3FIWA

Structure of sco0253, a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
173
Chain Sequence
b'KMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAEIDHESAFEAGLALITDGLVRHVDAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title Structure of SCO0253, a Tetr-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription regulator
total genus 56
structure length 173
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fiwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3fiwA02
3GTKJ 3PPBA 1WGXA 3VVXA 3CCYA 2HYJA 5K7FA 4RDUA 1PUFB 2E19A 2GBYA 3JSJA 5FLVA 3JRBA 1R9TJ 3BR2A 4A3IJ 5M3MJ 2OPTA 3TW7A 2Y30A 2VPRA 4XK4A 4C2MJ 2D6YA 2XGCA 1LFUP 3DEWA 1IC8A 1MBEA 2DA5A 3BTJA 4JX5A 1U9OA 2JA7J 3EGQA 3M3YJ 1HLVA 3DPJA 1NK2P 3FIWA 4G12A 5EZHA 2XPWA 3KKCA 3KNWA 1OCTC 1I50J 5EDNA 4I6ZA 1UHSA 5F08A 2QCOA 3SDGA 3BRUA 3COLA 2CQXA 5FKNA 5IP6A 3VOXA 2LD5A 3BTLA 1WH7A 5IPAA 3C2BA 3RKQA 4BKXA 4QIWN 1IRZA 3S1QJ 3VOKA 2DA7A 3A02A 2HQ5A 1E3OC 3ANPA 1Y1VJ 4A3FJ 5IP7J 3OSGA 3HDDA 4QSHA 3I4MJ 3RD3A 4IHYA 3FISA 3S2HJ 3OIOA 1AKHA 2W48A 9ANTA 4HNVA 1OFCX 3Q0VA 4A3KJ 2ID6A 1VNDA 3BR1A 4DYCA 4UUSB 1PUFA 3BT9A 2R0QC 2LP0A 2XB5A 5HBUA 3BR6A 5H9TA 4BY7J 3W6VA 3SJMA 2DG7A 1APLC 3VIBA 1Y1WJ 4A3GJ 3FK7A 4YZEA 4AC0A 1X2NA 1LE8A 2YVEA 4GCLA 2XDNA 2JA5J 3HOZJ 1U78A 2RAEA 1TWHJ 1CQTA 4D5CA 2NVQJ 2XGDA 2NS7A 4JX4A 2HOSA 5IOZA 1P7JA 3A01B 3TP3A 4ABZA 3UKGA 2O7OA 1DU6A 1T56A 3GTQJ 3E7LA 2UXUA 3T6NA 3G1MA 3HB9A 1BJZA 3GTJJ 3GTLJ 3CDLA 4CYCA 3HOWJ 1BW6A 2O7TA 2REKA 2YVHA 2M9HA 5JLXA 4DZJA 2CJJA 3WHCA 1IDZA 3GTMJ 3OSFA 3VW1A 2JMWA 3O60A 3QPLA 3QQAA 2L9RA 4S0HB 2NX4A 1FTZA 3SFIA 2EZIA 3S14J 5IYBJ 1DU0A 4A3BJ 3AQTA 2E2IJ 2COBA 2ECBA 2QIBA 3LSPA 2R92J 3JRAA 2JK3A 4UUSA 1TWGJ 4MXMA 1B72B 1F43A 4FE4A 2TRTA 2G0EA 2L0KA 3HEFA 3LSRA 2FJ1A 1IGNA 3VP5A 4ACIA 2IU5A 1ZK8A 2ZOZA 3B81A 3S17J 2HOTA 2K9QA 2EBIA 2I10A 1IG7A 1H89C 1Z0XA 3RZDJ 4IHWA 4A3JJ 1SFOJ 3QPSA 2LK2A 3GZIA 5IYDJ 3LSJA 4J19A 3A01A 4FCYA 1YRNB 3HGGA 1ETYA 1FIPA 1SANA 2Q24A 1U9NA 3Q3SA 1T33A 1MNMC 2V57A 5E3NA 3ZQIA 2R93J 5CXIA 2G7LA 3HKZN 1ZR2A 2LY9A 3PM1A 4Y52J 2WV1A 4BXXJ 2CUEA 2DA4A 3RQIA 1HDPA 5CXGA 5K7ZA 2JA8J 3S2DJ 4NELA 2GLOA 4GCTA 2WGBA 4DZPA 2YS9A 3S5RA 1UG2A 2W53A 5F0FA 3GTPJ 3ON2A 2HXIA 3ANGA 1BW5A 3BQZA 1WPKA 3RH2A 3G56A 5HSZA 1Q1VA 4M3BA 1WCMJ 2PBXA 4GFBA 4AF5A 5IP9J 2HKUA 3Q0UA 5EGOA 2ZCXA 2NS8A 3LSGA 4FTHA 2WB1N 1UMQA 2M8GX 1B72A 3S16J 3IH4A 4L62A 2YUSA 3B6AA 1I6HJ 2DN0A 1TC3C 1RPWA 1RESA 1U8BA 2DMUA 2R5ZB 3O8GA 2HI3A 2UXIA 2GUHA 4XRMA 3NARA 1IUFA 4JYKA 5F0CA 3NAUA 5C44J 2M2EA 3BQYA 2KT0A 3VVZA 4JL3A 1S7EA 3PASA 3K2AA 4MK6A 2L7ZA 2AO9A 4A3CJ 1BA5A 2Y31A 2MG4A 2K9SA 2CUFA 2LKXA 4IHVA 1ETKA 1MH3A 1W0UA 1QVTA 1HF0A 4XIDA 2NOGA 2Y2ZA 2QTQA 2DTZA 2JN6A 1NK3P 1JUPA 2DJNA 4FISA 4GFLA 5M5WJ 2Y0SN 1I3QJ 2ECCA 3K7AJ 3JRDA 2EZLA 3H3VK 2LLKA 5J1UA 5FHPA 1X2MA 2EZKA 4B1RA 3NRGA 2L7FP 1VF9A 1IJWC 5GPAA 2FD5A 4BBRJ 4W1UA 1MBJA 3BG3A 1LFBA 2LFBA 4AC6A 5HODA 3VW0A 2EZHA 2H8RA 2P81A 2NP5A 2ME6A 1OJLA 2UXOA 5EEAA 5FKKA 3V6GA 1WH5A 3FK6A 1ETWA 5M5XJ 1TWCJ 1AU7A 4ME9A 5EYRA 2WAQN 3BR5A 3ZQLA 1ZR4A 2QWTA 1GV2A 3ZQGA 3GBGA 1A6IA 4JNNA 1JT0A 4GFKA 1JTXA 1RETA 5F27A 1Z77A 2XPVA 3HM5A 4XRSG 2KDZA 1MBHA 4DW6A 5J1YA 2OI8A 2IEKA 3HOXJ 1K61A 2PMZN 3HOUJ 2GM4A 3CJDA 2K9NA 1BL0A 1JT6A 3HOYJ 3IUVA 3VUQA 4JKZA 5K58A 1JJ6C 2Y9YA 2IAIA 1ENHA 3HGYA 1OCPA 5DS9A 5EG0B 1JJ8C 4B3AA 4C3HJ 2D5VA 2RHAA 3FKIJ 1XC5A 4AYBN 1FJLA 3HBLA 4JX6A 2E2HJ 2MW8A 2XRLA 1JUSA 3IV5A 2Y9ZA 4XRSA 5EF6A 4C3JJ 4JP0A 3GTOJ 1GUUA 4Y7NJ 2CU7A 3A03A 3CQZJ 2NVYJ 5M5YJ 1JGGA 2NP3A 1ETVA 5F04A 4MIMA 3NPIA 2LR8A 2FBQA 2NVXJ 5F1JA 1ETOA 1QRYA 2UXHA 1POGA 3LOCA 1D5YA 1GVDA 3BR0A 1JKRC 2DG8A 4UDSA 2IBDA 3BCGA 1ORKA 3BHQA 4M3DA 5EFYA 1GV5A 1MBGA 5M3FJ 5GPCA 1JKQC 4A3EJ 3LWJA 3MN2A 2X9DA 2X48A 5C4XJ 4MFEA 2DMTA 1QPIA 4LOCA 3JREA 2G7SA 1H88C 3G1OA 5HAWA 2R7ZJ 1MSEC 5C3EJ 2ID3A 4MLOA 2WUIA 1JUMA 3BG5A 3JR9A 3P9TA 3C07A 1FIAA 4DYQA 5IYCJ 3IH3A 2EH3A 5CW8A 4D7NA 2OERA 5EG0A 3F0CA 4BY1J 4V2FA 1AHDP 3S15J 2DA2A 3GTGJ 2PZ9A 3LHQA 3B6CA 3BTIA 3G7RA 2MGQA 2XGEA 5FKLA 4PXIA 1AKHB 3VVYA 2YU9J 1JKPC 1HOMA 2H1KA 4BBSJ 3NNRA 2R5YB 1ZTRA 2CQQA 3IH2A 5AQCA 3BG9A 1GDTA 3FRQA 3MKLA 3D1NI 2HOAA 2HDDA 2NVTJ 1XS9A 3M4OJ 3GEUA 2XPUA 4C3IJ 5E3MA 3EUPA 3VPRA 1LE8B 2E2JJ 1EF4A 1UI5A 2F07A 1F36A 4A3DJ 3KZ9A 2ZOYA 4M3EA 1RKWA 2DA6A 1O4XA 3HOVJ 2ZCNA 1YRNA 2E1OA 2LTPA 5FKMA 5GP9A 3MNLA 2L7MP 2JA6J 4AUXA 5DTDA 1TWAJ 3ZQFA 2O9LA 4M3GA 2QF7A 2ZB9A 5K7HA 3L1PA 4B4CA 2DA1A 3JRCA 3CMYA 3I4NJ 2FQ4A 4L5EA 2XSDC 1VFCA 1FEXA 3S1RJ 3HTIA 4CYCB 2DMQA 3DCFA 5FJ8J 1FTTA 3HTAA 2VKVA 5FKOA 4X1EA 4M3FA 3HTHA 3PO3J 3Q0WA 4M6VA 5J3LA 4A69C 4QTRA 2MSYA 3ZOBA 1JKOC 5D1RA 2LVSA 3MVPA 3ON4A 1ZKGA 3NXCA 1B8IB 1X58A 1IDYA 3TP0A 3JRHA 2AHQA 2R5YA 2R5ZA 5C4YA 2ZCMA 4EEFG 1P7IA 1JTYA 3HTJA 2JJ7A 1ITYA 3BJBA 2O8KA 3BNIA 3KKDA 2VUMJ 4I76A 4RBOA 4MO7A 4KWAA 3JRFA 5BNGA 2JWTA 3LNQA 1ETQA 5FLMJ 4IEJA 3AQSA 3RZOJ 4FE7A 3V78A 5EZGA 3H0GJ 1ZQ3P 5FGLA 2G7GA 3LJLA 2K40A 4A3LJ 1MSFC 4V2GA 2FX0A 1W0TA 4UUTA 1RKTA 3BR3A 3ZQHA 3TEDA 2RASA 2QKOA 2X6OA 5IOYA 3NI7A 1XG1A 4NDLA 5E3OA 3TW6A 3HIMA 1MH4A 3CWRA 4W97A 2UXPA 4GCKA 1HCRA 3OOUA 2GFNA 4HKUA 1ETXA 5FMPA 1MBKA 3JRIA 1IV6A 1K83J 3S1MJ 2EQRA 1SGMA 2DMNA 2G3BA 1RR7A 4NN1A 5F0HA 3F1BA 2OF7A 1G2HA 4ICHA 1B8IA 1HDDC 2VI6A 5JLWA 2N8GA 3S1NJ 5EGOB 3E7QA 1NTCA 3HE0A 3QKXA 3VW2A 4D7MA 4A93J 4XICA 1TWFJ 4CGRA 3QBMA 5D18A 3BTCA 2ME0A 2QOPA 3ZQCA 1UI6A 1VI0A 1H8AC 5E3LA 1MBFA 4DYRA 2GENA 3CRJA 4A3MJ 4D5FA 5C4JJ 2M0CA 3JRGA 5D19A 2DA3A 3G1LA 3O8HA 2HYTA 4IHXA 3PO2J 5DAJA 2HXOA 4MFDA 1ZGWA 1A5JA 2VKEA 2M34A 5J1RA 2ELKA 2CRGA 2XB0X 4X6AJ 1QVUA 1GT0C 3WHBA 2B63J 1WI3A 2DMPA 2TCTA
chains in the Genus database with same CATH superfamily
3IAM2 1K7AA 5D5UB 3HSRA 3IUOA 2HYJA 2KIFA 2QGUA 3F8MA 3OYHA 1PUFB 5L3DA 2GBYA 4YIIA 2ZJ2A 3JSJA 3ONQA 3N4MA 2V79A 2Y30A 2HFHA 2L9NA 4N9HA 3CC4I 1IN6A 2DA5A 1R4MB 4JX5A 1U9OA 4UV8A 2JA7J 4PGGA 3EQLF 3DPJA 2VC1A 4G12A 2A6EF 2J5PA 2WV0A 3ZMVA 3KNWA 2ELHA 3ZR8X 1I50J 4OIQF 5ED4A 1O57A 2QCOA 3SDGA 5LHIA 2CQXA 4IXAA 1Z3XA 5IP6A 3DBRB 2VBYA 3BTLA 1WH7A 2W57A 5GAEJ 4I2OA 3RKQA 1BR2A 3PSFA 4QIWN 2PQ8A 3A0HC 1BBYA 4BQNA 4CZCA 4Q4ZF 4MGRA 2O0YA 3EUHC 3DEUA 3E5UA 2R7TA 4X0GA 2DBBA 3OSGA 1MMSA 4OWRB 4PUSA 1TBXA 2DT7B 2QM3A 1VQ5I 2M45A 2A05A 1OYWA 1HW5A 2W48A 4Y15A 1AKHA 1OKRA 2FOKA 1VNDA 2LBFA 3DTIA 4UUSB 3MFKA 4NQWA 2LP0A 2XB5A 1REPC 4H4KC 4IQJA 4L9NA 4BY7J 3W6VA 3CJTB 1DPRA 1R00A 2R7WA 3FK7A 4YZEA 4E70A 2LH9A 1BR4A 2XDNA 1FSEA 2JA5J 5TJJA 3MKYB 1JXSA 2NVQJ 3CJNA 4CGZA 3N97A 1S7OA 1TQMA 2QKMB 3KP5A 4HF0A 1G6NA 4ABZA 2PJPA 1E17A 1FBSA 5JHUA 3RPUD 3HPHA 1TTYA 1GVJA 3E7LA 3I71A 2UXUA 4RAZA 3KEQA 3HRTA 1XSVA 3RKYA 3OYNA 5JFRA 2TDXA 3WTYC 1H0MA 3GTJJ 3WU1B 3CDLA 1WSUA 3GTLJ 3HOWJ 4DQ2A 4V19K 3CCMI 5L3FA 1WQ2A 3WHCA 2Q1ZB 4XOTA 1HQCA 3GTMJ 1YX5A 3VW1A 2JMWA 3M8EA 2E5NA 4S0HB 2QQ8A 4A3BJ 5AONA 3AQTA 3JW4A 2R92J 3W2VA 3DLAA 2R7OA 2VJIA 4XNFA 4EJTA 1F43A 4U0YA 4CSWA 3HSEA 1ZK8A 1ZYRF 2DT6A 1W5SA 3ML6A 2K9QA 2QUFA 3KEYA 1H89C 4O3MA 4ZYGA 4IHWA 3OOPA 1SFOJ 4Q5SF 2XHKA 1YW7A 4PZJA 1V54H 3KLOA 3QP6A 4FCYA 1SANA 1X3WB 1W5CC 2BGCA 2JVHA 3Q3SA 4BQQA 5E3NA 5CXIA 1ZR2A 4OIPF 3TGNA 1K4TA 2NVUB 1W5TA 4XSZF 3TDUC 1AA7A 3E6BA 4DBQA 4LIVA 1R4NB 3SXYA 4F3QA 5K7ZA 4NELA 4GCTA 3P7NA 2YS9A 4GRIA 4K2EA 4Z2YA 3OR1C 3IC7A 1TL8A 1XGSA 3SHFA 3RH2A 2OC6A 4HRIA 1FPQA 1FLIA 4GFBA 2A68F 1PYVA 2ZFWA 3VSKA 2EFOA 2XSJC 4ZDOA 2NS8A 1UMQA 3H9GA 2Q8KA 2M87A 2YUSA 4PJMA 3GFIA 1I3AA 4UHTA 1QZEA 1U8BA 3CUQA 2R5ZB 3O8GA 4NHJA 2HI3A 4PJNA 5DV5A 1Z7UA 5D8LB 4XRMA 1IUFA 3VVZA 4JL3A 2KP6A 2M2EA 3BQYA 3E0JB 4B44A 2HPMA 1YYVA 4U7BA 1PVEA 2B0LA 5KCMA 3WTZA 1BOAA 2H09A 3RYRA 4B09A 5D4SA 3K1MA 4ESFA 3HYIA 4A3CJ 1BA5A 4EATA 1TNSA 2K9SA 4HNTA 2LKXA 1KZHA 1ETKA 1MH3A 4ZTFA 1PUEE 2M8EA 1QVTA 4KMUX 4XONA 3RDIA 4XIDA 2NOGA 2QTQA 2DTZA 2BY2A 1X1DA 3DTEA 1JUPA 3CCEI 4FISA 4GFLA 4OOIA 4D9JA 1DPUA 3FMQA 2ECCA 3SFZA 1MW7A 4AIHA 4H0EA 2YX4A 3OIQA 1V5GA 2LLKA 4KUMA 3JTHA 3VYRB 1YITI 2L7FP 4LGWA 3OS2A 3IWZA 2FD5A 3CJQB 3DKWA 3FDYA 4W1UA 3BG3A 4BBRJ 4L0YB 2LFBA 3F6VA 3FXMA 2CO5A 2EZHA 2H8RA 3K1NA 2L54A 3QP5A 2M7BA 2UXOA 2UWMA 4GCVA 2L01A 2V1UA 1IN8A 2HVQA 1MZBA 3WTTC 4KYWA 1ZR4A 4BE2A 2CW7A 1D3YA 2QWTA 1GV2A 3ZN1A 2G9WA 2HS5A 1Z77A 2KDZA 1KU7A 4DW6A 2IEKA 4J00A 2MD0A 4EM2A 3HOXJ 3CCRI 1IF1A 4OD5A 3VYTB 4BH9A 2X1EA 2GM4A 2K9NA 3MZ8A 4CCNA 4E7KA 4UUVA 3G4SI 2ZJQF 4BE1A 1K6OA 2IAIA 3HGYA 3GLXA 1SD7A 2EILH 4YG2F 5CJ9A 1A6QA 3I4PA 4C3HJ 1JJ8C 2D5VA 2A5WA 2FOWA 4MHGA 5CVRA 3HSFA 4Q47A 2DT5A 4UNOA 2XRLA 3E6CC 3EUKL 4C3JJ 4IZZA 1GHCA 3A0BC 5BPDA 1R7JA 2VLAA 4Y7NJ 3EYIA 3L2WA 1FOWA 2NVYJ 1T8IA 3GCMA 1JGGA 3IKTA 3MKZA 1SFKA 5DEQA 1XX5A 4FX0A 4IPAA 1ETOA 2JT1A 2W1OA 1D5YA 4CXFA 3TO6A 3KYDB 4G8XA 2IBDA 4JOMA 1ORKA 4EM0B 1U5TB 2WY8Q 5M3FJ 3BDDA 2ZBKA 5GPCA 4XOPA 3FXKA 2QSHX 3HOSA 1RC9A 2X9DA 2E35A 4MFEA 1B59A 3WG9A 1IRXA 4LOCA 3JREA 3J80K 1H88C 2G7SA 4LITA 1BIBA 2R7ZJ 3PFIA 2ID3A 5KNLA 2BV6A 2BZTA 3P9TA 2EFWA 1FIAA 2MLKA 1VTNC 4DYQA 3I5UA 4ZC3A 4P55A 1FBUA 4LB5A 1RUOA 1ERDA 1P6RA 4HX4A 5EG0A 1N77A 1YW9A 4V2FA 5BQTA 4N4NB 2DA2A 3GTGJ 2PZ9A 3LHQA 3S3OA 2DFHA 3BJ6A 3IRRA 1YO5C 5LGUA 4PXIA 2A6TA 1U0JA 4BEHB 3QRFF 1JKPC 2YU9J 3V4GA 2VJ5A 2H1KA 4FQGA 1FWZA 3QOPA 2FMLA 3MKLA 4RB2C 3WODF 3D1NI 1WHUA 1I27A 2W00A 4CHUA 1XS9A 2Y0MA 2F07A 2YR2A 4A3DJ 3QU6A 2RC4A 1ON1A 5H6QA 2ZOYA 4M3EA 5D5XB 1UJ8A 2ZCNA 2MYSA 5LGTA 3OYJA 1OISA 5GP9A 3MNLA 2VKHA 3PUBA 4UVCA 3I59A 5DTDA 3Q9VA 4CICA 2W25A 3DPTA 4HF2A 5J8CA 3OY9A 2M30A 1RNLA 2ZB9A 1ZRCA 3CCVI 3CMYA 2LREA 3MKWB 3L7WA 1U3EM 2P7VB 4ZTJA 1VFCA 1WJ5A 2BOLA 4HBLA 3SZPA 2FA5A 1HSTA 2H6CA 3HTIA 3HUGA 2YX7A 3HTAA 1BM9A 1T0FC 4E7SA 3KP6A 1T39A 2LDUA 3RYPA 1FSHA 4KFCA 5J3LA 3OYMA 1Y56A 4NC6A 2MSYA 3DV8A 1N75A 2LVSA 3FKJA 2FSWA 2JA2A 4IO9F 2ESHA 3CZ6A 1IDYA 3TP0A 2ZC2A 4NBQA 2R5YA 2DJIA 2DODA 3QYBA 2W4SA 4BDYA 2RGVA 5FD5A 2XAQA 1SVOA 1FNNA 3UNGC 2EIKH 3AG1H 1IV8A 2E1MB 5D6EA 2FQ3A 2DAOA 5FLMJ 2VE8A 4IJAA 3HPGA 4RAGA 5KAFC 5ERIA 3QYEA 1YOVB 3X2QH 3KEOA 4RA2A 3CESA 1P4WA 3WGGA 1DGRM 5LEKA 1F1ZA 2VBZA 3LAPA 3H36A 2MBFA 1YW8A 1MSFC 2OU2A 5BMZA 3BR3A 2RASA 3ZQHA 2IGKA 2X6OA 3I64A 3H9JA 5GTHC 5DYMA 1XG1A 2O3FA 2CS3A 2I8DA 4RLFA 2DI3A 2DPUA 1BI2A 1ETXA 5FMPA 1K83J 2A61A 1YTYA 3BY6A 2G7HA 1JHHA 1WKMA 1D0XA 1YX3A 4NN1A 2P6SA 3F1BA 1G2HA 4ICHA 2ZCWA 1AWCA 2V1DA 4AIDA 2PJRA 1MNDA 5EGOB 4D7MA 3OV8A 4CGRA 3QBMA 2OCEA 2LKPA 2H1LA 1QZZA 2KRCA 3V8KA 3BZCA 2KIMA 4CYDA 4E6KG 3ZQCA 1H8AC 1KQ0A 3HL2A 4RB0A 3CRJA 3ESWB 3OR2C 4D5FA 4LK1F 4ZYDA 3SWHA 3VODA 1V4RA 4Z6YA 1SMYF 1A5JA 4CUGA 5J1RA 3EPZA 1N25A 4F92B 3COAC 2CRGA 1D1BA 1SMTA 4X6AJ 5D6FA 2Y0SA 2B9SA 4ZDPA 4J01A 3NS4A 4EGYA 1QVUA 2DU9A 1W7PA 1GT0C 1WGXA 2MLGA 3RPQA 1HC8A 6PAXA 1FZPB 4IF4A 3DP7A 5GAGJ 2Q0OA 3VVXA 3CCYA 2NXNB 4RDUA 2XF7A 2NNNA 1G3SA 3ABMH 2JVGA 5FLVA 3JRBA 1J59A 4A3IJ 3GMEA 1U8RA 1KU2A 2VPLA 3H9QA 3FZVA 3PUFA 4C2MJ 2D6YA 2L9SA 2X6YA 3HTSB 2WAQA 3FHZA 5LHHA 5DDGA 4Q48A 5B1AH 2PX9A 1FP2A 5CVIA 5EDNA 5F08A 3S8PA 5HLGA 4IOCF 5FKNA 2PMZA 3H35A 1XDSA 1R36A 3C2BA 3BWGA 4BKXA 4KICA 4LG3A 3ASOH 5J4YA 1USSA 1IRZA 1SVLA 3L00A 4RLQA 1I6XA 1LVKA 2DA7A 4LB6B 1F4KA 5JI6A 1BN5A 1Y1VJ 5DCMB 3ZMTA 5IP7J 4AYBA 4A3FJ 1FOKA 1VQ6I 4XM3A 3RD3A 4XLNF 3MAJA 3FISA 4IHYA 1G59A 3OIOA 2AQFA 3DEEA 4I98B 1SVMA 1OFCX 3AKZA 4A3KJ 2ZMEB 1LKXA 2ISYA 2XKOA 3B73A 1W36D 1PUFA 4I01A 2YU3A 5HS9A 3BR6A 3AG3H 3SZGA 3WG7H 1S72I 3OWTA 2IVMA 2VJ4A 1HA8A 2F5CA 2ZXJA 3DU6A 2F5DA 1Y1WJ 2M0MA 2P8TA 1VQKI 4AM3A 1SD5A 1LE8A 4WXCA 2YVEA 4B43A 1Q1HA 2RAEA 2E1NA 4D5CA 2Q2EA 4AIKA 4M74A 3DKXA 1J2XA 1Y0UA 2HOSA 4ENNA 5E1ZB 4CCOA 3WGHA 4CCMA 1XGOA 3OMYA 3GTQJ 3KP4A 4HPQA 5L3GA 1HW1A 4KISA 3T6NA 3OYFA 1BI0A 3FMRA 3G1MA 2HKOA 4ZYAA 4OIOF 3IAS2 3TO7A 5LLQA 1MNEA 3LWFA 1BW6A 5E1XA 3VDXA 3F22A 2REKA 4U9LA 2DXIA 2CJJA 1K78A 2P7CB 1IDZA 2JUGA 3LSIA 1WJBA 4CA0A 1YS6A 2DTRA 2ZJPF 1FTZA 2G7UA 1JE8A 3S14J 1DU0A 2C6YA 2E2IJ 1KYWA 2CH0A 2EIMH 2ECBA 2PBIA 2XF6A 2Z1DA 3PNVA 3ZMZA 3LSPA 2QIBA 3K70D 5BS6A 3JRAA 3LSMA 4ZZDA 3PSIA 4UUSA 1TWGJ 4MXMA 1B72B 5HS8A 1IXRC 4PSXA 4OMZA 2G0EA 3HEFA 3VP5A 4XLFA 4WIBA 5E8IA 1B1BA 4M6YA 2L9VA 2QENA 3B81A 2QYOA 2EBIA 2V4JC 4BE0A 1IG7A 3WE2A 3TL4X 1Z0XA 2IS1A 5IY5H 2LK2A 1KONA 4J19A 2K4BA 2L5QA 3K2ZA 1ETYA 2X1CA 2Q24A 4YRVA 5HLIA 2E34A 2VN2A 3CDIA 3ABKH 1MNMC 1QNTA 2OCCH 2G7LA 3HKZN 3V42A 2UXNA 4BXXJ 2ZO4A 5K5OA 4WF2A 3RQIA 3GF2A 3H3ZA 3CP8A 5CXGA 3ABLH 2WADA 4MEYF 2OTJI 3ZP5A 1SAXA 2W53A 4CH7A 4R79A 1A31A 3GTPJ 3K8PC 1Z3YA 2Z2SB 3ON2A 2EV5A 1IN4A 1S7AA 3HIFA 3O3KA 1MMDA 1VQMI 2KZGA 1FYKA 4AF5A 4EJWA 5IP9J 4AIJA 2HKUA 4EM1A 5HDNA 2ZNYA 2QQAA 2IP2A 3LSGA 3S16J 2M8GX 2XKPA 2WWYA 3IH4A 4F55A 1P2FA 4L62A 2ZJRF 3B6AA 2I5UA 2DN0A 1I6HJ 1RESA 4JQFA 3CMEI 1DP3A 2DMUA 4AVZA 4I0AA 5J8FA 2WAFA 2GOMA 3HXLA 3RQ4A 4Y13A 2GUHA 3NARA 3F23A 3F6OA 3PASA 4MK6A 4CZZA 2XASA 2AO9A 2FF4A 4IHVA 2KKOA 1YQAA 3CCJI 1A36A 3LA3A 5J6XA 2Y2ZA 5F64A 1NK3P 3L09A 3L2CA 1DGWY 2DJNA 1SFEA 3FXOA 4M73A 5B1BH 1U5TC 2ISZA 2D2WA 2Y0SN 2KL4A 3K7AJ 4LLLA 3BJOA 1T6SA 2BVMA 4KIFA 4HV6A 2E36A 2X6WA 1VQPI 4BGDA 3NRGA 1LFPA 1OYYA 4IKFA 3QAHA 4XMYA 3OYEA 5HODA 4ZDLA 1YJWI 2P81A 3CLQA 4IHTA 3PJRA 2HYGD 5EEAA 3V6GA 1HSJA 1WH5A 1ETWA 3FK6A 2RREA 2V9KA 3AG2H 2HYFA 2K3FA 1U2WA 2R4GA 5HDGA 3VTIA 2WAQN 3BR5A 1V55H 4YEJA 5D8KB 3GBGA 1A6IA 4FT8A 2FNPA 4NC7A 4JNNA 2MD5A 2R7SA 1X3ZB 2LF7A 1IRGA 2L2OA 3DPUA 2IS6A 3NEUA 4A0XA 4YIRX 1HKTA 4E7LA 3E1SA 4HW0A 2OI8A 2XF5A 1OYIA 2DYRH 1FMWA 4I7HA 2K9LA 1K61A 2PMZN 3HOUJ 2ZNZA 4LG0A 2WA0A 4U9NA 3CJDA 2GOXB 1A35A 3HOTA 2GXAA 2ZXWH 4DGWB 1TQPA 3IUVA 5EJCA 3NWSA 2R7RA 3KZYA 5HVQC 1ENHA 2R7XA 1OCPA 5DS9A 3FKIJ 4RGRA 1XC5A 3S32A 4AYBN 4P9FA 3K1PA 3HBLA 4NNJA 4JX6A 2E2HJ 4M72A 1W1WE 2PMUA 1ZLKA 5FRMA 1R58A 1TLHB 3C7JA 4EMSA 5EF6A 3FXQA 3A03A 1KQ9A 1R49A 2P5VA 3CQZJ 2KHMA 3RI4A 1NG6A 2DO7A 3NPIA 1BC8C 3ZGKA 2QQ9A 4E4HA 1MKMA 5F1JA 2F6CA 1OCRH 2VT3A 1POGA 4IRVA 3BR0A 2F5EA 1G3WA 4UDSA 2HTJA 4M9XA 5ILSA 2CQKA 3BHQA 5EFYA 3C2GA 1R1UA 1X4PA 1R6RA 3MN2A 3QYFA 2M1BA 3S3MA 2X48A 5D5WB 2DMTA 2CFXA 3DFGA 2DOFA 3HZJA 4RAYA 1TW2A 5L3BA 4ENMA 3DF8A 5HNFA 1YJNI 1Y8QB 4ENJA 1TP4A 2WUIA 5KAIC 3GVAA 1JUMA 2ACJA 5EEGA 1T38A 3T8TA 2E1MC 4HX8A 4D7NA 3F0CA 1G4DA 1GLNA 1W7PD 2EIJH 3LL7A 3FXRA 4OU0A 5H20A 5J4VA 5AIPA 2E7WA 2IGOA 2H8WA 4UB8C 2XGEA 3BCAA 3LSTA 1AKHB 3VVYA 2OBPA 5TGTA 2LBFB 4QPOA 5AQCA 3I56I 5ICFA 3KCCA 1GDTA 3DU5A 4XORA 3FRQA 1S8NA 4ANJA 2HVRA 5A2QZ 4JBAA 3GEUA 3G71I 2O6GE 3PQJA 3EUHA 4C3IJ 1G3YA 3VPRA 2E2JJ 3N05A 3FBNB 3KIOA 2L7KA 1RKWA 1WJFA 2ELJA 2RDPA 3SYTA 3BLYA 1YRNA 3K4BA 3HOVJ 2UV1A 1D5VA 4KT6A 1PP8F 5FKMA 2DCEA 3OL4A 2PMHA 4MTEA 2L7MP 2JA6J 2DFIA 1TWAJ 3ZQFA 2QKLB 2O9LA 4C2UA 2QF7A 2CV1A 5BOXA 2NNYA 2K7LA 2Y69H 3L1PA 3CO6C 2DA1A 4S05A 1Z91A 4ESBA 4HNUA 3ABUA 3ZXSA 4G7OF 4HLXA 1K6YA 4HSTA 2XSDC 2OAZA 2QBYA 4M6XA 5FO5A 5FJ8J 4HYEA 1Z21A 4X1EA 1E2XA 3PO3J 2FU4A 4PJJA 1R5GA 1P4AA 4A69C 1XSDA 1CF7B 3ZOBA 4HA8A 3MVPA 5H6RA 3OYAA 1IXSB 3ON4A 4KMFA 2R7VA 1ZKGA 1MIJA 3NXCA 1B8IB 2QLZA 3JRHA 5C4YA 4BDZA 3MWMA 3HTJA 1I39A 2JJ7A 2K02A 2GWRA 1ITYA 2O8KA 3BNIA 2VKDA 2BVLA 1Y39A 1Z7LA 4MO7A 1H9GA 4DNCA 2HDCA 4HDVA 3LQRA 3KYCB 3U21A 4BU2A 3LNQA 3H5NA 1XGMA 1ON2A 1W4MA 2NYXA 4AD9A 3EUAA 3RZOJ 3V78A 4LJZF 3K4MA 1F5TA 4A0ZA 1ZQ3P 1TW3A 3EYYA 2A2FX 3T5XA 3ULQB 1SFXA 1ZGAA 4A6EA 2BY0A 3CF2A 3FXLA 3JSPA 2E5ZA 2K27A 3QWLA 4UUTA 3WU2C 2QKOA 4N4OB 3NI7A 1BR1A 4BXFA 2D1VA 4UVBA 3HIMA 2KRFA 3AL0C 2UXPA 2E71A 3GZ5A 1HCRA 2GFNA 3V7CA 5FLXZ 2CYYA 3S1MJ 2OD5A 2DMNA 1RR7A 2BY3A 3VWBA 3B02A 3S2WA 4L5JA 4G6DA 2EA2A 5JLWA 4G9YA 1HDDC 3S1NJ 3HE0A 1PP7U 4HQMA 3VW2A 3WTWC 3LAJA 3ZQ7A 5FFXA 4ETSA 4I02A 4G6QA 1QU3A 3BPVA 2QOPA 1GXQA 3K69A 4KDPA 2EINH 3TQNA 3CUQB 2ZMEC 1IAWA 2JZYA 3KFWX 5E3LA 1ZHFA 1IO2A 1ZREA 2J5OA 4A3MJ 4KA4A 3O8HA 2HYTA 4IHXA 5CYVA 1ONVA 3PO2J 2A69F 3RKXA 2CGPA 3K10A 4MFDA 3P9CA 2DW4A 1ZGWA 2VKEA 1OQYA 2X4HA 3MQ0A 5LBQA 1DDNA 3VSLA 1ZAOA 3FXUA 3IWFA 3RKWA 3VYSB 4DVYP 1JGSA 1WI3A 2DMPA 2DLLA 3I9V2 4BHCA 2TCTA 4BL0B 3CDHA 5E1WA 4RB1A 3I58A 4E7IA 2HKXA 3RCOA 2IRFG 3PPBA 1YHQI 2HOEA 2HNHA 3D5SC 3TOAA 2E19A 1OCCH 3J81K 4LD5A 1WI9A 1PJRA 5M3MJ 3KETA 4DJAA 1ODDA 1KYZA 3QPTA 2GIZA 4UY8I 3R0JA 2MFZA 2XGCA 3DEWA 5K5QA 3PQKA 1K79A 1IC8A 1QZYA 4MTDA 1MBEA 3BROA 3BTJA 3K4NA 3ZMDA 2E1CA 4NUBA 4L18B 3M3YJ 3EGQA 4B8XA 5EZHA 3ZN0A 1IUYA 2XPWA 3KKCA 1YJ9I 2L4MA 4I6ZA 4XKVA 1UHSA 3BRUA 2KPMA 3VOXA 3R61A 3D5RC 4OD4A 5IPAA 3JCUC 2BW3A 2A5YB 3NRVA 4XLPF 5CVVA 4OAZA 1SAUA 3FBIB 2ESNA 2ZY9A 3E5QA 2QSGX 2V9VA 4NB5A 1BIAA 2V6CA 3CD6I 1E3OC 5FFZA 3HDDA 1XDUA 2NS0A 2NRAC 4QSHA 1XCBA 5FGMA 1LPQA 3S2HJ 2F48A 4YFNF 9ANTA 2CW8A 3Q0VA 3OYKA 2H94A 2W85A 2EK5A 2ID6A 4DYCA 3AAFA 1MMGA 2R0QC 3L2VA 1MJAA 4UV9A 1R23A 2Z33A 1ZELA 2UUZA 3SJMA 2IW5A 2DG7A 3Q9SA 2ZSHB 5E79C 1VZ0A 1X2NA 4HZFA 4U88A 3HOZJ 1U78A 1TWHJ 1CQTA 3ECHA 3MEXA 2XGDA 2NS7A 3OL3A 5IOZA 2XUBA 1P7JA 3A01B 3TP3A 2CW0F 3HKZA 4QPQA 1Y6IA 4XKBA 2KIQA 1DU6A 3MCZA 1NHAA 2JPBA 2M5WA 4N9IA 3I55I 3U1KA 1VQLI 3VB2A 4XLHA 4F7ZA 1BJZA 3ZPLA 1OPCA 4CYCA 4RMNA 5E17F 5J40A 2YVHA 2M9HA 3PNTA 2CG4A 1EKEA 5IT3A 2PFBA 2EV6A 2V26A 3A1YA 4WWCA 5DCMA 1Z6TA 3QPLA 1WJCA 2K4JA 3QQAA 2VBXA 4BXUA 3SFIA 2EZIA 4BAYA 3GXOA 5HLTA 3EDPA 3DQVC 3FWEA 2JK3A 2JRMA 2MC4A 1UFMA 5B66C 3SDBA 3C18A 1R5HA 1A04A 2FJ1A 1IGNA 4ACIA 2ZOZA 2K5CA 1Y8RB 3CMMA 2HOTA 2JTVA 3F8FA 1MDMB 2CWEA 4Y17A 4A3JJ 2A3SA 5IYDJ 3LSJA 1J0RA 1VQNI 3R6SA 4A5NA 3FF5A 4ITVA 4HDUA 2Z9OA 1U9NA 3UR3C 1T33A 2V57A 1VQOI 4IOAF 2OJED 4C30A 2F4OB 3I59B 1HXDA 4Y52J 4PSWA 1XB4A 5L3CA 5GAHJ 3PIPF 2MH9A 1X1CA 2GIVA 4XQFA 2O8XA 1T2KA 2HQNA 3E6DA 2GLOA 2WGBA 4LIUA 3S5RA 1UG2A 4TV7A 3A4CA 3D5LA 1HBXG 3HUGB 2HXIA 3ANGA 1BW5A 3BQZA 2AXTC 1MMAA 1Q1VA 2PBXA 1D8KA 4I0BA 2ADUA 3Q0UA 2XIGA 2IS2A 2F5VA 2ZCXA 1SD4A 2WB1N 4MNUA 1B72A 2MABA 3PFYA 4EVIA 3V8JA 3OYDA 1TC3C 1S5LC 2EFPA 5LD2C 4EV0A 1ZLJA 3JAMZ 2HZTA 1ZGJA 2UXIA 2M4GA 4PFOA 1T0FA 4JYKA 5F0CA 2V1NA 4B48A 3AL0B 3CC7I 1ZG3A 1YFHA 3K4CA 1S7EA 4AWXB 3J7AO 4WXHA 3ISPA 1VQ7I 2L7ZA 1OR7C 4FX4A 4E7JA 2VODA 1W0UA 3W2AA 4RS8A 1V5EA 3R0AA 3JTGA 2CUZA 1O3SA 2JSCA 2X6XA 2VE9A 2FBKA 2EPFA 2VJJA 5M5WJ 1WWXA 2EZLA 1XCVA 4ASNA 1YE9A 3DKYA 4LLNA 2VONA 3BG6A 1EV7A 2EZKA 4B1RA 4F93B 1FC3A 3VFZA 5GPAA 4G7ZF 2HR3A 2DOAA 4HQEA 4AC6A 3VW0A 2XRNA 4Y4RA 2M4KA 4BJ5C 5ILUA 2ME6A 1LDKB 1OJLA 3IRQA 5K5RA 3T1BA 3HTUA 3IP4B 1TWCJ 4B47A 4BHBA 1OMIA 3LA2A 4XN3A 5JHFA 3G73A 3GO5A 2DFEA 5GTIC 1B4AA 2DYSH 3V7RA 3TBIA 2PJRB 4BYYA 1LB2A 2VL8A 1X1AA 1JT0A 5DCFA 2EFQA 4GFKA 1JTXA 1RETA 4OAYA 5F27A 4XRSG 3FHNA 2IJLA 2NOJB 2HU9A 2W84A 2CUJA 2EWNA 1MD0A 2GXGA 2QVOA 3WGIA 4ZYEA 4HX7A 2WBMA 2IT0A 2E7XA 1QPMA 2L4AA 2VQHA 3HOYJ 3VUQA 4P5OA 1JJ6C 2H27A 2DDBA 1JHFA 4N0BA 4HOBA 2Z16A 1ZN2A 2RHAA 1LVAA 1RI7A 2VT2A 5CQGA 1FJLA 1XGNA 4CDGA 4A5MA 5LRSA 2GXBA 3GFJA 1W7PB 2MW8A 1JUSA 3DPLC 3VEPA 3IV5A 2B7EA 4JP0A 2OV7A 3TMOA 1GUUA 3OYIA 4KNYA 3M07A 2NAZA 5M5YJ 1TT5B 4U87A 3I53A 2LR8A 2FBQA 2D1HA 2NVXJ 2EV0A 2STTA 4BHPA 4GGGA 2UXHA 1GVDA 4PJLA 1JKRC 3SZTA 4RM2A 1AOYA 2LRDA 3MMYB 4MQVA 1MBGA 4PK4A 1Z9CA 1JKQC 4C2MA 4OINF 3J7YJ 2KIUA 2P6TA 3DXJF 4R1HA 1KQ8A 4CCJA 3QODA 5CLSA 2BE5F 1MSEC 4IHSA 4YELA 3BOQA 1R1TA 2O61A 4U0WA 3BG5A 5ILVA 3OS1A 3C07A 1KU9A 5IYCJ 3FXJA 3ZMUA 1UHWA 1TQIA 5CW8A 3ELKA 4MEXF 3W6KB 3S15J 1N78A 2KRHA 3B6CA 1EH6A 5LFAA 2X85A 3W6JB 1ACIA 4P96A 2P5KA 2P4WA 2KJCA 2W24A 4OMYA 1T08B 5FRNA 5BPIA 3VOEA 1LEBA 4BBSJ 3NNRA 2X1DA 3U9GA 5FD6A 3BG9A 3G6EI 2VXDA 1OR7A 2HDDA 4IVNA 2NVTJ 4EGZA 2XAHA 5EEHA 2DQRA 1R22A 5E3MA 3CC2I 1LE8B 2AQEA 5IT9K 4GXOA 3FM5A 2IA0A 2DA6A 1O4XA 2Q2EB 2RVCA 3LQQA 2E1OA 1QBJA 4AUXA 3D0SA 1UG0A 1E3PA 4RM3A 1XN7A 1WVRA 1X1BA 1XMAA 5K1YA 3RTRA 1J09A 5K7HA 2DPDA 1BJAA 3DWLE 4UB6C 5TISC 3QOEA 4PGHA 2FQ4A 2Y75A 1HKQA 3TKYA 3TDZC 1P92A 5FB2A 3CUQC 4B3XA 3S1RJ 1MMNA 2KDOA 2FXAA 1ZG1A 5L3EA 1SD6A 2JQ7A 1K78B 2STWA 2QSFX 3Q0WA 1LUJB 1EH8A 2ETHA 4QTRA 2VB6A 2BYVE 4XLAA 1IW7F 3HG9A 1OCOH 1X58A 4XR6A 4JK1X 2R5ZA 4BS9A 2ZCMA 4EEFG 2BHYA 2QEXI 1P7IA 2PG4A 3TO9A 2B1EA 3KKDA 4I76A 2CV0A 4RAFA 4KWAA 3JRFA 2JRTA 5DM7F 4R8HA 1D1AA 1K4SA 2ZFUA 1W36C 1QHGA 1WZ2A 3S3NA 5TRDA 3BCBA 5HNHA 1X3UA 4FE7A 4PCQA 2XVCA 1B6AA 1LEAA 5KK1A 5FGLA 1FYMA 2G7GA 2A6HF 1FT9A 5DUKA 5E20A 3GYHX 5B3SH 1WFXA 2FX0A 4V2GA 3TEDA 4KT5C 3KX2A 4A12A 1QA6A 4NDLA 3U1DA 2CFOA 1XPXA 2LY2A 5E3OA 1CGPA 1B9MA 3OYCA 3F9KA 1MH4A 2MC3A 1IN5A 3CWRA 2HTSA 4GCKA 3CLOA 2IA1A 1MBKA 1UHMA 2GQQA 1IV6A 1CF7A 1V5FA 2EQRA 1SGMA 2HGCA 2XV4S 4KN4X 5F0HA 1QHHD 2L3DA 2L02A 2OF7A 4D1QA 3L2RA 1O7FA 4C9YA 3FM3A 3NQOA 1B8IA 2VI6A 3MD2A 2N8GA 3GZNB 3E7QA 4EJOA 3A2KA 4A93J 4XICA 5D4RA 3F8CA 2LSOA 2RKHA 5B5EC 1D1CA 5HDKA 2ZKZA 1UI6A 3RSNA 1VI0A 4ENKA 3H3UA 4DYRA 4RGXA 3K70C 1FY7A 3GZ6A 2M0CA 4Y3OA 3JRGA 2DA3A 1Y0NA 3E5XA 2RV8A 5DAJA 3DTKA 4FHTA 2VQGA 3M1EA 2M34A 1DUXC 1VQ4I 4L9JA 2ELKA 4LMYA 2WY7Q 4CO8A 4YFKF 2GAUA 4XKCA 3P5JA 3REOA 3KYLA 3Q5FA 2B63J 2FNAA 1WJAA 2O03A 5JVTA 1BOBA 3GTKJ 2HQAA 1B9NA 5LGNA 2LKSA 5K7FA 1BI3A 4L9VA 4NQWB 1D8JA 3WTUC 2EJRA 1R9TJ 5F6FA 3BR2A 2OPTA 4KIGA 3TW7A 2R7UA 2VPRA 3I0TA 4BQAA 4XK4A 3IL2A 3CCSI 2KLOA 1RZ4A 1LFUP 1U5TA 1XMKA 1X19A 5J47A 4KITB 1HLVA 1KU3A 2Z5UA 5CVUA 2HVSA 1NK2P 4ZZLA 1T95A 3FIWA 3FMSA 1ZRFA 4XLCA 1XMXA 3ERMA 2EFNA 1OCTC 3COLA 5JR3A 2FMYA 4G7HF 2ICWG 4XSXF 2XAUA 2W82A 4RGSA 2LD5A 1WJEA 2LF8A 1WRJA 3SQNA 4F91B 2F4IA 2FUG2 3HHGA 4LG0B 3S1QJ 3VOKA 1LDDA 3V8LA 2W7NA 3A02A 2HQ5A 1H9TA 2R3SA 3ANPA 1LNWA 3OYGA 4IRGA 3I4MJ 2E60A 4BJTA 1YIJI 2F5FA 3M1CA 3L9FA 3CTAA 3HC7A 4BEHA 1DQUA 4HNVA 2OQRA 5A2QK 1T98A 1BC7C 3KP3A 3BR1A 2VBWA 2V7FA 3BT9A 1EJ9A 2KZVA 5HBUA 5H9TA 2DOEA 1QGPA 3KLNA 4A2UA 1APLC 1FMVA 3VIBA 1NG7A 3SEZA 4A3GJ 4AC0A 2OZUA 4GCLA 2IXSA 2AXLA 4U0VA 1I5ZA 1XSXA 4JX4A 1QO0D 1M1EB 4U7DA 1UAAA 3UKGA 1FOXA 2O7OA 3CMAI 3ROUA 1T56A 4HSRA 3I3LA 4A0YA 2FE3A 2QQBA 3IHUA 3RIRA 1STZA 2DFFA 1FP1D 3U2RA 2X0LA 1HKSA 2BBYA 3HB9A 3VYUB 2QA4I 4D0PA 2O7TA 5JLXA 4DZJA 1KA8A 2HPIA 3C3WA 3J80Z 3QU3A 4KN7X 3OSFA 3KP2A 2BHZA 2YPRA 2LC2A 3CP2A 3O60A 2PFVA 1YS7A 1S9HA 2CMPA 2L9RA 4WX9A 2NX4A 1XTAA 5IYBJ 3L2UA 2WB1A 3C1DA 3H0DA 2COBA 3LSKA 1PDNC 2PLYA 1TT0A 3MZHA 3AFHA 4XLEA 3WTVC 2YVXA 2M7AA 4LLGF 4KJZA 3ZCOA 3OIPA 4FE4A 2GZWA 2TRTA 2VC0A 2L0KA 3S93A 3WTXC 3LSRA 1ZH5A 4ZJZA 2IU5A 3PNYA 1O3RA 2UZKA 2VXZA 3S17J 3KZZA 1JI8A 2VOOA 4L9TA 3GUDA 3TOBA 4BQOA 3CCQI 1IRFA 2I10A 2V1XA 2ZXIA 3RZDJ 4RB3C 1F9NA 2LG4A 3HJEA 3P9IA 3QPSA 5DD4A 1UB9A 3GZIA 4HAMA 3J81Z 3A01A 1D0ZA 1YRNB 3HGGA 1FIPA 4F52A 1LDJA 3ZQIA 2R93J 2RN7A 2LY9A 3SEQA 3PM1A 2WV1A 3LA7A 2CUEA 2DA4A 2FBIA 5GADJ 1HDPA 3DBLB 3CUOA 5FLXK 1YLFA 2IA2A 4IRHA 2JA8J 3S2DJ 2IGMA 4HEA2 4DZPA 2HQRA 1RRJA 5F0FA 2QBYB 1Z05A 1DP7P 3ECOA 3K4KA 4AU7A 1X4OA 5KHDA 1MJ9A 1WPKA 3I54A 2XDVA 3G56A 5HSZA 4M3BA 1WCMJ 3BG7A 3BZ6A 2HDWA 1LJ9A 5EGOA 4G6TB 4DIQA 2HWVA 4FTHA 2FJI1 2P5LC 3H1CA 1R5ID 2IPQX 3GFMA 3ASNH 1RPWA 3ZQQA 2H6BA 2JSPA 2K85A 3L2QA 2XAFA 1SC7A 2PN6A 3NAUA 5C44J 2XC7A 2KT0A 2MH2A 1D0YA 1MDMA 4EJUA 2O5RA 3K2AA 2OUMA 4RGUA 2Y31A 2MG4A 3ZMSA 2CUFA 3K6GA 2XAGA 2FEZA 1HF0A 1UCRA 4IL6C 2JN6A 3GLLA 4ZYHA 5D5VB 2X51A 3K9TA 3GEZA 5FROA 3CF5F 4O5VA 2F2EA 2VQLA 3IKVA 4FETA 1HW2A 1I3QJ 2LYCA 4HLYA 3JRDA 4HV5A 2LMDA 4E7HA 4Y33A 3H3VK 1UELB 1ULYA 5J1UA 5LHGA 5FHPA 1X2MA 1Z1DA 1VF9A 1IJWC 4WCGA 1MBJA 1LFBA 4M9SA 4ON0A 2NP5A 4HG2A 2CQ7A 3PIOF 1NH3A 4EQQA 4DBRA 5FKKA 3OS0A 1P9QC 1E0EA 5M5XJ 1EA3A 1AU7A 4ME9A 2WAEA 4DOZA 5EYRA 4C2TA 3LFKA 3ZQLA 2CQNA 3ZQGA 2DDAA 3H5AA 2KMUA 1MGTA 3OYBA 2XPVA 3HM5A 4UVAA 2VIXA 1MBHA 3RPUA 5J1YA 4ESJA 3F3XA 1VQ9I 4L0ZB 1J9IA 1GXPA 3DLLF 3T0YA 4P9UA 5DM6F 2Z3YA 5AIQA 1BL0A 3GW2A 4I99C 1JT6A 2WTEA 4CCLA 1TZLA 1WJDA 4JKZA 5K58A 2Y48A 2Y9YA 1O3TA 3W3CA 1OCZH 5EG0B 3KP7A 4B3AA 1TNTA 2JUCA 5LEJA 2PI0A 4E7ZA 2COMA 2ZMEA 1R71A 1C0WA 2Y9ZA 2XAJA 4XRSA 5E8GA 3LFUA 1FBQA 2M3AA 2R7FA 4MQ9F 3V7SA 1SFUA 4HF1A 3GTOJ 2QWWA 2CU7A 3K0LA 4M9ZA 2ZSIB 4GYGA 2LY1A 3KE2A 2NP3A 1ETVA 5F04A 4MIMA 4P1WA 3KZIC 1G8XA 5CVJA 3ABTA 1QRYA 3DBHB 2FBHA 3LOCA 5KVRA 1O7LA 3GX4X 2DG8A 2IS4A 3BCGA 3WTSC 3K4JA 4IRIA 4M3DA 1RUNA 1GV5A 3C2HA 2WC2A 1MJBA 4A3EJ 3LWJA 4CCKA 4GDFA 5C4XJ 4AVPA 2IGNA 4IQ4A 5HLHA 2OZ6A 1QPIA 4YIFA 4QLCU 3G1OA 1IZ1A 4XN0A 2P0WA 5HAWA 1U6GA 2BXYA 5C3EJ 4MLOA 2R7QA 2BW3B 1V3FA 3JR9A 3F21A 2FRHA 1YG2A 3HRMA 3QPHA 1I1GA 2K86A 3IH3A 2EH3A 4KIBA 4LK0F 5HS7A 2OERA 3H5RA 4BY1J 1AHDP 2D45A 3P9KA 1Z67A 2HZDA 1YI2I 3EETA 2KJBA 3BTIA 2GA1A 3G7RA 3G3ZA 3HRSA 1L3LA 2MGQA 5FKLA 3LSHA 4QWQA 1HOMA 5HOOA 1ZTRA 5E18F 2CQQA 3IH2A 2R5YB 1J75A 3MZYA 3LMMA 2HOAA 3CCLI 2JPCA 3M4OJ 3HHHA 3OYLA 4YFXF 2XPUA 4ZH4F 2V9PA 5ICCA 3O2PE 3EUPA 1EF4A 1UI5A 3KZ9A 1F36A 2PEXA 3AG4H 2A07F 2R7DA 2LTPA 3ERED 4BACA 2OA4A 2EA4A 2MA3A 3BP8A 2F4MB 1ZRDA 4M3GA 2EB7A 3T8RA 1QQIA 3K4LA 2BEOA 3ZRGA 2VQCA 4A6DA 2BY1A 4PFPA 2V6EA 4B4CA 3JRCA 1I1SA 3I4NJ 2QZ8A 2HEOA 4L5EA 3WE3A 5CQEA 1FEXA 2CV2A 1RR8C 2KISA 1S6LA 1G3TA 3R4KA 4CYCB 2RNGA 2DMQA 3DCFA 4L5IA 1FTTA 3M8FA 3O6BB 4O6JA 2VOPA 2VKVA 5FKOA 3F8BA 5JVGF 1L0OC 2GA2A 4M3FA 2UXXA 3W2WA 3HTHA 3E6MA 4EJVA 4M6VA 2LNBA 1UZCA 5LRRA 3M9AA 2RQPA 4XL9A 4PDKA 3JAMK 1JKOC 5D1RA 4II2A 3M8JA 1USTA 1J7KA 1BI1A 2DK5A 2AHQA 2RQQA 2B3WA 1EH7A 3WU0A 1JTYA 2BXZA 3BPXA 2KQRA 3J7ZI 4G94A 3BJBA 1S3JA 2Z99A 2VUMJ 1S29A 2XROA 4RBOA 2YSRA 3M7GA 1YIOA 2K3PA 5CKTA 5BNGA 2JWTA 1ETQA 2DK8A 4IEJA 3AQSA 1Z6RA 3CJRB 1J5YA 2RNJA 3G2BA 5EZGA 3H0GJ 2KFDA 3LJLA 1ZARA 1FOYA 2K40A 4A3LJ 3CCUI 2OTLI 1W0TA 1R1VA 1RKTA 1OLTA 1O3QA 3J7AY 2VASA 5IOYA 4GO1A 3BJAA 4LFUA 4WK8F 3JSOA 4XRFA 3TW6A 3CO7C 2CSOA 4UXNA 4W97A 1VQ8I 3R60A 3GWZA 4II3A 4BUPA 3OOUA 4HKUA 5CPRB 3JRIA 2G3BA 3E97A 1ZG5A 5ICGA 3BC8A 5H2FC 3H92A 4OIRF 1RIOH 1NTCA 3E3VA 3QKXA 3HRUA 2OQGA 5DD8A 1TWFJ 3FX3A 3PL8A 4BJ6C 1KGSA 2DQLA 3GFLA 5DUIA 5D18A 4S04A 1SEUA 3BTCA 2ME0A 4GYIA 1FX7A 4I09A 2AS5F 4IX7A 1MBFA 2ZXHA 3BZKA 2GENA 4BNCA 1XD7A 5C4JJ 5F1RA 5D19A 3G1LA 1E3HA 1IXCA 4FASD 5ICEA 1LQ1A 2HXOA 1P4XA 1IN7A 2K9MA 2LOOA 3F72A 3RJPA 4XBFA 2XGXA 2XB0X 3KPHA 3F8NA 3NWTA 4WXDA 5IT9Z 4XKWA 4M71A 1FYLA 3WHBA 4PJ0C 4NC8A 1X1PA
chains in the Genus database with same CATH topology
3GTKJ 3PPBA 1WGXA 3VVXA 3CCYA 2HYJA 5K7FA 4RDUA 1PUFB 2E19A 2GBYA 3JSJA 5FLVA 3JRBA 1R9TJ 3BR2A 4A3IJ 5M3MJ 2OPTA 3TW7A 2Y30A 2VPRA 4XK4A 4C2MJ 2D6YA 2XGCA 1LFUP 3DEWA 1IC8A 1MBEA 2DA5A 3BTJA 4JX5A 1U9OA 2JA7J 3EGQA 3M3YJ 1HLVA 3DPJA 1NK2P 3FIWA 4G12A 5EZHA 2XPWA 3KKCA 3KNWA 1OCTC 1I50J 5EDNA 4I6ZA 1UHSA 5F08A 2QCOA 3SDGA 3BRUA 3COLA 2CQXA 5FKNA 5IP6A 3VOXA 2LD5A 3BTLA 1WH7A 5IPAA 3C2BA 3RKQA 4BKXA 4QIWN 1IRZA 3S1QJ 3VOKA 2DA7A 3A02A 2HQ5A 1E3OC 3ANPA 1Y1VJ 4A3FJ 5IP7J 3OSGA 3HDDA 4QSHA 3I4MJ 3RD3A 4IHYA 3FISA 3S2HJ 3OIOA 1AKHA 2W48A 9ANTA 4HNVA 1OFCX 3Q0VA 4A3KJ 2ID6A 1VNDA 3BR1A 4DYCA 4UUSB 1PUFA 3BT9A 2R0QC 2LP0A 2XB5A 5HBUA 3BR6A 5H9TA 4BY7J 3W6VA 3SJMA 2DG7A 1APLC 3VIBA 1Y1WJ 4A3GJ 3FK7A 4YZEA 4AC0A 1X2NA 1LE8A 2YVEA 4GCLA 2XDNA 2JA5J 3HOZJ 1U78A 2RAEA 1TWHJ 1CQTA 4D5CA 2NVQJ 2XGDA 2NS7A 4JX4A 2HOSA 5IOZA 1P7JA 3A01B 3TP3A 4ABZA 3UKGA 2O7OA 1DU6A 1T56A 3GTQJ 3E7LA 2UXUA 3T6NA 3G1MA 3HB9A 1BJZA 3GTJJ 3GTLJ 3CDLA 4CYCA 3HOWJ 1BW6A 2O7TA 2REKA 2YVHA 2M9HA 5JLXA 4DZJA 2CJJA 3WHCA 1IDZA 3GTMJ 3OSFA 3VW1A 2JMWA 3O60A 3QPLA 3QQAA 2L9RA 4S0HB 2NX4A 1FTZA 3SFIA 2EZIA 3S14J 5IYBJ 1DU0A 4A3BJ 3AQTA 2E2IJ 2COBA 2ECBA 2QIBA 3LSPA 2R92J 3JRAA 2JK3A 4UUSA 1TWGJ 4MXMA 1B72B 1F43A 4FE4A 2TRTA 2G0EA 2L0KA 3HEFA 3LSRA 2FJ1A 1IGNA 3VP5A 4ACIA 2IU5A 1ZK8A 2ZOZA 3B81A 3S17J 2HOTA 2K9QA 2EBIA 2I10A 1IG7A 1H89C 1Z0XA 3RZDJ 4IHWA 4A3JJ 1SFOJ 3QPSA 2LK2A 3GZIA 5IYDJ 3LSJA 4J19A 3A01A 4FCYA 1YRNB 3HGGA 1ETYA 1FIPA 1SANA 2Q24A 1U9NA 3Q3SA 1T33A 1MNMC 2V57A 5E3NA 3ZQIA 2R93J 5CXIA 2G7LA 3HKZN 1ZR2A 2LY9A 3PM1A 4Y52J 2WV1A 4BXXJ 2CUEA 2DA4A 3RQIA 1HDPA 5CXGA 5K7ZA 2JA8J 3S2DJ 4NELA 2GLOA 4GCTA 2WGBA 4DZPA 2YS9A 3S5RA 1UG2A 2W53A 5F0FA 3GTPJ 3ON2A 2HXIA 3ANGA 1BW5A 3BQZA 1WPKA 3RH2A 3G56A 5HSZA 1Q1VA 4M3BA 1WCMJ 2PBXA 4GFBA 4AF5A 5IP9J 2HKUA 3Q0UA 5EGOA 2ZCXA 2NS8A 3LSGA 4FTHA 2WB1N 1UMQA 2M8GX 1B72A 3S16J 3IH4A 4L62A 2YUSA 3B6AA 1I6HJ 2DN0A 1TC3C 1RPWA 1RESA 1U8BA 2DMUA 2R5ZB 3O8GA 2HI3A 2UXIA 2GUHA 4XRMA 3NARA 1IUFA 4JYKA 5F0CA 3NAUA 5C44J 2M2EA 3BQYA 2KT0A 3VVZA 4JL3A 1S7EA 3PASA 3K2AA 4MK6A 2L7ZA 2AO9A 4A3CJ 1BA5A 2Y31A 2MG4A 2K9SA 2CUFA 2LKXA 4IHVA 1ETKA 1MH3A 1W0UA 1QVTA 1HF0A 4XIDA 2NOGA 2Y2ZA 2QTQA 2DTZA 2JN6A 1NK3P 1JUPA 2DJNA 4FISA 4GFLA 5M5WJ 2Y0SN 1I3QJ 2ECCA 3K7AJ 3JRDA 2EZLA 3H3VK 2LLKA 5J1UA 5FHPA 1X2MA 2EZKA 4B1RA 3NRGA 2L7FP 1VF9A 1IJWC 5GPAA 2FD5A 4BBRJ 4W1UA 1MBJA 3BG3A 1LFBA 2LFBA 4AC6A 5HODA 3VW0A 2EZHA 2H8RA 2P81A 2NP5A 2ME6A 1OJLA 2UXOA 5EEAA 5FKKA 3V6GA 1WH5A 3FK6A 1ETWA 5M5XJ 1TWCJ 1AU7A 4ME9A 5EYRA 2WAQN 3BR5A 3ZQLA 1ZR4A 2QWTA 1GV2A 3ZQGA 3GBGA 1A6IA 4JNNA 1JT0A 4GFKA 1JTXA 1RETA 5F27A 1Z77A 2XPVA 3HM5A 4XRSG 2KDZA 1MBHA 4DW6A 5J1YA 2OI8A 2IEKA 3HOXJ 1K61A 2PMZN 3HOUJ 2GM4A 3CJDA 2K9NA 1BL0A 1JT6A 3HOYJ 3IUVA 3VUQA 4JKZA 5K58A 1JJ6C 2Y9YA 2IAIA 1ENHA 3HGYA 1OCPA 5DS9A 5EG0B 1JJ8C 4B3AA 4C3HJ 2D5VA 2RHAA 3FKIJ 1XC5A 4AYBN 1FJLA 3HBLA 4JX6A 2E2HJ 2MW8A 2XRLA 1JUSA 3IV5A 2Y9ZA 4XRSA 5EF6A 4C3JJ 4JP0A 3GTOJ 1GUUA 4Y7NJ 2CU7A 3A03A 3CQZJ 2NVYJ 5M5YJ 1JGGA 2NP3A 1ETVA 5F04A 4MIMA 3NPIA 2LR8A 2FBQA 2NVXJ 5F1JA 1ETOA 1QRYA 2UXHA 1POGA 3LOCA 1D5YA 1GVDA 3BR0A 1JKRC 2DG8A 4UDSA 2IBDA 3BCGA 1ORKA 3BHQA 4M3DA 5EFYA 1GV5A 1MBGA 5M3FJ 5GPCA 1JKQC 4A3EJ 3LWJA 3MN2A 2X9DA 2X48A 5C4XJ 4MFEA 2DMTA 1QPIA 4LOCA 3JREA 2G7SA 1H88C 3G1OA 5HAWA 2R7ZJ 1MSEC 5C3EJ 2ID3A 4MLOA 2WUIA 1JUMA 3BG5A 3JR9A 3P9TA 3C07A 1FIAA 4DYQA 5IYCJ 3IH3A 2EH3A 5CW8A 4D7NA 2OERA 5EG0A 3F0CA 4BY1J 4V2FA 1AHDP 3S15J 2DA2A 3GTGJ 2PZ9A 3LHQA 3B6CA 3BTIA 3G7RA 2MGQA 2XGEA 5FKLA 4PXIA 1AKHB 3VVYA 2YU9J 1JKPC 1HOMA 2H1KA 4BBSJ 3NNRA 2R5YB 1ZTRA 2CQQA 3IH2A 5AQCA 3BG9A 1GDTA 3FRQA 3MKLA 3D1NI 2HOAA 2HDDA 2NVTJ 1XS9A 3M4OJ 3GEUA 2XPUA 4C3IJ 5E3MA 3EUPA 3VPRA 1LE8B 2E2JJ 1EF4A 1UI5A 2F07A 1F36A 4A3DJ 3KZ9A 2ZOYA 4M3EA 1RKWA 2DA6A 1O4XA 3HOVJ 2ZCNA 1YRNA 2E1OA 2LTPA 5FKMA 5GP9A 3MNLA 2L7MP 2JA6J 4AUXA 5DTDA 1TWAJ 3ZQFA 2O9LA 4M3GA 2QF7A 2ZB9A 5K7HA 3L1PA 4B4CA 2DA1A 3JRCA 3CMYA 3I4NJ 2FQ4A 4L5EA 2XSDC 1VFCA 1FEXA 3S1RJ 3HTIA 4CYCB 2DMQA 3DCFA 5FJ8J 1FTTA 3HTAA 2VKVA 5FKOA 4X1EA 4M3FA 3HTHA 3PO3J 3Q0WA 4M6VA 5J3LA 4A69C 4QTRA 2MSYA 3ZOBA 1JKOC 5D1RA 2LVSA 3MVPA 3ON4A 1ZKGA 3NXCA 1B8IB 1X58A 1IDYA 3TP0A 3JRHA 2AHQA 2R5YA 2R5ZA 5C4YA 2ZCMA 4EEFG 1P7IA 1JTYA 3HTJA 2JJ7A 1ITYA 3BJBA 2O8KA 3BNIA 3KKDA 2VUMJ 4I76A 4RBOA 4MO7A 4KWAA 3JRFA 5BNGA 2JWTA 3LNQA 1ETQA 5FLMJ 4IEJA 3AQSA 3RZOJ 4FE7A 3V78A 5EZGA 3H0GJ 1ZQ3P 5FGLA 2G7GA 3LJLA 2K40A 4A3LJ 1MSFC 4V2GA 2FX0A 1W0TA 4UUTA 1RKTA 3BR3A 3ZQHA 3TEDA 2RASA 2QKOA 2X6OA 5IOYA 3NI7A 1XG1A 4NDLA 5E3OA 3TW6A 3HIMA 1MH4A 3CWRA 4W97A 2UXPA 4GCKA 1HCRA 3OOUA 2GFNA 4HKUA 1ETXA 5FMPA 1MBKA 3JRIA 1IV6A 1K83J 3S1MJ 2EQRA 1SGMA 2DMNA 2G3BA 1RR7A 4NN1A 5F0HA 3F1BA 2OF7A 1G2HA 4ICHA 1B8IA 1HDDC 2VI6A 5JLWA 2N8GA 3S1NJ 5EGOB 3E7QA 1NTCA 3HE0A 3QKXA 3VW2A 4D7MA 4A93J 4XICA 1TWFJ 4CGRA 3QBMA 5D18A 3BTCA 2ME0A 2QOPA 3ZQCA 1UI6A 1VI0A 1H8AC 5E3LA 1MBFA 4DYRA 2GENA 3CRJA 4A3MJ 4D5FA 5C4JJ 2M0CA 3JRGA 5D19A 2DA3A 3G1LA 3O8HA 2HYTA 4IHXA 3PO2J 5DAJA 2HXOA 4MFDA 1ZGWA 1A5JA 2VKEA 2M34A 5J1RA 2ELKA 2CRGA 2XB0X 4X6AJ 1QVUA 1GT0C 3WHBA 2B63J 1WI3A 2DMPA 2TCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTK J;  3PPB A;  1WGX A;  3VVX A;  3CCY A;  2HYJ A;  5K7F A;  4RDU A;  1PUF B;  2E19 A;  2GBY A;  3JSJ A;  5FLV A;  3JRB A;  1R9T J;  3BR2 A;  4A3I J;  5M3M J;  2OPT A;  3TW7 A;  2Y30 A;  2VPR A;  4XK4 A;  4C2M J;  2D6Y A;  2XGC A;  1LFU P;  3DEW A;  1IC8 A;  1MBE A;  2DA5 A;  3BTJ A;  4JX5 A;  1U9O A;  2JA7 J;  3EGQ A;  3M3Y J;  1HLV A;  3DPJ A;  1NK2 P;  3FIW A;  4G12 A;  5EZH A;  2XPW A;  3KKC A;  3KNW A;  1OCT C;  1I50 J;  5EDN A;  4I6Z A;  1UHS A;  5F08 A;  2QCO A;  3SDG A;  3BRU A;  3COL A;  2CQX A;  5FKN A;  5IP6 A;  3VOX A;  2LD5 A;  3BTL A;  1WH7 A;  5IPA A;  3C2B A;  3RKQ A;  4BKX A;  4QIW N;  1IRZ A;  3S1Q J;  3VOK A;  2DA7 A;  3A02 A;  2HQ5 A;  1E3O C;  3ANP A;  1Y1V J;  4A3F J;  5IP7 J;  3OSG A;  3HDD A;  4QSH A;  3I4M J;  3RD3 A;  4IHY A;  3FIS A;  3S2H J;  3OIO A;  1AKH A;  2W48 A;  9ANT A;  4HNV A;  1OFC X;  3Q0V A;  4A3K J;  2ID6 A;  1VND A;  3BR1 A;  4DYC A;  4UUS B;  1PUF A;  3BT9 A;  2R0Q C;  2LP0 A;  2XB5 A;  5HBU A;  3BR6 A;  5H9T A;  4BY7 J;  3W6V A;  3SJM A;  2DG7 A;  1APL C;  3VIB A;  1Y1W J;  4A3G J;  3FK7 A;  4YZE A;  4AC0 A;  1X2N A;  1LE8 A;  2YVE A;  4GCL A;  2XDN A;  2JA5 J;  3HOZ J;  1U78 A;  2RAE A;  1TWH J;  1CQT A;  4D5C A;  2NVQ J;  2XGD A;  2NS7 A;  4JX4 A;  2HOS A;  5IOZ A;  1P7J A;  3A01 B;  3TP3 A;  4ABZ A;  3UKG A;  2O7O A;  1DU6 A;  1T56 A;  3GTQ J;  3E7L A;  2UXU A;  3T6N A;  3G1M A;  3HB9 A;  1BJZ A;  3GTJ J;  3GTL J;  3CDL A;  4CYC A;  3HOW J;  1BW6 A;  2O7T A;  2REK A;  2YVH A;  2M9H A;  5JLX A;  4DZJ A;  2CJJ A;  3WHC A;  1IDZ A;  3GTM J;  3OSF A;  3VW1 A;  2JMW A;  3O60 A;  3QPL A;  3QQA A;  2L9R A;  4S0H B;  2NX4 A;  1FTZ A;  3SFI A;  2EZI A;  3S14 J;  5IYB J;  1DU0 A;  4A3B J;  3AQT A;  2E2I J;  2COB A;  2ECB A;  2QIB A;  3LSP A;  2R92 J;  3JRA A;  2JK3 A;  4UUS A;  1TWG J;  4MXM A;  1B72 B;  1F43 A;  4FE4 A;  2TRT A;  2G0E A;  2L0K A;  3HEF A;  3LSR A;  2FJ1 A;  1IGN A;  3VP5 A;  4ACI A;  2IU5 A;  1ZK8 A;  2ZOZ A;  3B81 A;  3S17 J;  2HOT A;  2K9Q A;  2EBI A;  2I10 A;  1IG7 A;  1H89 C;  1Z0X A;  3RZD J;  4IHW A;  4A3J J;  1SFO J;  3QPS A;  2LK2 A;  3GZI A;  5IYD J;  3LSJ A;  4J19 A;  3A01 A;  4FCY A;  1YRN B;  3HGG A;  1ETY A;  1FIP A;  1SAN A;  2Q24 A;  1U9N A;  3Q3S A;  1T33 A;  1MNM C;  2V57 A;  5E3N A;  3ZQI A;  2R93 J;  5CXI A;  2G7L A;  3HKZ N;  1ZR2 A;  2LY9 A;  3PM1 A;  4Y52 J;  2WV1 A;  4BXX J;  2CUE A;  2DA4 A;  3RQI A;  1HDP A;  5CXG A;  5K7Z A;  2JA8 J;  3S2D J;  4NEL A;  2GLO A;  4GCT A;  2WGB A;  4DZP A;  2YS9 A;  3S5R A;  1UG2 A;  2W53 A;  5F0F A;  3GTP J;  3ON2 A;  2HXI A;  3ANG A;  1BW5 A;  3BQZ A;  1WPK A;  3RH2 A;  3G56 A;  5HSZ A;  1Q1V A;  4M3B A;  1WCM J;  2PBX A;  4GFB A;  4AF5 A;  5IP9 J;  2HKU A;  3Q0U A;  5EGO A;  2ZCX A;  2NS8 A;  3LSG A;  4FTH A;  2WB1 N;  1UMQ A;  2M8G X;  1B72 A;  3S16 J;  3IH4 A;  4L62 A;  2YUS A;  3B6A A;  1I6H J;  2DN0 A;  1TC3 C;  1RPW A;  1RES A;  1U8B A;  2DMU A;  2R5Z B;  3O8G A;  2HI3 A;  2UXI A;  2GUH A;  4XRM A;  3NAR A;  1IUF A;  4JYK A;  5F0C A;  3NAU A;  5C44 J;  2M2E A;  3BQY A;  2KT0 A;  3VVZ A;  4JL3 A;  1S7E A;  3PAS A;  3K2A A;  4MK6 A;  2L7Z A;  2AO9 A;  4A3C J;  1BA5 A;  2Y31 A;  2MG4 A;  2K9S A;  2CUF A;  2LKX A;  4IHV A;  1ETK A;  1MH3 A;  1W0U A;  1QVT A;  1HF0 A;  4XID A;  2NOG A;  2Y2Z A;  2QTQ A;  2DTZ A;  2JN6 A;  1NK3 P;  1JUP A;  2DJN A;  4FIS A;  4GFL A;  5M5W J;  2Y0S N;  1I3Q J;  2ECC A;  3K7A J;  3JRD A;  2EZL A;  3H3V K;  2LLK A;  5J1U A;  5FHP A;  1X2M A;  2EZK A;  4B1R A;  3NRG A;  2L7F P;  1VF9 A;  1IJW C;  5GPA A;  2FD5 A;  4BBR J;  4W1U A;  1MBJ A;  3BG3 A;  1LFB A;  2LFB A;  4AC6 A;  5HOD A;  3VW0 A;  2EZH A;  2H8R A;  2P81 A;  2NP5 A;  2ME6 A;  1OJL A;  2UXO A;  5EEA A;  5FKK A;  3V6G A;  1WH5 A;  3FK6 A;  1ETW A;  5M5X J;  1TWC J;  1AU7 A;  4ME9 A;  5EYR A;  2WAQ N;  3BR5 A;  3ZQL A;  1ZR4 A;  2QWT A;  1GV2 A;  3ZQG A;  3GBG A;  1A6I A;  4JNN A;  1JT0 A;  4GFK A;  1JTX A;  1RET A;  5F27 A;  1Z77 A;  2XPV A;  3HM5 A;  4XRS G;  2KDZ A;  1MBH A;  4DW6 A;  5J1Y A;  2OI8 A;  2IEK A;  3HOX J;  1K61 A;  2PMZ N;  3HOU J;  2GM4 A;  3CJD A;  2K9N A;  1BL0 A;  1JT6 A;  3HOY J;  3IUV A;  3VUQ A;  4JKZ A;  5K58 A;  1JJ6 C;  2Y9Y A;  2IAI A;  1ENH A;  3HGY A;  1OCP A;  5DS9 A;  5EG0 B;  1JJ8 C;  4B3A A;  4C3H J;  2D5V A;  2RHA A;  3FKI J;  1XC5 A;  4AYB N;  1FJL A;  3HBL A;  4JX6 A;  2E2H J;  2MW8 A;  2XRL A;  1JUS A;  3IV5 A;  2Y9Z A;  4XRS A;  5EF6 A;  4C3J J;  4JP0 A;  3GTO J;  1GUU A;  4Y7N J;  2CU7 A;  3A03 A;  3CQZ J;  2NVY J;  5M5Y J;  1JGG A;  2NP3 A;  1ETV A;  5F04 A;  4MIM A;  3NPI A;  2LR8 A;  2FBQ A;  2NVX J;  5F1J A;  1ETO A;  1QRY A;  2UXH A;  1POG A;  3LOC A;  1D5Y A;  1GVD A;  3BR0 A;  1JKR C;  2DG8 A;  4UDS A;  2IBD A;  3BCG A;  1ORK A;  3BHQ A;  4M3D A;  5EFY A;  1GV5 A;  1MBG A;  5M3F J;  5GPC A;  1JKQ C;  4A3E J;  3LWJ A;  3MN2 A;  2X9D A;  2X48 A;  5C4X J;  4MFE A;  2DMT A;  1QPI A;  4LOC A;  3JRE A;  2G7S A;  1H88 C;  3G1O A;  5HAW A;  2R7Z J;  1MSE C;  5C3E J;  2ID3 A;  4MLO A;  2WUI A;  1JUM A;  3BG5 A;  3JR9 A;  3P9T A;  3C07 A;  1FIA A;  4DYQ A;  5IYC J;  3IH3 A;  2EH3 A;  5CW8 A;  4D7N A;  2OER A;  5EG0 A;  3F0C A;  4BY1 J;  4V2F A;  1AHD P;  3S15 J;  2DA2 A;  3GTG J;  2PZ9 A;  3LHQ A;  3B6C A;  3BTI A;  3G7R A;  2MGQ A;  2XGE A;  5FKL A;  4PXI A;  1AKH B;  3VVY A;  2YU9 J;  1JKP C;  1HOM A;  2H1K A;  4BBS J;  3NNR A;  2R5Y B;  1ZTR A;  2CQQ A;  3IH2 A;  5AQC A;  3BG9 A;  1GDT A;  3FRQ A;  3MKL A;  3D1N I;  2HOA A;  2HDD A;  2NVT J;  1XS9 A;  3M4O J;  3GEU A;  2XPU A;  4C3I J;  5E3M A;  3EUP A;  3VPR A;  1LE8 B;  2E2J J;  1EF4 A;  1UI5 A;  2F07 A;  1F36 A;  4A3D J;  3KZ9 A;  2ZOY A;  4M3E A;  1RKW A;  2DA6 A;  1O4X A;  3HOV J;  2ZCN A;  1YRN A;  2E1O A;  2LTP A;  5FKM A;  5GP9 A;  3MNL A;  2L7M P;  2JA6 J;  4AUX A;  5DTD A;  1TWA J;  3ZQF A;  2O9L A;  4M3G A;  2QF7 A;  2ZB9 A;  5K7H A;  3L1P A;  4B4C A;  2DA1 A;  3JRC A;  3CMY A;  3I4N J;  2FQ4 A;  4L5E A;  2XSD C;  1VFC A;  1FEX A;  3S1R J;  3HTI A;  4CYC B;  2DMQ A;  3DCF A;  5FJ8 J;  1FTT A;  3HTA A;  2VKV A;  5FKO A;  4X1E A;  4M3F A;  3HTH A;  3PO3 J;  3Q0W A;  4M6V A;  5J3L A;  4A69 C;  4QTR A;  2MSY A;  3ZOB A;  1JKO C;  5D1R A;  2LVS A;  3MVP A;  3ON4 A;  1ZKG A;  3NXC A;  1B8I B;  1X58 A;  1IDY A;  3TP0 A;  3JRH A;  2AHQ A;  2R5Y A;  2R5Z A;  5C4Y A;  2ZCM A;  4EEF G;  1P7I A;  1JTY A;  3HTJ A;  2JJ7 A;  1ITY A;  3BJB A;  2O8K A;  3BNI A;  3KKD A;  2VUM J;  4I76 A;  4RBO A;  4MO7 A;  4KWA A;  3JRF A;  5BNG A;  2JWT A;  3LNQ A;  1ETQ A;  5FLM J;  4IEJ A;  3AQS A;  3RZO J;  4FE7 A;  3V78 A;  5EZG A;  3H0G J;  1ZQ3 P;  5FGL A;  2G7G A;  3LJL A;  2K40 A;  4A3L J;  1MSF C;  4V2G A;  2FX0 A;  1W0T A;  4UUT A;  1RKT A;  3BR3 A;  3ZQH A;  3TED A;  2RAS A;  2QKO A;  2X6O A;  5IOY A;  3NI7 A;  1XG1 A;  4NDL A;  5E3O A;  3TW6 A;  3HIM A;  1MH4 A;  3CWR A;  4W97 A;  2UXP A;  4GCK A;  1HCR A;  3OOU A;  2GFN A;  4HKU A;  1ETX A;  5FMP A;  1MBK A;  3JRI A;  1IV6 A;  1K83 J;  3S1M J;  2EQR A;  1SGM A;  2DMN A;  2G3B A;  1RR7 A;  4NN1 A;  5F0H A;  3F1B A;  2OF7 A;  1G2H A;  4ICH A;  1B8I A;  1HDD C;  2VI6 A;  5JLW A;  2N8G A;  3S1N J;  5EGO B;  3E7Q A;  1NTC A;  3HE0 A;  3QKX A;  3VW2 A;  4D7M A;  4A93 J;  4XIC A;  1TWF J;  4CGR A;  3QBM A;  5D18 A;  3BTC A;  2ME0 A;  2QOP A;  3ZQC A;  1UI6 A;  1VI0 A;  1H8A C;  5E3L A;  1MBF A;  4DYR A;  2GEN A;  3CRJ A;  4A3M J;  4D5F A;  5C4J J;  2M0C A;  3JRG A;  5D19 A;  2DA3 A;  3G1L A;  3O8H A;  2HYT A;  4IHX A;  3PO2 J;  5DAJ A;  2HXO A;  4MFD A;  1ZGW A;  1A5J A;  2VKE A;  2M34 A;  5J1R A;  2ELK A;  2CRG A;  2XB0 X;  4X6A J;  1QVU A;  1GT0 C;  3WHB A;  2B63 J;  1WI3 A;  2DMP A;  2TCT A; 
#chains in the Genus database with same CATH topology
 3IAM 2;  1K7A A;  5D5U B;  3HSR A;  3IUO A;  2HYJ A;  2KIF A;  2QGU A;  3F8M A;  3OYH A;  1PUF B;  5L3D A;  2GBY A;  4YII A;  2ZJ2 A;  3JSJ A;  3ONQ A;  3N4M A;  2V79 A;  2Y30 A;  2HFH A;  2L9N A;  4N9H A;  3CC4 I;  1IN6 A;  2DA5 A;  1R4M B;  4JX5 A;  1U9O A;  4UV8 A;  2JA7 J;  4PGG A;  3EQL F;  3DPJ A;  2VC1 A;  4G12 A;  2A6E F;  2J5P A;  2WV0 A;  3ZMV A;  3KNW A;  2ELH A;  3ZR8 X;  1I50 J;  4OIQ F;  5ED4 A;  1O57 A;  2QCO A;  3SDG A;  5LHI A;  2CQX A;  4IXA A;  1Z3X A;  5IP6 A;  3DBR B;  2VBY A;  3BTL A;  1WH7 A;  2W57 A;  5GAE J;  4I2O A;  3RKQ A;  1BR2 A;  3PSF A;  4QIW N;  2PQ8 A;  3A0H C;  1BBY A;  4BQN A;  4CZC A;  4Q4Z F;  4MGR A;  2O0Y A;  3EUH C;  3DEU A;  3E5U A;  2R7T A;  4X0G A;  2DBB A;  3OSG A;  1MMS A;  4OWR B;  4PUS A;  1TBX A;  2DT7 B;  2QM3 A;  1VQ5 I;  2M45 A;  2A05 A;  1OYW A;  1HW5 A;  2W48 A;  4Y15 A;  1AKH A;  1OKR A;  2FOK A;  1VND A;  2LBF A;  3DTI A;  4UUS B;  3MFK A;  4NQW A;  2LP0 A;  2XB5 A;  1REP C;  4H4K C;  4IQJ A;  4L9N A;  4BY7 J;  3W6V A;  3CJT B;  1DPR A;  1R00 A;  2R7W A;  3FK7 A;  4YZE A;  4E70 A;  2LH9 A;  1BR4 A;  2XDN A;  1FSE A;  2JA5 J;  5TJJ A;  3MKY B;  1JXS A;  2NVQ J;  3CJN A;  4CGZ A;  3N97 A;  1S7O A;  1TQM A;  2QKM B;  3KP5 A;  4HF0 A;  1G6N A;  4ABZ A;  2PJP A;  1E17 A;  1FBS A;  5JHU A;  3RPU D;  3HPH A;  1TTY A;  1GVJ A;  3E7L A;  3I71 A;  2UXU A;  4RAZ A;  3KEQ A;  3HRT A;  1XSV A;  3RKY A;  3OYN A;  5JFR A;  2TDX A;  3WTY C;  1H0M A;  3GTJ J;  3WU1 B;  3CDL A;  1WSU A;  3GTL J;  3HOW J;  4DQ2 A;  4V19 K;  3CCM I;  5L3F A;  1WQ2 A;  3WHC A;  2Q1Z B;  4XOT A;  1HQC A;  3GTM J;  1YX5 A;  3VW1 A;  2JMW A;  3M8E A;  2E5N A;  4S0H B;  2QQ8 A;  4A3B J;  5AON A;  3AQT A;  3JW4 A;  2R92 J;  3W2V A;  3DLA A;  2R7O A;  2VJI A;  4XNF A;  4EJT A;  1F43 A;  4U0Y A;  4CSW A;  3HSE A;  1ZK8 A;  1ZYR F;  2DT6 A;  1W5S A;  3ML6 A;  2K9Q A;  2QUF A;  3KEY A;  1H89 C;  4O3M A;  4ZYG A;  4IHW A;  3OOP A;  1SFO J;  4Q5S F;  2XHK A;  1YW7 A;  4PZJ A;  1V54 H;  3KLO A;  3QP6 A;  4FCY A;  1SAN A;  1X3W B;  1W5C C;  2BGC A;  2JVH A;  3Q3S A;  4BQQ A;  5E3N A;  5CXI A;  1ZR2 A;  4OIP F;  3TGN A;  1K4T A;  2NVU B;  1W5T A;  4XSZ F;  3TDU C;  1AA7 A;  3E6B A;  4DBQ A;  4LIV A;  1R4N B;  3SXY A;  4F3Q A;  5K7Z A;  4NEL A;  4GCT A;  3P7N A;  2YS9 A;  4GRI A;  4K2E A;  4Z2Y A;  3OR1 C;  3IC7 A;  1TL8 A;  1XGS A;  3SHF A;  3RH2 A;  2OC6 A;  4HRI A;  1FPQ A;  1FLI A;  4GFB A;  2A68 F;  1PYV A;  2ZFW A;  3VSK A;  2EFO A;  2XSJ C;  4ZDO A;  2NS8 A;  1UMQ A;  3H9G A;  2Q8K A;  2M87 A;  2YUS A;  4PJM A;  3GFI A;  1I3A A;  4UHT A;  1QZE A;  1U8B A;  3CUQ A;  2R5Z B;  3O8G A;  4NHJ A;  2HI3 A;  4PJN A;  5DV5 A;  1Z7U A;  5D8L B;  4XRM A;  1IUF A;  3VVZ A;  4JL3 A;  2KP6 A;  2M2E A;  3BQY A;  3E0J B;  4B44 A;  2HPM A;  1YYV A;  4U7B A;  1PVE A;  2B0L A;  5KCM A;  3WTZ A;  1BOA A;  2H09 A;  3RYR A;  4B09 A;  5D4S A;  3K1M A;  4ESF A;  3HYI A;  4A3C J;  1BA5 A;  4EAT A;  1TNS A;  2K9S A;  4HNT A;  2LKX A;  1KZH A;  1ETK A;  1MH3 A;  4ZTF A;  1PUE E;  2M8E A;  1QVT A;  4KMU X;  4XON A;  3RDI A;  4XID A;  2NOG A;  2QTQ A;  2DTZ A;  2BY2 A;  1X1D A;  3DTE A;  1JUP A;  3CCE I;  4FIS A;  4GFL A;  4OOI A;  4D9J A;  1DPU A;  3FMQ A;  2ECC A;  3SFZ A;  1MW7 A;  4AIH A;  4H0E A;  2YX4 A;  3OIQ A;  1V5G A;  2LLK A;  4KUM A;  3JTH A;  3VYR B;  1YIT I;  2L7F P;  4LGW A;  3OS2 A;  3IWZ A;  2FD5 A;  3CJQ B;  3DKW A;  3FDY A;  4W1U A;  3BG3 A;  4BBR J;  4L0Y B;  2LFB A;  3F6V A;  3FXM A;  2CO5 A;  2EZH A;  2H8R A;  3K1N A;  2L54 A;  3QP5 A;  2M7B A;  2UXO A;  2UWM A;  4GCV A;  2L01 A;  2V1U A;  1IN8 A;  2HVQ A;  1MZB A;  3WTT C;  4KYW A;  1ZR4 A;  4BE2 A;  2CW7 A;  1D3Y A;  2QWT A;  1GV2 A;  3ZN1 A;  2G9W A;  2HS5 A;  1Z77 A;  2KDZ A;  1KU7 A;  4DW6 A;  2IEK A;  4J00 A;  2MD0 A;  4EM2 A;  3HOX J;  3CCR I;  1IF1 A;  4OD5 A;  3VYT B;  4BH9 A;  2X1E A;  2GM4 A;  2K9N A;  3MZ8 A;  4CCN A;  4E7K A;  4UUV A;  3G4S I;  2ZJQ F;  4BE1 A;  1K6O A;  2IAI A;  3HGY A;  3GLX A;  1SD7 A;  2EIL H;  4YG2 F;  5CJ9 A;  1A6Q A;  3I4P A;  4C3H J;  1JJ8 C;  2D5V A;  2A5W A;  2FOW A;  4MHG A;  5CVR A;  3HSF A;  4Q47 A;  2DT5 A;  4UNO A;  2XRL A;  3E6C C;  3EUK L;  4C3J J;  4IZZ A;  1GHC A;  3A0B C;  5BPD A;  1R7J A;  2VLA A;  4Y7N J;  3EYI A;  3L2W A;  1FOW A;  2NVY J;  1T8I A;  3GCM A;  1JGG A;  3IKT A;  3MKZ A;  1SFK A;  5DEQ A;  1XX5 A;  4FX0 A;  4IPA A;  1ETO A;  2JT1 A;  2W1O A;  1D5Y A;  4CXF A;  3TO6 A;  3KYD B;  4G8X A;  2IBD A;  4JOM A;  1ORK A;  4EM0 B;  1U5T B;  2WY8 Q;  5M3F J;  3BDD A;  2ZBK A;  5GPC A;  4XOP A;  3FXK A;  2QSH X;  3HOS A;  1RC9 A;  2X9D A;  2E35 A;  4MFE A;  1B59 A;  3WG9 A;  1IRX A;  4LOC A;  3JRE A;  3J80 K;  1H88 C;  2G7S A;  4LIT A;  1BIB A;  2R7Z J;  3PFI A;  2ID3 A;  5KNL A;  2BV6 A;  2BZT A;  3P9T A;  2EFW A;  1FIA A;  2MLK A;  1VTN C;  4DYQ A;  3I5U A;  4ZC3 A;  4P55 A;  1FBU A;  4LB5 A;  1RUO A;  1ERD A;  1P6R A;  4HX4 A;  5EG0 A;  1N77 A;  1YW9 A;  4V2F A;  5BQT A;  4N4N B;  2DA2 A;  3GTG J;  2PZ9 A;  3LHQ A;  3S3O A;  2DFH A;  3BJ6 A;  3IRR A;  1YO5 C;  5LGU A;  4PXI A;  2A6T A;  1U0J A;  4BEH B;  3QRF F;  1JKP C;  2YU9 J;  3V4G A;  2VJ5 A;  2H1K A;  4FQG A;  1FWZ A;  3QOP A;  2FML A;  3MKL A;  4RB2 C;  3WOD F;  3D1N I;  1WHU A;  1I27 A;  2W00 A;  4CHU A;  1XS9 A;  2Y0M A;  2F07 A;  2YR2 A;  4A3D J;  3QU6 A;  2RC4 A;  1ON1 A;  5H6Q A;  2ZOY A;  4M3E A;  5D5X B;  1UJ8 A;  2ZCN A;  2MYS A;  5LGT A;  3OYJ A;  1OIS A;  5GP9 A;  3MNL A;  2VKH A;  3PUB A;  4UVC A;  3I59 A;  5DTD A;  3Q9V A;  4CIC A;  2W25 A;  3DPT A;  4HF2 A;  5J8C A;  3OY9 A;  2M30 A;  1RNL A;  2ZB9 A;  1ZRC A;  3CCV I;  3CMY A;  2LRE A;  3MKW B;  3L7W A;  1U3E M;  2P7V B;  4ZTJ A;  1VFC A;  1WJ5 A;  2BOL A;  4HBL A;  3SZP A;  2FA5 A;  1HST A;  2H6C A;  3HTI A;  3HUG A;  2YX7 A;  3HTA A;  1BM9 A;  1T0F C;  4E7S A;  3KP6 A;  1T39 A;  2LDU A;  3RYP A;  1FSH A;  4KFC A;  5J3L A;  3OYM A;  1Y56 A;  4NC6 A;  2MSY A;  3DV8 A;  1N75 A;  2LVS A;  3FKJ A;  2FSW A;  2JA2 A;  4IO9 F;  2ESH A;  3CZ6 A;  1IDY A;  3TP0 A;  2ZC2 A;  4NBQ A;  2R5Y A;  2DJI A;  2DOD A;  3QYB A;  2W4S A;  4BDY A;  2RGV A;  5FD5 A;  2XAQ A;  1SVO A;  1FNN A;  3UNG C;  2EIK H;  3AG1 H;  1IV8 A;  2E1M B;  5D6E A;  2FQ3 A;  2DAO A;  5FLM J;  2VE8 A;  4IJA A;  3HPG A;  4RAG A;  5KAF C;  5ERI A;  3QYE A;  1YOV B;  3X2Q H;  3KEO A;  4RA2 A;  3CES A;  1P4W A;  3WGG A;  1DGR M;  5LEK A;  1F1Z A;  2VBZ A;  3LAP A;  3H36 A;  2MBF A;  1YW8 A;  1MSF C;  2OU2 A;  5BMZ A;  3BR3 A;  2RAS A;  3ZQH A;  2IGK A;  2X6O A;  3I64 A;  3H9J A;  5GTH C;  5DYM A;  1XG1 A;  2O3F A;  2CS3 A;  2I8D A;  4RLF A;  2DI3 A;  2DPU A;  1BI2 A;  1ETX A;  5FMP A;  1K83 J;  2A61 A;  1YTY A;  3BY6 A;  2G7H A;  1JHH A;  1WKM A;  1D0X A;  1YX3 A;  4NN1 A;  2P6S A;  3F1B A;  1G2H A;  4ICH A;  2ZCW A;  1AWC A;  2V1D A;  4AID A;  2PJR A;  1MND A;  5EGO B;  4D7M A;  3OV8 A;  4CGR A;  3QBM A;  2OCE A;  2LKP A;  2H1L A;  1QZZ A;  2KRC A;  3V8K A;  3BZC A;  2KIM A;  4CYD A;  4E6K G;  3ZQC A;  1H8A C;  1KQ0 A;  3HL2 A;  4RB0 A;  3CRJ A;  3ESW B;  3OR2 C;  4D5F A;  4LK1 F;  4ZYD A;  3SWH A;  3VOD A;  1V4R A;  4Z6Y A;  1SMY F;  1A5J A;  4CUG A;  5J1R A;  3EPZ A;  1N25 A;  4F92 B;  3COA C;  2CRG A;  1D1B A;  1SMT A;  4X6A J;  5D6F A;  2Y0S A;  2B9S A;  4ZDP A;  4J01 A;  3NS4 A;  4EGY A;  1QVU A;  2DU9 A;  1W7P A;  1GT0 C;  1WGX A;  2MLG A;  3RPQ A;  1HC8 A;  6PAX A;  1FZP B;  4IF4 A;  3DP7 A;  5GAG J;  2Q0O A;  3VVX A;  3CCY A;  2NXN B;  4RDU A;  2XF7 A;  2NNN A;  1G3S A;  3ABM H;  2JVG A;  5FLV A;  3JRB A;  1J59 A;  4A3I J;  3GME A;  1U8R A;  1KU2 A;  2VPL A;  3H9Q A;  3FZV A;  3PUF A;  4C2M J;  2D6Y A;  2L9S A;  2X6Y A;  3HTS B;  2WAQ A;  3FHZ A;  5LHH A;  5DDG A;  4Q48 A;  5B1A H;  2PX9 A;  1FP2 A;  5CVI A;  5EDN A;  5F08 A;  3S8P A;  5HLG A;  4IOC F;  5FKN A;  2PMZ A;  3H35 A;  1XDS A;  1R36 A;  3C2B A;  3BWG A;  4BKX A;  4KIC A;  4LG3 A;  3ASO H;  5J4Y A;  1USS A;  1IRZ A;  1SVL A;  3L00 A;  4RLQ A;  1I6X A;  1LVK A;  2DA7 A;  4LB6 B;  1F4K A;  5JI6 A;  1BN5 A;  1Y1V J;  5DCM B;  3ZMT A;  5IP7 J;  4AYB A;  4A3F J;  1FOK A;  1VQ6 I;  4XM3 A;  3RD3 A;  4XLN F;  3MAJ A;  3FIS A;  4IHY A;  1G59 A;  3OIO A;  2AQF A;  3DEE A;  4I98 B;  1SVM A;  1OFC X;  3AKZ A;  4A3K J;  2ZME B;  1LKX A;  2ISY A;  2XKO A;  3B73 A;  1W36 D;  1PUF A;  4I01 A;  2YU3 A;  5HS9 A;  3BR6 A;  3AG3 H;  3SZG A;  3WG7 H;  1S72 I;  3OWT A;  2IVM A;  2VJ4 A;  1HA8 A;  2F5C A;  2ZXJ A;  3DU6 A;  2F5D A;  1Y1W J;  2M0M A;  2P8T A;  1VQK I;  4AM3 A;  1SD5 A;  1LE8 A;  4WXC A;  2YVE A;  4B43 A;  1Q1H A;  2RAE A;  2E1N A;  4D5C A;  2Q2E A;  4AIK A;  4M74 A;  3DKX A;  1J2X A;  1Y0U A;  2HOS A;  4ENN A;  5E1Z B;  4CCO A;  3WGH A;  4CCM A;  1XGO A;  3OMY A;  3GTQ J;  3KP4 A;  4HPQ A;  5L3G A;  1HW1 A;  4KIS A;  3T6N A;  3OYF A;  1BI0 A;  3FMR A;  3G1M A;  2HKO A;  4ZYA A;  4OIO F;  3IAS 2;  3TO7 A;  5LLQ A;  1MNE A;  3LWF A;  1BW6 A;  5E1X A;  3VDX A;  3F22 A;  2REK A;  4U9L A;  2DXI A;  2CJJ A;  1K78 A;  2P7C B;  1IDZ A;  2JUG A;  3LSI A;  1WJB A;  4CA0 A;  1YS6 A;  2DTR A;  2ZJP F;  1FTZ A;  2G7U A;  1JE8 A;  3S14 J;  1DU0 A;  2C6Y A;  2E2I J;  1KYW A;  2CH0 A;  2EIM H;  2ECB A;  2PBI A;  2XF6 A;  2Z1D A;  3PNV A;  3ZMZ A;  3LSP A;  2QIB A;  3K70 D;  5BS6 A;  3JRA A;  3LSM A;  4ZZD A;  3PSI A;  4UUS A;  1TWG J;  4MXM A;  1B72 B;  5HS8 A;  1IXR C;  4PSX A;  4OMZ A;  2G0E A;  3HEF A;  3VP5 A;  4XLF A;  4WIB A;  5E8I A;  1B1B A;  4M6Y A;  2L9V A;  2QEN A;  3B81 A;  2QYO A;  2EBI A;  2V4J C;  4BE0 A;  1IG7 A;  3WE2 A;  3TL4 X;  1Z0X A;  2IS1 A;  5IY5 H;  2LK2 A;  1KON A;  4J19 A;  2K4B A;  2L5Q A;  3K2Z A;  1ETY A;  2X1C A;  2Q24 A;  4YRV A;  5HLI A;  2E34 A;  2VN2 A;  3CDI A;  3ABK H;  1MNM C;  1QNT A;  2OCC H;  2G7L A;  3HKZ N;  3V42 A;  2UXN A;  4BXX J;  2ZO4 A;  5K5O A;  4WF2 A;  3RQI A;  3GF2 A;  3H3Z A;  3CP8 A;  5CXG A;  3ABL H;  2WAD A;  4MEY F;  2OTJ I;  3ZP5 A;  1SAX A;  2W53 A;  4CH7 A;  4R79 A;  1A31 A;  3GTP J;  3K8P C;  1Z3Y A;  2Z2S B;  3ON2 A;  2EV5 A;  1IN4 A;  1S7A A;  3HIF A;  3O3K A;  1MMD A;  1VQM I;  2KZG A;  1FYK A;  4AF5 A;  4EJW A;  5IP9 J;  4AIJ A;  2HKU A;  4EM1 A;  5HDN A;  2ZNY A;  2QQA A;  2IP2 A;  3LSG A;  3S16 J;  2M8G X;  2XKP A;  2WWY A;  3IH4 A;  4F55 A;  1P2F A;  4L62 A;  2ZJR F;  3B6A A;  2I5U A;  2DN0 A;  1I6H J;  1RES A;  4JQF A;  3CME I;  1DP3 A;  2DMU A;  4AVZ A;  4I0A A;  5J8F A;  2WAF A;  2GOM A;  3HXL A;  3RQ4 A;  4Y13 A;  2GUH A;  3NAR A;  3F23 A;  3F6O A;  3PAS A;  4MK6 A;  4CZZ A;  2XAS A;  2AO9 A;  2FF4 A;  4IHV A;  2KKO A;  1YQA A;  3CCJ I;  1A36 A;  3LA3 A;  5J6X A;  2Y2Z A;  5F64 A;  1NK3 P;  3L09 A;  3L2C A;  1DGW Y;  2DJN A;  1SFE A;  3FXO A;  4M73 A;  5B1B H;  1U5T C;  2ISZ A;  2D2W A;  2Y0S N;  2KL4 A;  3K7A J;  4LLL A;  3BJO A;  1T6S A;  2BVM A;  4KIF A;  4HV6 A;  2E36 A;  2X6W A;  1VQP I;  4BGD A;  3NRG A;  1LFP A;  1OYY A;  4IKF A;  3QAH A;  4XMY A;  3OYE A;  5HOD A;  4ZDL A;  1YJW I;  2P81 A;  3CLQ A;  4IHT A;  3PJR A;  2HYG D;  5EEA A;  3V6G A;  1HSJ A;  1WH5 A;  1ETW A;  3FK6 A;  2RRE A;  2V9K A;  3AG2 H;  2HYF A;  2K3F A;  1U2W A;  2R4G A;  5HDG A;  3VTI A;  2WAQ N;  3BR5 A;  1V55 H;  4YEJ A;  5D8K B;  3GBG A;  1A6I A;  4FT8 A;  2FNP A;  4NC7 A;  4JNN A;  2MD5 A;  2R7S A;  1X3Z B;  2LF7 A;  1IRG A;  2L2O A;  3DPU A;  2IS6 A;  3NEU A;  4A0X A;  4YIR X;  1HKT A;  4E7L A;  3E1S A;  4HW0 A;  2OI8 A;  2XF5 A;  1OYI A;  2DYR H;  1FMW A;  4I7H A;  2K9L A;  1K61 A;  2PMZ N;  3HOU J;  2ZNZ A;  4LG0 A;  2WA0 A;  4U9N A;  3CJD A;  2GOX B;  1A35 A;  3HOT A;  2GXA A;  2ZXW H;  4DGW B;  1TQP A;  3IUV A;  5EJC A;  3NWS A;  2R7R A;  3KZY A;  5HVQ C;  1ENH A;  2R7X A;  1OCP A;  5DS9 A;  3FKI J;  4RGR A;  1XC5 A;  3S32 A;  4AYB N;  4P9F A;  3K1P A;  3HBL A;  4NNJ A;  4JX6 A;  2E2H J;  4M72 A;  1W1W E;  2PMU A;  1ZLK A;  5FRM A;  1R58 A;  1TLH B;  3C7J A;  4EMS A;  5EF6 A;  3FXQ A;  3A03 A;  1KQ9 A;  1R49 A;  2P5V A;  3CQZ J;  2KHM A;  3RI4 A;  1NG6 A;  2DO7 A;  3NPI A;  1BC8 C;  3ZGK A;  2QQ9 A;  4E4H A;  1MKM A;  5F1J A;  2F6C A;  1OCR H;  2VT3 A;  1POG A;  4IRV A;  3BR0 A;  2F5E A;  1G3W A;  4UDS A;  2HTJ A;  4M9X A;  5ILS A;  2CQK A;  3BHQ A;  5EFY A;  3C2G A;  1R1U A;  1X4P A;  1R6R A;  3MN2 A;  3QYF A;  2M1B A;  3S3M A;  2X48 A;  5D5W B;  2DMT A;  2CFX A;  3DFG A;  2DOF A;  3HZJ A;  4RAY A;  1TW2 A;  5L3B A;  4ENM A;  3DF8 A;  5HNF A;  1YJN I;  1Y8Q B;  4ENJ A;  1TP4 A;  2WUI A;  5KAI C;  3GVA A;  1JUM A;  2ACJ A;  5EEG A;  1T38 A;  3T8T A;  2E1M C;  4HX8 A;  4D7N A;  3F0C A;  1G4D A;  1GLN A;  1W7P D;  2EIJ H;  3LL7 A;  3FXR A;  4OU0 A;  5H20 A;  5J4V A;  5AIP A;  2E7W A;  2IGO A;  2H8W A;  4UB8 C;  2XGE A;  3BCA A;  3LST A;  1AKH B;  3VVY A;  2OBP A;  5TGT A;  2LBF B;  4QPO A;  5AQC A;  3I56 I;  5ICF A;  3KCC A;  1GDT A;  3DU5 A;  4XOR A;  3FRQ A;  1S8N A;  4ANJ A;  2HVR A;  5A2Q Z;  4JBA A;  3GEU A;  3G71 I;  2O6G E;  3PQJ A;  3EUH A;  4C3I J;  1G3Y A;  3VPR A;  2E2J J;  3N05 A;  3FBN B;  3KIO A;  2L7K A;  1RKW A;  1WJF A;  2ELJ A;  2RDP A;  3SYT A;  3BLY A;  1YRN A;  3K4B A;  3HOV J;  2UV1 A;  1D5V A;  4KT6 A;  1PP8 F;  5FKM A;  2DCE A;  3OL4 A;  2PMH A;  4MTE A;  2L7M P;  2JA6 J;  2DFI A;  1TWA J;  3ZQF A;  2QKL B;  2O9L A;  4C2U A;  2QF7 A;  2CV1 A;  5BOX A;  2NNY A;  2K7L A;  2Y69 H;  3L1P A;  3CO6 C;  2DA1 A;  4S05 A;  1Z91 A;  4ESB A;  4HNU A;  3ABU A;  3ZXS A;  4G7O F;  4HLX A;  1K6Y A;  4HST A;  2XSD C;  2OAZ A;  2QBY A;  4M6X A;  5FO5 A;  5FJ8 J;  4HYE A;  1Z21 A;  4X1E A;  1E2X A;  3PO3 J;  2FU4 A;  4PJJ A;  1R5G A;  1P4A A;  4A69 C;  1XSD A;  1CF7 B;  3ZOB A;  4HA8 A;  3MVP A;  5H6R A;  3OYA A;  1IXS B;  3ON4 A;  4KMF A;  2R7V A;  1ZKG A;  1MIJ A;  3NXC A;  1B8I B;  2QLZ A;  3JRH A;  5C4Y A;  4BDZ A;  3MWM A;  3HTJ A;  1I39 A;  2JJ7 A;  2K02 A;  2GWR A;  1ITY A;  2O8K A;  3BNI A;  2VKD A;  2BVL A;  1Y39 A;  1Z7L A;  4MO7 A;  1H9G A;  4DNC A;  2HDC A;  4HDV A;  3LQR A;  3KYC B;  3U21 A;  4BU2 A;  3LNQ A;  3H5N A;  1XGM A;  1ON2 A;  1W4M A;  2NYX A;  4AD9 A;  3EUA A;  3RZO J;  3V78 A;  4LJZ F;  3K4M A;  1F5T A;  4A0Z A;  1ZQ3 P;  1TW3 A;  3EYY A;  2A2F X;  3T5X A;  3ULQ B;  1SFX A;  1ZGA A;  4A6E A;  2BY0 A;  3CF2 A;  3FXL A;  3JSP A;  2E5Z A;  2K27 A;  3QWL A;  4UUT A;  3WU2 C;  2QKO A;  4N4O B;  3NI7 A;  1BR1 A;  4BXF A;  2D1V A;  4UVB A;  3HIM A;  2KRF A;  3AL0 C;  2UXP A;  2E71 A;  3GZ5 A;  1HCR A;  2GFN A;  3V7C A;  5FLX Z;  2CYY A;  3S1M J;  2OD5 A;  2DMN A;  1RR7 A;  2BY3 A;  3VWB A;  3B02 A;  3S2W A;  4L5J A;  4G6D A;  2EA2 A;  5JLW A;  4G9Y A;  1HDD C;  3S1N J;  3HE0 A;  1PP7 U;  4HQM A;  3VW2 A;  3WTW C;  3LAJ A;  3ZQ7 A;  5FFX A;  4ETS A;  4I02 A;  4G6Q A;  1QU3 A;  3BPV A;  2QOP A;  1GXQ A;  3K69 A;  4KDP A;  2EIN H;  3TQN A;  3CUQ B;  2ZME C;  1IAW A;  2JZY A;  3KFW X;  5E3L A;  1ZHF A;  1IO2 A;  1ZRE A;  2J5O A;  4A3M J;  4KA4 A;  3O8H A;  2HYT A;  4IHX A;  5CYV A;  1ONV A;  3PO2 J;  2A69 F;  3RKX A;  2CGP A;  3K10 A;  4MFD A;  3P9C A;  2DW4 A;  1ZGW A;  2VKE A;  1OQY A;  2X4H A;  3MQ0 A;  5LBQ A;  1DDN A;  3VSL A;  1ZAO A;  3FXU A;  3IWF A;  3RKW A;  3VYS B;  4DVY P;  1JGS A;  1WI3 A;  2DMP A;  2DLL A;  3I9V 2;  4BHC A;  2TCT A;  4BL0 B;  3CDH A;  5E1W A;  4RB1 A;  3I58 A;  4E7I A;  2HKX A;  3RCO A;  2IRF G;  3PPB A;  1YHQ I;  2HOE A;  2HNH A;  3D5S C;  3TOA A;  2E19 A;  1OCC H;  3J81 K;  4LD5 A;  1WI9 A;  1PJR A;  5M3M J;  3KET A;  4DJA A;  1ODD A;  1KYZ A;  3QPT A;  2GIZ A;  4UY8 I;  3R0J A;  2MFZ A;  2XGC A;  3DEW A;  5K5Q A;  3PQK A;  1K79 A;  1IC8 A;  1QZY A;  4MTD A;  1MBE A;  3BRO A;  3BTJ A;  3K4N A;  3ZMD A;  2E1C A;  4NUB A;  4L18 B;  3M3Y J;  3EGQ A;  4B8X A;  5EZH A;  3ZN0 A;  1IUY A;  2XPW A;  3KKC A;  1YJ9 I;  2L4M A;  4I6Z A;  4XKV A;  1UHS A;  3BRU A;  2KPM A;  3VOX A;  3R61 A;  3D5R C;  4OD4 A;  5IPA A;  3JCU C;  2BW3 A;  2A5Y B;  3NRV A;  4XLP F;  5CVV A;  4OAZ A;  1SAU A;  3FBI B;  2ESN A;  2ZY9 A;  3E5Q A;  2QSG X;  2V9V A;  4NB5 A;  1BIA A;  2V6C A;  3CD6 I;  1E3O C;  5FFZ A;  3HDD A;  1XDU A;  2NS0 A;  2NRA C;  4QSH A;  1XCB A;  5FGM A;  1LPQ A;  3S2H J;  2F48 A;  4YFN F;  9ANT A;  2CW8 A;  3Q0V A;  3OYK A;  2H94 A;  2W85 A;  2EK5 A;  2ID6 A;  4DYC A;  3AAF A;  1MMG A;  2R0Q C;  3L2V A;  1MJA A;  4UV9 A;  1R23 A;  2Z33 A;  1ZEL A;  2UUZ A;  3SJM A;  2IW5 A;  2DG7 A;  3Q9S A;  2ZSH B;  5E79 C;  1VZ0 A;  1X2N A;  4HZF A;  4U88 A;  3HOZ J;  1U78 A;  1TWH J;  1CQT A;  3ECH A;  3MEX A;  2XGD A;  2NS7 A;  3OL3 A;  5IOZ A;  2XUB A;  1P7J A;  3A01 B;  3TP3 A;  2CW0 F;  3HKZ A;  4QPQ A;  1Y6I A;  4XKB A;  2KIQ A;  1DU6 A;  3MCZ A;  1NHA A;  2JPB A;  2M5W A;  4N9I A;  3I55 I;  3U1K A;  1VQL I;  3VB2 A;  4XLH A;  4F7Z A;  1BJZ A;  3ZPL A;  1OPC A;  4CYC A;  4RMN A;  5E17 F;  5J40 A;  2YVH A;  2M9H A;  3PNT A;  2CG4 A;  1EKE A;  5IT3 A;  2PFB A;  2EV6 A;  2V26 A;  3A1Y A;  4WWC A;  5DCM A;  1Z6T A;  3QPL A;  1WJC A;  2K4J A;  3QQA A;  2VBX A;  4BXU A;  3SFI A;  2EZI A;  4BAY A;  3GXO A;  5HLT A;  3EDP A;  3DQV C;  3FWE A;  2JK3 A;  2JRM A;  2MC4 A;  1UFM A;  5B66 C;  3SDB A;  3C18 A;  1R5H A;  1A04 A;  2FJ1 A;  1IGN A;  4ACI A;  2ZOZ A;  2K5C A;  1Y8R B;  3CMM A;  2HOT A;  2JTV A;  3F8F A;  1MDM B;  2CWE A;  4Y17 A;  4A3J J;  2A3S A;  5IYD J;  3LSJ A;  1J0R A;  1VQN I;  3R6S A;  4A5N A;  3FF5 A;  4ITV A;  4HDU A;  2Z9O A;  1U9N A;  3UR3 C;  1T33 A;  2V57 A;  1VQO I;  4IOA F;  2OJE D;  4C30 A;  2F4O B;  3I59 B;  1HXD A;  4Y52 J;  4PSW A;  1XB4 A;  5L3C A;  5GAH J;  3PIP F;  2MH9 A;  1X1C A;  2GIV A;  4XQF A;  2O8X A;  1T2K A;  2HQN A;  3E6D A;  2GLO A;  2WGB A;  4LIU A;  3S5R A;  1UG2 A;  4TV7 A;  3A4C A;  3D5L A;  1HBX G;  3HUG B;  2HXI A;  3ANG A;  1BW5 A;  3BQZ A;  2AXT C;  1MMA A;  1Q1V A;  2PBX A;  1D8K A;  4I0B A;  2ADU A;  3Q0U A;  2XIG A;  2IS2 A;  2F5V A;  2ZCX A;  1SD4 A;  2WB1 N;  4MNU A;  1B72 A;  2MAB A;  3PFY A;  4EVI A;  3V8J A;  3OYD A;  1TC3 C;  1S5L C;  2EFP A;  5LD2 C;  4EV0 A;  1ZLJ A;  3JAM Z;  2HZT A;  1ZGJ A;  2UXI A;  2M4G A;  4PFO A;  1T0F A;  4JYK A;  5F0C A;  2V1N A;  4B48 A;  3AL0 B;  3CC7 I;  1ZG3 A;  1YFH A;  3K4C A;  1S7E A;  4AWX B;  3J7A O;  4WXH A;  3ISP A;  1VQ7 I;  2L7Z A;  1OR7 C;  4FX4 A;  4E7J A;  2VOD A;  1W0U A;  3W2A A;  4RS8 A;  1V5E A;  3R0A A;  3JTG A;  2CUZ A;  1O3S A;  2JSC A;  2X6X A;  2VE9 A;  2FBK A;  2EPF A;  2VJJ A;  5M5W J;  1WWX A;  2EZL A;  1XCV A;  4ASN A;  1YE9 A;  3DKY A;  4LLN A;  2VON A;  3BG6 A;  1EV7 A;  2EZK A;  4B1R A;  4F93 B;  1FC3 A;  3VFZ A;  5GPA A;  4G7Z F;  2HR3 A;  2DOA A;  4HQE A;  4AC6 A;  3VW0 A;  2XRN A;  4Y4R A;  2M4K A;  4BJ5 C;  5ILU A;  2ME6 A;  1LDK B;  1OJL A;  3IRQ A;  5K5R A;  3T1B A;  3HTU A;  3IP4 B;  1TWC J;  4B47 A;  4BHB A;  1OMI A;  3LA2 A;  4XN3 A;  5JHF A;  3G73 A;  3GO5 A;  2DFE A;  5GTI C;  1B4A A;  2DYS H;  3V7R A;  3TBI A;  2PJR B;  4BYY A;  1LB2 A;  2VL8 A;  1X1A A;  1JT0 A;  5DCF A;  2EFQ A;  4GFK A;  1JTX A;  1RET A;  4OAY A;  5F27 A;  4XRS G;  3FHN A;  2IJL A;  2NOJ B;  2HU9 A;  2W84 A;  2CUJ A;  2EWN A;  1MD0 A;  2GXG A;  2QVO A;  3WGI A;  4ZYE A;  4HX7 A;  2WBM A;  2IT0 A;  2E7X A;  1QPM A;  2L4A A;  2VQH A;  3HOY J;  3VUQ A;  4P5O A;  1JJ6 C;  2H27 A;  2DDB A;  1JHF A;  4N0B A;  4HOB A;  2Z16 A;  1ZN2 A;  2RHA A;  1LVA A;  1RI7 A;  2VT2 A;  5CQG A;  1FJL A;  1XGN A;  4CDG A;  4A5M A;  5LRS A;  2GXB A;  3GFJ A;  1W7P B;  2MW8 A;  1JUS A;  3DPL C;  3VEP A;  3IV5 A;  2B7E A;  4JP0 A;  2OV7 A;  3TMO A;  1GUU A;  3OYI A;  4KNY A;  3M07 A;  2NAZ A;  5M5Y J;  1TT5 B;  4U87 A;  3I53 A;  2LR8 A;  2FBQ A;  2D1H A;  2NVX J;  2EV0 A;  2STT A;  4BHP A;  4GGG A;  2UXH A;  1GVD A;  4PJL A;  1JKR C;  3SZT A;  4RM2 A;  1AOY A;  2LRD A;  3MMY B;  4MQV A;  1MBG A;  4PK4 A;  1Z9C A;  1JKQ C;  4C2M A;  4OIN F;  3J7Y J;  2KIU A;  2P6T A;  3DXJ F;  4R1H A;  1KQ8 A;  4CCJ A;  3QOD A;  5CLS A;  2BE5 F;  1MSE C;  4IHS A;  4YEL A;  3BOQ A;  1R1T A;  2O61 A;  4U0W A;  3BG5 A;  5ILV A;  3OS1 A;  3C07 A;  1KU9 A;  5IYC J;  3FXJ A;  3ZMU A;  1UHW A;  1TQI A;  5CW8 A;  3ELK A;  4MEX F;  3W6K B;  3S15 J;  1N78 A;  2KRH A;  3B6C A;  1EH6 A;  5LFA A;  2X85 A;  3W6J B;  1ACI A;  4P96 A;  2P5K A;  2P4W A;  2KJC A;  2W24 A;  4OMY A;  1T08 B;  5FRN A;  5BPI A;  3VOE A;  1LEB A;  4BBS J;  3NNR A;  2X1D A;  3U9G A;  5FD6 A;  3BG9 A;  3G6E I;  2VXD A;  1OR7 A;  2HDD A;  4IVN A;  2NVT J;  4EGZ A;  2XAH A;  5EEH A;  2DQR A;  1R22 A;  5E3M A;  3CC2 I;  1LE8 B;  2AQE A;  5IT9 K;  4GXO A;  3FM5 A;  2IA0 A;  2DA6 A;  1O4X A;  2Q2E B;  2RVC A;  3LQQ A;  2E1O A;  1QBJ A;  4AUX A;  3D0S A;  1UG0 A;  1E3P A;  4RM3 A;  1XN7 A;  1WVR A;  1X1B A;  1XMA A;  5K1Y A;  3RTR A;  1J09 A;  5K7H A;  2DPD A;  1BJA A;  3DWL E;  4UB6 C;  5TIS C;  3QOE A;  4PGH A;  2FQ4 A;  2Y75 A;  1HKQ A;  3TKY A;  3TDZ C;  1P92 A;  5FB2 A;  3CUQ C;  4B3X A;  3S1R J;  1MMN A;  2KDO A;  2FXA A;  1ZG1 A;  5L3E A;  1SD6 A;  2JQ7 A;  1K78 B;  2STW A;  2QSF X;  3Q0W A;  1LUJ B;  1EH8 A;  2ETH A;  4QTR A;  2VB6 A;  2BYV E;  4XLA A;  1IW7 F;  3HG9 A;  1OCO H;  1X58 A;  4XR6 A;  4JK1 X;  2R5Z A;  4BS9 A;  2ZCM A;  4EEF G;  2BHY A;  2QEX I;  1P7I A;  2PG4 A;  3TO9 A;  2B1E A;  3KKD A;  4I76 A;  2CV0 A;  4RAF A;  4KWA A;  3JRF A;  2JRT A;  5DM7 F;  4R8H A;  1D1A A;  1K4S A;  2ZFU A;  1W36 C;  1QHG A;  1WZ2 A;  3S3N A;  5TRD A;  3BCB A;  5HNH A;  1X3U A;  4FE7 A;  4PCQ A;  2XVC A;  1B6A A;  1LEA A;  5KK1 A;  5FGL A;  1FYM A;  2G7G A;  2A6H F;  1FT9 A;  5DUK A;  5E20 A;  3GYH X;  5B3S H;  1WFX A;  2FX0 A;  4V2G A;  3TED A;  4KT5 C;  3KX2 A;  4A12 A;  1QA6 A;  4NDL A;  3U1D A;  2CFO A;  1XPX A;  2LY2 A;  5E3O A;  1CGP A;  1B9M A;  3OYC A;  3F9K A;  1MH4 A;  2MC3 A;  1IN5 A;  3CWR A;  2HTS A;  4GCK A;  3CLO A;  2IA1 A;  1MBK A;  1UHM A;  2GQQ A;  1IV6 A;  1CF7 A;  1V5F A;  2EQR A;  1SGM A;  2HGC A;  2XV4 S;  4KN4 X;  5F0H A;  1QHH D;  2L3D A;  2L02 A;  2OF7 A;  4D1Q A;  3L2R A;  1O7F A;  4C9Y A;  3FM3 A;  3NQO A;  1B8I A;  2VI6 A;  3MD2 A;  2N8G A;  3GZN B;  3E7Q A;  4EJO A;  3A2K A;  4A93 J;  4XIC A;  5D4R A;  3F8C A;  2LSO A;  2RKH A;  5B5E C;  1D1C A;  5HDK A;  2ZKZ A;  1UI6 A;  3RSN A;  1VI0 A;  4ENK A;  3H3U A;  4DYR A;  4RGX A;  3K70 C;  1FY7 A;  3GZ6 A;  2M0C A;  4Y3O A;  3JRG A;  2DA3 A;  1Y0N A;  3E5X A;  2RV8 A;  5DAJ A;  3DTK A;  4FHT A;  2VQG A;  3M1E A;  2M34 A;  1DUX C;  1VQ4 I;  4L9J A;  2ELK A;  4LMY A;  2WY7 Q;  4CO8 A;  4YFK F;  2GAU A;  4XKC A;  3P5J A;  3REO A;  3KYL A;  3Q5F A;  2B63 J;  2FNA A;  1WJA A;  2O03 A;  5JVT A;  1BOB A;  3GTK J;  2HQA A;  1B9N A;  5LGN A;  2LKS A;  5K7F A;  1BI3 A;  4L9V A;  4NQW B;  1D8J A;  3WTU C;  2EJR A;  1R9T J;  5F6F A;  3BR2 A;  2OPT A;  4KIG A;  3TW7 A;  2R7U A;  2VPR A;  3I0T A;  4BQA A;  4XK4 A;  3IL2 A;  3CCS I;  2KLO A;  1RZ4 A;  1LFU P;  1U5T A;  1XMK A;  1X19 A;  5J47 A;  4KIT B;  1HLV A;  1KU3 A;  2Z5U A;  5CVU A;  2HVS A;  1NK2 P;  4ZZL A;  1T95 A;  3FIW A;  3FMS A;  1ZRF A;  4XLC A;  1XMX A;  3ERM A;  2EFN A;  1OCT C;  3COL A;  5JR3 A;  2FMY A;  4G7H F;  2ICW G;  4XSX F;  2XAU A;  2W82 A;  4RGS A;  2LD5 A;  1WJE A;  2LF8 A;  1WRJ A;  3SQN A;  4F91 B;  2F4I A;  2FUG 2;  3HHG A;  4LG0 B;  3S1Q J;  3VOK A;  1LDD A;  3V8L A;  2W7N A;  3A02 A;  2HQ5 A;  1H9T A;  2R3S A;  3ANP A;  1LNW A;  3OYG A;  4IRG A;  3I4M J;  2E60 A;  4BJT A;  1YIJ I;  2F5F A;  3M1C A;  3L9F A;  3CTA A;  3HC7 A;  4BEH A;  1DQU A;  4HNV A;  2OQR A;  5A2Q K;  1T98 A;  1BC7 C;  3KP3 A;  3BR1 A;  2VBW A;  2V7F A;  3BT9 A;  1EJ9 A;  2KZV A;  5HBU A;  5H9T A;  2DOE A;  1QGP A;  3KLN A;  4A2U A;  1APL C;  1FMV A;  3VIB A;  1NG7 A;  3SEZ A;  4A3G J;  4AC0 A;  2OZU A;  4GCL A;  2IXS A;  2AXL A;  4U0V A;  1I5Z A;  1XSX A;  4JX4 A;  1QO0 D;  1M1E B;  4U7D A;  1UAA A;  3UKG A;  1FOX A;  2O7O A;  3CMA I;  3ROU A;  1T56 A;  4HSR A;  3I3L A;  4A0Y A;  2FE3 A;  2QQB A;  3IHU A;  3RIR A;  1STZ A;  2DFF A;  1FP1 D;  3U2R A;  2X0L A;  1HKS A;  2BBY A;  3HB9 A;  3VYU B;  2QA4 I;  4D0P A;  2O7T A;  5JLX A;  4DZJ A;  1KA8 A;  2HPI A;  3C3W A;  3J80 Z;  3QU3 A;  4KN7 X;  3OSF A;  3KP2 A;  2BHZ A;  2YPR A;  2LC2 A;  3CP2 A;  3O60 A;  2PFV A;  1YS7 A;  1S9H A;  2CMP A;  2L9R A;  4WX9 A;  2NX4 A;  1XTA A;  5IYB J;  3L2U A;  2WB1 A;  3C1D A;  3H0D A;  2COB A;  3LSK A;  1PDN C;  2PLY A;  1TT0 A;  3MZH A;  3AFH A;  4XLE A;  3WTV C;  2YVX A;  2M7A A;  4LLG F;  4KJZ A;  3ZCO A;  3OIP A;  4FE4 A;  2GZW A;  2TRT A;  2VC0 A;  2L0K A;  3S93 A;  3WTX C;  3LSR A;  1ZH5 A;  4ZJZ A;  2IU5 A;  3PNY A;  1O3R A;  2UZK A;  2VXZ A;  3S17 J;  3KZZ A;  1JI8 A;  2VOO A;  4L9T A;  3GUD A;  3TOB A;  4BQO A;  3CCQ I;  1IRF A;  2I10 A;  2V1X A;  2ZXI A;  3RZD J;  4RB3 C;  1F9N A;  2LG4 A;  3HJE A;  3P9I A;  3QPS A;  5DD4 A;  1UB9 A;  3GZI A;  4HAM A;  3J81 Z;  3A01 A;  1D0Z A;  1YRN B;  3HGG A;  1FIP A;  4F52 A;  1LDJ A;  3ZQI A;  2R93 J;  2RN7 A;  2LY9 A;  3SEQ A;  3PM1 A;  2WV1 A;  3LA7 A;  2CUE A;  2DA4 A;  2FBI A;  5GAD J;  1HDP A;  3DBL B;  3CUO A;  5FLX K;  1YLF A;  2IA2 A;  4IRH A;  2JA8 J;  3S2D J;  2IGM A;  4HEA 2;  4DZP A;  2HQR A;  1RRJ A;  5F0F A;  2QBY B;  1Z05 A;  1DP7 P;  3ECO A;  3K4K A;  4AU7 A;  1X4O A;  5KHD A;  1MJ9 A;  1WPK A;  3I54 A;  2XDV A;  3G56 A;  5HSZ A;  4M3B A;  1WCM J;  3BG7 A;  3BZ6 A;  2HDW A;  1LJ9 A;  5EGO A;  4G6T B;  4DIQ A;  2HWV A;  4FTH A;  2FJI 1;  2P5L C;  3H1C A;  1R5I D;  2IPQ X;  3GFM A;  3ASN H;  1RPW A;  3ZQQ A;  2H6B A;  2JSP A;  2K85 A;  3L2Q A;  2XAF A;  1SC7 A;  2PN6 A;  3NAU A;  5C44 J;  2XC7 A;  2KT0 A;  2MH2 A;  1D0Y A;  1MDM A;  4EJU A;  2O5R A;  3K2A A;  2OUM A;  4RGU A;  2Y31 A;  2MG4 A;  3ZMS A;  2CUF A;  3K6G A;  2XAG A;  2FEZ A;  1HF0 A;  1UCR A;  4IL6 C;  2JN6 A;  3GLL A;  4ZYH A;  5D5V B;  2X51 A;  3K9T A;  3GEZ A;  5FRO A;  3CF5 F;  4O5V A;  2F2E A;  2VQL A;  3IKV A;  4FET A;  1HW2 A;  1I3Q J;  2LYC A;  4HLY A;  3JRD A;  4HV5 A;  2LMD A;  4E7H A;  4Y33 A;  3H3V K;  1UEL B;  1ULY A;  5J1U A;  5LHG A;  5FHP A;  1X2M A;  1Z1D A;  1VF9 A;  1IJW C;  4WCG A;  1MBJ A;  1LFB A;  4M9S A;  4ON0 A;  2NP5 A;  4HG2 A;  2CQ7 A;  3PIO F;  1NH3 A;  4EQQ A;  4DBR A;  5FKK A;  3OS0 A;  1P9Q C;  1E0E A;  5M5X J;  1EA3 A;  1AU7 A;  4ME9 A;  2WAE A;  4DOZ A;  5EYR A;  4C2T A;  3LFK A;  3ZQL A;  2CQN A;  3ZQG A;  2DDA A;  3H5A A;  2KMU A;  1MGT A;  3OYB A;  2XPV A;  3HM5 A;  4UVA A;  2VIX A;  1MBH A;  3RPU A;  5J1Y A;  4ESJ A;  3F3X A;  1VQ9 I;  4L0Z B;  1J9I A;  1GXP A;  3DLL F;  3T0Y A;  4P9U A;  5DM6 F;  2Z3Y A;  5AIQ A;  1BL0 A;  3GW2 A;  4I99 C;  1JT6 A;  2WTE A;  4CCL A;  1TZL A;  1WJD A;  4JKZ A;  5K58 A;  2Y48 A;  2Y9Y A;  1O3T A;  3W3C A;  1OCZ H;  5EG0 B;  3KP7 A;  4B3A A;  1TNT A;  2JUC A;  5LEJ A;  2PI0 A;  4E7Z A;  2COM A;  2ZME A;  1R71 A;  1C0W A;  2Y9Z A;  2XAJ A;  4XRS A;  5E8G A;  3LFU A;  1FBQ A;  2M3A A;  2R7F A;  4MQ9 F;  3V7S A;  1SFU A;  4HF1 A;  3GTO J;  2QWW A;  2CU7 A;  3K0L A;  4M9Z A;  2ZSI B;  4GYG A;  2LY1 A;  3KE2 A;  2NP3 A;  1ETV A;  5F04 A;  4MIM A;  4P1W A;  3KZI C;  1G8X A;  5CVJ A;  3ABT A;  1QRY A;  3DBH B;  2FBH A;  3LOC A;  5KVR A;  1O7L A;  3GX4 X;  2DG8 A;  2IS4 A;  3BCG A;  3WTS C;  3K4J A;  4IRI A;  4M3D A;  1RUN A;  1GV5 A;  3C2H A;  2WC2 A;  1MJB A;  4A3E J;  3LWJ A;  4CCK A;  4GDF A;  5C4X J;  4AVP A;  2IGN A;  4IQ4 A;  5HLH A;  2OZ6 A;  1QPI A;  4YIF A;  4QLC U;  3G1O A;  1IZ1 A;  4XN0 A;  2P0W A;  5HAW A;  1U6G A;  2BXY A;  5C3E J;  4MLO A;  2R7Q A;  2BW3 B;  1V3F A;  3JR9 A;  3F21 A;  2FRH A;  1YG2 A;  3HRM A;  3QPH A;  1I1G A;  2K86 A;  3IH3 A;  2EH3 A;  4KIB A;  4LK0 F;  5HS7 A;  2OER A;  3H5R A;  4BY1 J;  1AHD P;  2D45 A;  3P9K A;  1Z67 A;  2HZD A;  1YI2 I;  3EET A;  2KJB A;  3BTI A;  2GA1 A;  3G7R A;  3G3Z A;  3HRS A;  1L3L A;  2MGQ A;  5FKL A;  3LSH A;  4QWQ A;  1HOM A;  5HOO A;  1ZTR A;  5E18 F;  2CQQ A;  3IH2 A;  2R5Y B;  1J75 A;  3MZY A;  3LMM A;  2HOA A;  3CCL I;  2JPC A;  3M4O J;  3HHH A;  3OYL A;  4YFX F;  2XPU A;  4ZH4 F;  2V9P A;  5ICC A;  3O2P E;  3EUP A;  1EF4 A;  1UI5 A;  3KZ9 A;  1F36 A;  2PEX A;  3AG4 H;  2A07 F;  2R7D A;  2LTP A;  3ERE D;  4BAC A;  2OA4 A;  2EA4 A;  2MA3 A;  3BP8 A;  2F4M B;  1ZRD A;  4M3G A;  2EB7 A;  3T8R A;  1QQI A;  3K4L A;  2BEO A;  3ZRG A;  2VQC A;  4A6D A;  2BY1 A;  4PFP A;  2V6E A;  4B4C A;  3JRC A;  1I1S A;  3I4N J;  2QZ8 A;  2HEO A;  4L5E A;  3WE3 A;  5CQE A;  1FEX A;  2CV2 A;  1RR8 C;  2KIS A;  1S6L A;  1G3T A;  3R4K A;  4CYC B;  2RNG A;  2DMQ A;  3DCF A;  4L5I A;  1FTT A;  3M8F A;  3O6B B;  4O6J A;  2VOP A;  2VKV A;  5FKO A;  3F8B A;  5JVG F;  1L0O C;  2GA2 A;  4M3F A;  2UXX A;  3W2W A;  3HTH A;  3E6M A;  4EJV A;  4M6V A;  2LNB A;  1UZC A;  5LRR A;  3M9A A;  2RQP A;  4XL9 A;  4PDK A;  3JAM K;  1JKO C;  5D1R A;  4II2 A;  3M8J A;  1UST A;  1J7K A;  1BI1 A;  2DK5 A;  2AHQ A;  2RQQ A;  2B3W A;  1EH7 A;  3WU0 A;  1JTY A;  2BXZ A;  3BPX A;  2KQR A;  3J7Z I;  4G94 A;  3BJB A;  1S3J A;  2Z99 A;  2VUM J;  1S29 A;  2XRO A;  4RBO A;  2YSR A;  3M7G A;  1YIO A;  2K3P A;  5CKT A;  5BNG A;  2JWT A;  1ETQ A;  2DK8 A;  4IEJ A;  3AQS A;  1Z6R A;  3CJR B;  1J5Y A;  2RNJ A;  3G2B A;  5EZG A;  3H0G J;  2KFD A;  3LJL A;  1ZAR A;  1FOY A;  2K40 A;  4A3L J;  3CCU I;  2OTL I;  1W0T A;  1R1V A;  1RKT A;  1OLT A;  1O3Q A;  3J7A Y;  2VAS A;  5IOY A;  4GO1 A;  3BJA A;  4LFU A;  4WK8 F;  3JSO A;  4XRF A;  3TW6 A;  3CO7 C;  2CSO A;  4UXN A;  4W97 A;  1VQ8 I;  3R60 A;  3GWZ A;  4II3 A;  4BUP A;  3OOU A;  4HKU A;  5CPR B;  3JRI A;  2G3B A;  3E97 A;  1ZG5 A;  5ICG A;  3BC8 A;  5H2F C;  3H92 A;  4OIR F;  1RIO H;  1NTC A;  3E3V A;  3QKX A;  3HRU A;  2OQG A;  5DD8 A;  1TWF J;  3FX3 A;  3PL8 A;  4BJ6 C;  1KGS A;  2DQL A;  3GFL A;  5DUI A;  5D18 A;  4S04 A;  1SEU A;  3BTC A;  2ME0 A;  4GYI A;  1FX7 A;  4I09 A;  2AS5 F;  4IX7 A;  1MBF A;  2ZXH A;  3BZK A;  2GEN A;  4BNC A;  1XD7 A;  5C4J J;  5F1R A;  5D19 A;  3G1L A;  1E3H A;  1IXC A;  4FAS D;  5ICE A;  1LQ1 A;  2HXO A;  1P4X A;  1IN7 A;  2K9M A;  2LOO A;  3F72 A;  3RJP A;  4XBF A;  2XGX A;  2XB0 X;  3KPH A;  3F8N A;  3NWT A;  4WXD A;  5IT9 Z;  4XKW A;  4M71 A;  1FYL A;  3WHB A;  4PJ0 C;  4NC8 A;  1X1P A; 
#chains in the Genus database with same CATH homology
 3GTK J;  3PPB A;  1WGX A;  3VVX A;  3CCY A;  2HYJ A;  5K7F A;  4RDU A;  1PUF B;  2E19 A;  2GBY A;  3JSJ A;  5FLV A;  3JRB A;  1R9T J;  3BR2 A;  4A3I J;  5M3M J;  2OPT A;  3TW7 A;  2Y30 A;  2VPR A;  4XK4 A;  4C2M J;  2D6Y A;  2XGC A;  1LFU P;  3DEW A;  1IC8 A;  1MBE A;  2DA5 A;  3BTJ A;  4JX5 A;  1U9O A;  2JA7 J;  3EGQ A;  3M3Y J;  1HLV A;  3DPJ A;  1NK2 P;  3FIW A;  4G12 A;  5EZH A;  2XPW A;  3KKC A;  3KNW A;  1OCT C;  1I50 J;  5EDN A;  4I6Z A;  1UHS A;  5F08 A;  2QCO A;  3SDG A;  3BRU A;  3COL A;  2CQX A;  5FKN A;  5IP6 A;  3VOX A;  2LD5 A;  3BTL A;  1WH7 A;  5IPA A;  3C2B A;  3RKQ A;  4BKX A;  4QIW N;  1IRZ A;  3S1Q J;  3VOK A;  2DA7 A;  3A02 A;  2HQ5 A;  1E3O C;  3ANP A;  1Y1V J;  4A3F J;  5IP7 J;  3OSG A;  3HDD A;  4QSH A;  3I4M J;  3RD3 A;  4IHY A;  3FIS A;  3S2H J;  3OIO A;  1AKH A;  2W48 A;  9ANT A;  4HNV A;  1OFC X;  3Q0V A;  4A3K J;  2ID6 A;  1VND A;  3BR1 A;  4DYC A;  4UUS B;  1PUF A;  3BT9 A;  2R0Q C;  2LP0 A;  2XB5 A;  5HBU A;  3BR6 A;  5H9T A;  4BY7 J;  3W6V A;  3SJM A;  2DG7 A;  1APL C;  3VIB A;  1Y1W J;  4A3G J;  3FK7 A;  4YZE A;  4AC0 A;  1X2N A;  1LE8 A;  2YVE A;  4GCL A;  2XDN A;  2JA5 J;  3HOZ J;  1U78 A;  2RAE A;  1TWH J;  1CQT A;  4D5C A;  2NVQ J;  2XGD A;  2NS7 A;  4JX4 A;  2HOS A;  5IOZ A;  1P7J A;  3A01 B;  3TP3 A;  4ABZ A;  3UKG A;  2O7O A;  1DU6 A;  1T56 A;  3GTQ J;  3E7L A;  2UXU A;  3T6N A;  3G1M A;  3HB9 A;  1BJZ A;  3GTJ J;  3GTL J;  3CDL A;  4CYC A;  3HOW J;  1BW6 A;  2O7T A;  2REK A;  2YVH A;  2M9H A;  5JLX A;  4DZJ A;  2CJJ A;  3WHC A;  1IDZ A;  3GTM J;  3OSF A;  3VW1 A;  2JMW A;  3O60 A;  3QPL A;  3QQA A;  2L9R A;  4S0H B;  2NX4 A;  1FTZ A;  3SFI A;  2EZI A;  3S14 J;  5IYB J;  1DU0 A;  4A3B J;  3AQT A;  2E2I J;  2COB A;  2ECB A;  2QIB A;  3LSP A;  2R92 J;  3JRA A;  2JK3 A;  4UUS A;  1TWG J;  4MXM A;  1B72 B;  1F43 A;  4FE4 A;  2TRT A;  2G0E A;  2L0K A;  3HEF A;  3LSR A;  2FJ1 A;  1IGN A;  3VP5 A;  4ACI A;  2IU5 A;  1ZK8 A;  2ZOZ A;  3B81 A;  3S17 J;  2HOT A;  2K9Q A;  2EBI A;  2I10 A;  1IG7 A;  1H89 C;  1Z0X A;  3RZD J;  4IHW A;  4A3J J;  1SFO J;  3QPS A;  2LK2 A;  3GZI A;  5IYD J;  3LSJ A;  4J19 A;  3A01 A;  4FCY A;  1YRN B;  3HGG A;  1ETY A;  1FIP A;  1SAN A;  2Q24 A;  1U9N A;  3Q3S A;  1T33 A;  1MNM C;  2V57 A;  5E3N A;  3ZQI A;  2R93 J;  5CXI A;  2G7L A;  3HKZ N;  1ZR2 A;  2LY9 A;  3PM1 A;  4Y52 J;  2WV1 A;  4BXX J;  2CUE A;  2DA4 A;  3RQI A;  1HDP A;  5CXG A;  5K7Z A;  2JA8 J;  3S2D J;  4NEL A;  2GLO A;  4GCT A;  2WGB A;  4DZP A;  2YS9 A;  3S5R A;  1UG2 A;  2W53 A;  5F0F A;  3GTP J;  3ON2 A;  2HXI A;  3ANG A;  1BW5 A;  3BQZ A;  1WPK A;  3RH2 A;  3G56 A;  5HSZ A;  1Q1V A;  4M3B A;  1WCM J;  2PBX A;  4GFB A;  4AF5 A;  5IP9 J;  2HKU A;  3Q0U A;  5EGO A;  2ZCX A;  2NS8 A;  3LSG A;  4FTH A;  2WB1 N;  1UMQ A;  2M8G X;  1B72 A;  3S16 J;  3IH4 A;  4L62 A;  2YUS A;  3B6A A;  1I6H J;  2DN0 A;  1TC3 C;  1RPW A;  1RES A;  1U8B A;  2DMU A;  2R5Z B;  3O8G A;  2HI3 A;  2UXI A;  2GUH A;  4XRM A;  3NAR A;  1IUF A;  4JYK A;  5F0C A;  3NAU A;  5C44 J;  2M2E A;  3BQY A;  2KT0 A;  3VVZ A;  4JL3 A;  1S7E A;  3PAS A;  3K2A A;  4MK6 A;  2L7Z A;  2AO9 A;  4A3C J;  1BA5 A;  2Y31 A;  2MG4 A;  2K9S A;  2CUF A;  2LKX A;  4IHV A;  1ETK A;  1MH3 A;  1W0U A;  1QVT A;  1HF0 A;  4XID A;  2NOG A;  2Y2Z A;  2QTQ A;  2DTZ A;  2JN6 A;  1NK3 P;  1JUP A;  2DJN A;  4FIS A;  4GFL A;  5M5W J;  2Y0S N;  1I3Q J;  2ECC A;  3K7A J;  3JRD A;  2EZL A;  3H3V K;  2LLK A;  5J1U A;  5FHP A;  1X2M A;  2EZK A;  4B1R A;  3NRG A;  2L7F P;  1VF9 A;  1IJW C;  5GPA A;  2FD5 A;  4BBR J;  4W1U A;  1MBJ A;  3BG3 A;  1LFB A;  2LFB A;  4AC6 A;  5HOD A;  3VW0 A;  2EZH A;  2H8R A;  2P81 A;  2NP5 A;  2ME6 A;  1OJL A;  2UXO A;  5EEA A;  5FKK A;  3V6G A;  1WH5 A;  3FK6 A;  1ETW A;  5M5X J;  1TWC J;  1AU7 A;  4ME9 A;  5EYR A;  2WAQ N;  3BR5 A;  3ZQL A;  1ZR4 A;  2QWT A;  1GV2 A;  3ZQG A;  3GBG A;  1A6I A;  4JNN A;  1JT0 A;  4GFK A;  1JTX A;  1RET A;  5F27 A;  1Z77 A;  2XPV A;  3HM5 A;  4XRS G;  2KDZ A;  1MBH A;  4DW6 A;  5J1Y A;  2OI8 A;  2IEK A;  3HOX J;  1K61 A;  2PMZ N;  3HOU J;  2GM4 A;  3CJD A;  2K9N A;  1BL0 A;  1JT6 A;  3HOY J;  3IUV A;  3VUQ A;  4JKZ A;  5K58 A;  1JJ6 C;  2Y9Y A;  2IAI A;  1ENH A;  3HGY A;  1OCP A;  5DS9 A;  5EG0 B;  1JJ8 C;  4B3A A;  4C3H J;  2D5V A;  2RHA A;  3FKI J;  1XC5 A;  4AYB N;  1FJL A;  3HBL A;  4JX6 A;  2E2H J;  2MW8 A;  2XRL A;  1JUS A;  3IV5 A;  2Y9Z A;  4XRS A;  5EF6 A;  4C3J J;  4JP0 A;  3GTO J;  1GUU A;  4Y7N J;  2CU7 A;  3A03 A;  3CQZ J;  2NVY J;  5M5Y J;  1JGG A;  2NP3 A;  1ETV A;  5F04 A;  4MIM A;  3NPI A;  2LR8 A;  2FBQ A;  2NVX J;  5F1J A;  1ETO A;  1QRY A;  2UXH A;  1POG A;  3LOC A;  1D5Y A;  1GVD A;  3BR0 A;  1JKR C;  2DG8 A;  4UDS A;  2IBD A;  3BCG A;  1ORK A;  3BHQ A;  4M3D A;  5EFY A;  1GV5 A;  1MBG A;  5M3F J;  5GPC A;  1JKQ C;  4A3E J;  3LWJ A;  3MN2 A;  2X9D A;  2X48 A;  5C4X J;  4MFE A;  2DMT A;  1QPI A;  4LOC A;  3JRE A;  2G7S A;  1H88 C;  3G1O A;  5HAW A;  2R7Z J;  1MSE C;  5C3E J;  2ID3 A;  4MLO A;  2WUI A;  1JUM A;  3BG5 A;  3JR9 A;  3P9T A;  3C07 A;  1FIA A;  4DYQ A;  5IYC J;  3IH3 A;  2EH3 A;  5CW8 A;  4D7N A;  2OER A;  5EG0 A;  3F0C A;  4BY1 J;  4V2F A;  1AHD P;  3S15 J;  2DA2 A;  3GTG J;  2PZ9 A;  3LHQ A;  3B6C A;  3BTI A;  3G7R A;  2MGQ A;  2XGE A;  5FKL A;  4PXI A;  1AKH B;  3VVY A;  2YU9 J;  1JKP C;  1HOM A;  2H1K A;  4BBS J;  3NNR A;  2R5Y B;  1ZTR A;  2CQQ A;  3IH2 A;  5AQC A;  3BG9 A;  1GDT A;  3FRQ A;  3MKL A;  3D1N I;  2HOA A;  2HDD A;  2NVT J;  1XS9 A;  3M4O J;  3GEU A;  2XPU A;  4C3I J;  5E3M A;  3EUP A;  3VPR A;  1LE8 B;  2E2J J;  1EF4 A;  1UI5 A;  2F07 A;  1F36 A;  4A3D J;  3KZ9 A;  2ZOY A;  4M3E A;  1RKW A;  2DA6 A;  1O4X A;  3HOV J;  2ZCN A;  1YRN A;  2E1O A;  2LTP A;  5FKM A;  5GP9 A;  3MNL A;  2L7M P;  2JA6 J;  4AUX A;  5DTD A;  1TWA J;  3ZQF A;  2O9L A;  4M3G A;  2QF7 A;  2ZB9 A;  5K7H A;  3L1P A;  4B4C A;  2DA1 A;  3JRC A;  3CMY A;  3I4N J;  2FQ4 A;  4L5E A;  2XSD C;  1VFC A;  1FEX A;  3S1R J;  3HTI A;  4CYC B;  2DMQ A;  3DCF A;  5FJ8 J;  1FTT A;  3HTA A;  2VKV A;  5FKO A;  4X1E A;  4M3F A;  3HTH A;  3PO3 J;  3Q0W A;  4M6V A;  5J3L A;  4A69 C;  4QTR A;  2MSY A;  3ZOB A;  1JKO C;  5D1R A;  2LVS A;  3MVP A;  3ON4 A;  1ZKG A;  3NXC A;  1B8I B;  1X58 A;  1IDY A;  3TP0 A;  3JRH A;  2AHQ A;  2R5Y A;  2R5Z A;  5C4Y A;  2ZCM A;  4EEF G;  1P7I A;  1JTY A;  3HTJ A;  2JJ7 A;  1ITY A;  3BJB A;  2O8K A;  3BNI A;  3KKD A;  2VUM J;  4I76 A;  4RBO A;  4MO7 A;  4KWA A;  3JRF A;  5BNG A;  2JWT A;  3LNQ A;  1ETQ A;  5FLM J;  4IEJ A;  3AQS A;  3RZO J;  4FE7 A;  3V78 A;  5EZG A;  3H0G J;  1ZQ3 P;  5FGL A;  2G7G A;  3LJL A;  2K40 A;  4A3L J;  1MSF C;  4V2G A;  2FX0 A;  1W0T A;  4UUT A;  1RKT A;  3BR3 A;  3ZQH A;  3TED A;  2RAS A;  2QKO A;  2X6O A;  5IOY A;  3NI7 A;  1XG1 A;  4NDL A;  5E3O A;  3TW6 A;  3HIM A;  1MH4 A;  3CWR A;  4W97 A;  2UXP A;  4GCK A;  1HCR A;  3OOU A;  2GFN A;  4HKU A;  1ETX A;  5FMP A;  1MBK A;  3JRI A;  1IV6 A;  1K83 J;  3S1M J;  2EQR A;  1SGM A;  2DMN A;  2G3B A;  1RR7 A;  4NN1 A;  5F0H A;  3F1B A;  2OF7 A;  1G2H A;  4ICH A;  1B8I A;  1HDD C;  2VI6 A;  5JLW A;  2N8G A;  3S1N J;  5EGO B;  3E7Q A;  1NTC A;  3HE0 A;  3QKX A;  3VW2 A;  4D7M A;  4A93 J;  4XIC A;  1TWF J;  4CGR A;  3QBM A;  5D18 A;  3BTC A;  2ME0 A;  2QOP A;  3ZQC A;  1UI6 A;  1VI0 A;  1H8A C;  5E3L A;  1MBF A;  4DYR A;  2GEN A;  3CRJ A;  4A3M J;  4D5F A;  5C4J J;  2M0C A;  3JRG A;  5D19 A;  2DA3 A;  3G1L A;  3O8H A;  2HYT A;  4IHX A;  3PO2 J;  5DAJ A;  2HXO A;  4MFD A;  1ZGW A;  1A5J A;  2VKE A;  2M34 A;  5J1R A;  2ELK A;  2CRG A;  2XB0 X;  4X6A J;  1QVU A;  1GT0 C;  3WHB A;  2B63 J;  1WI3 A;  2DMP A;  2TCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...