3FIWA

Structure of sco0253, a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
173
Chain Sequence
KMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAEIDHESAFEAGLALITDGLVRHVDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of SCO0253, a Tetr-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription regulator
molecule keywords Putative tetR-family transcriptional regulator
total genus 56
structure length 173
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fiwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3fiwA02
1Z77A 3NRGA 4AF5A 4XK4A 1NTCA 1R9TJ 5C44J 3JRGA 5IOYA 4DW6A 5CXGA 5HBUA 2TRTA 3BJBA 3A02A 5F0FA 3T6NA 2GM4A 2X9DA 2UXHA 9ANTA 4J19A 4D7MA 4A3IJ 2JMWA 4FE4A 2MG4A 2LD5A 3BG5A 1WH7A 2QIBA 4BKXA 2RAEA 3RQIA 1UG2A 5C3EJ 3HOYJ 2CRGA 1MNMC 2JA8J 1BW5A 3RH2A 4ACIA 1SANA 2DA2A 3FK7A 4MLOA 4BY7J 3BHQA 2DG7A 2HQ5A 1MBJA 1OCPA 3IH3A 2G7GA 3S1NJ 3Q0VA 5FLMJ 5EEAA 1IV6A 1AU7A 1Q1VA 3GTMJ 3LSJA 2AO9A 3DEWA 3NXCA 2RHAA 3B6AA 1IJWC 4FTHA 1ORKA 5EGOA 2EZIA 1MH4A 3HTIA 3C2BA 3IV5A 2VI6A 3BR1A 4A93J 3KZ9A 5DAJA 1UI6A 5F04A 1ETYA 4G12A 2UXUA 3VUQA 3HB9A 3CRJA 4V2GA 1K83J 4GFKA 3S2HJ 4AYBN 2UXIA 1JKRC 3AQSA 3P9TA 5J3LA 1I6HJ 2G7SA 2DA3A 4XIDA 3MN2A 4I6ZA 3FISA 3G1OA 2GFNA 2VPRA 1XS9A 2R93J 4JX5A 3ZQCA 2K9QA 4AUXA 3EGQA 1VI0A 1X2NA 3TEDA 3L1PA 1WI3A 2LR8A 3MNLA 2FQ4A 2EZLA 4QTRA 5K58A 3B6CA 1FIPA 1W0UA 5F0CA 3HOUJ 2MGQA 5FMPA 1JKQC 2EQRA 3HIMA 2XDNA 4M3GA 1VNDA 2P81A 5F1JA 2K40A 5FKMA 2O9LA 3HBLA 1MBFA 2CUEA 2R5YA 3GTPJ 3BTIA 5F27A 2WGBA 3S1MJ 5FGLA 4C3IJ 3LSRA 2G0EA 5M5XJ 2QTQA 4AC6A 4BBSJ 1ETKA 1JUMA 5IPAA 3QQAA 4XRSA 4RDUA 3JSJA 4M3DA 1ZK8A 3K2AA 2PBXA 5D18A 4D5FA 2CQQA 4A3JJ 1GV5A 2DA5A 2DTZA 3JRCA 3GTLJ 2O8KA 3CWRA 5FKLA 5FKKA 1P7IA 1A6IA 1GUUA 3VPRA 5J1YA 3S15J 2PZ9A 2KT0A 2DA4A 4M3BA 1BW6A 5E3NA 3UKGA 2CQXA 4GCLA 1APLC 2OPTA 3JRFA 2E2IJ 3W6VA 3G1MA 3BR0A 2DA7A 4A3EJ 3BCGA 4MIMA 4W1UA 5FKOA 2Q24A 5F08A 2W53A 5C4JJ 1QRYA 2DMNA 2ZCMA 1RETA 1B8IA 2ID6A 3I4NJ 4NN1A 2CUFA 2K9NA 4L5EA 2L9RA 1TWCJ 3HDDA 3VVYA 1IUFA 1VF9A 4CYCA 2HI3A 2G7LA 2X6OA 2GUHA 2LTPA 5EZGA 3GTQJ 1UMQA 4JL3A 2DMTA 3S2DJ 1B72B 2ZB9A 2FD5A 4MFEA 4DYCA 2M9HA 2QKOA 4GFBA 4M3FA 3QBMA 4IHXA 4EEFG 2K9SA 3FRQA 1K61A 2DMPA 1SGMA 5F0HA 3JRDA 1X2MA 3TP3A 2L7MP 4C3HJ 3S1RJ 4V2FA 1T56A 2NP3A 2EZKA 1TWGJ 1WPKA 1E3OC 2R92J 1H8AC 3LWJA 5M3MJ 3G1LA 2ECCA 5HODA 5EGOB 5EG0B 4MK6A 2E2JJ 1HF0A 1HLVA 1LE8A 5EDNA 3NAUA 4IHVA 2H1KA 2XPUA 5GP9A 2ID3A 1RESA 3HKZN 1Y1WJ 1RKWA 3HEFA 2O7OA 4QSHA 1JJ6C 2NP5A 3GZIA 2HDDA 1JUPA 4DYQA 2NS7A 1GT0C 1F43A 3BT9A 5M3FJ 1FTZA 2E2HJ 2V57A 5D19A 3ZQHA 5FKNA 3O60A 3VIBA 5HSZA 5M5WJ 3ANGA 1ZKGA 3ZQGA 3FIWA 5IYBJ 2WUIA 5CXIA 3NPIA 3ANPA 1S7EA 2NS8A 5M5YJ 1ETXA 1U78A 1AHDP 1UHSA 4A3GJ 1WH5A 4XICA 4Y7NJ 1ETQA 3K7AJ 4DZPA 1H88C 2NVXJ 1YRNB 4JKZA 3PASA 5FLVA 3HOWJ 1MBEA 5C4XJ 1B8IB 2JA7J 5IOZA 1ZQ3P 4AC0A 3KKCA 1I50J 3NARA 2VKEA 4A3KJ 2Y31A 1UI5A 2PMZN 2CU7A 3OSFA 1MBKA 1ETVA 2M34A 3LSPA 2YVHA 3GBGA 3TP0A 3CDLA 4HNVA 2D5VA 4L62A 1WGXA 2QF7A 1OJLA 3BTLA 3AQTA 1U9NA 3FK6A 1RPWA 1RR7A 5HAWA 1PUFA 5DTDA 1AKHA 4MXMA 1W0TA 4S0HB 2R0QC 4YZEA 1HOMA 1VFCA 2Y2ZA 3A01B 5C4YA 4IEJA 1RKTA 3M4OJ 3H3VK 1IG7A 4NELA 2HOTA 3PM1A 5H9TA 2XGCA 3O8GA 4UUSA 3VVZA 2MSYA 2TCTA 3CJDA 3RKQA 2HOAA 2HYJA 4RBOA 2WB1N 3HE0A 1QVTA 1ETWA 3TW7A 2E1OA 4A69C 4FISA 1P7JA 2JN6A 3Q0WA 3ON2A 1B72A 4MO7A 4D5CA 4DZJA 3OOUA 3S16J 3JR9A 5EZHA 4BBRJ 1XG1A 1GV2A 3VVXA 4UUSB 5FHPA 3KKDA 5DS9A 3KNWA 5EF6A 4ICHA 1JTYA 3PO2J 1FJLA 2QWTA 2NOGA 3S1QJ 5J1UA 3MVPA 1ZTRA 4M6VA 5K7HA 2YU9J 4GCKA 2DMUA 3WHCA 2ZCXA 2JJ7A 1BL0A 1JKPC 4ABZA 5J1RA 5IYCJ 1ZR4A 3I4MJ 3VOKA 5EFYA 3S14J 2NVYJ 3BR5A 3GTOJ 2R7ZJ 3NI7A 4PXIA 3TW6A 4JX6A 3CMYA 2ECBA 4IHYA 3BQZA 4B1RA 2F07A 3DPJA 4D7NA 3GTGJ 2JA5J 2NX4A 2XB0X 1HDDC 2H8RA 1D5YA 1DU0A 3E7LA 5K7FA 1HDPA 1TWHJ 4LOCA 2L7ZA 2FBQA 1Z0XA 4C2MJ 2IAIA 5EG0A 2CJJA 2XRLA 4DYRA 2GLOA 4HKUA 4JX4A 2IEKA 5E3LA 4ME9A 2Y9ZA 3HOVJ 4W97A 1IGNA 1JGGA 3JRIA 5K7ZA 3JRBA 1TC3C 3VW2A 1GVDA 2IBDA 3A03A 2JA6J 3BG3A 5IP6A 2WAQN 2GENA 3FKIJ 2ZOZA 1LFBA 3BG9A 3ZQLA 1QVUA 2FX0A 1IDZA 3F1BA 2X48A 3IUVA 1OFCX 2VUMJ 2I10A 1H89C 3VP5A 3RZOJ 2ZCNA 1G2HA 3EUPA 1MSEC 2Y30A 2XGDA 1LE8B 2N8GA 2YUSA 2EBIA 4CGRA 2M2EA 3HM5A 3QPLA 1MBHA 3SDGA 5AQCA 4C3JJ 3SFIA 3BTJA 2QOPA 4B4CA 1TWFJ 4Y52J 3QPSA 1IC8A 3JRHA 1ZR2A 2YS9A 3G56A 2DMQA 4JP0A 3LHQA 1JUSA 2OERA 2B63J 2AHQA 1FIAA 1JTXA 2DA1A 5EYRA 5GPCA 1MSFC 2LKXA 1MBGA 1FEXA 1ITYA 1T33A 2M0CA 3Q3SA 3BQYA 5E3OA 3C07A 3DCFA 1BA5A 4B3AA 1ETOA 3ON4A 2MW8A 2NVTJ 2XPVA 3JREA 1Y1VJ 3BRUA 1IRZA 4IHWA 2UXPA 3Q0UA 2DN0A 5IP7J 1U8BA 2WV1A 2LK2A 3G7RA 1LFUP 5FJ8J 2L7FP 2RASA 5GPAA 1PUFB 1AKHB 3S17J 3HTJA 4KWAA 2QCOA 3HTHA 3BR6A 2LLKA 3IH2A 2XB5A 4GFLA 2EZHA 3M3YJ 2G3BA 3E7QA 3HTAA 1IDYA 3BR2A 4BY1J 1ZGWA 1FTTA 1POGA 4JYKA 2LVSA 1XC5A 3BR3A 3LSGA 2NVQJ 3RD3A 2ZOYA 4MFDA 3CQZJ 3GEUA 2D6YA 3PPBA 1WCMJ 4UUTA 1SFOJ 3ZQIA 4A3FJ 1NK3P 2O7TA 2R5ZA 4QIWN 3RZDJ 4X6AJ 2COBA 2XGEA 2ME6A 1GDTA 1YRNA 1EF4A 3S5RA 1CQTA 2LFBA 3ZOBA 4A3LJ 3B81A 3MKLA 5IYDJ 3GTKJ 2Y0SN 3A01A 4UDSA 3JRAA 3VOXA 3HOZJ 4NDLA 2W48A 3WHBA 2E19A 2HYTA 1F36A 4A3BJ 2XSDC 2L0KA 3LJLA 5BNGA 3PO3J 2HKUA 4A3CJ 3OIOA 4M3EA 5IP9J 3HOXJ 3SJMA 4JNNA 1U9OA 2VKVA 1JJ8C 3V78A 4A3DJ 2LP0A 3LNQA 2UXOA 3COLA 3D1NI 1JT6A 2IU5A 1JKOC 4I76A 2HXOA 1HCRA 5JLXA 2KDZA 2OF7A 2DA6A 4A3MJ 5E3MA 3ZQFA 2M8GX 3HGGA 4XRSG 5JLWA 2ME0A 3NNRA 1O4XA 3BTCA 1ENHA 2R5YB 2YVEA 1NK2P 1BJZA 5D1RA 4CYCB 2JWTA 2XPWA 5CW8A 2Y9YA 2R5ZB 3F0CA 4X1EA 4FE7A 4FCYA 1QPIA 1DU6A 2OI8A 3LOCA 4GCTA 1JT0A 2REKA 1MH3A 2HOSA 3QKXA 3HGYA 1TWAJ 2FJ1A 2ELKA 3CCYA 3VW0A 2LY9A 3V6GA 2HXIA 4BXXJ 1A5JA 4XRMA 1OCTC 2GBYA 1I3QJ 3VW1A 3H0GJ 2DG8A 2DJNA 1X58A 3OSGA 2EH3A 3GTJJ 3O8HA 3IH4A 3BNIA 2JK3A
chains in the Genus database with same CATH superfamily
3LL7A 2IA2A 4HAMA 4AF5A 4ZH4F 1NTCA 1J75A 4CHUA 4DW6A 5HBUA 3QYEA 3CESA 2BY3A 3REOA 1PDNC 4E7KA 3N05A 4CXFA 2HNHA 3F6OA 3T6NA 2X9DA 2UXHA 1LJ9A 1IRGA 1TP4A 3AG2H 3SWHA 2ZJQF 4EATA 4M72A 1RIOH 1WH7A 4XLHA 2EFWA 5HLHA 3R60A 5C3EJ 2FUG2 3SDBA 3SXYA 3I58A 1DP3A 2HU9A 3PNTA 1QHGA 1SANA 2DA2A 4MLOA 4BEHB 5K5OA 4ZDOA 4CCNA 2DG7A 2KPMA 3L7WA 2H27A 2G7GA 5FLMJ 3GTMJ 3VYUB 1RC9A 4EM0B 3OYJA 3LSJA 2XAGA 1IZ1A 3OIPA 2H8WA 1DDNA 5EGOA 2XROA 4IQ4A 5BPDA 2CUJA 3GMEA 1S6LA 2DFHA 4NQWA 1IN8A 3CCQI 1BC8C 3BR1A 1P4XA 1LQ1A 3JSPA 5GTHC 1SMYF 4ASNA 1IN7A 2A6EF 1YHQI 2O0YA 1I5ZA 3CRJA 3P9TA 1I6HJ 3D5SC 4AVPA 2WB1A 4I6ZA 1H9GA 2LBFA 4XL9A 5F6FA 2RGVA 1XS9A 4OOIA 2R93J 3CF5F 1Z6RA 3ZQCA 2KLOA 2V6CA 4P5OA 3EGQA 5J40A 3ZRGA 4YEJA 2DDAA 5HVQC 3OMYA 3I55I 1G59A 2Q1ZB 3FBIB 2ZFUA 1RUOA 2RVCA 2JT1A 1BOAA 4B09A 5K58A 3CUQA 3B6CA 1FIPA 4C2TA 3Q9VA 4M9ZA 3RDIA 1Y6IA 2ADUA 1OKRA 5F0CA 5FMPA 4E70A 3HIMA 3OYHA 2L9SA 4PCQA 1X1AA 1VQ8I 2K40A 2JVHA 5AIQA 5FKMA 1P2FA 1LPQA 1W4MA 2FOWA 3QOPA 2O9LA 3ABKH 2DCEA 3GUDA 2Z16A 5DM6F 3FXMA 3KEYA 2MC3A 2VIXA 5A2QZ 4M9SA 2V1XA 4XRSA 1IRFA 1IAWA 1ZK8A 5BS6A 3K2AA 3DBLB 4HRIA 1S5LC 2CV2A 3LAPA 3ZMSA 4A3JJ 2QSHX 1X1BA 3JRCA 2O8KA 5FKKA 3VPRA 4M74A 1A6IA 1OCOH 3S15J 2Y75A 3BJ6A 2DA4A 3ESWB 2UZKA 4R1HA 1APLC 4A5MA 1Z05A 4BE0A 3O2PE 4LG0B 1S7OA 3PIPF 1X1DA 2LKPA 5LGNA 4XN3A 3OYEA 2EPFA 1FOXA 1QRYA 2DMNA 2XAHA 1Z1DA 3DP7A 3BCBA 5TJJA 2ID6A 1IF1A 4IX7A 3BZCA 1XPXA 2JPBA 1JI8A 3GFMA 4CYCA 4XSXF 4FT8A 3SFZA 2GUHA 2LTPA 2M8EA 3HYIA 3HTUA 4Z6YA 4U87A 2CFXA 2Z1DA 2M9HA 1K79A 1FLIA 3QRFF 2QKOA 4M3FA 4EEFG 5LHHA 3KP5A 3KEOA 1PUEE 1MMAA 1X2MA 2CUZA 1W5CC 3DU5A 4V2FA 3VEPA 1IXSB 3P9CA 2NP3A 5FFZA 2DTRA 4IKFA 1ULYA 4IRHA 2LC2A 2VKDA 2M0MA 2R92J 2ZXWH 3BWGA 5HODA 5EGOB 5EG0B 1I1GA 4UXNA 4P1WA 2Z33A 3JW4A 2E2JJ 1HF0A 1RRJA 2BXZA 5EDNA 4ZDPA 5ICFA 1OR7A 5GP9A 2VB6A 2ID3A 1YJ9I 4XQFA 1SFUA 3K4NA 2R7WA 2BYVE 1QZZA 2HVQA 4DYQA 3BT9A 1FTZA 1TQIA 2V57A 3ZQHA 5FKNA 4FQGA 3ZXSA 4P9UA 4IRIA 2XIGA 1XSXA 1P9QC 4DBRA 4HPQA 1HBXG 1BR2A 4RGUA 2WUIA 4RLQA 3EUAA 2HZDA 1G8XA 2E5NA 3W6KB 4ZZDA 1S7EA 2A5WA 2WY7Q 4DZPA 3GWZA 5BOXA 3O6BB 1MMNA 1YRNB 4JKZA 5KAIC 1MBEA 4PJNA 4CCMA 2M3AA 3QP6A 2PFBA 3KKCA 1RNLA 3NARA 3LQQA 3SEQA 4MHGA 1D8KA 2Y31A 3P5JA 4HLYA 3OSFA 3I3LA 2VOOA 1ETVA 2VL8A 2MD5A 4HX8A 3TO9A 1BOBA 4IRGA 1K4TA 3CZ6A 2F4IA 1J09A 3TP0A 1FPQA 4HNVA 2HOEA 1FBQA 2IS1A 2F5EA 3ZPLA 2MBFA 3L2UA 5LEKA 1XD7A 3KZYA 4YRVA 3WU1B 3TKYA 1RR7A 2EJRA 5BMZA 3KYCB 4ZYEA 5DTDA 4MXMA 5J4YA 5FD6A 4S0HB 1VQ4I 1ZRDA 4BU2A 4GYGA 1N25A 2Y2ZA 3ERMA 3M8FA 1T39A 1U5TB 4AVZA 1MDMA 3RSNA 1U5TC 4ZTJA 3RIRA 4CZZA 3O8GA 3TDZC 4UUSA 2TCTA 3H5AA 2Q8KA 3CJDA 3DKWA 4KUMA 2HYJA 3RKQA 2M4KA 1OISA 3FMSA 4RBOA 1K7AA 2R7UA 1O3SA 1ETWA 3TW7A 1EA3A 2UXXA 4H4KC 3PUBA 4A69C 1PJRA 4RS8A 4D5CA 4DZJA 4N9IA 5IT9Z 2B7EA 3MZHA 4A0XA 1V54H 2OQRA 3PQJA 2PEXA 3VYRB 2LOOA 3ELKA 1XG1A 3L2RA 1NG7A 2LNBA 2FF4A 3WG9A 4ESJA 3DBHB 4UUSB 1XDUA 3DPTA 5DS9A 3KNWA 1R6RA 2QA4I 1FJLA 1TT0A 2AQFA 3CMAI 2CQNA 3MVPA 3G73A 4EJOA 4IJAA 4RAFA 2DMUA 4HNUA 2ZCXA 4RB2C 3SHFA 4A2UA 2AXLA 4AWXB 2BE5F 3S14J 3GTOJ 2CQ7A 3TW6A 3CMYA 2ECBA 3K4KA 2CG4A 4A5NA 2VQLA 4KYWA 3T5XA 4B1RA 1O7FA 1BM9A 2GA1A 3GTGJ 2Q2EA 2IT0A 2L9VA 3L2QA 1T8IA 1UFMA 1BI0A 1X19A 1W36C 3E7LA 2VJ4A 5K7FA 3ZQ7A 2KRHA 2VQCA 1S9HA 1QZYA 1OCZH 2L7ZA 2TDXA 4C2MJ 2IAIA 4II3A 4HQEA 2QQBA 2CJJA 4DYRA 3L00A 2XV4S 4HKUA 5E3LA 2F4OB 2LYCA 2X51A 4W97A 1JGGA 3RPUD 5DEQA 5K7ZA 1A35A 4OAYA 3JRBA 1TC3C 3E6DA 1GVDA 4BXUA 1Y56A 2D1VA 2BHYA 5IP6A 1G3YA 3FKIJ 3KFWX 2F2EA 1IDZA 4GYIA 2L02A 3IUVA 4BACA 1OFCX 3VSLA 4LMYA 1H89C 2P7VB 3GZ5A 2CYYA 4CDGA 5ERIA 3P9IA 2VT2A 2HKOA 3HHHA 2ZCNA 1BI3A 2Z5UA 2STWA 2Q0OA 3J7AY 2EBIA 4CGRA 4RMNA 1T98A 1SD5A 3SDGA 4DQ2A 4L9TA 4C3JJ 1WJAA 2QOPA 1KU2A 1D8JA 1K6OA 2ZCWA 4MQVA 1IUYA 4ENJA 2B63J 5HS9A 2C6YA 2L9NA 2QQAA 1WI9A 2K7LA 5EYRA 3GF2A 1UHMA 3GX4X 5HOOA 3T8RA 1JGSA 4L9JA 1ITYA 2M0CA 5KHDA 3WTWC 3BQYA 4KNYA 1K6YA 3C07A 3DCFA 4II2A 4B3AA 3LSKA 1ETOA 1TLHB 1O3TA 2RNJA 3FXLA 3JREA 2WA0A 1FC3A 2VC0A 1XMXA 3HRSA 3Q0UA 3J80K 1SFKA 3HG9A 5HS8A 1YIJI 1Z3XA 3R0JA 1AKHB 2OD5A 3H92A 5LBQA 3CCUI 3OL3A 5B1AH 2ISYA 5ILUA 2XB5A 3CJQB 1VQKI 1G3SA 3TGNA 2Y0SA 4N4NB 4G6QA 1IDYA 2MYSA 2R4GA 1FTTA 4HYEA 3OS1A 2XF5A 4RAGA 1XC5A 2KKOA 3CQZJ 2L01A 3MD2A 3GEUA 3J7AO 2W4SA 3J81K 1WQ2A 1O57A 3ZQIA 1MGTA 5FRNA 3HXLA 3C2GA 3LA2A 4HOBA 4QIWN 3RZDJ 3S3MA 4M6XA 2XGEA 2IGKA 5LGTA 3EYYA 1EF4A 2LY1A 3CCMI 2X1EA 2L4AA 4KISA 3MKLA 1R7JA 3FF5A 4U0VA 2Y0SN 3WTSC 4PGHA 3L9FA 4G6DA 4NDLA 2A61A 3WHBA 3DLAA 2H94A 2HYTA 1XGOA 1E2XA 3D5LA 1SD7A 1B9MA 2IRFG 2KIFA 3GFLA 1QGPA 2ICWG 1ZRFA 3CUOA 1GXPA 2DAOA 3CO6C 1U9OA 3E5QA 4IQJA 4HEA2 3VYSB 4BDYA 1H0MA 2LP0A 3D0SA 3H3UA 1JT6A 2ZXJA 4YFXF 3UR3C 1BR1A 2PFVA 5B5EC 1XSVA 4BHCA 2OZUA 2NVUB 2OF7A 5CYVA 4A3MJ 5EEGA 3ZQFA 5ED4A 3BTCA 1BJZA 1TZLA 2QYOA 1MMSA 1KU9A 3SQNA 2L3DA 3FMRA 2GOXB 4CYCB 1R00A 2IPQX 3HRMA 1QZEA 4U9NA 2JZYA 2W82A 3M7GA 4DVYP 1Q1HA 2E36A 2HDCA 2GQQA 3V4GA 2HYGD 2RQQA 3K4LA 2EIMH 3CCYA 2BBYA 1G3TA 4XBFA 1R36A 2R7QA 2VQHA 3V6GA 1BC7C 4BXXJ 1A5JA 2GZWA 2FJI1 1LVAA 1Z21A 2CW8A 4OU0A 2IGNA 1SFXA 3GZ6A 4BJTA 1X58A 5GAHJ 4K2EA 2EH3A 3GTJJ 3O3KA 3M1CA 3O8HA 1FBUA 3BNIA 1Z77A 3NRGA 3M8JA 2VBYA 4XK4A 2V1UA 1YI2I 4IOCF 1RI7A 5J8CA 1D3YA 3A02A 4CA0A 3DFGA 1KU7A 4KMFA 1HKTA 3CLQA 3GZNB 3FXJA 2MG4A 2FNPA 3BG5A 3T1BA 2V7FA 4E7IA 1N77A 4BKXA 1UG2A 4CO8A 4EGYA 1MNMC 3CF2A 2JA8J 1BW5A 4BY7J 3CC7I 1HA8A 3E97A 1W7PD 3BHQA 2KL4A 3PSFA 4WWCA 4I01A 2PQ8A 2RN7A 5LEJA 3C1DA 1A36A 3K1MA 3Q0VA 4UB6C 1IV6A 3X2QH 1Q1VA 4XMYA 4OIOF 2Y69H 3DEWA 3NXCA 1XCVA 3IKVA 3B6AA 1IJWC 4FTHA 4TV7A 3F8MA 5E1XA 4L18B 2EZIA 4Q5SF 4LIUA 1MH4A 1HW2A 3GLLA 3IV5A 1BR4A 3ASNH 5GTIC 1OR7C 2F48A 2FE3A 2VJJA 5F04A 4U88A 5HDGA 3TOBA 2BW3A 2UXUA 3VUQA 4BQNA 2A05A 2CMPA 3CO7C 4RGSA 2FOKA 1HKSA 5FRMA 2BEOA 4GFKA 3S2HJ 4PJMA 1JKRC 1JE8A 2YPRA 3ZR8X 3U2RA 5D5VB 1WHUA 4EJTA 3BG6A 2KRCA 3FISA 2KIUA 2WWYA 3G1OA 2VPRA 5H6QA 5ILSA 3H5NA 4IF4A 4JX5A 2ZMEC 4WXCA 2K9QA 4KN4X 1VI0A 2ZSIB 2XGXA 1HQCA 1EH6A 3TEDA 1WI3A 3CMMA 1GVJA 3C3WA 3H9JA 2EZLA 3CTAA 4QTRA 5CKTA 2KJBA 2A2FX 2MGQA 1XB4A 4FHTA 2EQRA 3QPTA 4G8XA 2XDNA 3H3ZA 5JVTA 1UJ8A 5F1JA 2KFDA 2ZXIA 2CUEA 2R5YA 3I71A 3A0BC 3BTIA 4ZYGA 4MEXF 3S1MJ 2EA4A 5FGLA 5DM7F 2G0EA 4AC6A 4BBSJ 3QQAA 1MZBA 2DDBA 1MIJA 4M3DA 3JSJA 4YIRX 1PYVA 2PBXA 4D5FA 2Z3YA 2FBIA 4G7HF 3QWLA 3MMYB 4BS9A 3GTLJ 5FKLA 5HLTA 3LQRA 2HQRA 5J1YA 2KT0A 3MEXA 1BW6A 1YS6A 1LUJB 3VFZA 3K2ZA 2OPTA 4XKBA 3RI4A 2EILH 3OL4A 3F22A 5D4SA 2LBFB 2ACJA 2E2IJ 4A3EJ 1FMWA 3G2BA 4W1UA 2DFEA 2FEZA 4OD5A 5E20A 2ZNYA 5F08A 4HX7A 5C4JJ 2UUZA 2VXDA 1B8IA 3I4NJ 2VONA 2L9RA 2HPIA 1YTYA 2AXTC 3HDDA 3VVYA 2HI3A 2G7LA 2E1NA 4LJZF 4JQFA 1S7AA 4JL3A 1CF7B 2F5VA 3ECHA 1B72B 3CDIA 3V8LA 2VJIA 5E17F 4MFEA 3U21A 2LREA 4DYCA 2F6CA 3WTXC 3QBMA 4IHXA 4CH7A 2K9SA 3FRQA 4BAYA 2DMPA 2X1DA 4RLFA 4E7LA 5DCMA 5HLIA 2EIJH 4Q48A 1U2WA 2IA0A 4ZYAA 3OYIA 3CCRI 3S1RJ 4IL6C 1T56A 1KQ9A 2IS4A 1CF7A 4NBQA 2K4JA 2BY0A 3ZMUA 4ZJZA 3IWZA 1E3OC 4J00A 5CVRA 3LWJA 1OQYA 3BPXA 4UHTA 4XLFA 3V7SA 1RZ4A 5F64A 3K10A 2FMYA 3B02A 4PUSA 2FSWA 1LE8A 3GLXA 2H1KA 4HF1A 2XF6A 3A2KA 1V3FA 3HKZN 1Y1WJ 3OS2A 4QSHA 1FP2A 1KGSA 2D1HA 2K9MA 3C7JA 3AKZA 4IO9F 4U7BA 1ZG1A 4C9YA 1V5EA 4O6JA 4BJ6C 5HSZA 2A69F 1IO2A 3GFIA 2KMUA 3ZQGA 3P9KA 2K4BA 2R3SA 2W24A 3EUHA 1IXRC 3NPIA 3OYFA 4FX4A 4EJUA 2VT3A 5E1WA 2A3SA 1U78A 1AHDP 1DUXC 4LB6B 4A3GJ 1KYZA 4XICA 4RM2A 4Y7NJ 1IN4A 4WXHA 4HF2A 3H9GA 3QU6A 3GVAA 1IN6A 5HNFA 5D5UB 2QSGX 5FLVA 5CQGA 5DCMB 3PASA 4AC0A 1I50J 1Y0NA 1ZGAA 2VKEA 5K5RA 1ZHFA 4U0YA 1UI5A 2KIQA 4AIHA 1X3WB 4KIGA 5CVVA 4YELA 3GBGA 2YVHA 3CDLA 2D5VA 1WGXA 3C2HA 3FHZA 5B1BH 3AQTA 2ZNZA 3FM5A 1YYVA 5ICCA 4R8HA 2YSRA 4RAYA 5B66C 3IL2A 2QQ8A 1PUFA 1TBXA 2E1MC 4AU7A 3QAHA 4UVAA 1W0TA 2R0QC 2DOFA 4YZEA 3KCCA 4A0YA 2OCCH 5DUKA 2B0LA 1EH7A 4JBAA 3H3VK 1FOYA 1IG7A 5J6XA 3I5UA 2E71A 2XGCA 4I7HA 1OYYA 5GADJ 1GLNA 2MSYA 2XAJA 4CUGA 4S04A 4LD5A 3FWEA 4QWQA 3T8TA 4YFKF 2WB1N 2JSCA 4BE1A 4YG2F 2E1OA 3ON2A 1N78A 2DLLA 2CV1A 2VLAA 4CCLA 1XGNA 3S16J 1AA7A 1HXDA 2GOMA 5EZHA 3F9KA 3COAC 1QBJA 1QPMA 2BXYA 3IKTA 3WG7H 2IVMA 3OOPA 4E6KG 5LRRA 5EF6A 2QWTA 1SFEA 4C30A 4UB8C 5K7HA 1VQMI 4GCKA 2O03A 3GW2A 1BL0A 3VB2A 1JKPC 1IRXA 3E5UA 3G3ZA 3KYDB 1ZR4A 3I4MJ 1FYMA 5EFYA 2VASA 2NVYJ 3BR5A 3JCUC 3GFJA 2GIZA 4JX6A 1Y39A 2PI0A 4DGWB 2CGPA 2DPDA 4XN0A 1P92A 2NYXA 2O5RA 2KDOA 2HFHA 2W25A 4R79A 3DPJA 3V42A 3K1PA 4WXDA 2XB0X 1XN7A 1D5YA 3DEEA 3AFHA 1HDPA 3H5RA 4KN7X 3E3VA 1TWHJ 2W84A 2ZY9A 1R4NB 4LOCA 4ZDLA 2RQPA 3EUKL 2FBKA 3LWFA 5EG0A 2V9VA 2LKSA 1REPC 4RB3C 2IEKA 3WTTC 1HSTA 4G7ZF 2HYFA 1DPUA 4ME9A 3JRIA 4WX9A 1ONVA 5HDNA 3VW2A 2IBDA 3CC4I 1YG2A 2JA6J 2A6HF 2ZOZA 2EK5A 3NEUA 3S32A 4C2UA 3EDPA 2VUMJ 2I10A 3CJNA 4IXAA 2HS5A 3M9AA 4I09A 3RZOJ 3HSFA 5D5WB 2DI3A 4RB0A 2P0WA 1LE8B 2YUSA 2EFNA 4EGZA 3QPLA 5D6EA 4M71A 5D6FA 1SAUA 1G4DA 2DJIA 3TDUC 3J7YJ 1DPRA 1TWFJ 2P7CB 1MKMA 2FRHA 3QPSA 2EB7A 2VJ5A 2YS9A 3PFIA 4A0ZA 4EVIA 3JRHA 4NHJA 4JP0A 4AIKA 5D4RA 1JTXA 2ETHA 3JSOA 1NHAA 1U6GA 2OV7A 1D0XA 4HA8A 2G7UA 5GPCA 2BVMA 2KZVA 4XM3A 4LG0A 4XLEA 1XTAA 1FOWA 1FEXA 1T33A 1TTYA 3Q3SA 3E5XA 5E3OA 2PJRA 1ON2A 3OYGA 1BA5A 3L2WA 2RREA 3DU6A 1QA6A 3NRVA 3KLOA 3MAJA 2ZO4A 3U9GA 2NVTJ 2CO5A 1YIOA 1X4OA 2QBYB 4WIBA 3K4BA 1LNWA 1AOYA 1Y1VJ 3BY6A 2FMLA 4I0AA 2WV1A 2LK2A 2EINH 3G7RA 3K70D 2RASA 5KNLA 2L2OA 3QPHA 2Z9OA 3HTJA 4KWAA 4A12A 2Q2EB 3IUOA 3HTHA 2LLKA 3IH2A 3SZPA 3U1KA 2G3BA 2F5DA 1BI2A 3HTAA 3BR2A 4BY1J 1HW1A 2LVSA 3BR3A 3LSGA 2NVQJ 4LK1F 2ZOYA 3OS0A 2H6BA 1WCMJ 2W1OA 4LLNA 1MMDA 1SFOJ 4KIFA 5DCFA 4M9XA 4BL0B 4X6AJ 2V9KA 2GXBA 2COBA 3HRTA 2E1MB 4BXFA 2LFBA 3ZOBA 1V55H 1T2KA 5IYDJ 1Z6TA 3A1YA 4UDSA 3A01A 3HOZJ 3VODA 2K5CA 4GCVA 2E19A 2MLGA 4A3BJ 1ZREA 2L0KA 1SAXA 4IHTA 3ULQB 4OD4A 1V4RA 4PJJA 3OIOA 5FROA 3I4PA 4MTDA 3SJMA 4JNNA 5CJ9A 2DQLA 2D45A 1MJ9A 5DD8A 3S3OA 1W5TA 4HSRA 1HCRA 5JLXA 1O7LA 2CS3A 3J7ZI 4E4HA 2DA6A 5E3MA 1USSA 4XSZF 2M8GX 3WE2A 5JLWA 2YR2A 1O4XA 2V1DA 3CD6I 2YVEA 2IJLA 4Q4ZF 4E7ZA 4E7SA 4U9LA 3CJRB 1I6XA 2JWTA 2Y9YA 3TOAA 2O61A 3KP7A 3HKZA 3F0CA 3BPVA 3EQLF 3HIFA 4N4OB 2M7AA 3BJAA 2WBMA 3KX2A 3CLOA 4KMUX 4GCTA 2VQGA 3QKXA 1TWAJ 2FJ1A 2WC2A 3OR2C 2RKHA 2LY9A 2ZC2A 3BG7A 1BIAA 2R7XA 4UV8A 4XRMA 1OCTC 3FX3A 2GBYA 1I3QJ 1S3JA 3MWMA 5ICGA 3OYCA 4B48A 2DT6A 4ACIA 2PG4A 3IH4A 4V19K 2JK3A 4LG3A 2DW4A 4HNTA 3N97A 1J9IA 3WTYC 4NUBA 5CXGA 2TRTA 4BH9A 5F0FA 4OWRB 3CC2I 2V1NA 2VBXA 3FM3A 1Z67A 4GGGA 4HW0A 2L7KA 4D7MA 4J19A 1YW9A 4FE4A 4A3IJ 1YITI 3RPQA 6PAXA 2QIBA 2RAEA 3HOYJ 2CRGA 3KP4A 3RH2A 1W5SA 1U0JA 1ZLKA 5L3GA 1A6QA 2HTJA 2HQ5A 2E7WA 1MBJA 1OCPA 3HSRA 1O3RA 5EEAA 3JTGA 1B9NA 1R71A 4BDZA 2AO9A 4D9JA 1WJBA 2EA2A 2RHAA 4AD9A 2QSFX 4BHBA 2CFOA 2M30A 3C2BA 2VI6A 1MNDA 5FD5A 4A93J 3MZ8A 1ETYA 3JAMZ 4ZZLA 1I3AA 4AIDA 1AWCA 4MGRA 4V2GA 1K83J 2UXIA 3AQSA 2W57A 4CSWA 4XKWA 3RYRA 3WTVC 4XIDA 2IS6A 1FSHA 3DKXA 5J8FA 2GFNA 1F5TA 1XMKA 2OBPA 2OCEA 2VBZA 2W85A 2CW7A 3BP8A 4MTEA 3ZCOA 5FO5A 2OQGA 3FHNA 4PSWA 2WV0A 2HTSA 3ABUA 3IAS2 3L1PA 1KA8A 1ERDA 3E0JB 3HUGA 3HOUJ 3JTHA 1YX5A 1JKQC 2UV1A 2A6TA 4M3GA 1VNDA 2NOJB 2VC1A 3KZZA 3HBLA 3GTPJ 5F27A 3ZGKA 2BHZA 3TO7A 4B43A 4L9NA 4C3IJ 4IHSA 3LSRA 3J81Z 1JUMA 5IPAA 2DK5A 3MKZA 3LFKA 1YLFA 4F93B 3SEZA 1ZARA 5D18A 4BQQA 1GV5A 2DTZA 5ILVA 1GXQA 1ZYRF 4B3XA 3OYMA 3F72A 4ENMA 1PP8F 1H9TA 2DXIA 1LFPA 2CQXA 3ZMVA 3J80Z 5CLSA 2X0LA 2HR3A 2EWNA 4E7HA 3W6VA 1W7PA 3G1MA 3RQ4A 3BCGA 3ECOA 2YU3A 2W53A 1P6RA 1V5GA 2LMDA 5AONA 1MNEA 1R58A 1LDDA 1LDKB 1J5YA 2CUFA 2K9NA 3HUGB 4L5EA 4UVBA 1TWCJ 3MCZA 2CSOA 2BGCA 4HV6A 2KRFA 1IUFA 2FA5A 2DOAA 5DUIA 2X6OA 4Y4RA 3GTQJ 1UMQA 3CDHA 3S2DJ 3S8PA 4HQMA 1DP7P 3SZGA 2FD5A 2WAEA 1Z91A 3ASOH 4GFBA 2DODA 5KAFC 3ZP5A 2NXNB 1K61A 5K5QA 4GO1A 2QKLB 1SGMA 2V26A 5F0HA 2M5WA 4XONA 1R5HA 3SZTA 3TP3A 4NC6A 2F5CA 3WU2C 3LFUA 4C3HJ 5HLGA 4Y17A 3KYLA 4HDVA 1D5VA 2EZKA 3DTEA 3PNYA 1ZG5A 1KU3A 1R1UA 1WPKA 4P9FA 3CMEI 1SMTA 2X6XA 1FZPB 2QLZA 2QBYA 1X1CA 4JK1X 4Z2YA 5M3MJ 3G1LA 1ZH5A 3E1SA 2JA2A 4GRIA 1UCRA 4NC7A 2MLKA 4D0PA 2P5VA 1VQLI 4IHVA 3IAM2 2ESHA 2ZJPF 1X3ZB 5KCMA 2WY8Q 3BCAA 2NP5A 2XUBA 1RKWA 3HEFA 2O7OA 3I59B 2W7NA 1JJ6C 3GZIA 2HDDA 3HL2A 1WZ2A 2NS7A 1F43A 1D1BA 5M3FJ 2HGCA 2GXAA 3O60A 1S72I 5M5WJ 1YOVB 1ZKGA 1VQ9I 3FIWA 2ESNA 2KIMA 4AIJA 3KPHA 3OYAA 3P7NA 1L3LA 4IRVA 2NS8A 5M5YJ 3AG4H 1ETXA 3BC8A 1UHSA 2FQ3A 1ETQA 3K7AJ 3M8EA 5GAEJ 2XHKA 3HOWJ 5C4XJ 4IVNA 1B8IB 2JA7J 5IOZA 1ZQ3P 4OINF 3DTIA 1ZELA 3A0HC 2PJPA 2CU7A 2HVRA 1KYWA 2M34A 3LSPA 5HNHA 4CGZA 1TQPA 1WVRA 2R7TA 2FU4A 4XLPF 2DPUA 4CCJA 4O5VA 1WJ5A 1U9NA 3FK6A 5ICEA 1QQIA 1LKXA 2WAQA 2X1CA 4S05A 1KZHA 1MJBA 5JI6A 2EV5A 5FLXZ 3KETA 1EV7A 1U3EM 4KT5C 1JXSA 1WJDA 3AAFA 1ZG3A 1TW3A 1J0RA 1NG6A 3EUHC 4EM2A 1ZLJA 3PL8A 3QYBA 2MH2A 2V9PA 3K0LA 2XC7A 3M4OJ 4G7OF 4NELA 4BHPA 1D0YA 4HV5A 1SEUA 3CCVI 5IY5H 3QU3A 2XAUA 2HOAA 3HE0A 1TNSA 3W3CA 1QVTA 4BYYA 3I54A 3Q0WA 4L0YB 2VOPA 1B72A 4MO7A 5JR3A 4G94A 3M1EA 2P6SA 1USTA 4HX4A 4MNUA 5FFXA 3U1DA 4I98B 1XMAA 4G9YA 3K69A 5FHPA 3VOEA 4U0WA 1YQAA 4XKVA 3H0DA 1LB2A 4ICHA 1JTYA 3PO2J 4ON0A 3K6GA 3EPZA 5K1YA 1WJCA 2JRMA 3S1QJ 1HKQA 1ZTRA 2QGUA 4BQOA 1XGMA 3WU0A 3CUQB 2J5OA 4PFOA 2M1BA 2PMZA 3WHCA 2OTLI 2R7SA 4ABZA 5IYCJ 3L2CA 3VOKA 3RJPA 2D2WA 2HEOA 1VQNI 1YE9A 3DF8A 2NRAC 1R49A 2P5LC 4Y13A 3AL0B 1S29A 3BQZA 1DGWY 2AS5F 4KT6A 3VTIA 3BJOA 2KHMA 1XSDA 2JA5J 3WTZA 1WSUA 5LRSA 3RPUA 3SYTA 1HDDC 2H8RA 1Z9CA 1FBSA 1KQ0A 1DU0A 1VQPI 4D1QA 3NS4A 2FBQA 1WRJA 3DPUA 3LMMA 2JSPA 2XRLA 4RB1A 5LHIA 4JX4A 4XLNF 2OJED 2Y9ZA 2A5YB 4L9VA 2HKXA 1X4PA 1IGNA 3E6CC 3FXOA 1R1TA 2COMA 2IXSA 2Z99A 3BG3A 3ABLH 2WAQN 5EEHA 3ZQLA 1OMIA 3OYDA 1SC7A 2FX0A 3F1BA 4O3MA 3VP5A 1PP7U 3Q9SA 1SD6A 2DBBA 2XSJC 3I59A 3IWFA 3KP3A 1XX5A 3HRUA 3W2WA 3CCEI 3F6VA 1YS7A 2XGDA 2YX4A 3ONQA 5DV5A 4Q47A 3OYNA 3UNGC 2K27A 1FY7A 1D1AA 1UHWA 1TNTA 3HM5A 4NNJA 1MBHA 1TL8A 1O3QA 3R4KA 4B4CA 3CP8A 2IS2A 1I39A 4Y52J 4ZC3A 3WTUC 3G56A 5JFRA 2DMQA 2QM3A 2X4HA 3OWTA 2OERA 2AHQA 3FKJA 2DA1A 1F1ZA 2QWWA 2Y48A 2JUCA 1MSFC 5H6RA 1R23A 4NC8A 2VODA 4N0BA 3HHGA 3MZYA 1IN5A 3VWBA 1PVEA 3H36A 1FYKA 3K9TA 3ON4A 2MW8A 4OIRF 4KA4A 3ISPA 4P55A 3AL0C 2KP6A 4PZJA 5F1RA 2VN2A 3F3XA 4WK8F 4IHWA 1IRZA 2UXPA 2DN0A 4GDFA 2ZBKA 1LFUP 3HPHA 2L7FP 4I02A 4LLGF 4KIBA 5GPAA 1PUFB 4BJ5C 2HQNA 2ZMEA 1MD0A 2EFOA 4L0ZB 1TW2A 3ZMTA 2GXGA 4ENNA 2EZHA 3M3YJ 1MMGA 2AQEA 1N75A 1WFXA 4CYDA 1Z7UA 2LG4A 3E7QA 3ZN1A 5KK1A 4F91B 2OU2A 4MQ9F 5CVJA 2OA4A 1G3WA 1POGA 2XAFA 1FP1D 3ABTA 3M07A 4JYKA 4XORA 3RD3A 2QEXI 3PPBA 1C0WA 1T0FC 2XDVA 4A3FJ 3CCSI 1TQMA 1B4AA 2O7TA 2PBIA 4A6EA 2R5ZA 1MJAA 3MKYB 3GXOA 4PJ0C 5L3FA 1EKEA 1YFHA 1GDTA 1E0EA 2ZMEB 3S5RA 1JHHA 1CQTA 4OAZA 4ESFA 3B81A 4OMZA 3ZMDA 3GTKJ 3FBNB 4HF0A 3ZMZA 3B73A 3JRAA 3VOXA 4UNOA 4I2OA 3AG1H 1YO5C 4OMYA 5BNGA 3PO3J 2HKUA 2DFFA 1EH8A 5IP9J 2DOEA 3I0TA 4AYBA 3HOXJ 2E1CA 1CGPA 5E1ZB 3IP4B 2VKVA 1RR8C 4ANJA 1JJ8C 1G6NA 3V78A 2UXOA 4M73A 3LNQA 1F9NA 2WAFA 1JKOC 4I76A 2KZGA 3IC7A 2B3WA 3ZN0A 3HGGA 4XRSG 2ME0A 2O8XA 3V7RA 4CCOA 1ENHA 2R5YB 3MFKA 1J7KA 1I1SA 5D1RA 4PDKA 5DDGA 1V5FA 2XPWA 5CW8A 3H9QA 3KLNA 4M6YA 1A31A 2K3PA 3ERED 2R5ZB 1QPIA 1X3UA 4FCYA 2OI8A 3LOCA 2ELHA 4F3QA 4F7ZA 1T6SA 4G6TB 3F23A 1JT0A 3LSMA 2REKA 1MH3A 2HOSA 3WE3A 5FB2A 3HGYA 2PX9A 2ELKA 2QVOA 1U8RA 2HXIA 2BY2A 3RKYA 3F8NA 2K85A 4MEYF 4CCKA 5EJCA 3H0GJ 3V8JA 2DJNA 2LDUA 5BPIA 1LEBA 4C2MA 3KZIC 4CZCA 2ECCA 4QLCU 2K9LA 2NS0A 4OIPF 2R7RA 2DFIA 1XCBA 5C44J 3JRGA 5IOYA 3L09A 1R9TJ 3E6MA 4J01A 3BJBA 2CH0A 3DXJF 2L54A 1W36D 2WADA 2BW3B 2ZSHB 2DT5A 2IGMA 2B9SA 2VE8A 2GM4A 4EMSA 1R22A 2NNNA 9ANTA 3GO5A 2JMWA 3TO6A 3S2WA 4ESBA 1U5TA 2LD5A 2KISA 1WWXA 1VQ7I 3RQIA 5B3SH 2KQRA 3ABMH 2HVSA 2R7VA 4LGWA 4OIQF 3JAMK 5FGMA 3DEUA 4LITA 2G9WA 3FK7A 1YW7A 1E3PA 1K4SA 2LRDA 2EV0A 4WCGA 3DPLC 3IH3A 3LAJA 5JVGF 3S1NJ 1AU7A 1Y8RB 4XR6A 5TRDA 2EIKH 2HWVA 3KP2A 3PUFA 4UUVA 1ORKA 3LA7A 2DU9A 4CICA 3HTIA 3KZ9A 3H35A 2LY2A 5DAJA 4XRFA 1UI6A 4G12A 1FNNA 2FXAA 2NAZA 3HB9A 1RUNA 4AYBN 4HBLA 5J3LA 3E6BA 4IOAF 2YX7A 2G7SA 1B6AA 2DA3A 2QUFA 1NH3A 3MN2A 1W7PB 2LF7A 1DQUA 1ACIA 3GCMA 4XKCA 4NQWB 2OUMA 3HPGA 4AUXA 5HDKA 4UV9A 2O6GE 1X2NA 1VQ6I 2LR8A 3MNLA 2FQ4A 4XOTA 3BOQA 5CPRB 1W0UA 3T0YA 4KICA 4YFNF 2GA2A 4B44A 1A04A 1SD4A 2P81A 1EJ9A 1LDJA 2WGBA 1MBFA 2JRTA 4RGXA 3OYLA 5M5XJ 2QTQA 3OYBA 1ETKA 5TGTA 3MQ0A 2BZTA 5IT9K 4RDUA 1SVLA 2XVCA 1FOKA 2CQQA 5AIPA 4EJVA 4BNCA 2DA5A 1QHHD 4LIVA 2HQAA 3CWRA 1ON1A 1P7IA 1GUUA 2X6WA 2PZ9A 4M3BA 2XRNA 3DBRB 5E3NA 3UKGA 4GCLA 1OYWA 3ZQQA 1WJEA 1UAAA 3JRFA 2IA1A 3MKWB 2VBWA 3DKYA 2LH9A 3BLYA 3BR0A 2DA7A 4FX0A 4MIMA 3TQNA 3ROUA 4B8XA 5A2QK 2A07F 4EM1A 4UY8I 4DBQA 2L5QA 5FKOA 2Q24A 1IW7F 4H0EA 2ZCMA 3DV8A 1RETA 1Y0UA 1T38A 3TBIA 1P4WA 2XKPA 3F8BA 1Z3YA 2X6YA 2RV8A 3I9V2 1UG0A 4NN1A 5CVUA 3RCOA 2XAQA 2K02A 1VF9A 2JVGA 3NQOA 3KIOA 1OLTA 3AG3H 5EZGA 2DMTA 5TISC 2ZJ2A 2ZB9A 3W2VA 5L3BA 1YX3A 2ELJA 3EETA 4QPOA 5E8IA 3PJRA 2E5ZA 5LHGA 3JRDA 2L7MP 1SVMA 5D8KB 2ISZA 1MW7A 2DYRH 1TWGJ 3N4MA 3K1NA 3OIQA 1H8AC 2I5UA 2KJCA 3BDDA 2HPMA 3HOTA 3OV8A 4RM3A 4X0GA 4MK6A 1FWZA 5J47A 4KJZA 1HLVA 3NAUA 3LSTA 5D5XB 1K78B 2XPUA 3FMQA 4ENKA 1RESA 4F52A 3CJTB 2EV6A 2V4JC 2CQKA 1K78A 1JUPA 5D19A 4EQQA 3FZVA 1GT0C 3EYIA 2E2HJ 3VIBA 3CUQC 3R6SA 2VPLA 3ANGA 3PNVA 2GWRA 2BV6A 2RC4A 5IYBJ 5D8LB 3RYPA 3KP6A 3Q5FA 3OYKA 3ANPA 5CXIA 1ZN2A 1UZCA 2BVLA 1WH5A 2M45A 1H88C 2NVXJ 4KFCA 4Y3OA 3DLLF 1FT9A 3HSEA 2QQ9A 5FLXK 2ZFWA 1D0ZA 4A3KJ 4BE2A 1BN5A 2PMZN 4N9HA 5LLQA 1MBKA 1ZRCA 1B1BA 3IRQA 2VKHA 1QNTA 5LFAA 3R0AA 4LLLA 4L62A 1OPCA 1YW8A 2QF7A 1OJLA 3BTLA 1T08B 4GXOA 4EJWA 2ZJRF 1FYLA 4PFPA 3KEQA 3QOEA 3HC7A 3W6JB 4BQAA 2YVXA 1RPWA 3F8CA 5HAWA 4P96A 3CCLI 3NWTA 1AKHA 4BEHA 1MDMB 1HOMA 1HSJA 1BI1A 4PK4A 1VFCA 3H1CA 3WGHA 3A01B 5C4YA 4IEJA 2ZKZA 3S3NA 1RKTA 3BROA 4ETSA 2EFQA 2HOTA 3PM1A 4DNCA 5H9TA 3V8KA 3HZJA 4HLXA 3PIOF 4KDPA 1BBYA 2VE9A 3R61A 3VVZA 2P6TA 3WODF 4I99C 4FISA 1P7JA 2JN6A 2MFZA 3VYTB 2W00A 2DK8A 2P8TA 3V7CA 3KE2A 3OOUA 4Y15A 2IGOA 5H20A 3JR9A 4UVCA 3PQKA 5CVIA 3I56I 2LF8A 1Y8QB 4BBRJ 3L2VA 3FXKA 1GV2A 2A68F 3VVXA 3KKDA 1GHCA 2J5PA 3GEZA 4WF2A 2HZTA 2NOGA 1WKMA 5LGUA 1YJNI 5J1UA 3CCJI 4M6VA 1YJWI 3RKXA 2YU9J 2VXZA 3FXRA 3LSIA 3RKWA 4HSTA 4BUPA 2JJ7A 5IT3A 5J1RA 1QU3A 3PSIA 1E17A 1ODDA 1IXCA 2R7ZJ 3NI7A 4PXIA 4NB5A 2MA3A 1XDSA 3FXQA 2PJRB 4IHYA 1SVOA 2ZXHA 2CWEA 4FETA 2PMHA 2QKMB 2F07A 2CW0F 1BJAA 4IZZA 4D7NA 1T95A 2RDPA 2WTEA 2M87A 2HDWA 2H1LA 2NX4A 2DYSH 4BGDA 2FBHA 2GIVA 2K86A 4L5IA 1LVKA 3PFYA 5L3DA 4XOPA 2CV0A 2PN6A 4FASD 2R7FA 5LD2C 1VQOI 4IPAA 2M4GA 5DYMA 1Z0XA 4LK0F 2P5KA 3TMOA 2GLOA 4AM3A 2F5FA 4L5JA 1FMVA 3CP2A 3HOVJ 2UWMA 1OYIA 3I64A 1F4KA 3QP5A 2B1EA 3A03A 2OTJI 1J2XA 1QO0D 2GENA 1LFBA 3BG9A 3K8PC 3GYHX 1QVUA 3W2AA 2H09A 2X48A 4YIIA 5HS7A 1DGRM 2Z2SB 2QENA 5L3CA 2MABA 4YIFA 1X1PA 4B47A 4F92B 3EUPA 1G2HA 5H2FC 3DWLE 1ZGJA 2Y30A 1MSEC 2FNAA 4DIQA 2OAZA 2IW5A 2V6EA 2V79A 4Y33A 2N8GA 3HJEA 2M2EA 2E7XA 1B59A 4XNFA 5AQCA 3SFIA 3BTJA 5E79C 1IC8A 1ZR2A 4KITB 1E3HA 2OC6A 3LHQA 1JUSA 2BOLA 1FIAA 3IHUA 3VSKA 1VZ0A 2X85A 3F21A 1OCRH 3F8FA 3VDXA 2LKXA 1MBGA 3C18A 4LB5A 2E60A 4RGRA 4ZYDA 1UELB 3K4MA 5J4VA 3OR1C 4LFUA 3FXUA 3LA3A 2MD0A 2R7OA 2E35A 2PMUA 2XPVA 1OCCH 5GAGJ 1XGSA 4E7JA 2BY1A 3BRUA 4XLCA 2DO7A 5IP7J 1HW5A 1U8BA 3HTSB 4F55A 5FJ8J 3S17J 1KQ8A 3RTRA 4RAZA 2L4MA 3D5RC 1BIBA 2QCOA 2XKOA 1IV8A 3BR6A 2RNGA 1M1EB 4GFLA 2P4WA 4RA2A 1T0FA 5BQTA 1ZGWA 2DQRA 1W1WE 3DQVC 2M7BA 4MFDA 2PLYA 4ZTFA 4DJAA 2D6YA 4UUTA 3S93A 2MC4A 1NK3P 2MH9A 3NWSA 3K4JA 1P4AA 1D1CA 3IRRA 3DTKA 4A6DA 2XASA 2XF7A 2ME6A 1YRNA 3TL4X 2IP2A 5E8GA 3ML6A 4HZFA 5L3EA 4A3LJ 1LEAA 1R4MB 2DT7B 1STZA 4HG2A 4HDUA 3G4SI 3G6EI 5E18F 2W48A 2OZ6A 1TT5B 1F36A 2STTA 2XSDC 3LJLA 4A3CJ 4M3EA 3K70C 1VTNC 3I53A 4ITVA 4A3DJ 3COLA 1FX7A 4JOMA 3D1NI 2O3FA 2IU5A 2HXOA 5KVRA 3BZKA 2JTVA 2LSOA 2UXNA 1WJFA 2E34A 2KDZA 2NNYA 2H6CA 2JUGA 3NNRA 3G71I 3WGGA 3WGIA 2Y0MA 1NK2P 3QODA 4PGGA 2I8DA 1FSEA 1S8NA 4PSXA 1J59A 4I0BA 1R1VA 2JPCA 5JHUA 3HOSA 2JQ7A 1JHFA 4X1EA 1DU6A 4FE7A 3FDYA 4PJLA 1HC8A 4EV0A 3A4CA 2EFPA 1R5ID 4U7DA 1KONA 1ZAOA 2R7DA 3VW0A 2G7HA 3BZ6A 1R5GA 5CQEA 2K3FA 5DD4A 4ZYHA 3K4CA 2F4MB 1UB9A 3VW1A 1I27A 2GAUA 3QYFA 3OY9A 1VQ5I 2DG8A 5JHFA 3OSGA 3LSHA 4QPQA 4DOZA 2QZ8A 1Z7LA 4XLAA 1L0OC
chains in the Genus database with same CATH topology
1Z77A 3NRGA 4AF5A 4XK4A 1NTCA 1R9TJ 5C44J 3JRGA 5IOYA 4DW6A 5CXGA 5HBUA 2TRTA 3BJBA 3A02A 5F0FA 3T6NA 2GM4A 2X9DA 2UXHA 9ANTA 4J19A 4D7MA 4A3IJ 2JMWA 4FE4A 2MG4A 2LD5A 3BG5A 1WH7A 2QIBA 4BKXA 2RAEA 3RQIA 1UG2A 5C3EJ 3HOYJ 2CRGA 1MNMC 2JA8J 1BW5A 3RH2A 4ACIA 1SANA 2DA2A 3FK7A 4MLOA 4BY7J 3BHQA 2DG7A 2HQ5A 1MBJA 1OCPA 3IH3A 2G7GA 3S1NJ 3Q0VA 5FLMJ 5EEAA 1IV6A 1AU7A 1Q1VA 3GTMJ 3LSJA 2AO9A 3DEWA 3NXCA 2RHAA 3B6AA 1IJWC 4FTHA 1ORKA 5EGOA 2EZIA 1MH4A 3HTIA 3C2BA 3IV5A 2VI6A 3BR1A 4A93J 3KZ9A 5DAJA 1UI6A 5F04A 1ETYA 4G12A 2UXUA 3VUQA 3HB9A 3CRJA 4V2GA 1K83J 4GFKA 3S2HJ 4AYBN 2UXIA 1JKRC 3AQSA 3P9TA 5J3LA 1I6HJ 2G7SA 2DA3A 4XIDA 3MN2A 4I6ZA 3FISA 3G1OA 2GFNA 2VPRA 1XS9A 2R93J 4JX5A 3ZQCA 2K9QA 4AUXA 3EGQA 1VI0A 1X2NA 3TEDA 3L1PA 1WI3A 2LR8A 3MNLA 2FQ4A 2EZLA 4QTRA 5K58A 3B6CA 1FIPA 1W0UA 5F0CA 3HOUJ 2MGQA 5FMPA 1JKQC 2EQRA 3HIMA 2XDNA 4M3GA 1VNDA 2P81A 5F1JA 2K40A 5FKMA 2O9LA 3HBLA 1MBFA 2CUEA 2R5YA 3GTPJ 3BTIA 5F27A 2WGBA 3S1MJ 5FGLA 4C3IJ 3LSRA 2G0EA 5M5XJ 2QTQA 4AC6A 4BBSJ 1ETKA 1JUMA 5IPAA 3QQAA 4XRSA 4RDUA 3JSJA 4M3DA 1ZK8A 3K2AA 2PBXA 5D18A 4D5FA 2CQQA 4A3JJ 1GV5A 2DA5A 2DTZA 3JRCA 3GTLJ 2O8KA 3CWRA 5FKLA 5FKKA 1P7IA 1A6IA 1GUUA 3VPRA 5J1YA 3S15J 2PZ9A 2KT0A 2DA4A 4M3BA 1BW6A 5E3NA 3UKGA 2CQXA 4GCLA 1APLC 2OPTA 3JRFA 2E2IJ 3W6VA 3G1MA 3BR0A 2DA7A 4A3EJ 3BCGA 4MIMA 4W1UA 5FKOA 2Q24A 5F08A 2W53A 5C4JJ 1QRYA 2DMNA 2ZCMA 1RETA 1B8IA 2ID6A 3I4NJ 4NN1A 2CUFA 2K9NA 4L5EA 2L9RA 1TWCJ 3HDDA 3VVYA 1IUFA 1VF9A 4CYCA 2HI3A 2G7LA 2X6OA 2GUHA 2LTPA 5EZGA 3GTQJ 1UMQA 4JL3A 2DMTA 3S2DJ 1B72B 2ZB9A 2FD5A 4MFEA 4DYCA 2M9HA 2QKOA 4GFBA 4M3FA 3QBMA 4IHXA 4EEFG 2K9SA 3FRQA 1K61A 2DMPA 1SGMA 5F0HA 3JRDA 1X2MA 3TP3A 2L7MP 4C3HJ 3S1RJ 4V2FA 1T56A 2NP3A 2EZKA 1TWGJ 1WPKA 1E3OC 2R92J 1H8AC 3LWJA 5M3MJ 3G1LA 2ECCA 5HODA 5EGOB 5EG0B 4MK6A 2E2JJ 1HF0A 1HLVA 1LE8A 5EDNA 3NAUA 4IHVA 2H1KA 2XPUA 5GP9A 2ID3A 1RESA 3HKZN 1Y1WJ 1RKWA 3HEFA 2O7OA 4QSHA 1JJ6C 2NP5A 3GZIA 2HDDA 1JUPA 4DYQA 2NS7A 1GT0C 1F43A 3BT9A 5M3FJ 1FTZA 2E2HJ 2V57A 5D19A 3ZQHA 5FKNA 3O60A 3VIBA 5HSZA 5M5WJ 3ANGA 1ZKGA 3ZQGA 3FIWA 5IYBJ 2WUIA 5CXIA 3NPIA 3ANPA 1S7EA 2NS8A 5M5YJ 1ETXA 1U78A 1AHDP 1UHSA 4A3GJ 1WH5A 4XICA 4Y7NJ 1ETQA 3K7AJ 4DZPA 1H88C 2NVXJ 1YRNB 4JKZA 3PASA 5FLVA 3HOWJ 1MBEA 5C4XJ 1B8IB 2JA7J 5IOZA 1ZQ3P 4AC0A 3KKCA 1I50J 3NARA 2VKEA 4A3KJ 2Y31A 1UI5A 2PMZN 2CU7A 3OSFA 1MBKA 1ETVA 2M34A 3LSPA 2YVHA 3GBGA 3TP0A 3CDLA 4HNVA 2D5VA 4L62A 1WGXA 2QF7A 1OJLA 3BTLA 3AQTA 1U9NA 3FK6A 1RPWA 1RR7A 5HAWA 1PUFA 5DTDA 1AKHA 4MXMA 1W0TA 4S0HB 2R0QC 4YZEA 1HOMA 1VFCA 2Y2ZA 3A01B 5C4YA 4IEJA 1RKTA 3M4OJ 3H3VK 1IG7A 4NELA 2HOTA 3PM1A 5H9TA 2XGCA 3O8GA 4UUSA 3VVZA 2MSYA 2TCTA 3CJDA 3RKQA 2HOAA 2HYJA 4RBOA 2WB1N 3HE0A 1QVTA 1ETWA 3TW7A 2E1OA 4A69C 4FISA 1P7JA 2JN6A 3Q0WA 3ON2A 1B72A 4MO7A 4D5CA 4DZJA 3OOUA 3S16J 3JR9A 5EZHA 4BBRJ 1XG1A 1GV2A 3VVXA 4UUSB 5FHPA 3KKDA 5DS9A 3KNWA 5EF6A 4ICHA 1JTYA 3PO2J 1FJLA 2QWTA 2NOGA 3S1QJ 5J1UA 3MVPA 1ZTRA 4M6VA 5K7HA 2YU9J 4GCKA 2DMUA 3WHCA 2ZCXA 2JJ7A 1BL0A 1JKPC 4ABZA 5J1RA 5IYCJ 1ZR4A 3I4MJ 3VOKA 5EFYA 3S14J 2NVYJ 3BR5A 3GTOJ 2R7ZJ 3NI7A 4PXIA 3TW6A 4JX6A 3CMYA 2ECBA 4IHYA 3BQZA 4B1RA 2F07A 3DPJA 4D7NA 3GTGJ 2JA5J 2NX4A 2XB0X 1HDDC 2H8RA 1D5YA 1DU0A 3E7LA 5K7FA 1HDPA 1TWHJ 4LOCA 2L7ZA 2FBQA 1Z0XA 4C2MJ 2IAIA 5EG0A 2CJJA 2XRLA 4DYRA 2GLOA 4HKUA 4JX4A 2IEKA 5E3LA 4ME9A 2Y9ZA 3HOVJ 4W97A 1IGNA 1JGGA 3JRIA 5K7ZA 3JRBA 1TC3C 3VW2A 1GVDA 2IBDA 3A03A 2JA6J 3BG3A 5IP6A 2WAQN 2GENA 3FKIJ 2ZOZA 1LFBA 3BG9A 3ZQLA 1QVUA 2FX0A 1IDZA 3F1BA 2X48A 3IUVA 1OFCX 2VUMJ 2I10A 1H89C 3VP5A 3RZOJ 2ZCNA 1G2HA 3EUPA 1MSEC 2Y30A 2XGDA 1LE8B 2N8GA 2YUSA 2EBIA 4CGRA 2M2EA 3HM5A 3QPLA 1MBHA 3SDGA 5AQCA 4C3JJ 3SFIA 3BTJA 2QOPA 4B4CA 1TWFJ 4Y52J 3QPSA 1IC8A 3JRHA 1ZR2A 2YS9A 3G56A 2DMQA 4JP0A 3LHQA 1JUSA 2OERA 2B63J 2AHQA 1FIAA 1JTXA 2DA1A 5EYRA 5GPCA 1MSFC 2LKXA 1MBGA 1FEXA 1ITYA 1T33A 2M0CA 3Q3SA 3BQYA 5E3OA 3C07A 3DCFA 1BA5A 4B3AA 1ETOA 3ON4A 2MW8A 2NVTJ 2XPVA 3JREA 1Y1VJ 3BRUA 1IRZA 4IHWA 2UXPA 3Q0UA 2DN0A 5IP7J 1U8BA 2WV1A 2LK2A 3G7RA 1LFUP 5FJ8J 2L7FP 2RASA 5GPAA 1PUFB 1AKHB 3S17J 3HTJA 4KWAA 2QCOA 3HTHA 3BR6A 2LLKA 3IH2A 2XB5A 4GFLA 2EZHA 3M3YJ 2G3BA 3E7QA 3HTAA 1IDYA 3BR2A 4BY1J 1ZGWA 1FTTA 1POGA 4JYKA 2LVSA 1XC5A 3BR3A 3LSGA 2NVQJ 3RD3A 2ZOYA 4MFDA 3CQZJ 3GEUA 2D6YA 3PPBA 1WCMJ 4UUTA 1SFOJ 3ZQIA 4A3FJ 1NK3P 2O7TA 2R5ZA 4QIWN 3RZDJ 4X6AJ 2COBA 2XGEA 2ME6A 1GDTA 1YRNA 1EF4A 3S5RA 1CQTA 2LFBA 3ZOBA 4A3LJ 3B81A 3MKLA 5IYDJ 3GTKJ 2Y0SN 3A01A 4UDSA 3JRAA 3VOXA 3HOZJ 4NDLA 2W48A 3WHBA 2E19A 2HYTA 1F36A 4A3BJ 2XSDC 2L0KA 3LJLA 5BNGA 3PO3J 2HKUA 4A3CJ 3OIOA 4M3EA 5IP9J 3HOXJ 3SJMA 4JNNA 1U9OA 2VKVA 1JJ8C 3V78A 4A3DJ 2LP0A 3LNQA 2UXOA 3COLA 3D1NI 1JT6A 2IU5A 1JKOC 4I76A 2HXOA 1HCRA 5JLXA 2KDZA 2OF7A 2DA6A 4A3MJ 5E3MA 3ZQFA 2M8GX 3HGGA 4XRSG 5JLWA 2ME0A 3NNRA 1O4XA 3BTCA 1ENHA 2R5YB 2YVEA 1NK2P 1BJZA 5D1RA 4CYCB 2JWTA 2XPWA 5CW8A 2Y9YA 2R5ZB 3F0CA 4X1EA 4FE7A 4FCYA 1QPIA 1DU6A 2OI8A 3LOCA 4GCTA 1JT0A 2REKA 1MH3A 2HOSA 3QKXA 3HGYA 1TWAJ 2FJ1A 2ELKA 3CCYA 3VW0A 2LY9A 3V6GA 2HXIA 4BXXJ 1A5JA 4XRMA 1OCTC 2GBYA 1I3QJ 3VW1A 3H0GJ 2DG8A 2DJNA 1X58A 3OSGA 2EH3A 3GTJJ 3O8HA 3IH4A 3BNIA 2JK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z77 A;  3NRG A;  4AF5 A;  4XK4 A;  1NTC A;  1R9T J;  5C44 J;  3JRG A;  5IOY A;  4DW6 A;  5CXG A;  5HBU A;  2TRT A;  3BJB A;  3A02 A;  5F0F A;  3T6N A;  2GM4 A;  2X9D A;  2UXH A;  9ANT A;  4J19 A;  4D7M A;  4A3I J;  2JMW A;  4FE4 A;  2MG4 A;  2LD5 A;  3BG5 A;  1WH7 A;  2QIB A;  4BKX A;  2RAE A;  3RQI A;  1UG2 A;  5C3E J;  3HOY J;  2CRG A;  1MNM C;  2JA8 J;  1BW5 A;  3RH2 A;  4ACI A;  1SAN A;  2DA2 A;  3FK7 A;  4MLO A;  4BY7 J;  3BHQ A;  2DG7 A;  2HQ5 A;  1MBJ A;  1OCP A;  3IH3 A;  2G7G A;  3S1N J;  3Q0V A;  5FLM J;  5EEA A;  1IV6 A;  1AU7 A;  1Q1V A;  3GTM J;  3LSJ A;  2AO9 A;  3DEW A;  3NXC A;  2RHA A;  3B6A A;  1IJW C;  4FTH A;  1ORK A;  5EGO A;  2EZI A;  1MH4 A;  3HTI A;  3C2B A;  3IV5 A;  2VI6 A;  3BR1 A;  4A93 J;  3KZ9 A;  5DAJ A;  1UI6 A;  5F04 A;  1ETY A;  4G12 A;  2UXU A;  3VUQ A;  3HB9 A;  3CRJ A;  4V2G A;  1K83 J;  4GFK A;  3S2H J;  4AYB N;  2UXI A;  1JKR C;  3AQS A;  3P9T A;  5J3L A;  1I6H J;  2G7S A;  2DA3 A;  4XID A;  3MN2 A;  4I6Z A;  3FIS A;  3G1O A;  2GFN A;  2VPR A;  1XS9 A;  2R93 J;  4JX5 A;  3ZQC A;  2K9Q A;  4AUX A;  3EGQ A;  1VI0 A;  1X2N A;  3TED A;  3L1P A;  1WI3 A;  2LR8 A;  3MNL A;  2FQ4 A;  2EZL A;  4QTR A;  5K58 A;  3B6C A;  1FIP A;  1W0U A;  5F0C A;  3HOU J;  2MGQ A;  5FMP A;  1JKQ C;  2EQR A;  3HIM A;  2XDN A;  4M3G A;  1VND A;  2P81 A;  5F1J A;  2K40 A;  5FKM A;  2O9L A;  3HBL A;  1MBF A;  2CUE A;  2R5Y A;  3GTP J;  3BTI A;  5F27 A;  2WGB A;  3S1M J;  5FGL A;  4C3I J;  3LSR A;  2G0E A;  5M5X J;  2QTQ A;  4AC6 A;  4BBS J;  1ETK A;  1JUM A;  5IPA A;  3QQA A;  4XRS A;  4RDU A;  3JSJ A;  4M3D A;  1ZK8 A;  3K2A A;  2PBX A;  5D18 A;  4D5F A;  2CQQ A;  4A3J J;  1GV5 A;  2DA5 A;  2DTZ A;  3JRC A;  3GTL J;  2O8K A;  3CWR A;  5FKL A;  5FKK A;  1P7I A;  1A6I A;  1GUU A;  3VPR A;  5J1Y A;  3S15 J;  2PZ9 A;  2KT0 A;  2DA4 A;  4M3B A;  1BW6 A;  5E3N A;  3UKG A;  2CQX A;  4GCL A;  1APL C;  2OPT A;  3JRF A;  2E2I J;  3W6V A;  3G1M A;  3BR0 A;  2DA7 A;  4A3E J;  3BCG A;  4MIM A;  4W1U A;  5FKO A;  2Q24 A;  5F08 A;  2W53 A;  5C4J J;  1QRY A;  2DMN A;  2ZCM A;  1RET A;  1B8I A;  2ID6 A;  3I4N J;  4NN1 A;  2CUF A;  2K9N A;  4L5E A;  2L9R A;  1TWC J;  3HDD A;  3VVY A;  1IUF A;  1VF9 A;  4CYC A;  2HI3 A;  2G7L A;  2X6O A;  2GUH A;  2LTP A;  5EZG A;  3GTQ J;  1UMQ A;  4JL3 A;  2DMT A;  3S2D J;  1B72 B;  2ZB9 A;  2FD5 A;  4MFE A;  4DYC A;  2M9H A;  2QKO A;  4GFB A;  4M3F A;  3QBM A;  4IHX A;  4EEF G;  2K9S A;  3FRQ A;  1K61 A;  2DMP A;  1SGM A;  5F0H A;  3JRD A;  1X2M A;  3TP3 A;  2L7M P;  4C3H J;  3S1R J;  4V2F A;  1T56 A;  2NP3 A;  2EZK A;  1TWG J;  1WPK A;  1E3O C;  2R92 J;  1H8A C;  3LWJ A;  5M3M J;  3G1L A;  2ECC A;  5HOD A;  5EGO B;  5EG0 B;  4MK6 A;  2E2J J;  1HF0 A;  1HLV A;  1LE8 A;  5EDN A;  3NAU A;  4IHV A;  2H1K A;  2XPU A;  5GP9 A;  2ID3 A;  1RES A;  3HKZ N;  1Y1W J;  1RKW A;  3HEF A;  2O7O A;  4QSH A;  1JJ6 C;  2NP5 A;  3GZI A;  2HDD A;  1JUP A;  4DYQ A;  2NS7 A;  1GT0 C;  1F43 A;  3BT9 A;  5M3F J;  1FTZ A;  2E2H J;  2V57 A;  5D19 A;  3ZQH A;  5FKN A;  3O60 A;  3VIB A;  5HSZ A;  5M5W J;  3ANG A;  1ZKG A;  3ZQG A;  3FIW A;  5IYB J;  2WUI A;  5CXI A;  3NPI A;  3ANP A;  1S7E A;  2NS8 A;  5M5Y J;  1ETX A;  1U78 A;  1AHD P;  1UHS A;  4A3G J;  1WH5 A;  4XIC A;  4Y7N J;  1ETQ A;  3K7A J;  4DZP A;  1H88 C;  2NVX J;  1YRN B;  4JKZ A;  3PAS A;  5FLV A;  3HOW J;  1MBE A;  5C4X J;  1B8I B;  2JA7 J;  5IOZ A;  1ZQ3 P;  4AC0 A;  3KKC A;  1I50 J;  3NAR A;  2VKE A;  4A3K J;  2Y31 A;  1UI5 A;  2PMZ N;  2CU7 A;  3OSF A;  1MBK A;  1ETV A;  2M34 A;  3LSP A;  2YVH A;  3GBG A;  3TP0 A;  3CDL A;  4HNV A;  2D5V A;  4L62 A;  1WGX A;  2QF7 A;  1OJL A;  3BTL A;  3AQT A;  1U9N A;  3FK6 A;  1RPW A;  1RR7 A;  5HAW A;  1PUF A;  5DTD A;  1AKH A;  4MXM A;  1W0T A;  4S0H B;  2R0Q C;  4YZE A;  1HOM A;  1VFC A;  2Y2Z A;  3A01 B;  5C4Y A;  4IEJ A;  1RKT A;  3M4O J;  3H3V K;  1IG7 A;  4NEL A;  2HOT A;  3PM1 A;  5H9T A;  2XGC A;  3O8G A;  4UUS A;  3VVZ A;  2MSY A;  2TCT A;  3CJD A;  3RKQ A;  2HOA A;  2HYJ A;  4RBO A;  2WB1 N;  3HE0 A;  1QVT A;  1ETW A;  3TW7 A;  2E1O A;  4A69 C;  4FIS A;  1P7J A;  2JN6 A;  3Q0W A;  3ON2 A;  1B72 A;  4MO7 A;  4D5C A;  4DZJ A;  3OOU A;  3S16 J;  3JR9 A;  5EZH A;  4BBR J;  1XG1 A;  1GV2 A;  3VVX A;  4UUS B;  5FHP A;  3KKD A;  5DS9 A;  3KNW A;  5EF6 A;  4ICH A;  1JTY A;  3PO2 J;  1FJL A;  2QWT A;  2NOG A;  3S1Q J;  5J1U A;  3MVP A;  1ZTR A;  4M6V A;  5K7H A;  2YU9 J;  4GCK A;  2DMU A;  3WHC A;  2ZCX A;  2JJ7 A;  1BL0 A;  1JKP C;  4ABZ A;  5J1R A;  5IYC J;  1ZR4 A;  3I4M J;  3VOK A;  5EFY A;  3S14 J;  2NVY J;  3BR5 A;  3GTO J;  2R7Z J;  3NI7 A;  4PXI A;  3TW6 A;  4JX6 A;  3CMY A;  2ECB A;  4IHY A;  3BQZ A;  4B1R A;  2F07 A;  3DPJ A;  4D7N A;  3GTG J;  2JA5 J;  2NX4 A;  2XB0 X;  1HDD C;  2H8R A;  1D5Y A;  1DU0 A;  3E7L A;  5K7F A;  1HDP A;  1TWH J;  4LOC A;  2L7Z A;  2FBQ A;  1Z0X A;  4C2M J;  2IAI A;  5EG0 A;  2CJJ A;  2XRL A;  4DYR A;  2GLO A;  4HKU A;  4JX4 A;  2IEK A;  5E3L A;  4ME9 A;  2Y9Z A;  3HOV J;  4W97 A;  1IGN A;  1JGG A;  3JRI A;  5K7Z A;  3JRB A;  1TC3 C;  3VW2 A;  1GVD A;  2IBD A;  3A03 A;  2JA6 J;  3BG3 A;  5IP6 A;  2WAQ N;  2GEN A;  3FKI J;  2ZOZ A;  1LFB A;  3BG9 A;  3ZQL A;  1QVU A;  2FX0 A;  1IDZ A;  3F1B A;  2X48 A;  3IUV A;  1OFC X;  2VUM J;  2I10 A;  1H89 C;  3VP5 A;  3RZO J;  2ZCN A;  1G2H A;  3EUP A;  1MSE C;  2Y30 A;  2XGD A;  1LE8 B;  2N8G A;  2YUS A;  2EBI A;  4CGR A;  2M2E A;  3HM5 A;  3QPL A;  1MBH A;  3SDG A;  5AQC A;  4C3J J;  3SFI A;  3BTJ A;  2QOP A;  4B4C A;  1TWF J;  4Y52 J;  3QPS A;  1IC8 A;  3JRH A;  1ZR2 A;  2YS9 A;  3G56 A;  2DMQ A;  4JP0 A;  3LHQ A;  1JUS A;  2OER A;  2B63 J;  2AHQ A;  1FIA A;  1JTX A;  2DA1 A;  5EYR A;  5GPC A;  1MSF C;  2LKX A;  1MBG A;  1FEX A;  1ITY A;  1T33 A;  2M0C A;  3Q3S A;  3BQY A;  5E3O A;  3C07 A;  3DCF A;  1BA5 A;  4B3A A;  1ETO A;  3ON4 A;  2MW8 A;  2NVT J;  2XPV A;  3JRE A;  1Y1V J;  3BRU A;  1IRZ A;  4IHW A;  2UXP A;  3Q0U A;  2DN0 A;  5IP7 J;  1U8B A;  2WV1 A;  2LK2 A;  3G7R A;  1LFU P;  5FJ8 J;  2L7F P;  2RAS A;  5GPA A;  1PUF B;  1AKH B;  3S17 J;  3HTJ A;  4KWA A;  2QCO A;  3HTH A;  3BR6 A;  2LLK A;  3IH2 A;  2XB5 A;  4GFL A;  2EZH A;  3M3Y J;  2G3B A;  3E7Q A;  3HTA A;  1IDY A;  3BR2 A;  4BY1 J;  1ZGW A;  1FTT A;  1POG A;  4JYK A;  2LVS A;  1XC5 A;  3BR3 A;  3LSG A;  2NVQ J;  3RD3 A;  2ZOY A;  4MFD A;  3CQZ J;  3GEU A;  2D6Y A;  3PPB A;  1WCM J;  4UUT A;  1SFO J;  3ZQI A;  4A3F J;  1NK3 P;  2O7T A;  2R5Z A;  4QIW N;  3RZD J;  4X6A J;  2COB A;  2XGE A;  2ME6 A;  1GDT A;  1YRN A;  1EF4 A;  3S5R A;  1CQT A;  2LFB A;  3ZOB A;  4A3L J;  3B81 A;  3MKL A;  5IYD J;  3GTK J;  2Y0S N;  3A01 A;  4UDS A;  3JRA A;  3VOX A;  3HOZ J;  4NDL A;  2W48 A;  3WHB A;  2E19 A;  2HYT A;  1F36 A;  4A3B J;  2XSD C;  2L0K A;  3LJL A;  5BNG A;  3PO3 J;  2HKU A;  4A3C J;  3OIO A;  4M3E A;  5IP9 J;  3HOX J;  3SJM A;  4JNN A;  1U9O A;  2VKV A;  1JJ8 C;  3V78 A;  4A3D J;  2LP0 A;  3LNQ A;  2UXO A;  3COL A;  3D1N I;  1JT6 A;  2IU5 A;  1JKO C;  4I76 A;  2HXO A;  1HCR A;  5JLX A;  2KDZ A;  2OF7 A;  2DA6 A;  4A3M J;  5E3M A;  3ZQF A;  2M8G X;  3HGG A;  4XRS G;  5JLW A;  2ME0 A;  3NNR A;  1O4X A;  3BTC A;  1ENH A;  2R5Y B;  2YVE A;  1NK2 P;  1BJZ A;  5D1R A;  4CYC B;  2JWT A;  2XPW A;  5CW8 A;  2Y9Y A;  2R5Z B;  3F0C A;  4X1E A;  4FE7 A;  4FCY A;  1QPI A;  1DU6 A;  2OI8 A;  3LOC A;  4GCT A;  1JT0 A;  2REK A;  1MH3 A;  2HOS A;  3QKX A;  3HGY A;  1TWA J;  2FJ1 A;  2ELK A;  3CCY A;  3VW0 A;  2LY9 A;  3V6G A;  2HXI A;  4BXX J;  1A5J A;  4XRM A;  1OCT C;  2GBY A;  1I3Q J;  3VW1 A;  3H0G J;  2DG8 A;  2DJN A;  1X58 A;  3OSG A;  2EH3 A;  3GTJ J;  3O8H A;  3IH4 A;  3BNI A;  2JK3 A; 
#chains in the Genus database with same CATH topology
 3LL7 A;  2IA2 A;  4HAM A;  4AF5 A;  4ZH4 F;  1NTC A;  1J75 A;  4CHU A;  4DW6 A;  5HBU A;  3QYE A;  3CES A;  2BY3 A;  3REO A;  1PDN C;  4E7K A;  3N05 A;  4CXF A;  2HNH A;  3F6O A;  3T6N A;  2X9D A;  2UXH A;  1LJ9 A;  1IRG A;  1TP4 A;  3AG2 H;  3SWH A;  2ZJQ F;  4EAT A;  4M72 A;  1RIO H;  1WH7 A;  4XLH A;  2EFW A;  5HLH A;  3R60 A;  5C3E J;  2FUG 2;  3SDB A;  3SXY A;  3I58 A;  1DP3 A;  2HU9 A;  3PNT A;  1QHG A;  1SAN A;  2DA2 A;  4MLO A;  4BEH B;  5K5O A;  4ZDO A;  4CCN A;  2DG7 A;  2KPM A;  3L7W A;  2H27 A;  2G7G A;  5FLM J;  3GTM J;  3VYU B;  1RC9 A;  4EM0 B;  3OYJ A;  3LSJ A;  2XAG A;  1IZ1 A;  3OIP A;  2H8W A;  1DDN A;  5EGO A;  2XRO A;  4IQ4 A;  5BPD A;  2CUJ A;  3GME A;  1S6L A;  2DFH A;  4NQW A;  1IN8 A;  3CCQ I;  1BC8 C;  3BR1 A;  1P4X A;  1LQ1 A;  3JSP A;  5GTH C;  1SMY F;  4ASN A;  1IN7 A;  2A6E F;  1YHQ I;  2O0Y A;  1I5Z A;  3CRJ A;  3P9T A;  1I6H J;  3D5S C;  4AVP A;  2WB1 A;  4I6Z A;  1H9G A;  2LBF A;  4XL9 A;  5F6F A;  2RGV A;  1XS9 A;  4OOI A;  2R93 J;  3CF5 F;  1Z6R A;  3ZQC A;  2KLO A;  2V6C A;  4P5O A;  3EGQ A;  5J40 A;  3ZRG A;  4YEJ A;  2DDA A;  5HVQ C;  3OMY A;  3I55 I;  1G59 A;  2Q1Z B;  3FBI B;  2ZFU A;  1RUO A;  2RVC A;  2JT1 A;  1BOA A;  4B09 A;  5K58 A;  3CUQ A;  3B6C A;  1FIP A;  4C2T A;  3Q9V A;  4M9Z A;  3RDI A;  1Y6I A;  2ADU A;  1OKR A;  5F0C A;  5FMP A;  4E70 A;  3HIM A;  3OYH A;  2L9S A;  4PCQ A;  1X1A A;  1VQ8 I;  2K40 A;  2JVH A;  5AIQ A;  5FKM A;  1P2F A;  1LPQ A;  1W4M A;  2FOW A;  3QOP A;  2O9L A;  3ABK H;  2DCE A;  3GUD A;  2Z16 A;  5DM6 F;  3FXM A;  3KEY A;  2MC3 A;  2VIX A;  5A2Q Z;  4M9S A;  2V1X A;  4XRS A;  1IRF A;  1IAW A;  1ZK8 A;  5BS6 A;  3K2A A;  3DBL B;  4HRI A;  1S5L C;  2CV2 A;  3LAP A;  3ZMS A;  4A3J J;  2QSH X;  1X1B A;  3JRC A;  2O8K A;  5FKK A;  3VPR A;  4M74 A;  1A6I A;  1OCO H;  3S15 J;  2Y75 A;  3BJ6 A;  2DA4 A;  3ESW B;  2UZK A;  4R1H A;  1APL C;  4A5M A;  1Z05 A;  4BE0 A;  3O2P E;  4LG0 B;  1S7O A;  3PIP F;  1X1D A;  2LKP A;  5LGN A;  4XN3 A;  3OYE A;  2EPF A;  1FOX A;  1QRY A;  2DMN A;  2XAH A;  1Z1D A;  3DP7 A;  3BCB A;  5TJJ A;  2ID6 A;  1IF1 A;  4IX7 A;  3BZC A;  1XPX A;  2JPB A;  1JI8 A;  3GFM A;  4CYC A;  4XSX F;  4FT8 A;  3SFZ A;  2GUH A;  2LTP A;  2M8E A;  3HYI A;  3HTU A;  4Z6Y A;  4U87 A;  2CFX A;  2Z1D A;  2M9H A;  1K79 A;  1FLI A;  3QRF F;  2QKO A;  4M3F A;  4EEF G;  5LHH A;  3KP5 A;  3KEO A;  1PUE E;  1MMA A;  1X2M A;  2CUZ A;  1W5C C;  3DU5 A;  4V2F A;  3VEP A;  1IXS B;  3P9C A;  2NP3 A;  5FFZ A;  2DTR A;  4IKF A;  1ULY A;  4IRH A;  2LC2 A;  2VKD A;  2M0M A;  2R92 J;  2ZXW H;  3BWG A;  5HOD A;  5EGO B;  5EG0 B;  1I1G A;  4UXN A;  4P1W A;  2Z33 A;  3JW4 A;  2E2J J;  1HF0 A;  1RRJ A;  2BXZ A;  5EDN A;  4ZDP A;  5ICF A;  1OR7 A;  5GP9 A;  2VB6 A;  2ID3 A;  1YJ9 I;  4XQF A;  1SFU A;  3K4N A;  2R7W A;  2BYV E;  1QZZ A;  2HVQ A;  4DYQ A;  3BT9 A;  1FTZ A;  1TQI A;  2V57 A;  3ZQH A;  5FKN A;  4FQG A;  3ZXS A;  4P9U A;  4IRI A;  2XIG A;  1XSX A;  1P9Q C;  4DBR A;  4HPQ A;  1HBX G;  1BR2 A;  4RGU A;  2WUI A;  4RLQ A;  3EUA A;  2HZD A;  1G8X A;  2E5N A;  3W6K B;  4ZZD A;  1S7E A;  2A5W A;  2WY7 Q;  4DZP A;  3GWZ A;  5BOX A;  3O6B B;  1MMN A;  1YRN B;  4JKZ A;  5KAI C;  1MBE A;  4PJN A;  4CCM A;  2M3A A;  3QP6 A;  2PFB A;  3KKC A;  1RNL A;  3NAR A;  3LQQ A;  3SEQ A;  4MHG A;  1D8K A;  2Y31 A;  3P5J A;  4HLY A;  3OSF A;  3I3L A;  2VOO A;  1ETV A;  2VL8 A;  2MD5 A;  4HX8 A;  3TO9 A;  1BOB A;  4IRG A;  1K4T A;  3CZ6 A;  2F4I A;  1J09 A;  3TP0 A;  1FPQ A;  4HNV A;  2HOE A;  1FBQ A;  2IS1 A;  2F5E A;  3ZPL A;  2MBF A;  3L2U A;  5LEK A;  1XD7 A;  3KZY A;  4YRV A;  3WU1 B;  3TKY A;  1RR7 A;  2EJR A;  5BMZ A;  3KYC B;  4ZYE A;  5DTD A;  4MXM A;  5J4Y A;  5FD6 A;  4S0H B;  1VQ4 I;  1ZRD A;  4BU2 A;  4GYG A;  1N25 A;  2Y2Z A;  3ERM A;  3M8F A;  1T39 A;  1U5T B;  4AVZ A;  1MDM A;  3RSN A;  1U5T C;  4ZTJ A;  3RIR A;  4CZZ A;  3O8G A;  3TDZ C;  4UUS A;  2TCT A;  3H5A A;  2Q8K A;  3CJD A;  3DKW A;  4KUM A;  2HYJ A;  3RKQ A;  2M4K A;  1OIS A;  3FMS A;  4RBO A;  1K7A A;  2R7U A;  1O3S A;  1ETW A;  3TW7 A;  1EA3 A;  2UXX A;  4H4K C;  3PUB A;  4A69 C;  1PJR A;  4RS8 A;  4D5C A;  4DZJ A;  4N9I A;  5IT9 Z;  2B7E A;  3MZH A;  4A0X A;  1V54 H;  2OQR A;  3PQJ A;  2PEX A;  3VYR B;  2LOO A;  3ELK A;  1XG1 A;  3L2R A;  1NG7 A;  2LNB A;  2FF4 A;  3WG9 A;  4ESJ A;  3DBH B;  4UUS B;  1XDU A;  3DPT A;  5DS9 A;  3KNW A;  1R6R A;  2QA4 I;  1FJL A;  1TT0 A;  2AQF A;  3CMA I;  2CQN A;  3MVP A;  3G73 A;  4EJO A;  4IJA A;  4RAF A;  2DMU A;  4HNU A;  2ZCX A;  4RB2 C;  3SHF A;  4A2U A;  2AXL A;  4AWX B;  2BE5 F;  3S14 J;  3GTO J;  2CQ7 A;  3TW6 A;  3CMY A;  2ECB A;  3K4K A;  2CG4 A;  4A5N A;  2VQL A;  4KYW A;  3T5X A;  4B1R A;  1O7F A;  1BM9 A;  2GA1 A;  3GTG J;  2Q2E A;  2IT0 A;  2L9V A;  3L2Q A;  1T8I A;  1UFM A;  1BI0 A;  1X19 A;  1W36 C;  3E7L A;  2VJ4 A;  5K7F A;  3ZQ7 A;  2KRH A;  2VQC A;  1S9H A;  1QZY A;  1OCZ H;  2L7Z A;  2TDX A;  4C2M J;  2IAI A;  4II3 A;  4HQE A;  2QQB A;  2CJJ A;  4DYR A;  3L00 A;  2XV4 S;  4HKU A;  5E3L A;  2F4O B;  2LYC A;  2X51 A;  4W97 A;  1JGG A;  3RPU D;  5DEQ A;  5K7Z A;  1A35 A;  4OAY A;  3JRB A;  1TC3 C;  3E6D A;  1GVD A;  4BXU A;  1Y56 A;  2D1V A;  2BHY A;  5IP6 A;  1G3Y A;  3FKI J;  3KFW X;  2F2E A;  1IDZ A;  4GYI A;  2L02 A;  3IUV A;  4BAC A;  1OFC X;  3VSL A;  4LMY A;  1H89 C;  2P7V B;  3GZ5 A;  2CYY A;  4CDG A;  5ERI A;  3P9I A;  2VT2 A;  2HKO A;  3HHH A;  2ZCN A;  1BI3 A;  2Z5U A;  2STW A;  2Q0O A;  3J7A Y;  2EBI A;  4CGR A;  4RMN A;  1T98 A;  1SD5 A;  3SDG A;  4DQ2 A;  4L9T A;  4C3J J;  1WJA A;  2QOP A;  1KU2 A;  1D8J A;  1K6O A;  2ZCW A;  4MQV A;  1IUY A;  4ENJ A;  2B63 J;  5HS9 A;  2C6Y A;  2L9N A;  2QQA A;  1WI9 A;  2K7L A;  5EYR A;  3GF2 A;  1UHM A;  3GX4 X;  5HOO A;  3T8R A;  1JGS A;  4L9J A;  1ITY A;  2M0C A;  5KHD A;  3WTW C;  3BQY A;  4KNY A;  1K6Y A;  3C07 A;  3DCF A;  4II2 A;  4B3A A;  3LSK A;  1ETO A;  1TLH B;  1O3T A;  2RNJ A;  3FXL A;  3JRE A;  2WA0 A;  1FC3 A;  2VC0 A;  1XMX A;  3HRS A;  3Q0U A;  3J80 K;  1SFK A;  3HG9 A;  5HS8 A;  1YIJ I;  1Z3X A;  3R0J A;  1AKH B;  2OD5 A;  3H92 A;  5LBQ A;  3CCU I;  3OL3 A;  5B1A H;  2ISY A;  5ILU A;  2XB5 A;  3CJQ B;  1VQK I;  1G3S A;  3TGN A;  2Y0S A;  4N4N B;  4G6Q A;  1IDY A;  2MYS A;  2R4G A;  1FTT A;  4HYE A;  3OS1 A;  2XF5 A;  4RAG A;  1XC5 A;  2KKO A;  3CQZ J;  2L01 A;  3MD2 A;  3GEU A;  3J7A O;  2W4S A;  3J81 K;  1WQ2 A;  1O57 A;  3ZQI A;  1MGT A;  5FRN A;  3HXL A;  3C2G A;  3LA2 A;  4HOB A;  4QIW N;  3RZD J;  3S3M A;  4M6X A;  2XGE A;  2IGK A;  5LGT A;  3EYY A;  1EF4 A;  2LY1 A;  3CCM I;  2X1E A;  2L4A A;  4KIS A;  3MKL A;  1R7J A;  3FF5 A;  4U0V A;  2Y0S N;  3WTS C;  4PGH A;  3L9F A;  4G6D A;  4NDL A;  2A61 A;  3WHB A;  3DLA A;  2H94 A;  2HYT A;  1XGO A;  1E2X A;  3D5L A;  1SD7 A;  1B9M A;  2IRF G;  2KIF A;  3GFL A;  1QGP A;  2ICW G;  1ZRF A;  3CUO A;  1GXP A;  2DAO A;  3CO6 C;  1U9O A;  3E5Q A;  4IQJ A;  4HEA 2;  3VYS B;  4BDY A;  1H0M A;  2LP0 A;  3D0S A;  3H3U A;  1JT6 A;  2ZXJ A;  4YFX F;  3UR3 C;  1BR1 A;  2PFV A;  5B5E C;  1XSV A;  4BHC A;  2OZU A;  2NVU B;  2OF7 A;  5CYV A;  4A3M J;  5EEG A;  3ZQF A;  5ED4 A;  3BTC A;  1BJZ A;  1TZL A;  2QYO A;  1MMS A;  1KU9 A;  3SQN A;  2L3D A;  3FMR A;  2GOX B;  4CYC B;  1R00 A;  2IPQ X;  3HRM A;  1QZE A;  4U9N A;  2JZY A;  2W82 A;  3M7G A;  4DVY P;  1Q1H A;  2E36 A;  2HDC A;  2GQQ A;  3V4G A;  2HYG D;  2RQQ A;  3K4L A;  2EIM H;  3CCY A;  2BBY A;  1G3T A;  4XBF A;  1R36 A;  2R7Q A;  2VQH A;  3V6G A;  1BC7 C;  4BXX J;  1A5J A;  2GZW A;  2FJI 1;  1LVA A;  1Z21 A;  2CW8 A;  4OU0 A;  2IGN A;  1SFX A;  3GZ6 A;  4BJT A;  1X58 A;  5GAH J;  4K2E A;  2EH3 A;  3GTJ J;  3O3K A;  3M1C A;  3O8H A;  1FBU A;  3BNI A;  1Z77 A;  3NRG A;  3M8J A;  2VBY A;  4XK4 A;  2V1U A;  1YI2 I;  4IOC F;  1RI7 A;  5J8C A;  1D3Y A;  3A02 A;  4CA0 A;  3DFG A;  1KU7 A;  4KMF A;  1HKT A;  3CLQ A;  3GZN B;  3FXJ A;  2MG4 A;  2FNP A;  3BG5 A;  3T1B A;  2V7F A;  4E7I A;  1N77 A;  4BKX A;  1UG2 A;  4CO8 A;  4EGY A;  1MNM C;  3CF2 A;  2JA8 J;  1BW5 A;  4BY7 J;  3CC7 I;  1HA8 A;  3E97 A;  1W7P D;  3BHQ A;  2KL4 A;  3PSF A;  4WWC A;  4I01 A;  2PQ8 A;  2RN7 A;  5LEJ A;  3C1D A;  1A36 A;  3K1M A;  3Q0V A;  4UB6 C;  1IV6 A;  3X2Q H;  1Q1V A;  4XMY A;  4OIO F;  2Y69 H;  3DEW A;  3NXC A;  1XCV A;  3IKV A;  3B6A A;  1IJW C;  4FTH A;  4TV7 A;  3F8M A;  5E1X A;  4L18 B;  2EZI A;  4Q5S F;  4LIU A;  1MH4 A;  1HW2 A;  3GLL A;  3IV5 A;  1BR4 A;  3ASN H;  5GTI C;  1OR7 C;  2F48 A;  2FE3 A;  2VJJ A;  5F04 A;  4U88 A;  5HDG A;  3TOB A;  2BW3 A;  2UXU A;  3VUQ A;  4BQN A;  2A05 A;  2CMP A;  3CO7 C;  4RGS A;  2FOK A;  1HKS A;  5FRM A;  2BEO A;  4GFK A;  3S2H J;  4PJM A;  1JKR C;  1JE8 A;  2YPR A;  3ZR8 X;  3U2R A;  5D5V B;  1WHU A;  4EJT A;  3BG6 A;  2KRC A;  3FIS A;  2KIU A;  2WWY A;  3G1O A;  2VPR A;  5H6Q A;  5ILS A;  3H5N A;  4IF4 A;  4JX5 A;  2ZME C;  4WXC A;  2K9Q A;  4KN4 X;  1VI0 A;  2ZSI B;  2XGX A;  1HQC A;  1EH6 A;  3TED A;  1WI3 A;  3CMM A;  1GVJ A;  3C3W A;  3H9J A;  2EZL A;  3CTA A;  4QTR A;  5CKT A;  2KJB A;  2A2F X;  2MGQ A;  1XB4 A;  4FHT A;  2EQR A;  3QPT A;  4G8X A;  2XDN A;  3H3Z A;  5JVT A;  1UJ8 A;  5F1J A;  2KFD A;  2ZXI A;  2CUE A;  2R5Y A;  3I71 A;  3A0B C;  3BTI A;  4ZYG A;  4MEX F;  3S1M J;  2EA4 A;  5FGL A;  5DM7 F;  2G0E A;  4AC6 A;  4BBS J;  3QQA A;  1MZB A;  2DDB A;  1MIJ A;  4M3D A;  3JSJ A;  4YIR X;  1PYV A;  2PBX A;  4D5F A;  2Z3Y A;  2FBI A;  4G7H F;  3QWL A;  3MMY B;  4BS9 A;  3GTL J;  5FKL A;  5HLT A;  3LQR A;  2HQR A;  5J1Y A;  2KT0 A;  3MEX A;  1BW6 A;  1YS6 A;  1LUJ B;  3VFZ A;  3K2Z A;  2OPT A;  4XKB A;  3RI4 A;  2EIL H;  3OL4 A;  3F22 A;  5D4S A;  2LBF B;  2ACJ A;  2E2I J;  4A3E J;  1FMW A;  3G2B A;  4W1U A;  2DFE A;  2FEZ A;  4OD5 A;  5E20 A;  2ZNY A;  5F08 A;  4HX7 A;  5C4J J;  2UUZ A;  2VXD A;  1B8I A;  3I4N J;  2VON A;  2L9R A;  2HPI A;  1YTY A;  2AXT C;  3HDD A;  3VVY A;  2HI3 A;  2G7L A;  2E1N A;  4LJZ F;  4JQF A;  1S7A A;  4JL3 A;  1CF7 B;  2F5V A;  3ECH A;  1B72 B;  3CDI A;  3V8L A;  2VJI A;  5E17 F;  4MFE A;  3U21 A;  2LRE A;  4DYC A;  2F6C A;  3WTX C;  3QBM A;  4IHX A;  4CH7 A;  2K9S A;  3FRQ A;  4BAY A;  2DMP A;  2X1D A;  4RLF A;  4E7L A;  5DCM A;  5HLI A;  2EIJ H;  4Q48 A;  1U2W A;  2IA0 A;  4ZYA A;  3OYI A;  3CCR I;  3S1R J;  4IL6 C;  1T56 A;  1KQ9 A;  2IS4 A;  1CF7 A;  4NBQ A;  2K4J A;  2BY0 A;  3ZMU A;  4ZJZ A;  3IWZ A;  1E3O C;  4J00 A;  5CVR A;  3LWJ A;  1OQY A;  3BPX A;  4UHT A;  4XLF A;  3V7S A;  1RZ4 A;  5F64 A;  3K10 A;  2FMY A;  3B02 A;  4PUS A;  2FSW A;  1LE8 A;  3GLX A;  2H1K A;  4HF1 A;  2XF6 A;  3A2K A;  1V3F A;  3HKZ N;  1Y1W J;  3OS2 A;  4QSH A;  1FP2 A;  1KGS A;  2D1H A;  2K9M A;  3C7J A;  3AKZ A;  4IO9 F;  4U7B A;  1ZG1 A;  4C9Y A;  1V5E A;  4O6J A;  4BJ6 C;  5HSZ A;  2A69 F;  1IO2 A;  3GFI A;  2KMU A;  3ZQG A;  3P9K A;  2K4B A;  2R3S A;  2W24 A;  3EUH A;  1IXR C;  3NPI A;  3OYF A;  4FX4 A;  4EJU A;  2VT3 A;  5E1W A;  2A3S A;  1U78 A;  1AHD P;  1DUX C;  4LB6 B;  4A3G J;  1KYZ A;  4XIC A;  4RM2 A;  4Y7N J;  1IN4 A;  4WXH A;  4HF2 A;  3H9G A;  3QU6 A;  3GVA A;  1IN6 A;  5HNF A;  5D5U B;  2QSG X;  5FLV A;  5CQG A;  5DCM B;  3PAS A;  4AC0 A;  1I50 J;  1Y0N A;  1ZGA A;  2VKE A;  5K5R A;  1ZHF A;  4U0Y A;  1UI5 A;  2KIQ A;  4AIH A;  1X3W B;  4KIG A;  5CVV A;  4YEL A;  3GBG A;  2YVH A;  3CDL A;  2D5V A;  1WGX A;  3C2H A;  3FHZ A;  5B1B H;  3AQT A;  2ZNZ A;  3FM5 A;  1YYV A;  5ICC A;  4R8H A;  2YSR A;  4RAY A;  5B66 C;  3IL2 A;  2QQ8 A;  1PUF A;  1TBX A;  2E1M C;  4AU7 A;  3QAH A;  4UVA A;  1W0T A;  2R0Q C;  2DOF A;  4YZE A;  3KCC A;  4A0Y A;  2OCC H;  5DUK A;  2B0L A;  1EH7 A;  4JBA A;  3H3V K;  1FOY A;  1IG7 A;  5J6X A;  3I5U A;  2E71 A;  2XGC A;  4I7H A;  1OYY A;  5GAD J;  1GLN A;  2MSY A;  2XAJ A;  4CUG A;  4S04 A;  4LD5 A;  3FWE A;  4QWQ A;  3T8T A;  4YFK F;  2WB1 N;  2JSC A;  4BE1 A;  4YG2 F;  2E1O A;  3ON2 A;  1N78 A;  2DLL A;  2CV1 A;  2VLA A;  4CCL A;  1XGN A;  3S16 J;  1AA7 A;  1HXD A;  2GOM A;  5EZH A;  3F9K A;  3COA C;  1QBJ A;  1QPM A;  2BXY A;  3IKT A;  3WG7 H;  2IVM A;  3OOP A;  4E6K G;  5LRR A;  5EF6 A;  2QWT A;  1SFE A;  4C30 A;  4UB8 C;  5K7H A;  1VQM I;  4GCK A;  2O03 A;  3GW2 A;  1BL0 A;  3VB2 A;  1JKP C;  1IRX A;  3E5U A;  3G3Z A;  3KYD B;  1ZR4 A;  3I4M J;  1FYM A;  5EFY A;  2VAS A;  2NVY J;  3BR5 A;  3JCU C;  3GFJ A;  2GIZ A;  4JX6 A;  1Y39 A;  2PI0 A;  4DGW B;  2CGP A;  2DPD A;  4XN0 A;  1P92 A;  2NYX A;  2O5R A;  2KDO A;  2HFH A;  2W25 A;  4R79 A;  3DPJ A;  3V42 A;  3K1P A;  4WXD A;  2XB0 X;  1XN7 A;  1D5Y A;  3DEE A;  3AFH A;  1HDP A;  3H5R A;  4KN7 X;  3E3V A;  1TWH J;  2W84 A;  2ZY9 A;  1R4N B;  4LOC A;  4ZDL A;  2RQP A;  3EUK L;  2FBK A;  3LWF A;  5EG0 A;  2V9V A;  2LKS A;  1REP C;  4RB3 C;  2IEK A;  3WTT C;  1HST A;  4G7Z F;  2HYF A;  1DPU A;  4ME9 A;  3JRI A;  4WX9 A;  1ONV A;  5HDN A;  3VW2 A;  2IBD A;  3CC4 I;  1YG2 A;  2JA6 J;  2A6H F;  2ZOZ A;  2EK5 A;  3NEU A;  3S32 A;  4C2U A;  3EDP A;  2VUM J;  2I10 A;  3CJN A;  4IXA A;  2HS5 A;  3M9A A;  4I09 A;  3RZO J;  3HSF A;  5D5W B;  2DI3 A;  4RB0 A;  2P0W A;  1LE8 B;  2YUS A;  2EFN A;  4EGZ A;  3QPL A;  5D6E A;  4M71 A;  5D6F A;  1SAU A;  1G4D A;  2DJI A;  3TDU C;  3J7Y J;  1DPR A;  1TWF J;  2P7C B;  1MKM A;  2FRH A;  3QPS A;  2EB7 A;  2VJ5 A;  2YS9 A;  3PFI A;  4A0Z A;  4EVI A;  3JRH A;  4NHJ A;  4JP0 A;  4AIK A;  5D4R A;  1JTX A;  2ETH A;  3JSO A;  1NHA A;  1U6G A;  2OV7 A;  1D0X A;  4HA8 A;  2G7U A;  5GPC A;  2BVM A;  2KZV A;  4XM3 A;  4LG0 A;  4XLE A;  1XTA A;  1FOW A;  1FEX A;  1T33 A;  1TTY A;  3Q3S A;  3E5X A;  5E3O A;  2PJR A;  1ON2 A;  3OYG A;  1BA5 A;  3L2W A;  2RRE A;  3DU6 A;  1QA6 A;  3NRV A;  3KLO A;  3MAJ A;  2ZO4 A;  3U9G A;  2NVT J;  2CO5 A;  1YIO A;  1X4O A;  2QBY B;  4WIB A;  3K4B A;  1LNW A;  1AOY A;  1Y1V J;  3BY6 A;  2FML A;  4I0A A;  2WV1 A;  2LK2 A;  2EIN H;  3G7R A;  3K70 D;  2RAS A;  5KNL A;  2L2O A;  3QPH A;  2Z9O A;  3HTJ A;  4KWA A;  4A12 A;  2Q2E B;  3IUO A;  3HTH A;  2LLK A;  3IH2 A;  3SZP A;  3U1K A;  2G3B A;  2F5D A;  1BI2 A;  3HTA A;  3BR2 A;  4BY1 J;  1HW1 A;  2LVS A;  3BR3 A;  3LSG A;  2NVQ J;  4LK1 F;  2ZOY A;  3OS0 A;  2H6B A;  1WCM J;  2W1O A;  4LLN A;  1MMD A;  1SFO J;  4KIF A;  5DCF A;  4M9X A;  4BL0 B;  4X6A J;  2V9K A;  2GXB A;  2COB A;  3HRT A;  2E1M B;  4BXF A;  2LFB A;  3ZOB A;  1V55 H;  1T2K A;  5IYD J;  1Z6T A;  3A1Y A;  4UDS A;  3A01 A;  3HOZ J;  3VOD A;  2K5C A;  4GCV A;  2E19 A;  2MLG A;  4A3B J;  1ZRE A;  2L0K A;  1SAX A;  4IHT A;  3ULQ B;  4OD4 A;  1V4R A;  4PJJ A;  3OIO A;  5FRO A;  3I4P A;  4MTD A;  3SJM A;  4JNN A;  5CJ9 A;  2DQL A;  2D45 A;  1MJ9 A;  5DD8 A;  3S3O A;  1W5T A;  4HSR A;  1HCR A;  5JLX A;  1O7L A;  2CS3 A;  3J7Z I;  4E4H A;  2DA6 A;  5E3M A;  1USS A;  4XSZ F;  2M8G X;  3WE2 A;  5JLW A;  2YR2 A;  1O4X A;  2V1D A;  3CD6 I;  2YVE A;  2IJL A;  4Q4Z F;  4E7Z A;  4E7S A;  4U9L A;  3CJR B;  1I6X A;  2JWT A;  2Y9Y A;  3TOA A;  2O61 A;  3KP7 A;  3HKZ A;  3F0C A;  3BPV A;  3EQL F;  3HIF A;  4N4O B;  2M7A A;  3BJA A;  2WBM A;  3KX2 A;  3CLO A;  4KMU X;  4GCT A;  2VQG A;  3QKX A;  1TWA J;  2FJ1 A;  2WC2 A;  3OR2 C;  2RKH A;  2LY9 A;  2ZC2 A;  3BG7 A;  1BIA A;  2R7X A;  4UV8 A;  4XRM A;  1OCT C;  3FX3 A;  2GBY A;  1I3Q J;  1S3J A;  3MWM A;  5ICG A;  3OYC A;  4B48 A;  2DT6 A;  4ACI A;  2PG4 A;  3IH4 A;  4V19 K;  2JK3 A;  4LG3 A;  2DW4 A;  4HNT A;  3N97 A;  1J9I A;  3WTY C;  4NUB A;  5CXG A;  2TRT A;  4BH9 A;  5F0F A;  4OWR B;  3CC2 I;  2V1N A;  2VBX A;  3FM3 A;  1Z67 A;  4GGG A;  4HW0 A;  2L7K A;  4D7M A;  4J19 A;  1YW9 A;  4FE4 A;  4A3I J;  1YIT I;  3RPQ A;  6PAX A;  2QIB A;  2RAE A;  3HOY J;  2CRG A;  3KP4 A;  3RH2 A;  1W5S A;  1U0J A;  1ZLK A;  5L3G A;  1A6Q A;  2HTJ A;  2HQ5 A;  2E7W A;  1MBJ A;  1OCP A;  3HSR A;  1O3R A;  5EEA A;  3JTG A;  1B9N A;  1R71 A;  4BDZ A;  2AO9 A;  4D9J A;  1WJB A;  2EA2 A;  2RHA A;  4AD9 A;  2QSF X;  4BHB A;  2CFO A;  2M30 A;  3C2B A;  2VI6 A;  1MND A;  5FD5 A;  4A93 J;  3MZ8 A;  1ETY A;  3JAM Z;  4ZZL A;  1I3A A;  4AID A;  1AWC A;  4MGR A;  4V2G A;  1K83 J;  2UXI A;  3AQS A;  2W57 A;  4CSW A;  4XKW A;  3RYR A;  3WTV C;  4XID A;  2IS6 A;  1FSH A;  3DKX A;  5J8F A;  2GFN A;  1F5T A;  1XMK A;  2OBP A;  2OCE A;  2VBZ A;  2W85 A;  2CW7 A;  3BP8 A;  4MTE A;  3ZCO A;  5FO5 A;  2OQG A;  3FHN A;  4PSW A;  2WV0 A;  2HTS A;  3ABU A;  3IAS 2;  3L1P A;  1KA8 A;  1ERD A;  3E0J B;  3HUG A;  3HOU J;  3JTH A;  1YX5 A;  1JKQ C;  2UV1 A;  2A6T A;  4M3G A;  1VND A;  2NOJ B;  2VC1 A;  3KZZ A;  3HBL A;  3GTP J;  5F27 A;  3ZGK A;  2BHZ A;  3TO7 A;  4B43 A;  4L9N A;  4C3I J;  4IHS A;  3LSR A;  3J81 Z;  1JUM A;  5IPA A;  2DK5 A;  3MKZ A;  3LFK A;  1YLF A;  4F93 B;  3SEZ A;  1ZAR A;  5D18 A;  4BQQ A;  1GV5 A;  2DTZ A;  5ILV A;  1GXQ A;  1ZYR F;  4B3X A;  3OYM A;  3F72 A;  4ENM A;  1PP8 F;  1H9T A;  2DXI A;  1LFP A;  2CQX A;  3ZMV A;  3J80 Z;  5CLS A;  2X0L A;  2HR3 A;  2EWN A;  4E7H A;  3W6V A;  1W7P A;  3G1M A;  3RQ4 A;  3BCG A;  3ECO A;  2YU3 A;  2W53 A;  1P6R A;  1V5G A;  2LMD A;  5AON A;  1MNE A;  1R58 A;  1LDD A;  1LDK B;  1J5Y A;  2CUF A;  2K9N A;  3HUG B;  4L5E A;  4UVB A;  1TWC J;  3MCZ A;  2CSO A;  2BGC A;  4HV6 A;  2KRF A;  1IUF A;  2FA5 A;  2DOA A;  5DUI A;  2X6O A;  4Y4R A;  3GTQ J;  1UMQ A;  3CDH A;  3S2D J;  3S8P A;  4HQM A;  1DP7 P;  3SZG A;  2FD5 A;  2WAE A;  1Z91 A;  3ASO H;  4GFB A;  2DOD A;  5KAF C;  3ZP5 A;  2NXN B;  1K61 A;  5K5Q A;  4GO1 A;  2QKL B;  1SGM A;  2V26 A;  5F0H A;  2M5W A;  4XON A;  1R5H A;  3SZT A;  3TP3 A;  4NC6 A;  2F5C A;  3WU2 C;  3LFU A;  4C3H J;  5HLG A;  4Y17 A;  3KYL A;  4HDV A;  1D5V A;  2EZK A;  3DTE A;  3PNY A;  1ZG5 A;  1KU3 A;  1R1U A;  1WPK A;  4P9F A;  3CME I;  1SMT A;  2X6X A;  1FZP B;  2QLZ A;  2QBY A;  1X1C A;  4JK1 X;  4Z2Y A;  5M3M J;  3G1L A;  1ZH5 A;  3E1S A;  2JA2 A;  4GRI A;  1UCR A;  4NC7 A;  2MLK A;  4D0P A;  2P5V A;  1VQL I;  4IHV A;  3IAM 2;  2ESH A;  2ZJP F;  1X3Z B;  5KCM A;  2WY8 Q;  3BCA A;  2NP5 A;  2XUB A;  1RKW A;  3HEF A;  2O7O A;  3I59 B;  2W7N A;  1JJ6 C;  3GZI A;  2HDD A;  3HL2 A;  1WZ2 A;  2NS7 A;  1F43 A;  1D1B A;  5M3F J;  2HGC A;  2GXA A;  3O60 A;  1S72 I;  5M5W J;  1YOV B;  1ZKG A;  1VQ9 I;  3FIW A;  2ESN A;  2KIM A;  4AIJ A;  3KPH A;  3OYA A;  3P7N A;  1L3L A;  4IRV A;  2NS8 A;  5M5Y J;  3AG4 H;  1ETX A;  3BC8 A;  1UHS A;  2FQ3 A;  1ETQ A;  3K7A J;  3M8E A;  5GAE J;  2XHK A;  3HOW J;  5C4X J;  4IVN A;  1B8I B;  2JA7 J;  5IOZ A;  1ZQ3 P;  4OIN F;  3DTI A;  1ZEL A;  3A0H C;  2PJP A;  2CU7 A;  2HVR A;  1KYW A;  2M34 A;  3LSP A;  5HNH A;  4CGZ A;  1TQP A;  1WVR A;  2R7T A;  2FU4 A;  4XLP F;  2DPU A;  4CCJ A;  4O5V A;  1WJ5 A;  1U9N A;  3FK6 A;  5ICE A;  1QQI A;  1LKX A;  2WAQ A;  2X1C A;  4S05 A;  1KZH A;  1MJB A;  5JI6 A;  2EV5 A;  5FLX Z;  3KET A;  1EV7 A;  1U3E M;  4KT5 C;  1JXS A;  1WJD A;  3AAF A;  1ZG3 A;  1TW3 A;  1J0R A;  1NG6 A;  3EUH C;  4EM2 A;  1ZLJ A;  3PL8 A;  3QYB A;  2MH2 A;  2V9P A;  3K0L A;  2XC7 A;  3M4O J;  4G7O F;  4NEL A;  4BHP A;  1D0Y A;  4HV5 A;  1SEU A;  3CCV I;  5IY5 H;  3QU3 A;  2XAU A;  2HOA A;  3HE0 A;  1TNS A;  3W3C A;  1QVT A;  4BYY A;  3I54 A;  3Q0W A;  4L0Y B;  2VOP A;  1B72 A;  4MO7 A;  5JR3 A;  4G94 A;  3M1E A;  2P6S A;  1UST A;  4HX4 A;  4MNU A;  5FFX A;  3U1D A;  4I98 B;  1XMA A;  4G9Y A;  3K69 A;  5FHP A;  3VOE A;  4U0W A;  1YQA A;  4XKV A;  3H0D A;  1LB2 A;  4ICH A;  1JTY A;  3PO2 J;  4ON0 A;  3K6G A;  3EPZ A;  5K1Y A;  1WJC A;  2JRM A;  3S1Q J;  1HKQ A;  1ZTR A;  2QGU A;  4BQO A;  1XGM A;  3WU0 A;  3CUQ B;  2J5O A;  4PFO A;  2M1B A;  2PMZ A;  3WHC A;  2OTL I;  2R7S A;  4ABZ A;  5IYC J;  3L2C A;  3VOK A;  3RJP A;  2D2W A;  2HEO A;  1VQN I;  1YE9 A;  3DF8 A;  2NRA C;  1R49 A;  2P5L C;  4Y13 A;  3AL0 B;  1S29 A;  3BQZ A;  1DGW Y;  2AS5 F;  4KT6 A;  3VTI A;  3BJO A;  2KHM A;  1XSD A;  2JA5 J;  3WTZ A;  1WSU A;  5LRS A;  3RPU A;  3SYT A;  1HDD C;  2H8R A;  1Z9C A;  1FBS A;  1KQ0 A;  1DU0 A;  1VQP I;  4D1Q A;  3NS4 A;  2FBQ A;  1WRJ A;  3DPU A;  3LMM A;  2JSP A;  2XRL A;  4RB1 A;  5LHI A;  4JX4 A;  4XLN F;  2OJE D;  2Y9Z A;  2A5Y B;  4L9V A;  2HKX A;  1X4P A;  1IGN A;  3E6C C;  3FXO A;  1R1T A;  2COM A;  2IXS A;  2Z99 A;  3BG3 A;  3ABL H;  2WAQ N;  5EEH A;  3ZQL A;  1OMI A;  3OYD A;  1SC7 A;  2FX0 A;  3F1B A;  4O3M A;  3VP5 A;  1PP7 U;  3Q9S A;  1SD6 A;  2DBB A;  2XSJ C;  3I59 A;  3IWF A;  3KP3 A;  1XX5 A;  3HRU A;  3W2W A;  3CCE I;  3F6V A;  1YS7 A;  2XGD A;  2YX4 A;  3ONQ A;  5DV5 A;  4Q47 A;  3OYN A;  3UNG C;  2K27 A;  1FY7 A;  1D1A A;  1UHW A;  1TNT A;  3HM5 A;  4NNJ A;  1MBH A;  1TL8 A;  1O3Q A;  3R4K A;  4B4C A;  3CP8 A;  2IS2 A;  1I39 A;  4Y52 J;  4ZC3 A;  3WTU C;  3G56 A;  5JFR A;  2DMQ A;  2QM3 A;  2X4H A;  3OWT A;  2OER A;  2AHQ A;  3FKJ A;  2DA1 A;  1F1Z A;  2QWW A;  2Y48 A;  2JUC A;  1MSF C;  5H6R A;  1R23 A;  4NC8 A;  2VOD A;  4N0B A;  3HHG A;  3MZY A;  1IN5 A;  3VWB A;  1PVE A;  3H36 A;  1FYK A;  3K9T A;  3ON4 A;  2MW8 A;  4OIR F;  4KA4 A;  3ISP A;  4P55 A;  3AL0 C;  2KP6 A;  4PZJ A;  5F1R A;  2VN2 A;  3F3X A;  4WK8 F;  4IHW A;  1IRZ A;  2UXP A;  2DN0 A;  4GDF A;  2ZBK A;  1LFU P;  3HPH A;  2L7F P;  4I02 A;  4LLG F;  4KIB A;  5GPA A;  1PUF B;  4BJ5 C;  2HQN A;  2ZME A;  1MD0 A;  2EFO A;  4L0Z B;  1TW2 A;  3ZMT A;  2GXG A;  4ENN A;  2EZH A;  3M3Y J;  1MMG A;  2AQE A;  1N75 A;  1WFX A;  4CYD A;  1Z7U A;  2LG4 A;  3E7Q A;  3ZN1 A;  5KK1 A;  4F91 B;  2OU2 A;  4MQ9 F;  5CVJ A;  2OA4 A;  1G3W A;  1POG A;  2XAF A;  1FP1 D;  3ABT A;  3M07 A;  4JYK A;  4XOR A;  3RD3 A;  2QEX I;  3PPB A;  1C0W A;  1T0F C;  2XDV A;  4A3F J;  3CCS I;  1TQM A;  1B4A A;  2O7T A;  2PBI A;  4A6E A;  2R5Z A;  1MJA A;  3MKY B;  3GXO A;  4PJ0 C;  5L3F A;  1EKE A;  1YFH A;  1GDT A;  1E0E A;  2ZME B;  3S5R A;  1JHH A;  1CQT A;  4OAZ A;  4ESF A;  3B81 A;  4OMZ A;  3ZMD A;  3GTK J;  3FBN B;  4HF0 A;  3ZMZ A;  3B73 A;  3JRA A;  3VOX A;  4UNO A;  4I2O A;  3AG1 H;  1YO5 C;  4OMY A;  5BNG A;  3PO3 J;  2HKU A;  2DFF A;  1EH8 A;  5IP9 J;  2DOE A;  3I0T A;  4AYB A;  3HOX J;  2E1C A;  1CGP A;  5E1Z B;  3IP4 B;  2VKV A;  1RR8 C;  4ANJ A;  1JJ8 C;  1G6N A;  3V78 A;  2UXO A;  4M73 A;  3LNQ A;  1F9N A;  2WAF A;  1JKO C;  4I76 A;  2KZG A;  3IC7 A;  2B3W A;  3ZN0 A;  3HGG A;  4XRS G;  2ME0 A;  2O8X A;  3V7R A;  4CCO A;  1ENH A;  2R5Y B;  3MFK A;  1J7K A;  1I1S A;  5D1R A;  4PDK A;  5DDG A;  1V5F A;  2XPW A;  5CW8 A;  3H9Q A;  3KLN A;  4M6Y A;  1A31 A;  2K3P A;  3ERE D;  2R5Z B;  1QPI A;  1X3U A;  4FCY A;  2OI8 A;  3LOC A;  2ELH A;  4F3Q A;  4F7Z A;  1T6S A;  4G6T B;  3F23 A;  1JT0 A;  3LSM A;  2REK A;  1MH3 A;  2HOS A;  3WE3 A;  5FB2 A;  3HGY A;  2PX9 A;  2ELK A;  2QVO A;  1U8R A;  2HXI A;  2BY2 A;  3RKY A;  3F8N A;  2K85 A;  4MEY F;  4CCK A;  5EJC A;  3H0G J;  3V8J A;  2DJN A;  2LDU A;  5BPI A;  1LEB A;  4C2M A;  3KZI C;  4CZC A;  2ECC A;  4QLC U;  2K9L A;  2NS0 A;  4OIP F;  2R7R A;  2DFI A;  1XCB A;  5C44 J;  3JRG A;  5IOY A;  3L09 A;  1R9T J;  3E6M A;  4J01 A;  3BJB A;  2CH0 A;  3DXJ F;  2L54 A;  1W36 D;  2WAD A;  2BW3 B;  2ZSH B;  2DT5 A;  2IGM A;  2B9S A;  2VE8 A;  2GM4 A;  4EMS A;  1R22 A;  2NNN A;  9ANT A;  3GO5 A;  2JMW A;  3TO6 A;  3S2W A;  4ESB A;  1U5T A;  2LD5 A;  2KIS A;  1WWX A;  1VQ7 I;  3RQI A;  5B3S H;  2KQR A;  3ABM H;  2HVS A;  2R7V A;  4LGW A;  4OIQ F;  3JAM K;  5FGM A;  3DEU A;  4LIT A;  2G9W A;  3FK7 A;  1YW7 A;  1E3P A;  1K4S A;  2LRD A;  2EV0 A;  4WCG A;  3DPL C;  3IH3 A;  3LAJ A;  5JVG F;  3S1N J;  1AU7 A;  1Y8R B;  4XR6 A;  5TRD A;  2EIK H;  2HWV A;  3KP2 A;  3PUF A;  4UUV A;  1ORK A;  3LA7 A;  2DU9 A;  4CIC A;  3HTI A;  3KZ9 A;  3H35 A;  2LY2 A;  5DAJ A;  4XRF A;  1UI6 A;  4G12 A;  1FNN A;  2FXA A;  2NAZ A;  3HB9 A;  1RUN A;  4AYB N;  4HBL A;  5J3L A;  3E6B A;  4IOA F;  2YX7 A;  2G7S A;  1B6A A;  2DA3 A;  2QUF A;  1NH3 A;  3MN2 A;  1W7P B;  2LF7 A;  1DQU A;  1ACI A;  3GCM A;  4XKC A;  4NQW B;  2OUM A;  3HPG A;  4AUX A;  5HDK A;  4UV9 A;  2O6G E;  1X2N A;  1VQ6 I;  2LR8 A;  3MNL A;  2FQ4 A;  4XOT A;  3BOQ A;  5CPR B;  1W0U A;  3T0Y A;  4KIC A;  4YFN F;  2GA2 A;  4B44 A;  1A04 A;  1SD4 A;  2P81 A;  1EJ9 A;  1LDJ A;  2WGB A;  1MBF A;  2JRT A;  4RGX A;  3OYL A;  5M5X J;  2QTQ A;  3OYB A;  1ETK A;  5TGT A;  3MQ0 A;  2BZT A;  5IT9 K;  4RDU A;  1SVL A;  2XVC A;  1FOK A;  2CQQ A;  5AIP A;  4EJV A;  4BNC A;  2DA5 A;  1QHH D;  4LIV A;  2HQA A;  3CWR A;  1ON1 A;  1P7I A;  1GUU A;  2X6W A;  2PZ9 A;  4M3B A;  2XRN A;  3DBR B;  5E3N A;  3UKG A;  4GCL A;  1OYW A;  3ZQQ A;  1WJE A;  1UAA A;  3JRF A;  2IA1 A;  3MKW B;  2VBW A;  3DKY A;  2LH9 A;  3BLY A;  3BR0 A;  2DA7 A;  4FX0 A;  4MIM A;  3TQN A;  3ROU A;  4B8X A;  5A2Q K;  2A07 F;  4EM1 A;  4UY8 I;  4DBQ A;  2L5Q A;  5FKO A;  2Q24 A;  1IW7 F;  4H0E A;  2ZCM A;  3DV8 A;  1RET A;  1Y0U A;  1T38 A;  3TBI A;  1P4W A;  2XKP A;  3F8B A;  1Z3Y A;  2X6Y A;  2RV8 A;  3I9V 2;  1UG0 A;  4NN1 A;  5CVU A;  3RCO A;  2XAQ A;  2K02 A;  1VF9 A;  2JVG A;  3NQO A;  3KIO A;  1OLT A;  3AG3 H;  5EZG A;  2DMT A;  5TIS C;  2ZJ2 A;  2ZB9 A;  3W2V A;  5L3B A;  1YX3 A;  2ELJ A;  3EET A;  4QPO A;  5E8I A;  3PJR A;  2E5Z A;  5LHG A;  3JRD A;  2L7M P;  1SVM A;  5D8K B;  2ISZ A;  1MW7 A;  2DYR H;  1TWG J;  3N4M A;  3K1N A;  3OIQ A;  1H8A C;  2I5U A;  2KJC A;  3BDD A;  2HPM A;  3HOT A;  3OV8 A;  4RM3 A;  4X0G A;  4MK6 A;  1FWZ A;  5J47 A;  4KJZ A;  1HLV A;  3NAU A;  3LST A;  5D5X B;  1K78 B;  2XPU A;  3FMQ A;  4ENK A;  1RES A;  4F52 A;  3CJT B;  2EV6 A;  2V4J C;  2CQK A;  1K78 A;  1JUP A;  5D19 A;  4EQQ A;  3FZV A;  1GT0 C;  3EYI A;  2E2H J;  3VIB A;  3CUQ C;  3R6S A;  2VPL A;  3ANG A;  3PNV A;  2GWR A;  2BV6 A;  2RC4 A;  5IYB J;  5D8L B;  3RYP A;  3KP6 A;  3Q5F A;  3OYK A;  3ANP A;  5CXI A;  1ZN2 A;  1UZC A;  2BVL A;  1WH5 A;  2M45 A;  1H88 C;  2NVX J;  4KFC A;  4Y3O A;  3DLL F;  1FT9 A;  3HSE A;  2QQ9 A;  5FLX K;  2ZFW A;  1D0Z A;  4A3K J;  4BE2 A;  1BN5 A;  2PMZ N;  4N9H A;  5LLQ A;  1MBK A;  1ZRC A;  1B1B A;  3IRQ A;  2VKH A;  1QNT A;  5LFA A;  3R0A A;  4LLL A;  4L62 A;  1OPC A;  1YW8 A;  2QF7 A;  1OJL A;  3BTL A;  1T08 B;  4GXO A;  4EJW A;  2ZJR F;  1FYL A;  4PFP A;  3KEQ A;  3QOE A;  3HC7 A;  3W6J B;  4BQA A;  2YVX A;  1RPW A;  3F8C A;  5HAW A;  4P96 A;  3CCL I;  3NWT A;  1AKH A;  4BEH A;  1MDM B;  1HOM A;  1HSJ A;  1BI1 A;  4PK4 A;  1VFC A;  3H1C A;  3WGH A;  3A01 B;  5C4Y A;  4IEJ A;  2ZKZ A;  3S3N A;  1RKT A;  3BRO A;  4ETS A;  2EFQ A;  2HOT A;  3PM1 A;  4DNC A;  5H9T A;  3V8K A;  3HZJ A;  4HLX A;  3PIO F;  4KDP A;  1BBY A;  2VE9 A;  3R61 A;  3VVZ A;  2P6T A;  3WOD F;  4I99 C;  4FIS A;  1P7J A;  2JN6 A;  2MFZ A;  3VYT B;  2W00 A;  2DK8 A;  2P8T A;  3V7C A;  3KE2 A;  3OOU A;  4Y15 A;  2IGO A;  5H20 A;  3JR9 A;  4UVC A;  3PQK A;  5CVI A;  3I56 I;  2LF8 A;  1Y8Q B;  4BBR J;  3L2V A;  3FXK A;  1GV2 A;  2A68 F;  3VVX A;  3KKD A;  1GHC A;  2J5P A;  3GEZ A;  4WF2 A;  2HZT A;  2NOG A;  1WKM A;  5LGU A;  1YJN I;  5J1U A;  3CCJ I;  4M6V A;  1YJW I;  3RKX A;  2YU9 J;  2VXZ A;  3FXR A;  3LSI A;  3RKW A;  4HST A;  4BUP A;  2JJ7 A;  5IT3 A;  5J1R A;  1QU3 A;  3PSI A;  1E17 A;  1ODD A;  1IXC A;  2R7Z J;  3NI7 A;  4PXI A;  4NB5 A;  2MA3 A;  1XDS A;  3FXQ A;  2PJR B;  4IHY A;  1SVO A;  2ZXH A;  2CWE A;  4FET A;  2PMH A;  2QKM B;  2F07 A;  2CW0 F;  1BJA A;  4IZZ A;  4D7N A;  1T95 A;  2RDP A;  2WTE A;  2M87 A;  2HDW A;  2H1L A;  2NX4 A;  2DYS H;  4BGD A;  2FBH A;  2GIV A;  2K86 A;  4L5I A;  1LVK A;  3PFY A;  5L3D A;  4XOP A;  2CV0 A;  2PN6 A;  4FAS D;  2R7F A;  5LD2 C;  1VQO I;  4IPA A;  2M4G A;  5DYM A;  1Z0X A;  4LK0 F;  2P5K A;  3TMO A;  2GLO A;  4AM3 A;  2F5F A;  4L5J A;  1FMV A;  3CP2 A;  3HOV J;  2UWM A;  1OYI A;  3I64 A;  1F4K A;  3QP5 A;  2B1E A;  3A03 A;  2OTJ I;  1J2X A;  1QO0 D;  2GEN A;  1LFB A;  3BG9 A;  3K8P C;  3GYH X;  1QVU A;  3W2A A;  2H09 A;  2X48 A;  4YII A;  5HS7 A;  1DGR M;  2Z2S B;  2QEN A;  5L3C A;  2MAB A;  4YIF A;  1X1P A;  4B47 A;  4F92 B;  3EUP A;  1G2H A;  5H2F C;  3DWL E;  1ZGJ A;  2Y30 A;  1MSE C;  2FNA A;  4DIQ A;  2OAZ A;  2IW5 A;  2V6E A;  2V79 A;  4Y33 A;  2N8G A;  3HJE A;  2M2E A;  2E7X A;  1B59 A;  4XNF A;  5AQC A;  3SFI A;  3BTJ A;  5E79 C;  1IC8 A;  1ZR2 A;  4KIT B;  1E3H A;  2OC6 A;  3LHQ A;  1JUS A;  2BOL A;  1FIA A;  3IHU A;  3VSK A;  1VZ0 A;  2X85 A;  3F21 A;  1OCR H;  3F8F A;  3VDX A;  2LKX A;  1MBG A;  3C18 A;  4LB5 A;  2E60 A;  4RGR A;  4ZYD A;  1UEL B;  3K4M A;  5J4V A;  3OR1 C;  4LFU A;  3FXU A;  3LA3 A;  2MD0 A;  2R7O A;  2E35 A;  2PMU A;  2XPV A;  1OCC H;  5GAG J;  1XGS A;  4E7J A;  2BY1 A;  3BRU A;  4XLC A;  2DO7 A;  5IP7 J;  1HW5 A;  1U8B A;  3HTS B;  4F55 A;  5FJ8 J;  3S17 J;  1KQ8 A;  3RTR A;  4RAZ A;  2L4M A;  3D5R C;  1BIB A;  2QCO A;  2XKO A;  1IV8 A;  3BR6 A;  2RNG A;  1M1E B;  4GFL A;  2P4W A;  4RA2 A;  1T0F A;  5BQT A;  1ZGW A;  2DQR A;  1W1W E;  3DQV C;  2M7B A;  4MFD A;  2PLY A;  4ZTF A;  4DJA A;  2D6Y A;  4UUT A;  3S93 A;  2MC4 A;  1NK3 P;  2MH9 A;  3NWS A;  3K4J A;  1P4A A;  1D1C A;  3IRR A;  3DTK A;  4A6D A;  2XAS A;  2XF7 A;  2ME6 A;  1YRN A;  3TL4 X;  2IP2 A;  5E8G A;  3ML6 A;  4HZF A;  5L3E A;  4A3L J;  1LEA A;  1R4M B;  2DT7 B;  1STZ A;  4HG2 A;  4HDU A;  3G4S I;  3G6E I;  5E18 F;  2W48 A;  2OZ6 A;  1TT5 B;  1F36 A;  2STT A;  2XSD C;  3LJL A;  4A3C J;  4M3E A;  3K70 C;  1VTN C;  3I53 A;  4ITV A;  4A3D J;  3COL A;  1FX7 A;  4JOM A;  3D1N I;  2O3F A;  2IU5 A;  2HXO A;  5KVR A;  3BZK A;  2JTV A;  2LSO A;  2UXN A;  1WJF A;  2E34 A;  2KDZ A;  2NNY A;  2H6C A;  2JUG A;  3NNR A;  3G71 I;  3WGG A;  3WGI A;  2Y0M A;  1NK2 P;  3QOD A;  4PGG A;  2I8D A;  1FSE A;  1S8N A;  4PSX A;  1J59 A;  4I0B A;  1R1V A;  2JPC A;  5JHU A;  3HOS A;  2JQ7 A;  1JHF A;  4X1E A;  1DU6 A;  4FE7 A;  3FDY A;  4PJL A;  1HC8 A;  4EV0 A;  3A4C A;  2EFP A;  1R5I D;  4U7D A;  1KON A;  1ZAO A;  2R7D A;  3VW0 A;  2G7H A;  3BZ6 A;  1R5G A;  5CQE A;  2K3F A;  5DD4 A;  4ZYH A;  3K4C A;  2F4M B;  1UB9 A;  3VW1 A;  1I27 A;  2GAU A;  3QYF A;  3OY9 A;  1VQ5 I;  2DG8 A;  5JHF A;  3OSG A;  3LSH A;  4QPQ A;  4DOZ A;  2QZ8 A;  1Z7L A;  4XLA A;  1L0O C; 
#chains in the Genus database with same CATH homology
 1Z77 A;  3NRG A;  4AF5 A;  4XK4 A;  1NTC A;  1R9T J;  5C44 J;  3JRG A;  5IOY A;  4DW6 A;  5CXG A;  5HBU A;  2TRT A;  3BJB A;  3A02 A;  5F0F A;  3T6N A;  2GM4 A;  2X9D A;  2UXH A;  9ANT A;  4J19 A;  4D7M A;  4A3I J;  2JMW A;  4FE4 A;  2MG4 A;  2LD5 A;  3BG5 A;  1WH7 A;  2QIB A;  4BKX A;  2RAE A;  3RQI A;  1UG2 A;  5C3E J;  3HOY J;  2CRG A;  1MNM C;  2JA8 J;  1BW5 A;  3RH2 A;  4ACI A;  1SAN A;  2DA2 A;  3FK7 A;  4MLO A;  4BY7 J;  3BHQ A;  2DG7 A;  2HQ5 A;  1MBJ A;  1OCP A;  3IH3 A;  2G7G A;  3S1N J;  3Q0V A;  5FLM J;  5EEA A;  1IV6 A;  1AU7 A;  1Q1V A;  3GTM J;  3LSJ A;  2AO9 A;  3DEW A;  3NXC A;  2RHA A;  3B6A A;  1IJW C;  4FTH A;  1ORK A;  5EGO A;  2EZI A;  1MH4 A;  3HTI A;  3C2B A;  3IV5 A;  2VI6 A;  3BR1 A;  4A93 J;  3KZ9 A;  5DAJ A;  1UI6 A;  5F04 A;  1ETY A;  4G12 A;  2UXU A;  3VUQ A;  3HB9 A;  3CRJ A;  4V2G A;  1K83 J;  4GFK A;  3S2H J;  4AYB N;  2UXI A;  1JKR C;  3AQS A;  3P9T A;  5J3L A;  1I6H J;  2G7S A;  2DA3 A;  4XID A;  3MN2 A;  4I6Z A;  3FIS A;  3G1O A;  2GFN A;  2VPR A;  1XS9 A;  2R93 J;  4JX5 A;  3ZQC A;  2K9Q A;  4AUX A;  3EGQ A;  1VI0 A;  1X2N A;  3TED A;  3L1P A;  1WI3 A;  2LR8 A;  3MNL A;  2FQ4 A;  2EZL A;  4QTR A;  5K58 A;  3B6C A;  1FIP A;  1W0U A;  5F0C A;  3HOU J;  2MGQ A;  5FMP A;  1JKQ C;  2EQR A;  3HIM A;  2XDN A;  4M3G A;  1VND A;  2P81 A;  5F1J A;  2K40 A;  5FKM A;  2O9L A;  3HBL A;  1MBF A;  2CUE A;  2R5Y A;  3GTP J;  3BTI A;  5F27 A;  2WGB A;  3S1M J;  5FGL A;  4C3I J;  3LSR A;  2G0E A;  5M5X J;  2QTQ A;  4AC6 A;  4BBS J;  1ETK A;  1JUM A;  5IPA A;  3QQA A;  4XRS A;  4RDU A;  3JSJ A;  4M3D A;  1ZK8 A;  3K2A A;  2PBX A;  5D18 A;  4D5F A;  2CQQ A;  4A3J J;  1GV5 A;  2DA5 A;  2DTZ A;  3JRC A;  3GTL J;  2O8K A;  3CWR A;  5FKL A;  5FKK A;  1P7I A;  1A6I A;  1GUU A;  3VPR A;  5J1Y A;  3S15 J;  2PZ9 A;  2KT0 A;  2DA4 A;  4M3B A;  1BW6 A;  5E3N A;  3UKG A;  2CQX A;  4GCL A;  1APL C;  2OPT A;  3JRF A;  2E2I J;  3W6V A;  3G1M A;  3BR0 A;  2DA7 A;  4A3E J;  3BCG A;  4MIM A;  4W1U A;  5FKO A;  2Q24 A;  5F08 A;  2W53 A;  5C4J J;  1QRY A;  2DMN A;  2ZCM A;  1RET A;  1B8I A;  2ID6 A;  3I4N J;  4NN1 A;  2CUF A;  2K9N A;  4L5E A;  2L9R A;  1TWC J;  3HDD A;  3VVY A;  1IUF A;  1VF9 A;  4CYC A;  2HI3 A;  2G7L A;  2X6O A;  2GUH A;  2LTP A;  5EZG A;  3GTQ J;  1UMQ A;  4JL3 A;  2DMT A;  3S2D J;  1B72 B;  2ZB9 A;  2FD5 A;  4MFE A;  4DYC A;  2M9H A;  2QKO A;  4GFB A;  4M3F A;  3QBM A;  4IHX A;  4EEF G;  2K9S A;  3FRQ A;  1K61 A;  2DMP A;  1SGM A;  5F0H A;  3JRD A;  1X2M A;  3TP3 A;  2L7M P;  4C3H J;  3S1R J;  4V2F A;  1T56 A;  2NP3 A;  2EZK A;  1TWG J;  1WPK A;  1E3O C;  2R92 J;  1H8A C;  3LWJ A;  5M3M J;  3G1L A;  2ECC A;  5HOD A;  5EGO B;  5EG0 B;  4MK6 A;  2E2J J;  1HF0 A;  1HLV A;  1LE8 A;  5EDN A;  3NAU A;  4IHV A;  2H1K A;  2XPU A;  5GP9 A;  2ID3 A;  1RES A;  3HKZ N;  1Y1W J;  1RKW A;  3HEF A;  2O7O A;  4QSH A;  1JJ6 C;  2NP5 A;  3GZI A;  2HDD A;  1JUP A;  4DYQ A;  2NS7 A;  1GT0 C;  1F43 A;  3BT9 A;  5M3F J;  1FTZ A;  2E2H J;  2V57 A;  5D19 A;  3ZQH A;  5FKN A;  3O60 A;  3VIB A;  5HSZ A;  5M5W J;  3ANG A;  1ZKG A;  3ZQG A;  3FIW A;  5IYB J;  2WUI A;  5CXI A;  3NPI A;  3ANP A;  1S7E A;  2NS8 A;  5M5Y J;  1ETX A;  1U78 A;  1AHD P;  1UHS A;  4A3G J;  1WH5 A;  4XIC A;  4Y7N J;  1ETQ A;  3K7A J;  4DZP A;  1H88 C;  2NVX J;  1YRN B;  4JKZ A;  3PAS A;  5FLV A;  3HOW J;  1MBE A;  5C4X J;  1B8I B;  2JA7 J;  5IOZ A;  1ZQ3 P;  4AC0 A;  3KKC A;  1I50 J;  3NAR A;  2VKE A;  4A3K J;  2Y31 A;  1UI5 A;  2PMZ N;  2CU7 A;  3OSF A;  1MBK A;  1ETV A;  2M34 A;  3LSP A;  2YVH A;  3GBG A;  3TP0 A;  3CDL A;  4HNV A;  2D5V A;  4L62 A;  1WGX A;  2QF7 A;  1OJL A;  3BTL A;  3AQT A;  1U9N A;  3FK6 A;  1RPW A;  1RR7 A;  5HAW A;  1PUF A;  5DTD A;  1AKH A;  4MXM A;  1W0T A;  4S0H B;  2R0Q C;  4YZE A;  1HOM A;  1VFC A;  2Y2Z A;  3A01 B;  5C4Y A;  4IEJ A;  1RKT A;  3M4O J;  3H3V K;  1IG7 A;  4NEL A;  2HOT A;  3PM1 A;  5H9T A;  2XGC A;  3O8G A;  4UUS A;  3VVZ A;  2MSY A;  2TCT A;  3CJD A;  3RKQ A;  2HOA A;  2HYJ A;  4RBO A;  2WB1 N;  3HE0 A;  1QVT A;  1ETW A;  3TW7 A;  2E1O A;  4A69 C;  4FIS A;  1P7J A;  2JN6 A;  3Q0W A;  3ON2 A;  1B72 A;  4MO7 A;  4D5C A;  4DZJ A;  3OOU A;  3S16 J;  3JR9 A;  5EZH A;  4BBR J;  1XG1 A;  1GV2 A;  3VVX A;  4UUS B;  5FHP A;  3KKD A;  5DS9 A;  3KNW A;  5EF6 A;  4ICH A;  1JTY A;  3PO2 J;  1FJL A;  2QWT A;  2NOG A;  3S1Q J;  5J1U A;  3MVP A;  1ZTR A;  4M6V A;  5K7H A;  2YU9 J;  4GCK A;  2DMU A;  3WHC A;  2ZCX A;  2JJ7 A;  1BL0 A;  1JKP C;  4ABZ A;  5J1R A;  5IYC J;  1ZR4 A;  3I4M J;  3VOK A;  5EFY A;  3S14 J;  2NVY J;  3BR5 A;  3GTO J;  2R7Z J;  3NI7 A;  4PXI A;  3TW6 A;  4JX6 A;  3CMY A;  2ECB A;  4IHY A;  3BQZ A;  4B1R A;  2F07 A;  3DPJ A;  4D7N A;  3GTG J;  2JA5 J;  2NX4 A;  2XB0 X;  1HDD C;  2H8R A;  1D5Y A;  1DU0 A;  3E7L A;  5K7F A;  1HDP A;  1TWH J;  4LOC A;  2L7Z A;  2FBQ A;  1Z0X A;  4C2M J;  2IAI A;  5EG0 A;  2CJJ A;  2XRL A;  4DYR A;  2GLO A;  4HKU A;  4JX4 A;  2IEK A;  5E3L A;  4ME9 A;  2Y9Z A;  3HOV J;  4W97 A;  1IGN A;  1JGG A;  3JRI A;  5K7Z A;  3JRB A;  1TC3 C;  3VW2 A;  1GVD A;  2IBD A;  3A03 A;  2JA6 J;  3BG3 A;  5IP6 A;  2WAQ N;  2GEN A;  3FKI J;  2ZOZ A;  1LFB A;  3BG9 A;  3ZQL A;  1QVU A;  2FX0 A;  1IDZ A;  3F1B A;  2X48 A;  3IUV A;  1OFC X;  2VUM J;  2I10 A;  1H89 C;  3VP5 A;  3RZO J;  2ZCN A;  1G2H A;  3EUP A;  1MSE C;  2Y30 A;  2XGD A;  1LE8 B;  2N8G A;  2YUS A;  2EBI A;  4CGR A;  2M2E A;  3HM5 A;  3QPL A;  1MBH A;  3SDG A;  5AQC A;  4C3J J;  3SFI A;  3BTJ A;  2QOP A;  4B4C A;  1TWF J;  4Y52 J;  3QPS A;  1IC8 A;  3JRH A;  1ZR2 A;  2YS9 A;  3G56 A;  2DMQ A;  4JP0 A;  3LHQ A;  1JUS A;  2OER A;  2B63 J;  2AHQ A;  1FIA A;  1JTX A;  2DA1 A;  5EYR A;  5GPC A;  1MSF C;  2LKX A;  1MBG A;  1FEX A;  1ITY A;  1T33 A;  2M0C A;  3Q3S A;  3BQY A;  5E3O A;  3C07 A;  3DCF A;  1BA5 A;  4B3A A;  1ETO A;  3ON4 A;  2MW8 A;  2NVT J;  2XPV A;  3JRE A;  1Y1V J;  3BRU A;  1IRZ A;  4IHW A;  2UXP A;  3Q0U A;  2DN0 A;  5IP7 J;  1U8B A;  2WV1 A;  2LK2 A;  3G7R A;  1LFU P;  5FJ8 J;  2L7F P;  2RAS A;  5GPA A;  1PUF B;  1AKH B;  3S17 J;  3HTJ A;  4KWA A;  2QCO A;  3HTH A;  3BR6 A;  2LLK A;  3IH2 A;  2XB5 A;  4GFL A;  2EZH A;  3M3Y J;  2G3B A;  3E7Q A;  3HTA A;  1IDY A;  3BR2 A;  4BY1 J;  1ZGW A;  1FTT A;  1POG A;  4JYK A;  2LVS A;  1XC5 A;  3BR3 A;  3LSG A;  2NVQ J;  3RD3 A;  2ZOY A;  4MFD A;  3CQZ J;  3GEU A;  2D6Y A;  3PPB A;  1WCM J;  4UUT A;  1SFO J;  3ZQI A;  4A3F J;  1NK3 P;  2O7T A;  2R5Z A;  4QIW N;  3RZD J;  4X6A J;  2COB A;  2XGE A;  2ME6 A;  1GDT A;  1YRN A;  1EF4 A;  3S5R A;  1CQT A;  2LFB A;  3ZOB A;  4A3L J;  3B81 A;  3MKL A;  5IYD J;  3GTK J;  2Y0S N;  3A01 A;  4UDS A;  3JRA A;  3VOX A;  3HOZ J;  4NDL A;  2W48 A;  3WHB A;  2E19 A;  2HYT A;  1F36 A;  4A3B J;  2XSD C;  2L0K A;  3LJL A;  5BNG A;  3PO3 J;  2HKU A;  4A3C J;  3OIO A;  4M3E A;  5IP9 J;  3HOX J;  3SJM A;  4JNN A;  1U9O A;  2VKV A;  1JJ8 C;  3V78 A;  4A3D J;  2LP0 A;  3LNQ A;  2UXO A;  3COL A;  3D1N I;  1JT6 A;  2IU5 A;  1JKO C;  4I76 A;  2HXO A;  1HCR A;  5JLX A;  2KDZ A;  2OF7 A;  2DA6 A;  4A3M J;  5E3M A;  3ZQF A;  2M8G X;  3HGG A;  4XRS G;  5JLW A;  2ME0 A;  3NNR A;  1O4X A;  3BTC A;  1ENH A;  2R5Y B;  2YVE A;  1NK2 P;  1BJZ A;  5D1R A;  4CYC B;  2JWT A;  2XPW A;  5CW8 A;  2Y9Y A;  2R5Z B;  3F0C A;  4X1E A;  4FE7 A;  4FCY A;  1QPI A;  1DU6 A;  2OI8 A;  3LOC A;  4GCT A;  1JT0 A;  2REK A;  1MH3 A;  2HOS A;  3QKX A;  3HGY A;  1TWA J;  2FJ1 A;  2ELK A;  3CCY A;  3VW0 A;  2LY9 A;  3V6G A;  2HXI A;  4BXX J;  1A5J A;  4XRM A;  1OCT C;  2GBY A;  1I3Q J;  3VW1 A;  3H0G J;  2DG8 A;  2DJN A;  1X58 A;  3OSG A;  2EH3 A;  3GTJ J;  3O8H A;  3IH4 A;  3BNI A;  2JK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...