1A 4JX5A 3OIOA 1G2HA 2CQQA 4XRMA 4BY1J 1IJWC 3ON2A 2G7SA 3TP3A 4A3IJ 2EZIA 4A3FJ 3GBGA 1D5YA 4MIMA 1GVDA 1T33A 5GPAA 1BL0A 2H8RA 3IH2A 2M0CA 3Q0VA 4DZJA 2ME0A 2OI8A 5C4JJ 3FRQA 3W6VA 3P9TA 4IHXA 2CRGA 2COBA 3Q3SA 3BTLA 4M3BA 2WV1A 2LK2A 2WUIA 2CJJA 2DTZA 1TC3C 4S0HB 2NP3A 3PASA 1SANA 2OPTA 3BR5A 4M3FA 4A3GJ 1ETOA 1JKOC 3JRCA 3LNQA 2NVXJ 4AUXA 2CQXA 2P81A 3QQAA 1WGXA 3BG9A 1H8AC 1WPKA 2O7OA 2HXOA 1WH5A 5EF6A 2WB1N 3IH4A 4A69C 5F08A 2B63J 1S7EA 2LLKA 5HODA 1JJ8C 2YU9J 3HIMA 1MSFC 5E3NA 3HTIA 4GFKA 2UXIA 5E3MA 5IPAA 3LOCA 3L1PA 1LE8B 3MN2A 4XRSA 1A6IA 2MSYA 4NDLA 5K7ZA 5FKOA 3HTJA 2VKVA 3LWJA 1NTCA 1LE8A 1IG7A 2XB0X 1Z0XA 3MKLA 5JLWA 2XDNA 5FMPA 2DMNA 2RAEA 1FJLA 3GTMJ 4I76A 4JX4A 2DG8A 4JKZA 2XB5A 4CYCB 2D5VA 2NVQJ 2O9LA 4FISA 1QVTA 3PPBA 2E2IJ 3GTJJ 4ABZA 1H89C 1Y1VJ 1UI6A 5EGOB 3S14J 5K7FA 5GPCA 4IHVA 3VPRA 4HNVA 4AF5A 2JA6J 4CYCA 2ZCNA 4D5FA 2YVEA 3BR2A 4FE4A 2HI3A 3JR9A 1ZQ3P 3HB9A 3QBMA 2EZHA 2L7FP 5IOYA 5EDNA 2I10A 5EGOA 2XRLA 3BQZA 1U8BA 4UUSB 1VFCA 1HF0A 3G1MA 3JSJA 4MXMA 4G12A 2VKEA 3KKCA 3LSRA 4ME9A 2WAQN 3BRUA 1WI3A 5EG0B 1FIPA 3CWRA 2DMQA 5FKKA 1IDYA 5IP9J 3JRDA 3BHQA 3LSPA 5CXIA 2DA6A 4UUSA 1MH3A 1A5JA 4A3EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDZ A;  3F1B A;  1JTY A;  5EG0 A;  3JRG A;  2Y31 A;  2R0Q C;  2NOG A;  3EGQ A;  5C4X J;  2XGE A;  4W1U A;  3LHQ A;  5FLV A;  1X58 A;  1NK2 P;  2O7T A;  1APL C;  2EBI A;  3S17 J;  3NNR A;  3BR3 A;  5F0C A;  4JNN A;  4D7M A;  5BNG A;  2JK3 A;  5DS9 A;  2YS9 A;  5C44 J;  2N8G A;  2YUS A;  3ZOB A;  3FKI J;  1ZR4 A;  5DAJ A;  2LD5 A;  1F36 A;  2VPR A;  4RDU A;  5M3M J;  1HDP A;  2LR8 A;  4QSH A;  3OSG A;  1VI0 A;  2L0K A;  2E2J J;  2GM4 A;  2NVT J;  2EZL A;  3GTK J;  4MFD A;  2CUF A;  5IP6 A;  3JRB A;  5E3O A;  4LOC A;  2HKU A;  1BA5 A;  1ORK A;  2WGB A;  3RH2 A;  1OCP A;  2XPV A;  4JP0 A;  4QTR A;  3RD3 A;  1OJL A;  1IC8 A;  3E7Q A;  3FK7 A;  3GZI A;  1Y1W J;  2G3B A;  3CDL A;  2JN6 A;  2JMW A;  1JT0 A;  5FKN A;  2LTP A;  3WHB A;  5F04 A;  2ZCX A;  1H88 C;  4A3C J;  4B1R A;  2LVS A;  2M34 A;  2R5Y B;  4IHW A;  4BKX A;  1GDT A;  4DYQ A;  2ZOZ A;  2G0E A;  3M3Y J;  4X6A J;  5FKM A;  5D18 A;  1JKR C;  3G7R A;  1LFB A;  1B8I B;  4EEF G;  3H0G J;  3C07 A;  2X9D A;  3ON4 A;  3VP5 A;  2R5Y A;  4FCY A;  1MBJ A;  2QCO A;  1ETQ A;  2NP5 A;  3FK6 A;  2Y30 A;  1W0T A;  5HAW A;  3BG5 A;  3BR6 A;  3KZ9 A;  3HBL A;  2M9H A;  1ETK A;  1JGG A;  2OER A;  1B8I A;  5J1Y A;  2G7G A;  2UXP A;  1U9N A;  2RAS A;  3RQI A;  5J1R A;  3RZO J;  3JRA A;  1FTZ A;  1JT6 A;  1UG2 A;  2Y9Y A;  4MLO A;  3LJL A;  2QF7 A;  2QIB A;  2JA5 J;  1FIA A;  4D5C A;  4MK6 A;  5FGL A;  1JJ6 C;  1ITY A;  2Y9Z A;  3HKZ N;  2IU5 A;  3LSG A;  5FJ8 J;  3JRE A;  1UHS A;  1MH4 A;  3HOU J;  1IRZ A;  5F0H A;  3FIW A;  3Q0W A;  1K61 A;  1I6H J;  3RKQ A;  2GLO A;  4GFB A;  4HKU A;  3NRG A;  4ACI A;  4C3H J;  3C2B A;  1JUM A;  3S1N J;  1B72 B;  2NVY J;  1AKH B;  2DN0 A;  1TWH J;  1XS9 A;  2DG7 A;  2REK A;  3BT9 A;  5M3F J;  3NAR A;  4QIW N;  2DMU A;  4IEJ A;  1QVU A;  2HOA A;  3ZQC A;  1LFU P;  5C4Y A;  4M6V A;  2X6O A;  3T6N A;  1YRN B;  5EYR A;  4XK4 A;  1IDZ A;  4XID A;  1B72 A;  3M4O J;  3S2H J;  3E7L A;  5GP9 A;  5D1R A;  4BBS J;  2K9Q A;  1CQT A;  1OFC X;  1TWC J;  3HOW J;  3V78 A;  1ENH A;  3OOU A;  1AU7 A;  2FJ1 A;  1YRN A;  2F07 A;  3G1L A;  2NX4 A;  5F0F A;  3B6A A;  5CW8 A;  3GTG J;  4NEL A;  3VW0 A;  1IV6 A;  1UMQ A;  2MG4 A;  2H1K A;  2R7Z J;  1I50 J;  1BJZ A;  3O8G A;  4M3G A;  2LY9 A;  5IOZ A;  3S1R J;  3K2A A;  4A3L J;  3AQT A;  3ANP A;  3GTP J;  3CQZ J;  2XPW A;  3HOZ J;  3QKX A;  5EEA A;  3A03 A;  3VIB A;  1VND A;  4FE7 A;  2M8G X;  1ETV A;  5J3L A;  4MFE A;  3HTH A;  5F27 A;  2LFB A;  1VF9 A;  2E2H J;  4GCT A;  1RES A;  3GTQ J;  4A3B J;  3G1O A;  3VUQ A;  3WHC A;  2ZCM A;  4YZE A;  2HQ5 A;  3JRI A;  2RHA A;  3F0C A;  4M3E A;  3VW1 A;  2ZOY A;  2FBQ A;  2Y2Z A;  2PBX A;  3DEW A;  3TW7 A;  3QPS A;  1GT0 C;  2L9R A;  5JLX A;  1JUS A;  2R5Z B;  3PM1 A;  4XIC A;  5IP7 J;  3BNI A;  3DPJ A;  3I4M J;  2R93 J;  5K58 A;  3NXC A;  5IYB J;  1U9O A;  2XGD A;  1ETW A;  3NAU A;  5E3L A;  4DYR A;  3HE0 A;  1TWA J;  2ECC A;  4X1E A;  3VVZ A;  2NS8 A;  2R5Z A;  3ZQH A;  3HOV J;  1O4X A;  3UKG A;  2CU7 A;  2JWT A;  1FTT A;  2LP0 A;  3COL A;  2K40 A;  3SDG A;  1RET A;  3JRF A;  2YVH A;  1MBE A;  2GUH A;  3BCG A;  2XPU A;  3BR1 A;  1ETX A;  5HSZ A;  1GUU A;  3BTJ A;  4A3J J;  2IEK A;  3HOX J;  5IYC J;  2KT0 A;  3A02 A;  1QRY A;  3ZQG A;  4JL3 A;  5F1J A;  3VVX A;  4UDS A;  2JA7 J;  1SFO J;  3GTO J;  1FEX A;  3VOX A;  3CJD A;  1HLV A;  2IBD A;  5FLM J;  2ME6 A;  3TED A;  4ICH A;  3KNW A;  1EF4 A;  2NS7 A;  4M3D A;  3DCF A;  1OCT C;  2G7L A;  5AQC A;  2GBY A;  3RZD J;  1TWG J;  1ZGW A;  1MBF A;  1NK3 P;  4DZP A;  2FX0 A;  5FKL A;  2HXI A;  4BXX J;  3MVP A;  1JUP A;  2VI6 A;  4AC0 A;  1DU0 A;  3S1M J;  1AHD P;  1BW5 A;  2E1O A;  2L7Z A;  3TP0 A;  2QOP A;  3S2D J;  4PXI A;  1IUF A;  1HOM A;  2Q24 A;  3IUV A;  2HYT A;  2DA7 A;  4XRS G;  3HTA A;  2AHQ A;  2DJN A;  3S15 J;  3H3V K;  1WCM J;  2AO9 A;  3HEF A;  5CXG A;  2EH3 A;  2MGQ A;  2PMZ N;  1RKT A;  2XGC A;  3MNL A;  2LKX A;  2VUM J;  2FD5 A;  2CUE A;  3BTC A;  3ZQI A;  4GCK A;  4DW6 A;  3HOY J;  4AC6 A;  2IAI A;  1X2N A;  3IH3 A;  2DMT A;  2D6Y A;  2HOT A;  3HDD A;  4DYC A;  3VOK A;  3ZQF A;  3CMY A;  1E3O C;  1TWF J;  5D19 A;  4L5E A;  2TCT A;  5K7H A;  1W0U A;  3Q0U A;  4I6Z A;  2ID3 A;  4JYK A;  3B6C A;  5M5Y J;  3HGG A;  1K83 J;  3BG3 A;  4V2G A;  3JRH A;  5HBU A;  3GTL J;  2UXH A;  3ZQL A;  2HDD A;  4A93 J;  3BJB A;  4C3I J;  2JA8 J;  1GV5 A;  4CGR A;  3TW6 A;  2EQR A;  5C3E J;  4A3K J;  5IYD J;  2QWT A;  2FQ4 A;  3BQY A;  3PO2 J;  2K9S A;  3CCY A;  1AKH A;  3LSJ A;  4V2F A;  1DU6 A;  1IGN A;  2HOS A;  4W97 A;  1X2M A;  1UI5 A;  1RKW A;  2ZB9 A;  3FIS A;  3QPL A;  2Y0S N;  4BY7 J;  3NI7 A;  2DMP A;  2ECB A;  1XC5 A;  3AQS A;  2GEN A;  3EUP A;  4A3M J;  2HYJ A;  1MSE C;  2XSD C;  1RR7 A;  1GV2 A;  1Q1V A;  2X48 A;  4L62 A;  4BBR J;  3NPI A;  2DA1 A;  3ANG A;  3OSF A;  4MO7 A;  4Y52 J;  2L7M P;  3VVY A;  4JX6 A;  1U78 A;  1MBG A;  5EZG A;  2ELK A;  3K7A J;  3S1Q J;  3B81 A;  1POG A;  1P7J A;  3SFI A;  3HM5 A;  1PUF B;  1MBK A;  3CRJ A;  4GFL A;  2K9N A;  4NN1 A;  2QTQ A;  1QPI A;  9ANT A;  5EZH A;  1ZK8 A;  2DA5 A;  2O8K A;  3D1N I;  4C3J J;  1MNM C;  4C2M J;  3V6G A;  4B3A A;  2QKO A;  1T56 A;  1PUF A;  4IHY A;  1RPW A;  2DA4 A;  4FTH A;  5H9T A;  2E19 A;  2MW8 A;  2EZK A;  2GFN A;  1MBH A;  4GCL A;  1BW6 A;  1ZR2 A;  4UUT A;  1ZTR A;  3O8H A;  4D7N A;  2W53 A;  4KWA A;  2DA2 A;  3A01 B;  4Y7N J;  1Z77 A;  4AYB N;  1HDD C;  5M5W J;  3HGY A;  2M2E A;  2V57 A;  1F43 A;  1P7I A;  5FHP A;  4A3D J;  1I3Q J;  2W48 A;  1HCR A;  5M5X J;  3A01 A;  1ZKG A;  1JTX A;  3BR0 A;  3IV5 A;  3G56 A;  4B4C A;  2R92 J;  1JKQ C;  2PZ9 A;  1R9T J;  3VW2 A;  3I4N J;  2OF7 A;  1WH7 A;  5J1U A;  1ETY A;  3S5R A;  2UXO A;  5EFY A;  4RBO A;  2UXU A;  3KKD A;  1JKP C;  1SGM A;  5DTD A;  3SJM A;  3S16 J;  2ID6 A;  2DA3 A;  4J19 A;  2TRT A;  3O60 A;  3GEU A;  3BTI A;  2JJ7 A;  3PO3 J;  1XG1 A;  4JX5 A;  3OIO A;  1G2H A;  2CQQ A;  4XRM A;  4BY1 J;  1IJW C;  3ON2 A;  2G7S A;  3TP3 A;  4A3I J;  2EZI A;  4A3F J;  3GBG A;  1D5Y A;  4MIM A;  1GVD A;  1T33 A;  5GPA A;  1BL0 A;  2H8R A;  3IH2 A;  2M0C A;  3Q0V A;  4DZJ A;  2ME0 A;  2OI8 A;  5C4J J;  3FRQ A;  3W6V A;  3P9T A;  4IHX A;  2CRG A;  2COB A;  3Q3S A;  3BTL A;  4M3B A;  2WV1 A;  2LK2 A;  2WUI A;  2CJJ A;  2DTZ A;  1TC3 C;  4S0H B;  2NP3 A;  3PAS A;  1SAN A;  2OPT A;  3BR5 A;  4M3F A;  4A3G J;  1ETO A;  1JKO C;  3JRC A;  3LNQ A;  2NVX J;  4AUX A;  2CQX A;  2P81 A;  3QQA A;  1WGX A;  3BG9 A;  1H8A C;  1WPK A;  2O7O A;  2HXO A;  1WH5 A;  5EF6 A;  2WB1 N;  3IH4 A;  4A69 C;  5F08 A;  2B63 J;  1S7E A;  2LLK A;  5HOD A;  1JJ8 C;  2YU9 J;  3HIM A;  1MSF C;  5E3N A;  3HTI A;  4GFK A;  2UXI A;  5E3M A;  5IPA A;  3LOC A;  3L1P A;  1LE8 B;  3MN2 A;  4XRS A;  1A6I A;  2MSY A;  4NDL A;  5K7Z A;  5FKO A;  3HTJ A;  2VKV A;  3LWJ A;  1NTC A;  1LE8 A;  1IG7 A;  2XB0 X;  1Z0X A;  3MKL A;  5JLW A;  2XDN A;  5FMP A;  2DMN A;  2RAE A;  1FJL A;  3GTM J;  4I76 A;  4JX4 A;  2DG8 A;  4JKZ A;  2XB5 A;  4CYC B;  2D5V A;  2NVQ J;  2O9L A;  4FIS A;  1QVT A;  3PPB A;  2E2I J;  3GTJ J;  4ABZ A;  1H89 C;  1Y1V J;  1UI6 A;  5EGO B;  3S14 J;  5K7F A;  5GPC A;  4IHV A;  3VPR A;  4HNV A;  4AF5 A;  2JA6 J;  4CYC A;  2ZCN A;  4D5F A;  2YVE A;  3BR2 A;  4FE4 A;  2HI3 A;  3JR9 A;  1ZQ3 P;  3HB9 A;  3QBM A;  2EZH A;  2L7F P;  5IOY A;  5EDN A;  2I10 A;  5EGO A;  2XRL A;  3BQZ A;  1U8B A;  4UUS B;  1VFC A;  1HF0 A;  3G1M A;  3JSJ A;  4MXM A;  4G12 A;  2VKE A;  3KKC A;  3LSR A;  4ME9 A;  2WAQ N;  3BRU A;  1WI3 A;  5EG0 B;  1FIP A;  3CWR A;  2DMQ A;  5FKK A;  1IDY A;  5IP9 J;  3JRD A;  3BHQ A;  3LSP A;  5CXI A;  2DA6 A;  4UUS A;  1MH3 A;  1A5J A;  4A3E J; 
#chains in the Genus database with same CATH topology
 4XOR A;  1VTN C;  2ZC2 A;  1FP1 D;  2K5C A;  4A0Y A;  5EG0 A;  3PQJ A;  2Y31 A;  2NOG A;  3N97 A;  3I59 B;  2XGE A;  4W1U A;  3MKZ A;  3G73 A;  5FFZ A;  4M6X A;  3BR3 A;  3NNR A;  2IA0 A;  5CVI A;  1TL8 A;  4D7M A;  5BNG A;  5IT3 A;  2VL8 A;  2JK3 A;  2X6Y A;  2YUS A;  1I6X A;  2IS6 A;  5K1Y A;  4ITV A;  3FHN A;  2F48 A;  1F36 A;  3CZ6 A;  4CO8 A;  5M3M J;  1HSJ A;  2LR8 A;  3OSG A;  2ZBK A;  2X0L A;  1BI2 A;  4LGW A;  3ZRG A;  2YSR A;  4JBA A;  5CPR B;  2CUF A;  4BDZ A;  2KRH A;  4LOC A;  1W36 D;  1BA5 A;  4H4K C;  1S6L A;  2WGB A;  4PK4 A;  3VYR B;  1IC8 A;  4GCV A;  4PJL A;  4DIQ A;  2O6G E;  3GZI A;  2G3B A;  3J7Z I;  2X1D A;  3DLA A;  3TOB A;  4IRI A;  1I1G A;  1RZ4 A;  2V1U A;  2DK8 A;  4S04 A;  1IW7 F;  2K27 A;  1WJB A;  5GAD J;  2LTP A;  3F21 A;  5CJ9 A;  1DPR A;  4A3C J;  1LVK A;  2LVS A;  2M34 A;  2Z99 A;  4CZZ A;  3W6K B;  2ZOZ A;  3W2A A;  3IHU A;  1K4T A;  1YLF A;  4BE2 A;  2STW A;  1LFB A;  3G7R A;  1B8I B;  4EEF G;  3M8E A;  2GQQ A;  4BJT A;  2DI3 A;  2R5Y A;  5CVR A;  2NP5 A;  2XV4 S;  3K9T A;  4U9L A;  2M5W A;  2L4M A;  1RNL A;  1MZB A;  1PVE A;  3DPU A;  1K78 B;  1ETK A;  1AA7 A;  3ZXS A;  2OER A;  4L5I A;  2XF7 A;  2DDA A;  1TP4 A;  1X1P A;  4UHT A;  4B48 A;  4PSW A;  4RMN A;  3RZO J;  1FTZ A;  3H9J A;  1J2X A;  2Y9Y A;  4RLQ A;  2KZG A;  4XLA A;  3TQN A;  3W2V A;  3DBL B;  3LJL A;  3K70 C;  2QF7 A;  3CDI A;  3VOD A;  1FIA A;  2JA5 J;  2HQR A;  3CJN A;  5KCM A;  3K0L A;  3LSG A;  4XKC A;  2ZFW A;  3FXK A;  5FD6 A;  1IAW A;  3HOU J;  4ZJZ A;  1T95 A;  3OV8 A;  4OIN F;  2GLO A;  2JUC A;  4Z6Y A;  4ON0 A;  1B9N A;  4LFU A;  4HF1 A;  1TWH J;  1XS9 A;  1P92 A;  4G6Q A;  4NNJ A;  3ZQC A;  3BDD A;  5C4Y A;  4MEY F;  1FSE A;  3F9K A;  3T6N A;  3L2U A;  1SFX A;  4KN7 X;  1XSV A;  2X1E A;  2E34 A;  3OYL A;  1A5J A;  2VBY A;  1IDZ A;  1B72 A;  3KP2 A;  3E7L A;  4RAG A;  4LMY A;  1L3L A;  4BBS J;  1CQT A;  1TWC J;  3E3V A;  1O7L A;  2E60 A;  1ENH A;  1H9T A;  4WXD A;  4U0Y A;  5KHD A;  1AU7 A;  2ZNZ A;  1S3J A;  4HRI A;  4ENK A;  2QKL B;  4YEJ A;  4C2U A;  2XAG A;  3HRU A;  2DBB A;  2ISY A;  3GTG J;  2P5K A;  5CYV A;  3VW0 A;  1W7P D;  1YE9 A;  2WAD A;  1UMQ A;  3E5X A;  3EPZ A;  5GAE J;  2R7Z J;  3ONQ A;  4M3G A;  3AG2 H;  2VB6 A;  2B9S A;  3K2A A;  3ZN0 A;  3AQT A;  5K5O A;  3HOT A;  1SAU A;  1UB9 A;  2MD0 A;  3FXJ A;  3FXQ A;  4RS8 A;  5E79 C;  3F23 A;  3HOZ J;  2V9V A;  3QKX A;  5DEQ A;  3VIB A;  4XN0 A;  2XIG A;  2LH9 A;  4FE7 A;  4WX9 A;  3ZPL A;  2ZXW H;  3GZN B;  2M8G X;  2Z5U A;  1ZG1 A;  3LST A;  2E2H J;  3RKW A;  4GCT A;  3GTQ J;  1H9G A;  4A3B J;  4YZE A;  2KL4 A;  2D2W A;  3PNV A;  3RPQ A;  5TRD A;  2FBQ A;  2PBX A;  3TW7 A;  2KJC A;  3QPS A;  3DF8 A;  1GT0 C;  1A31 A;  2HR3 A;  5JLX A;  1MMD A;  4XNF A;  1NG7 A;  4XIC A;  3BNI A;  4Z2Y A;  3DPJ A;  2KIS A;  3GME A;  4RM3 A;  4N4N B;  5K58 A;  2YVX A;  2A6E F;  3DKW A;  3NAU A;  3ABL H;  2ECC A;  4XKB A;  1IV8 A;  1MMA A;  2R5Z A;  3ZQH A;  4XN3 A;  3BJ6 A;  2A6H F;  4CHU A;  3LQQ A;  2CU7 A;  3F3X A;  1A6Q A;  2BGC A;  1TBX A;  3LAJ A;  1WJF A;  1Z67 A;  1RET A;  2YVH A;  3H1C A;  2OU2 A;  1D0Z A;  1FOW A;  3TDU C;  1GUU A;  4WXC A;  3HOX J;  2BY3 A;  4DVY P;  1YI2 I;  4C2M A;  1J5Y A;  3HPG A;  4ESB A;  1HW2 A;  2B1E A;  2IPQ X;  3JCU C;  4QLC U;  4UDS A;  5HLT A;  2RQQ A;  2E35 A;  4ENJ A;  3DU6 A;  3CJD A;  4LLG F;  4KT6 A;  1U3E M;  1O7F A;  3DBH B;  1MMN A;  2NS7 A;  3QYF A;  4M3D A;  3DCF A;  4EMS A;  3RZD J;  1TWG J;  1ZGW A;  1T6S A;  1G3T A;  2P6T A;  2QQ8 A;  5J8F A;  1Z91 A;  1FZP B;  2HXI A;  4BXX J;  3MVP A;  4AC0 A;  3TO6 A;  4KDP A;  1OCR H;  2PEX A;  2E1O A;  1ZRE A;  2QOP A;  4M72 A;  4D0P A;  1MIJ A;  2Q24 A;  2RGV A;  3FXM A;  3SQN A;  5AON A;  1I5Z A;  3GCM A;  4EM0 B;  3H3V K;  2AO9 A;  2JQ7 A;  5K5Q A;  3DBR B;  2PQ8 A;  3HUG A;  2R7T A;  4II3 A;  4BUP A;  3VYU B;  1KON A;  2W24 A;  2DMT A;  2D6Y A;  1FYM A;  2XAH A;  3REO A;  1O3Q A;  4DYC A;  3F8C A;  3CME I;  3ZQF A;  3CC7 I;  1ZYR F;  4BS9 A;  4CZC A;  4UUV A;  2V6E A;  3B73 A;  2FBH A;  1BI1 A;  1W7P B;  3PUB A;  4XLN F;  5LRR A;  2PMZ A;  2ID3 A;  4JYK A;  3B6C A;  4PJ0 C;  5M5Y J;  2XGX A;  1K83 J;  4LG3 A;  1ZRF A;  5H6Q A;  1QZE A;  2JA8 J;  2L9V A;  1G3S A;  2QWT A;  1R1U A;  2A5Y B;  2PFB A;  3JAM Z;  3FXO A;  4BAY A;  1AKH A;  1UCR A;  1GHC A;  1YTY A;  1X2M A;  1ZRD A;  1QNT A;  3E0J B;  3SXY A;  2E71 A;  1RKW A;  2MYS A;  1JXS A;  3QPL A;  3NI7 A;  4M74 A;  3BG7 A;  3BOQ A;  2QVO A;  3EUP A;  5D5W B;  2XSD C;  2PFV A;  2X48 A;  4L62 A;  3FMQ A;  1FSH A;  1U0J A;  3GF2 A;  3OSF A;  5DUI A;  3LSI A;  1SD4 A;  2DYR H;  4B47 A;  1SFE A;  1SMY F;  2LYC A;  3M9A A;  1FP2 A;  3QYB A;  1U78 A;  2F5F A;  4B43 A;  2OQR A;  4M9X A;  1WJE A;  1MGT A;  1D1A A;  4WF2 A;  1POG A;  4YIF A;  3SFI A;  1CF7 B;  1S29 A;  3O6B B;  1R6R A;  4GYI A;  1KU9 A;  1XDU A;  3HM5 A;  4BDY A;  5EEG A;  3VB2 A;  3PSI A;  3H35 A;  1MJ9 A;  1ZK8 A;  3TKY A;  4Y33 A;  3D1N I;  5BPI A;  3FWE A;  1MNM C;  1V3F A;  1V5G A;  4B3A A;  2D45 A;  2QKO A;  5K5R A;  3V6G A;  4HW0 A;  1G3Y A;  1Z6R A;  1PUF A;  2DJI A;  2VE9 A;  1W5T A;  5IY5 H;  2V79 A;  3NWT A;  4EJV A;  2CV2 A;  5H9T A;  2E19 A;  5JR3 A;  2VC1 A;  2Z9O A;  3HG9 A;  1UHM A;  3WU0 A;  4U9N A;  5J8C A;  4GCL A;  1ZHF A;  1ZR2 A;  3K1P A;  4D7N A;  2W53 A;  2PX9 A;  3RPU D;  2NNY A;  2KIM A;  4YRV A;  1WKM A;  4Y7N J;  5LHH A;  1HDD C;  4N0B A;  1REP C;  3CDH A;  2VOP A;  2W57 A;  3HGY A;  1BI3 A;  1X3U A;  2M2E A;  4CIC A;  3MZ8 A;  4RLF A;  3VYT B;  5FHP A;  4A3D J;  3MMY B;  5M5X J;  2GIZ A;  5HDN A;  2GZW A;  4JOM A;  1JTX A;  2JZY A;  3PIO F;  3G56 A;  2EFO A;  2Q2E B;  2R92 J;  3GUD A;  1R9T J;  3I4N J;  3N05 A;  2E1N A;  2GIV A;  2H1L A;  2F6C A;  3V4G A;  2Q1Z B;  3BZC A;  2EIM H;  3LWF A;  5H20 A;  5J1U A;  2DFI A;  3RKX A;  4AYB A;  1F5T A;  2CV1 A;  3S5R A;  3KKD A;  2UXU A;  1RUO A;  1R49 A;  3SJM A;  4F55 A;  3MKW B;  2O03 A;  3K4M A;  3KEY A;  1OMI A;  1PJR A;  3J81 Z;  1S8N A;  4HDU A;  3PO3 J;  3FMS A;  1G3W A;  3LA2 A;  3OS1 A;  3PSF A;  3P7N A;  4XRM A;  4YFK F;  2QKM B;  3ON2 A;  3FZV A;  3TP3 A;  4KT5 C;  4XBF A;  2W25 A;  4GRI A;  4MEX F;  1ULY A;  4BE1 A;  1IO2 A;  5CVU A;  3R0A A;  2DDB A;  2FU4 A;  2O5R A;  4WXH A;  2DO7 A;  2C6Y A;  5GPA A;  1HW5 A;  3FXR A;  4CH7 A;  1BL0 A;  3HZJ A;  2M0C A;  3Q0V A;  5HDG A;  2QBY A;  2OI8 A;  2V4J C;  3H3U A;  2OTJ I;  2CRG A;  3WU2 C;  3Q3S A;  4MTD A;  2A61 A;  4J01 A;  2JVH A;  3F8F A;  2FF4 A;  2NP3 A;  3R6S A;  2WUI A;  2G7U A;  3BR5 A;  4QWQ A;  1ETO A;  3JRC A;  3G6E I;  3WGH A;  3JTG A;  3ZQ7 A;  4UXN A;  4XLP F;  2P81 A;  5J47 A;  3QQA A;  5HLH A;  3BG9 A;  1WPK A;  2CV0 A;  2O7O A;  2HXO A;  1WH5 A;  2WB1 N;  2VXD A;  2ZJQ F;  2DT5 A;  5HLI A;  1T08 B;  3PJR A;  2XC7 A;  4I09 A;  5E3N A;  1BIB A;  4L9N A;  4A3E J;  2UXI A;  4OU0 A;  2NOJ B;  1LUJ B;  3CCJ I;  1SVM A;  2M30 A;  4JQF A;  3MZY A;  3QOP A;  3L1P A;  4BXU A;  2ZJR F;  3EYI A;  4XRS A;  1A6I A;  1XX5 A;  2ZSH B;  4FQG A;  4NHJ A;  1D5V A;  4NDL A;  4BJ5 C;  3S3O A;  2KKO A;  5FKO A;  2QGU A;  2HVQ A;  3CJQ B;  4NQW A;  1W4M A;  3OOP A;  1TW2 A;  4XOT A;  5ED4 A;  1IRG A;  2XB0 X;  1NG6 A;  2LBF A;  4R8H A;  5DCF A;  2KRC A;  5KK1 A;  2VQL A;  3HHG A;  3ECH A;  1TZL A;  2FXA A;  3GTM J;  4JX4 A;  2R7X A;  2GXB A;  5HVQ C;  4IF4 A;  4CYC B;  2M7B A;  5LFA A;  1IRF A;  3P9K A;  2RN7 A;  2O9L A;  2NVQ J;  3C3W A;  3JAM K;  1KYW A;  4S05 A;  1MMG A;  2L7K A;  3ESW B;  4LG0 B;  5LGT A;  3S14 J;  4E7Z A;  5K7F A;  2L3D A;  5GPC A;  4HF2 A;  3M1E A;  1ZGA A;  3CLQ A;  3LFU A;  2JA6 J;  4D9J A;  2E1M B;  2ZCN A;  4D5F A;  3BR2 A;  4KA4 A;  1ZQ3 P;  1WI9 A;  2EZH A;  3WU1 B;  5EDN A;  3QPT A;  5DCM B;  2IW5 A;  1RI7 A;  4UUS B;  3MKY B;  2OUM A;  1ONV A;  2CGP A;  4G12 A;  3JSJ A;  3KKC A;  2WAQ N;  2DMQ A;  2ZNY A;  1IDY A;  3H5N A;  3BHQ A;  4KIG A;  2Y0M A;  4LIV A;  5CXI A;  3OWT A;  2KDZ A;  1SD5 A;  3LHQ A;  5FLV A;  4OIO F;  2EBI A;  2W00 A;  3BZ6 A;  5F0C A;  2ZJ2 A;  4JNN A;  3QRF F;  3FF5 A;  3DEE A;  3I5U A;  1EA3 A;  3I59 A;  2P5L C;  2N8G A;  5ERI A;  1SEU A;  3IC7 A;  2RNG A;  1M1E B;  1NHA A;  4AIH A;  2LOO A;  2IGN A;  2LD5 A;  1ZR4 A;  5DAJ A;  1WSU A;  2VPR A;  4QSH A;  4F7Z A;  4Y3O A;  1D1B A;  3KLN A;  1VI0 A;  2L0K A;  2E2J J;  3GTK J;  3CP8 A;  4C30 A;  2F5C A;  2O0Y A;  2GXG A;  2HWV A;  3ERE D;  2HKU A;  4XRF A;  4HX7 A;  2DW4 A;  1C0W A;  3K1M A;  1OCP A;  5LHI A;  4QTR A;  3RD3 A;  3K2Z A;  1WJA A;  1IN8 A;  2KDO A;  3K10 A;  3ZP5 A;  2CWE A;  3CDL A;  2W7N A;  3H0D A;  4A0Z A;  5GTI C;  2JTV A;  1YJ9 I;  3OYK A;  1WFX A;  3WHB A;  2ZCX A;  1H88 C;  3CCS I;  4B1R A;  1TNS A;  4BKX A;  2H94 A;  2YU3 A;  4E6K G;  3AG1 H;  1X1C A;  3BJO A;  4F52 A;  3M3Y J;  3ABU A;  2CUJ A;  3J81 K;  2QZ8 A;  5D18 A;  1JKR C;  4UV8 A;  3C07 A;  2X9D A;  3IUO A;  3VP5 A;  2QCO A;  1R58 A;  2PN6 A;  1SAX A;  2Y30 A;  3OYJ A;  2DPU A;  3HL2 A;  1ZN2 A;  3BG5 A;  3OYD A;  4UY8 I;  1JGG A;  1GXP A;  1B8I A;  1EV7 A;  4HNT A;  2RAS A;  3RQI A;  2YX7 A;  2HFH A;  3J7Y J;  3JRA A;  1BR1 A;  3CJT B;  1YIJ I;  2QIB A;  4PJM A;  2WTE A;  3RTR A;  4IX7 A;  2Z3Y A;  2FNP A;  3OYB A;  3RI4 A;  3HKZ N;  2BBY A;  5FJ8 J;  1T39 A;  1JHH A;  3DTE A;  4LIU A;  1MH4 A;  3TGN A;  5F0H A;  3FIW A;  3Q0W A;  3RYP A;  1K61 A;  4RAY A;  2XKO A;  3SEZ A;  2STT A;  3L2V A;  3NRG A;  3ERM A;  4FET A;  1JUM A;  4ZDP A;  4C3H J;  3S1N J;  3KP3 A;  4LB5 A;  2REK A;  2BOL A;  3GFI A;  1TT5 B;  3UNG C;  4L9T A;  3V8L A;  4QIW N;  2DMU A;  4IEJ A;  2WAE A;  3VWB A;  3BP8 A;  5KAI C;  1B1B A;  5L3G A;  2CYY A;  3KP7 A;  4F93 B;  3L2W A;  4HST A;  1R7J A;  5GP9 A;  2F4I A;  2BHZ A;  1OFC X;  1Y56 A;  4ZH4 F;  3T0Y A;  3V78 A;  1QGP A;  3OOU A;  2FJ1 A;  3RKY A;  3AFH A;  4NC8 A;  3JW4 A;  3ABT A;  2W82 A;  2QLZ A;  4RAF A;  5F0F A;  3ASO H;  2HPM A;  3ABK H;  3B6A A;  3CCR I;  3ISP A;  1OPC A;  3OY9 A;  1BJZ A;  3O8G A;  2VOO A;  1LB2 A;  1UZC A;  1PYV A;  3S1R J;  3ANP A;  2LC2 A;  2IGK A;  3TDZ C;  3AG3 H;  3BC8 A;  1BC8 C;  4WCG A;  4NB5 A;  3MWM A;  2BW3 B;  5HLG A;  5JVT A;  1UST A;  4ZZL A;  2HOE A;  2YPR A;  3E5Q A;  1U8R A;  2EFN A;  3H92 A;  1R4N B;  3SWH A;  1RES A;  3Q9V A;  1B59 A;  3QOD A;  2ZCM A;  2HQ5 A;  4P9F A;  3JRI A;  2YX4 A;  4CCL A;  2RHA A;  2ZOY A;  2BVM A;  1SVL A;  2DU9 A;  1ON2 A;  3DEW A;  5F64 A;  1BR4 A;  4BEH A;  4O5V A;  3FKJ A;  2X51 A;  3PM1 A;  2X6X A;  4L0Y B;  1B9M A;  4KFC A;  1YX5 A;  2KFD A;  3NXC A;  1U9O A;  2FA5 A;  5E8G A;  2XGD A;  1JE8 A;  4J00 A;  4GXO A;  4M71 A;  1YS6 A;  4KMF A;  2PJP A;  1OR7 C;  1TWA J;  2GOX B;  3MFK A;  1XCV A;  2DOE A;  2E7X A;  2V26 A;  1KU7 A;  1SD7 A;  1YYV A;  2Z1D A;  2Y48 A;  4DOZ A;  4X0G A;  2LP0 A;  3COL A;  4IL6 C;  2K40 A;  2R3S A;  3SDG A;  4P96 A;  2L9S A;  3JRF A;  5BMZ A;  3GEZ A;  2GUH A;  4HF0 A;  2LKS A;  3BR1 A;  1WWX A;  5HSZ A;  2KQR A;  5IYC J;  3H5R A;  1HC8 A;  1KU2 A;  2KT0 A;  1MJA A;  1STZ A;  2AXL A;  2KHM A;  5F1J A;  1T0F C;  4EJO A;  2JA7 J;  2DK5 A;  1TQI A;  4M6Y A;  3VOX A;  5L3E A;  4U7B A;  2HQN A;  2L2O A;  5AQC A;  2RC4 A;  3S8P A;  2DOF A;  5JFR A;  5E18 F;  1R22 A;  5E1Z B;  1Y0N A;  4MTE A;  2MC4 A;  3CES A;  2BEO A;  5CKT A;  4EJW A;  1YOV B;  3K1N A;  1AHD P;  3S2W A;  4PXI A;  3K4J A;  3IUV A;  2HYT A;  2OQG A;  4N4O B;  3GW2 A;  3MQ0 A;  1WCM J;  3LL7 A;  2KIU A;  3HSF A;  2VE8 A;  2GAU A;  2MGQ A;  4BAC A;  4CCO A;  1RKT A;  4B44 A;  2EIL H;  1X3Z B;  3ZQI A;  5H2F C;  4GCK A;  3HOY J;  3IRQ A;  1X2N A;  3E6D A;  1FX7 A;  2K02 A;  3R60 A;  4G9Y A;  1UAA A;  1N75 A;  5B5E C;  1OCZ H;  3T5X A;  1XSD A;  1XSX A;  4FT8 A;  4G8X A;  2M1B A;  3WE2 A;  2VJI A;  1WHU A;  5D19 A;  4L5E A;  3H5A A;  1W0U A;  2P5V A;  2XAS A;  4I6Z A;  4E7I A;  1BOB A;  4ZTF A;  4NUB A;  3HGG A;  3TBI A;  5J4Y A;  3I0T A;  4V2G A;  2UXH A;  1UEL B;  4DBQ A;  2JSC A;  1Z21 A;  3ZQL A;  2UWM A;  3HXL A;  3DTK A;  4C3I J;  1SD6 A;  1GV5 A;  1W7P A;  4UNO A;  2COM A;  3TW6 A;  1LEB A;  4CGR A;  3ZMD A;  2FRH A;  4IQJ A;  5FFX A;  3CCY A;  4L9J A;  2WBM A;  1VQL I;  1DU6 A;  4V2F A;  1IGN A;  2D1H A;  4W97 A;  1UI5 A;  3OR2 C;  2ZB9 A;  1SVO A;  2QUF A;  4ZYA A;  4BY7 J;  1IN7 A;  3AQS A;  1XD7 A;  2HYJ A;  1MSE C;  3VTI A;  4G7O F;  1TT0 A;  3I4P A;  1VQK I;  3NRV A;  3GX4 X;  1OQY A;  4E7L A;  1EH7 A;  1KYZ A;  2XAU A;  3KFW X;  1A35 A;  5DM6 F;  2AXT C;  2K86 A;  4JX6 A;  5TIS C;  1XMX A;  1TLH B;  1MBG A;  2ETH A;  5EZG A;  3FX3 A;  2ELK A;  3BG6 A;  5HS9 A;  4Q4Z F;  3S1Q J;  1YJW I;  1U5T B;  5D5X B;  1P7J A;  1X4P A;  1R1T A;  3RIR A;  1GLN A;  4P9U A;  1J9I A;  1MBK A;  3CRJ A;  4GFL A;  2K9N A;  1K6Y A;  4FX0 A;  2QTQ A;  3ZMZ A;  9ANT A;  1P2F A;  2E36 A;  5EZH A;  3OYC A;  2QSF X;  2LY2 A;  4ZYD A;  3AL0 C;  2O8K A;  2CUZ A;  1X3W B;  5E17 F;  1T56 A;  4UVB A;  4AM3 A;  1RPW A;  3ZR8 X;  2F5D A;  2DA4 A;  3I64 A;  2VQC A;  1LFP A;  4FTH A;  2DT7 B;  1QHH D;  3BCB A;  4PFP A;  2EZK A;  3K4B A;  1MBH A;  2MH2 A;  1BW6 A;  2QQ9 A;  1OIS A;  2R7F A;  1X1B A;  3O8H A;  4UUT A;  3WTW C;  2DA2 A;  3A01 B;  1HW1 A;  3OMY A;  2P0W A;  3WTZ A;  4MGR A;  1ACI A;  1F43 A;  3DV8 A;  2W48 A;  3K8P C;  2L02 A;  2JRT A;  1ZKG A;  3T8R A;  1TW3 A;  2BY1 A;  2WWY A;  5FRO A;  2BYV E;  2NNN A;  2HVS A;  5CLS A;  4BHB A;  1EJ9 A;  2PZ9 A;  4LIT A;  1G59 A;  1BN5 A;  5ICC A;  5GAH J;  4BE0 A;  3X2Q H;  2E5Z A;  1V5E A;  3RJP A;  1JKP C;  1SGM A;  1FBU A;  2IA1 A;  5CVJ A;  3WTX C;  4ZC3 A;  2XAF A;  1P6R A;  3FBI B;  2DQL A;  2GOM A;  2ID6 A;  3QYE A;  4J19 A;  2TRT A;  1N77 A;  1P4W A;  3CCV I;  2JJ7 A;  1BOA A;  2A3S A;  3E6C C;  1XG1 A;  3I54 A;  4JX5 A;  2AS5 F;  5D6F A;  4A5M A;  1IJW C;  3TO9 A;  4U0V A;  4CCJ A;  4OMZ A;  3RQ4 A;  4A3I J;  2IXS A;  3DWL E;  3GFL A;  1D5Y A;  1VQ5 I;  4MIM A;  2ICW G;  1T33 A;  3GZ6 A;  3Q5F A;  2ZFU A;  3NWS A;  1FLI A;  2EFP A;  1X19 A;  4DZJ A;  3GO5 A;  5C4J J;  5D6E A;  5D8L B;  3K4L A;  1K79 A;  3P9T A;  2QSG X;  4XL9 A;  4LD5 A;  4M3B A;  2I5U A;  2LK2 A;  5L3B A;  1TC3 C;  2W84 A;  1XGN A;  4HQM A;  1K7A A;  4A3G J;  4RM2 A;  1ZEL A;  4PFO A;  3OS0 A;  3OIQ A;  1Y8Q B;  1GXQ A;  3CCM I;  1ZH5 A;  4IXA A;  3Q9S A;  2HVR A;  3OYH A;  4AIK A;  1XN7 A;  2KPM A;  2KMU A;  4A69 C;  5HOD A;  3F8M A;  2YU9 J;  3HIM A;  4ZZD A;  5HS8 A;  1QHG A;  2JPC A;  2MA3 A;  4KYW A;  2MH9 A;  2OV7 A;  5IPA A;  3LOC A;  2V9K A;  1LE8 B;  4WK8 F;  5AIP A;  3HJE A;  1IN4 A;  5TJJ A;  1B6A A;  3UR3 C;  3SYT A;  5K7Z A;  3HTJ A;  5JHU A;  5HS7 A;  4HBL A;  1NTC A;  2R7Q A;  2P6S A;  1ZG5 A;  4EM1 A;  5FLX Z;  3AG4 H;  1IXR C;  1IG7 A;  3MKL A;  3LSM A;  5JLW A;  2DMN A;  3WG9 A;  4R1H A;  4XLE A;  4ZYG A;  3OS2 A;  1FJL A;  1KU3 A;  1OCO H;  3KEQ A;  4I76 A;  2IS1 A;  4JKZ A;  2XB5 A;  1FT9 A;  2D5V A;  4PZJ A;  2A69 F;  4AWX B;  5E20 A;  2Y0S A;  3K6G A;  2DXI A;  1H89 C;  1JHF A;  1Y1V J;  2E1C A;  4M9S A;  5EGO B;  2ZME B;  1Y8R B;  4IHV A;  4WIB A;  4CYC A;  3G4S I;  3RPU A;  3ELK A;  1MDM B;  4RGS A;  1QO0 D;  3HB9 A;  2NVU B;  2L7F P;  3QPH A;  4LG0 A;  3CMA I;  2I10 A;  2XRL A;  4LK0 F;  3I58 A;  4MQ9 F;  1HF0 A;  3KLO A;  2VAS A;  1KA8 A;  3G1M A;  4MXM A;  2VKE A;  3LSR A;  4ME9 A;  1FIP A;  4E7S A;  1XMA A;  1SFU A;  3E1S A;  4I01 A;  2OJE D;  3DPL C;  2VIX A;  2VON A;  1YJN I;  4UUS A;  2EJR A;  1XPX A;  1FOK A;  1P4X A;  2CW7 A;  3F1B A;  2XUB A;  2IGM A;  1W36 C;  4O6J A;  3JRG A;  4PGG A;  2R7W A;  1F4K A;  2V1X A;  4CYD A;  5LGU A;  4K2E A;  1OYW A;  2BXY A;  3TL4 X;  1T38 A;  2V9P A;  1LDK B;  2HQA A;  1X58 A;  1J75 A;  1APL C;  4HNU A;  2E7W A;  4U0W A;  1PDN C;  2WAQ A;  4ESJ A;  3VEP A;  1EH6 A;  2JSP A;  3B02 A;  3WE3 A;  3CC2 I;  5DS9 A;  5C44 J;  3ULQ B;  4IRV A;  3I71 A;  2KIF A;  4I0A A;  3EUA A;  5D4R A;  5FRM A;  3FKI J;  4I7H A;  1HKS A;  2DQR A;  2VPL A;  1HDP A;  3V7C A;  1V54 H;  2Z33 A;  2IS4 A;  2EZL A;  4MFD A;  3JRB A;  5L3D A;  5E3O A;  3WGG A;  3CMM A;  2AQE A;  3DTI A;  5DDG A;  2H27 A;  4KNY A;  3ECO A;  1UFM A;  4ESF A;  1ORK A;  2EB7 A;  3DKX A;  1OJL A;  1FMV A;  2CSO A;  2HS5 A;  2PBI A;  1MW7 A;  3U1K A;  3CUO A;  3FXU A;  5FKN A;  1FC3 A;  5F04 A;  4KIC A;  4XLC A;  4IHW A;  1TQP A;  2LF8 A;  1ZG3 A;  5E1W A;  1PP7 U;  3S3N A;  2BHY A;  3H3Z A;  2G0E A;  4PJN A;  4X6A J;  2LF7 A;  2VKH A;  5FKM A;  2CQ7 A;  2K3P A;  2HPI A;  2KIQ A;  4U87 A;  1XGM A;  2JA2 A;  1ZAR A;  4AVZ A;  5E8I A;  3BRO A;  3OYN A;  3MD2 A;  1QZZ A;  3BR6 A;  4UB6 C;  3WGI A;  3QOE A;  3KZ9 A;  2BV6 A;  2M9H A;  3HBL A;  4ENN A;  4B3X A;  5J1Y A;  5CVV A;  1VZ0 A;  2P7C B;  4I2O A;  3ZMS A;  2G7G A;  1U9N A;  3PQK A;  1DGW Y;  5J1R A;  2L9N A;  3SZP A;  4MLO A;  5FGL A;  5FD5 A;  1JJ6 C;  2Y9Z A;  3KYL A;  2IP2 A;  1I39 A;  3HOS A;  3E6M A;  4AVP A;  1UHS A;  3VSK A;  3S3M A;  2OTL I;  3KZI C;  3H36 A;  2PLY A;  1Z1D A;  3K4N A;  3KIO A;  3BZK A;  3LA7 A;  1I3A A;  3RKQ A;  1I6H J;  1H0M A;  4GFB A;  4HKU A;  3CUQ B;  1AKH B;  1W5S A;  2NVY J;  4FHT A;  2DG7 A;  2OA4 A;  3CC4 I;  5IT9 Z;  1PUE E;  2QYO A;  1LEA A;  2HOA A;  1LFU P;  2PJR B;  2RVC A;  3HKZ A;  1YRN B;  5EYR A;  3DPT A;  4RA2 A;  2QSH X;  4XM3 A;  3CCU I;  4E7K A;  4XID A;  1Z9C A;  3DKY A;  3S2H J;  1K6O A;  3K70 D;  5D1R A;  4HSR A;  1G8X A;  4N9H A;  3HOW J;  4YEL A;  2L4A A;  4FAS D;  3CP2 A;  1YFH A;  3CD6 I;  1BJA A;  2L01 A;  3G1L A;  4KIT B;  3RSN A;  3T1B A;  1N25 A;  5CW8 A;  4NEL A;  3IWZ A;  2ESN A;  2MG4 A;  2H1K A;  1I50 J;  1QQI A;  2LY9 A;  3GFM A;  2FML A;  2HNH A;  2EIN H;  5FLX K;  5B1A H;  3C2G A;  3KPH A;  3WTV C;  3GTP J;  3CQZ J;  5FO5 A;  2XPW A;  2NRA C;  5EEA A;  3A03 A;  2HZT A;  4L5J A;  1VND A;  2CW8 A;  3KZY A;  4PGH A;  2QA4 I;  4IKF A;  5HOO A;  5J3L A;  4MFE A;  5HDK A;  3HTH A;  1FNN A;  4H0E A;  3G1O A;  3WHC A;  2A05 A;  1J0R A;  2PI0 A;  3F8B A;  3F0C A;  2BE5 F;  3I3L A;  1D8J A;  4ANJ A;  2PMH A;  2Y2Z A;  2B3W A;  4Q5S F;  2HYF A;  2L9R A;  2ZXH A;  3M1C A;  1YQA A;  4A6D A;  3WTS C;  3A1Y A;  4GYG A;  3WG7 H;  1W1W E;  3I4M J;  2BVL A;  1J09 A;  1BI0 A;  2XHK A;  3I9V 2;  2FBK A;  2R7S A;  5IYB J;  3GYH X;  4TV7 A;  1ETW A;  3JSP A;  3HE0 A;  4DYR A;  5ILS A;  2DCE A;  4X1E A;  2FOW A;  3MZH A;  1F9N A;  3HOV J;  1EKE A;  4BJ6 C;  5ICF A;  1FTT A;  3U2R A;  2R7O A;  1RIO H;  4BYY A;  3DXJ F;  5H6R A;  3A0H C;  1R1V A;  3C7J A;  3BCG A;  2XPU A;  1IN6 A;  1ETX A;  4XMY A;  2IVM A;  3BTJ A;  3QAH A;  4A3J J;  2IS2 A;  2HKX A;  3M07 A;  1FOX A;  4EVI A;  3A02 A;  4UV9 A;  1QRY A;  1OCC H;  4JL3 A;  3OYI A;  3VVX A;  5ICG A;  1R5I D;  2LRE A;  1XCB A;  1R5G A;  5DD4 A;  2IBD A;  5FLM J;  2ELJ A;  2MBF A;  1KQ9 A;  4ICH A;  3L2R A;  3KNW A;  1QU3 A;  1OCT C;  2G7L A;  2H8W A;  2GBY A;  4BHP A;  1FYL A;  1MBF A;  2MAB A;  1IF1 A;  4DZP A;  3K4K A;  4IOA F;  2E5N A;  5FRN A;  3D5S C;  1BBY A;  1DU0 A;  2H09 A;  3W6J B;  1WJD A;  4L18 B;  2L7Z A;  3TP0 A;  3KCC A;  1ZLK A;  4AIJ A;  3S2D J;  4PJJ A;  1HOM A;  1FYK A;  2DA7 A;  3WTY C;  4XRS G;  3HTA A;  2DJN A;  2EH3 A;  3KYD B;  5D5U B;  2DPD A;  2ISZ A;  1D1C A;  2XGC A;  4RGR A;  3W3C A;  2VUM J;  3MNL A;  2FD5 A;  2CUE A;  3OL4 A;  3N4M A;  2M87 A;  2IAI A;  3IH3 A;  1K78 A;  4ASN A;  3HDD A;  3VOK A;  5DV5 A;  1Y6I A;  2R4G A;  3CMY A;  1E3O C;  1QA6 A;  2EA4 A;  4U88 A;  3O3K A;  3HTU A;  2HKO A;  2L54 A;  5K7H A;  3ZMT A;  3EUK L;  2V7F A;  4A93 J;  3BJB A;  4PUS A;  3IL2 A;  5C3E J;  4A3K J;  3R61 A;  2NYX A;  5IYD J;  2EV5 A;  2FQ4 A;  1VQ9 I;  3PO2 J;  3OYA A;  2HOS A;  4KUM A;  5KVR A;  1FMW A;  4DGW B;  3FIS A;  1MD0 A;  3HC7 A;  3PNT A;  2CQK A;  3AKZ A;  2CFX A;  3BJA A;  3CLO A;  1Z05 A;  1GV2 A;  1Q1V A;  3L09 A;  1PP8 F;  2O8X A;  3NPI A;  4IRH A;  3HYI A;  3ANG A;  5B3S H;  4HZF A;  3OYM A;  4EGZ A;  1VQM I;  2DT6 A;  4MO7 A;  5IT9 K;  5E1X A;  2L7M P;  3VDX A;  1T8I A;  4XLH A;  2DOD A;  4IO9 F;  3D5R C;  3LAP A;  3ZCO A;  3L9F A;  5CQE A;  3S93 A;  3QU3 A;  4FX4 A;  4LB6 B;  3ZGK A;  4RGU A;  4CCN A;  4EV0 A;  2UUZ A;  4BQA A;  3F72 A;  2DFH A;  3HRS A;  4AU7 A;  3O2P E;  3W2W A;  1U5T A;  1IXC A;  2DA5 A;  3V7S A;  2HU9 A;  3V8J A;  1QBJ A;  4C3J J;  3FM3 A;  4C2M J;  3FDY A;  5F6F A;  1UG0 A;  3P9C A;  4IHY A;  4OD5 A;  3BPX A;  1Q1H A;  2FOK A;  2K9M A;  2LG4 A;  4BQN A;  1VQ6 I;  2DFF A;  4HG2 A;  2PMU A;  1T98 A;  3BPV A;  3ROU A;  4I99 C;  2FQ3 A;  5M5W J;  2ZSI B;  1MND A;  3SEQ A;  1Z7U A;  1Y0U A;  4BQO A;  1OLT A;  1P7I A;  3HRM A;  1I3Q J;  1FBQ A;  3A01 A;  2RRE A;  3G2B A;  4G6T B;  2K85 A;  4B4C A;  4RB0 A;  1XDS A;  3VW2 A;  2F5E A;  4L9V A;  1RR8 C;  2NXN B;  2GXA A;  2EPF A;  1FOY A;  2WV0 A;  1AOY A;  3CO6 C;  1JGS A;  1DP7 P;  3L2C A;  3LSK A;  2UXO A;  5EFY A;  2NS0 A;  4RBO A;  3HSE A;  2ADU A;  3S16 J;  1Z7L A;  3EDP A;  5KNL A;  4RB2 C;  5LD2 C;  5BPD A;  2DA3 A;  4LJZ F;  3IAS 2;  2NAZ A;  4EJU A;  3O60 A;  3BTI A;  4G6D A;  4II2 A;  3OIO A;  1G2H A;  2JUG A;  3A4C A;  3DFG A;  2G7S A;  4WWC A;  2ZXI A;  4A6E A;  2EA2 A;  1O3S A;  3JSO A;  3RDI A;  2XRN A;  2QM3 A;  1LNW A;  2RKH A;  4PSX A;  4XSZ F;  2KRF A;  1S7O A;  2DFE A;  1I27 A;  2K7L A;  2V6C A;  2ME0 A;  2Z2S B;  4Y13 A;  1DP3 A;  1X1D A;  2FE3 A;  1LKX A;  1WZ2 A;  2B0L A;  3H9Q A;  4A12 A;  1HKT A;  4IHX A;  3BLY A;  2COB A;  3I56 I;  3BTL A;  2IRF G;  2WV1 A;  2A2F X;  2CJJ A;  3PAS A;  1R36 A;  4HV6 A;  4Y17 A;  4S0H B;  1SAN A;  2OPT A;  1ON1 A;  3DP7 A;  4M3F A;  5LRS A;  1JKO C;  2LKP A;  5CQG A;  3LNQ A;  2VQH A;  2NVX J;  2FUG 2;  4AUX A;  5ILV A;  3J80 K;  1LQ1 A;  4ENM A;  1SC7 A;  2VLA A;  1H8A C;  3KP4 A;  1ZRC A;  5EF6 A;  3EET A;  3IH4 A;  3IRR A;  3H9G A;  4RAZ A;  4HAM A;  3P9I A;  2LLK A;  1JJ8 C;  1MSF C;  3G3Z A;  4OIQ F;  3HTI A;  3FMR A;  1KQ0 A;  1D0X A;  4KIS A;  3CF5 F;  3MN2 A;  2EV0 A;  1YW7 A;  3D5L A;  3HHH A;  4OAY A;  5EEH A;  5GTH C;  3ML6 A;  1FPQ A;  3AAF A;  2VKV A;  3LWJ A;  1B4A A;  1HKQ A;  1D3Y A;  2GA1 A;  4BGD A;  4G7Z F;  3GLL A;  1LE8 A;  1USS A;  1Z0X A;  5FMP A;  2XDN A;  2HDC A;  1NH3 A;  3CO7 C;  1LDJ A;  4I02 A;  3QP5 A;  4IOC F;  2WC2 A;  2JRM A;  4EM2 A;  1QVT A;  3PPB A;  2E2I J;  3GTJ J;  4ABZ A;  1RC9 A;  2XVC A;  4IVN A;  3IAM 2;  4D1Q A;  1UI6 A;  3NS4 A;  2OBP A;  3VPR A;  4BL0 B;  4HNV A;  4AF5 A;  2CFO A;  2Y75 A;  3FBN B;  1QPM A;  1ZAO A;  3VSL A;  5BOX A;  2YVE A;  4FE4 A;  3QBM A;  4ZDO A;  5IOY A;  1CF7 A;  5EGO A;  3BQZ A;  1U8B A;  2ZME A;  4DQ2 A;  5L3C A;  1VFC A;  2VN2 A;  1MJB A;  1YX3 A;  1TQM A;  1E2X A;  2R7V A;  1MDM A;  5DD8 A;  3NQO A;  5EG0 B;  2Y69 H;  5JI6 A;  3R4K A;  5FKK A;  2A07 F;  3JRD A;  2LMD A;  2GWR A;  1E3P A;  5FB2 A;  1WJ5 A;  2JVG A;  1MH3 A;  3K4C A;  2O3F A;  4RB3 C;  1Z6T A;  1R00 A;  3COA C;  4EGY A;  1XGS A;  1JTY A;  3C1D A;  4BEH B;  4C9Y A;  1F1Z A;  2R0Q C;  3EGQ A;  4DNC A;  5C4X J;  1CGP A;  3IKT A;  1T2K A;  1NK2 P;  2O7T A;  1E17 A;  2XDV A;  3S17 J;  2A68 F;  4L0Z B;  3BWG A;  4XSX F;  2UXN A;  2YS9 A;  3HSR A;  2M4G A;  2EV6 A;  4HYE A;  3ZOB A;  3CF2 A;  1VQP I;  1R5H A;  1OYY A;  4HOB A;  4N9I A;  4RDU A;  2XSJ C;  4E7H A;  3EUH A;  4E4H A;  4GDF A;  2Q2E A;  2VJ4 A;  2GM4 A;  2NVT J;  5IP6 A;  3F6O A;  2XRO A;  3J7A O;  2RNJ A;  4V19 K;  2M45 A;  2ESH A;  3TMO A;  1E3H A;  4C2T A;  1RUN A;  1W5C C;  3RH2 A;  2XPV A;  4JP0 A;  3L00 A;  4PDK A;  3PL8 A;  3TOA A;  5D4S A;  3E7Q A;  3FK7 A;  5F1R A;  4YFN F;  1Y1W J;  1DUX C;  2JN6 A;  2CW0 F;  5J6X A;  2JMW A;  2H6B A;  1JT0 A;  3CCQ I;  3BY6 A;  2OC6 A;  4XR6 A;  2R5Y B;  1YHQ I;  2CS3 A;  2H6C A;  1GDT A;  4DYQ A;  5A2Q Z;  3QWL A;  2WAF A;  2XAQ A;  3H0G J;  3OR1 C;  3ON4 A;  4FCY A;  2ZCW A;  1MBJ A;  3E5U A;  5D8K B;  1ETQ A;  3V7R A;  3FK6 A;  1WVR A;  1W0T A;  5HAW A;  2LNB A;  4Y15 A;  2HYG D;  4ZDL A;  2RDP A;  1IXS B;  3GXO A;  4P55 A;  4BNC A;  2UXP A;  2EIK H;  3GLX A;  2YR2 A;  1S7A A;  2ACJ A;  3VOE A;  4BQQ A;  2JPB A;  2HDW A;  5EJC A;  1JT6 A;  1UG2 A;  3U9G A;  4F92 B;  2R7R A;  4A5N A;  2CQN A;  4MK6 A;  4D5C A;  3OYE A;  5J40 A;  1RRJ A;  2HEO A;  4Y4R A;  3SZT A;  4ZYH A;  1ITY A;  3ABM H;  1D8K A;  4CCK A;  1LDD A;  3OL3 A;  2Q0O A;  2IU5 A;  2K3F A;  2P8T A;  3JRE A;  1V4R A;  1YS7 A;  1HST A;  1N78 A;  1IRZ A;  1XGO A;  2J5P A;  4HLX A;  2MLG A;  2B7E A;  2WB1 A;  4ACI A;  3ASN H;  3C2B A;  1O57 A;  1B72 B;  2BZT A;  3LFK A;  2DN0 A;  4UVA A;  4YIR X;  6PAX A;  3BT9 A;  4NBQ A;  5M3F J;  4P5O A;  3NAR A;  5AIQ A;  1QVU A;  1KZH A;  3CCE I;  1DDN A;  4M6V A;  2X6O A;  3F22 A;  4U7D A;  4YII A;  1A36 A;  5BQT A;  2W85 A;  4HEA 2;  4XK4 A;  1UHW A;  3KZZ A;  3CUQ A;  3M4O J;  1R71 A;  2K9Q A;  2M3A A;  1G6N A;  2VJ5 A;  2PJR A;  1OYI A;  3OYG A;  2AQF A;  1YRN A;  2F07 A;  4YG2 F;  2XAJ A;  2NX4 A;  2HGC A;  1XTA A;  3KET A;  2PG4 A;  2F2E A;  5TGT A;  1IV6 A;  5LEK A;  4OOI A;  1WQ2 A;  4LK1 F;  1QZY A;  5B1B H;  5IOZ A;  2VXZ A;  4GO1 A;  4A3L J;  1R4M B;  2MFZ A;  4CA0 A;  1MNE A;  1Z3Y A;  2K4B A;  5DCM A;  1U5T C;  5B66 C;  4OAZ A;  4JK1 X;  3QP6 A;  3WTT C;  1ETV A;  2K4J A;  3OIP A;  1DPU A;  5F27 A;  2LFB A;  1VF9 A;  2X1C A;  3VUQ A;  3I53 A;  3JTH A;  4M3E A;  3VW1 A;  2UXX A;  4HX4 A;  2VQG A;  3PFY A;  4HX8 A;  2TDX A;  1G4D A;  1JUS A;  4OIR F;  2QEX I;  2R5Z B;  5IP7 J;  3MCZ A;  3HTS B;  3M7G A;  2G9W A;  1Z3X A;  2OD5 A;  2R93 J;  2FJI 1;  3P5J A;  3SFZ A;  2DAO A;  4BHC A;  4I0B A;  5E3L A;  2VBZ A;  2EFW A;  4OD4 A;  4IZZ A;  4XLF A;  2NS8 A;  2F4M B;  2L5Q A;  3VVZ A;  3GWZ A;  1O4X A;  3UKG A;  4OWR B;  2JWT A;  2ZKZ A;  1LJ9 A;  1OR7 A;  1S72 I;  1D0Y A;  1MBE A;  2X4H A;  3KP5 A;  3QU6 A;  1YIO A;  2HTS A;  2XKP A;  1BC7 C;  3KE2 A;  2IEK A;  2O61 A;  3KEO A;  3ZQQ A;  1BR2 A;  1EH8 A;  3LA3 A;  4M73 A;  4RGX A;  3ZQG A;  4YFX F;  5HNH A;  1I1S A;  2DOA A;  1SFO J;  3GTO J;  1FEX A;  2D1V A;  1HLV A;  4CXF A;  2FNA A;  2X6W A;  2ME6 A;  3TED A;  2M0M A;  2R7U A;  1ERD A;  1EF4 A;  1T0F A;  2IA2 A;  4QPQ A;  2LDU A;  1HXD A;  2FX0 A;  1NK3 P;  5FKL A;  3IKV A;  1JUP A;  4I98 B;  2K9L A;  2VI6 A;  3L7W A;  5LEJ A;  3S1M J;  5JHF A;  3E97 A;  3HUG B;  2FBI A;  4KIB A;  1BW5 A;  3C2H A;  3IWF A;  1IUF A;  3F8N A;  2AHQ A;  3S15 J;  3EYY A;  2A6T A;  3HEF A;  5CXG A;  1L0O C;  2PMZ N;  2QQA A;  1SMT A;  2CMP A;  2LKX A;  3BTC A;  4F3Q A;  2VBW A;  3F6V A;  2FMY A;  4DW6 A;  1GVJ A;  4KIF A;  1KQ8 A;  4AC6 A;  2HOT A;  5DM7 F;  1YW9 A;  1FWZ A;  5A2Q K;  1U6G A;  4CUG A;  2JT1 A;  2KJB A;  1TWF J;  3L2Q A;  1YG2 A;  1Y39 A;  5DUK A;  2TCT A;  1HA8 A;  3Q0U A;  4XKW A;  2FEZ A;  3RCO A;  3VFZ A;  3BG3 A;  2XF5 A;  3JRH A;  5HBU A;  1TNT A;  4IRG A;  4DJA A;  3GTL J;  2HDD A;  3BCA A;  4KN4 X;  1DGR M;  3FXL A;  2ELH A;  1S5L C;  2ZXJ A;  1P4A A;  2CO5 A;  2IT0 A;  3CJR B;  1DQU A;  2FSW A;  2EQR A;  2J5O A;  4UB8 C;  1MKM A;  3I55 I;  3BQY A;  5D5V B;  5BS6 A;  2K9S A;  5LGN A;  4IHT A;  3U1D A;  3FM5 A;  3LSJ A;  3GZ5 A;  1VQN I;  4CGZ A;  3KP6 A;  4KMU X;  3PFI A;  2Y0S N;  4KJZ A;  2DMP A;  4AD9 A;  2ECB A;  1XC5 A;  4E70 A;  2GEN A;  3FHZ A;  2G7H A;  4A3M J;  3SHF A;  2QEN A;  1WJC A;  2ZO4 A;  1RR7 A;  1A04 A;  3K69 A;  3LQR A;  3NEU A;  2DA1 A;  4BBR J;  5LHG A;  1VQ4 I;  2OZU A;  3WOD F;  3KYC B;  4Y52 J;  3E6B A;  3IP4 B;  3WTU C;  1JI8 A;  2ZY9 A;  3VVY A;  4CCM A;  4Q47 A;  3TO7 A;  3DLL F;  1E0E A;  3DQV C;  3K7A J;  3B81 A;  4BH9 A;  4XON A;  4DBR A;  2VOD A;  2CH0 A;  2ZME C;  2LRD A;  1SFK A;  2RQP A;  4IPA A;  4IQ4 A;  1PUF B;  3S32 A;  4NN1 A;  2W4S A;  1QPI A;  5JVG F;  2Q8K A;  3A0B C;  3HPH A;  2OZ6 A;  2BW3 A;  1LVA A;  1FBS A;  4R79 A;  1BM9 A;  3M8F A;  4ZYE A;  4HA8 A;  4B09 A;  3A2K A;  1U2W A;  4A0X A;  4O3M A;  2VKD A;  2IJL A;  4UVC A;  2MW8 A;  2GFN A;  3R0J A;  4ETS A;  2MD5 A;  1HBX G;  4LLL A;  1O3R A;  4BXF A;  1AWC A;  1ZTR A;  4KWA A;  4Q48 A;  1YO5 C;  3PUF A;  5FGM A;  4E7J A;  2WY7 Q;  2VT2 A;  4G94 A;  2HZD A;  1Z77 A;  4AYB N;  3PNY A;  4CDG A;  4BU2 A;  3DU5 A;  4HPQ A;  2V57 A;  2GA2 A;  3HIF A;  3J7A Y;  1HCR A;  5ILU A;  1VQ7 I;  2VT3 A;  1V5F A;  3BR0 A;  4QPO A;  4EQQ A;  3IV5 A;  2WY8 Q;  3EUH C;  4MHG A;  3SDB A;  1JKQ C;  1IUY A;  2OF7 A;  1J59 A;  1ZLJ A;  2DTR A;  1WH7 A;  3LSH A;  1ETY A;  3D0S A;  5KAF C;  1OKR A;  4P1W A;  2WA0 A;  2VJJ A;  5DTD A;  1V55 H;  2QQB A;  1XB4 A;  5GAG J;  3GVA A;  2P7V B;  3GEU A;  2UZK A;  2QWW A;  2CQQ A;  4BY1 J;  1MMS A;  4MQV A;  2BY2 A;  2X85 A;  5DYM A;  3V42 A;  2M4K A;  2QBY B;  2EZI A;  4XQF A;  5ICE A;  4A3F J;  3GBG A;  4OMY A;  1BIA A;  3J80 Z;  3C18 A;  2Z16 A;  1WRJ A;  5J4V A;  2F5V A;  4GGG A;  1GVD A;  4RB1 A;  4IJA A;  2M8E A;  1K4S A;  2KP6 A;  2H8R A;  3RYR A;  2VBX A;  1HQC A;  3IH2 A;  4B8X A;  2OCC H;  1ODD A;  3FRQ A;  3W6V A;  1UJ8 A;  3ZMV A;  3LMM A;  4OIP F;  1YW8 A;  2DTZ A;  3ZN1 A;  4AID A;  4IHS A;  3CTA A;  1VQO I;  1YIT I;  1KGS A;  3VYS B;  2LY1 A;  1O3T A;  2EFQ A;  2CQX A;  2R7D A;  2UV1 A;  2BY0 A;  2LSO A;  2MLK A;  3GFJ A;  3T8T A;  1WGX A;  4MNU A;  2CG4 A;  4LLN A;  4ZTJ A;  3CCL I;  3HRT A;  3U21 A;  5F08 A;  3G71 I;  2B63 J;  1S7E A;  3PIP F;  4PCQ A;  4HQE A;  2OCE A;  5LLQ A;  4EJT A;  4GFK A;  1S9H A;  1XMK A;  5E3M A;  2V1D A;  2I8D A;  2F4O B;  1J7K A;  1LPQ A;  2W1O A;  4NQW B;  1P9Q C;  3DEU A;  4HLY A;  2DYS H;  2MSY A;  1IRX A;  1IN5 A;  2P4W A;  4A2U A;  2LBF B;  4XOP A;  3CUQ C;  2IGO A;  2BXZ A;  3M8J A;  3SZG A;  3V8K A;  3EQL F;  5HNF A;  1TTY A;  5L3F A;  4HV5 A;  2EWN A;  4M9Z A;  2RAE A;  1IZ1 A;  2A5W A;  2XF6 A;  2DG8 A;  2RV8 A;  2KLO A;  4FIS A;  4CSW A;  3MAJ A;  1VQ8 I;  2MC3 A;  4XKV A;  2EIJ H;  2KZV A;  2M7A A;  4NC6 A;  4EAT A;  2E1M C;  3JR9 A;  2DLL A;  2HI3 A;  2ZJP F;  4G7H F;  3AL0 B;  2EK5 A;  2HTJ A;  4HDV A;  1FY7 A;  1X4O A;  3KX2 A;  1X1A A;  2VC0 A;  3ZMU A;  2V1N A;  3BRU A;  3MEX A;  1WI3 A;  4NC7 A;  3CWR A;  1R23 A;  5IP9 J;  3LSP A;  2DA6 A;  4F91 B;  2OAZ A;  5LBQ A;  3OYF A;  1ZGJ A; 
#chains in the Genus database with same CATH homology
 2KDZ A;  3F1B A;  1JTY A;  5EG0 A;  3JRG A;  2Y31 A;  2R0Q C;  2NOG A;  3EGQ A;  5C4X J;  2XGE A;  4W1U A;  3LHQ A;  5FLV A;  1X58 A;  1NK2 P;  2O7T A;  1APL C;  2EBI A;  3S17 J;  3NNR A;  3BR3 A;  5F0C A;  4JNN A;  4D7M A;  5BNG A;  2JK3 A;  5DS9 A;  2YS9 A;  5C44 J;  2N8G A;  2YUS A;  3ZOB A;  3FKI J;  1ZR4 A;  5DAJ A;  2LD5 A;  1F36 A;  2VPR A;  4RDU A;  5M3M J;  1HDP A;  2LR8 A;  4QSH A;  3OSG A;  1VI0 A;  2L0K A;  2E2J J;  2GM4 A;  2NVT J;  2EZL A;  3GTK J;  4MFD A;  2CUF A;  5IP6 A;  3JRB A;  5E3O A;  4LOC A;  2HKU A;  1BA5 A;  1ORK A;  2WGB A;  3RH2 A;  1OCP A;  2XPV A;  4JP0 A;  4QTR A;  3RD3 A;  1OJL A;  1IC8 A;  3E7Q A;  3FK7 A;  3GZI A;  1Y1W J;  2G3B A;  3CDL A;  2JN6 A;  2JMW A;  1JT0 A;  5FKN A;  2LTP A;  3WHB A;  5F04 A;  2ZCX A;  1H88 C;  4A3C J;  4B1R A;  2LVS A;  2M34 A;  2R5Y B;  4IHW A;  4BKX A;  1GDT A;  4DYQ A;  2ZOZ A;  2G0E A;  3M3Y J;  4X6A J;  5FKM A;  5D18 A;  1JKR C;  3G7R A;  1LFB A;  1B8I B;  4EEF G;  3H0G J;  3C07 A;  2X9D A;  3ON4 A;  3VP5 A;  2R5Y A;  4FCY A;  1MBJ A;  2QCO A;  1ETQ A;  2NP5 A;  3FK6 A;  2Y30 A;  1W0T A;  5HAW A;  3BG5 A;  3BR6 A;  3KZ9 A;  3HBL A;  2M9H A;  1ETK A;  1JGG A;  2OER A;  1B8I A;  5J1Y A;  2G7G A;  2UXP A;  1U9N A;  2RAS A;  3RQI A;  5J1R A;  3RZO J;  3JRA A;  1FTZ A;  1JT6 A;  1UG2 A;  2Y9Y A;  4MLO A;  3LJL A;  2QF7 A;  2QIB A;  2JA5 J;  1FIA A;  4D5C A;  4MK6 A;  5FGL A;  1JJ6 C;  1ITY A;  2Y9Z A;  3HKZ N;  2IU5 A;  3LSG A;  5FJ8 J;  3JRE A;  1UHS A;  1MH4 A;  3HOU J;  1IRZ A;  5F0H A;  3FIW A;  3Q0W A;  1K61 A;  1I6H J;  3RKQ A;  2GLO A;  4GFB A;  4HKU A;  3NRG A;  4ACI A;  4C3H J;  3C2B A;  1JUM A;  3S1N J;  1B72 B;  2NVY J;  1AKH B;  2DN0 A;  1TWH J;  1XS9 A;  2DG7 A;  2REK A;  3BT9 A;  5M3F J;  3NAR A;  4QIW N;  2DMU A;  4IEJ A;  1QVU A;  2HOA A;  3ZQC A;  1LFU P;  5C4Y A;  4M6V A;  2X6O A;  3T6N A;  1YRN B;  5EYR A;  4XK4 A;  1IDZ A;  4XID A;  1B72 A;  3M4O J;  3S2H J;  3E7L A;  5GP9 A;  5D1R A;  4BBS J;  2K9Q A;  1CQT A;  1OFC X;  1TWC J;  3HOW J;  3V78 A;  1ENH A;  3OOU A;  1AU7 A;  2FJ1 A;  1YRN A;  2F07 A;  3G1L A;  2NX4 A;  5F0F A;  3B6A A;  5CW8 A;  3GTG J;  4NEL A;  3VW0 A;  1IV6 A;  1UMQ A;  2MG4 A;  2H1K A;  2R7Z J;  1I50 J;  1BJZ A;  3O8G A;  4M3G A;  2LY9 A;  5IOZ A;  3S1R J;  3K2A A;  4A3L J;  3AQT A;  3ANP A;  3GTP J;  3CQZ J;  2XPW A;  3HOZ J;  3QKX A;  5EEA A;  3A03 A;  3VIB A;  1VND A;  4FE7 A;  2M8G X;  1ETV A;  5J3L A;  4MFE A;  3HTH A;  5F27 A;  2LFB A;  1VF9 A;  2E2H J;  4GCT A;  1RES A;  3GTQ J;  4A3B J;  3G1O A;  3VUQ A;  3WHC A;  2ZCM A;  4YZE A;  2HQ5 A;  3JRI A;  2RHA A;  3F0C A;  4M3E A;  3VW1 A;  2ZOY A;  2FBQ A;  2Y2Z A;  2PBX A;  3DEW A;  3TW7 A;  3QPS A;  1GT0 C;  2L9R A;  5JLX A;  1JUS A;  2R5Z B;  3PM1 A;  4XIC A;  5IP7 J;  3BNI A;  3DPJ A;  3I4M J;  2R93 J;  5K58 A;  3NXC A;  5IYB J;  1U9O A;  2XGD A;  1ETW A;  3NAU A;  5E3L A;  4DYR A;  3HE0 A;  1TWA J;  2ECC A;  4X1E A;  3VVZ A;  2NS8 A;  2R5Z A;  3ZQH A;  3HOV J;  1O4X A;  3UKG A;  2CU7 A;  2JWT A;  1FTT A;  2LP0 A;  3COL A;  2K40 A;  3SDG A;  1RET A;  3JRF A;  2YVH A;  1MBE A;  2GUH A;  3BCG A;  2XPU A;  3BR1 A;  1ETX A;  5HSZ A;  1GUU A;  3BTJ A;  4A3J J;  2IEK A;  3HOX J;  5IYC J;  2KT0 A;  3A02 A;  1QRY A;  3ZQG A;  4JL3 A;  5F1J A;  3VVX A;  4UDS A;  2JA7 J;  1SFO J;  3GTO J;  1FEX A;  3VOX A;  3CJD A;  1HLV A;  2IBD A;  5FLM J;  2ME6 A;  3TED A;  4ICH A;  3KNW A;  1EF4 A;  2NS7 A;  4M3D A;  3DCF A;  1OCT C;  2G7L A;  5AQC A;  2GBY A;  3RZD J;  1TWG J;  1ZGW A;  1MBF A;  1NK3 P;  4DZP A;  2FX0 A;  5FKL A;  2HXI A;  4BXX J;  3MVP A;  1JUP A;  2VI6 A;  4AC0 A;  1DU0 A;  3S1M J;  1AHD P;  1BW5 A;  2E1O A;  2L7Z A;  3TP0 A;  2QOP A;  3S2D J;  4PXI A;  1IUF A;  1HOM A;  2Q24 A;  3IUV A;  2HYT A;  2DA7 A;  4XRS G;  3HTA A;  2AHQ A;  2DJN A;  3S15 J;  3H3V K;  1WCM J;  2AO9 A;  3HEF A;  5CXG A;  2EH3 A;  2MGQ A;  2PMZ N;  1RKT A;  2XGC A;  3MNL A;  2LKX A;  2VUM J;  2FD5 A;  2CUE A;  3BTC A;  3ZQI A;  4GCK A;  4DW6 A;  3HOY J;  4AC6 A;  2IAI A;  1X2N A;  3IH3 A;  2DMT A;  2D6Y A;  2HOT A;  3HDD A;  4DYC A;  3VOK A;  3ZQF A;  3CMY A;  1E3O C;  1TWF J;  5D19 A;  4L5E A;  2TCT A;  5K7H A;  1W0U A;  3Q0U A;  4I6Z A;  2ID3 A;  4JYK A;  3B6C A;  5M5Y J;  3HGG A;  1K83 J;  3BG3 A;  4V2G A;  3JRH A;  5HBU A;  3GTL J;  2UXH A;  3ZQL A;  2HDD A;  4A93 J;  3BJB A;  4C3I J;  2JA8 J;  1GV5 A;  4CGR A;  3TW6 A;  2EQR A;  5C3E J;  4A3K J;  5IYD J;  2QWT A;  2FQ4 A;  3BQY A;  3PO2 J;  2K9S A;  3CCY A;  1AKH A;  3LSJ A;  4V2F A;  1DU6 A;  1IGN A;  2HOS A;  4W97 A;  1X2M A;  1UI5 A;  1RKW A;  2ZB9 A;  3FIS A;  3QPL A;  2Y0S N;  4BY7 J;  3NI7 A;  2DMP A;  2ECB A;  1XC5 A;  3AQS A;  2GEN A;  3EUP A;  4A3M J;  2HYJ A;  1MSE C;  2XSD C;  1RR7 A;  1GV2 A;  1Q1V A;  2X48 A;  4L62 A;  4BBR J;  3NPI A;  2DA1 A;  3ANG A;  3OSF A;  4MO7 A;  4Y52 J;  2L7M P;  3VVY A;  4JX6 A;  1U78 A;  1MBG A;  5EZG A;  2ELK A;  3K7A J;  3S1Q J;  3B81 A;  1POG A;  1P7J A;  3SFI A;  3HM5 A;  1PUF B;  1MBK A;  3CRJ A;  4GFL A;  2K9N A;  4NN1 A;  2QTQ A;  1QPI A;  9ANT A;  5EZH A;  1ZK8 A;  2DA5 A;  2O8K A;  3D1N I;  4C3J J;  1MNM C;  4C2M J;  3V6G A;  4B3A A;  2QKO A;  1T56 A;  1PUF A;  4IHY A;  1RPW A;  2DA4 A;  4FTH A;  5H9T A;  2E19 A;  2MW8 A;  2EZK A;  2GFN A;  1MBH A;  4GCL A;  1BW6 A;  1ZR2 A;  4UUT A;  1ZTR A;  3O8H A;  4D7N A;  2W53 A;  4KWA A;  2DA2 A;  3A01 B;  4Y7N J;  1Z77 A;  4AYB N;  1HDD C;  5M5W J;  3HGY A;  2M2E A;  2V57 A;  1F43 A;  1P7I A;  5FHP A;  4A3D J;  1I3Q J;  2W48 A;  1HCR A;  5M5X J;  3A01 A;  1ZKG A;  1JTX A;  3BR0 A;  3IV5 A;  3G56 A;  4B4C A;  2R92 J;  1JKQ C;  2PZ9 A;  1R9T J;  3VW2 A;  3I4N J;  2OF7 A;  1WH7 A;  5J1U A;  1ETY A;  3S5R A;  2UXO A;  5EFY A;  4RBO A;  2UXU A;  3KKD A;  1JKP C;  1SGM A;  5DTD A;  3SJM A;  3S16 J;  2ID6 A;  2DA3 A;  4J19 A;  2TRT A;  3O60 A;  3GEU A;  3BTI A;  2JJ7 A;  3PO3 J;  1XG1 A;  4JX5 A;  3OIO A;  1G2H A;  2CQQ A;  4XRM A;  4BY1 J;  1IJW C;  3ON2 A;  2G7S A;  3TP3 A;  4A3I J;  2EZI A;  4A3F J;  3GBG A;  1D5Y A;  4MIM A;  1GVD A;  1T33 A;  5GPA A;  1BL0 A;  2H8R A;  3IH2 A;  2M0C A;  3Q0V A;  4DZJ A;  2ME0 A;  2OI8 A;  5C4J J;  3FRQ A;  3W6V A;  3P9T A;  4IHX A;  2CRG A;  2COB A;  3Q3S A;  3BTL A;  4M3B A;  2WV1 A;  2LK2 A;  2WUI A;  2CJJ A;  2DTZ A;  1TC3 C;  4S0H B;  2NP3 A;  3PAS A;  1SAN A;  2OPT A;  3BR5 A;  4M3F A;  4A3G J;  1ETO A;  1JKO C;  3JRC A;  3LNQ A;  2NVX J;  4AUX A;  2CQX A;  2P81 A;  3QQA A;  1WGX A;  3BG9 A;  1H8A C;  1WPK A;  2O7O A;  2HXO A;  1WH5 A;  5EF6 A;  2WB1 N;  3IH4 A;  4A69 C;  5F08 A;  2B63 J;  1S7E A;  2LLK A;  5HOD A;  1JJ8 C;  2YU9 J;  3HIM A;  1MSF C;  5E3N A;  3HTI A;  4GFK A;  2UXI A;  5E3M A;  5IPA A;  3LOC A;  3L1P A;  1LE8 B;  3MN2 A;  4XRS A;  1A6I A;  2MSY A;  4NDL A;  5K7Z A;  5FKO A;  3HTJ A;  2VKV A;  3LWJ A;  1NTC A;  1LE8 A;  1IG7 A;  2XB0 X;  1Z0X A;  3MKL A;  5JLW A;  2XDN A;  5FMP A;  2DMN A;  2RAE A;  1FJL A;  3GTM J;  4I76 A;  4JX4 A;  2DG8 A;  4JKZ A;  2XB5 A;  4CYC B;  2D5V A;  2NVQ J;  2O9L A;  4FIS A;  1QVT A;  3PPB A;  2E2I J;  3GTJ J;  4ABZ A;  1H89 C;  1Y1V J;  1UI6 A;  5EGO B;  3S14 J;  5K7F A;  5GPC A;  4IHV A;  3VPR A;  4HNV A;  4AF5 A;  2JA6 J;  4CYC A;  2ZCN A;  4D5F A;  2YVE A;  3BR2 A;  4FE4 A;  2HI3 A;  3JR9 A;  1ZQ3 P;  3HB9 A;  3QBM A;  2EZH A;  2L7F P;  5IOY A;  5EDN A;  2I10 A;  5EGO A;  2XRL A;  3BQZ A;  1U8B A;  4UUS B;  1VFC A;  1HF0 A;  3G1M A;  3JSJ A;  4MXM A;  4G12 A;  2VKE A;  3KKC A;  3LSR A;  4ME9 A;  2WAQ N;  3BRU A;  1WI3 A;  5EG0 B;  1FIP A;  3CWR A;  2DMQ A;  5FKK A;  1IDY A;  5IP9 J;  3JRD A;  3BHQ A;  3LSP A;  5CXI A;  2DA6 A;  4UUS A;  1MH3 A;  1A5J A;  4A3E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...