3FIWA

Structure of sco0253, a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
173
Chain Sequence
KMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAEIDHESAFEAGLALITDGLVRHVDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title Structure of SCO0253, a Tetr-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription regulator
total genus 56
structure length 173
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fiwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3fiwA02
3BCGA 3E7QA 4B4CA 3NNRA 2EZHA 3BR0A 5C4JJ 3BG5A 2Y31A 3K7AJ 2LFBA 2HI3A 2MW8A 1K83J 2K9SA 3QPSA 3TW7A 4JYKA 2LD5A 2JA5J 4A3CJ 2RAEA 2FX0A 2XPUA 2KT0A 3LSPA 5EZGA 2HXIA 5F08A 3HTIA 3K2AA 4M3GA 4BY7J 3MKLA 3A03A 4QSHA 1XC5A 2HXOA 3DEWA 1VF9A 1OJLA 2OERA 1SGMA 3NARA 2F07A 2RASA 1IV6A 3NAUA 1LFBA 2ZB9A 1ZGWA 3O8GA 1GVDA 2DMUA 5FMPA 3MVPA 3NXCA 2IU5A 1Y1WJ 5H9TA 4A3GJ 1UMQA 2W48A 1YRNB 3W6VA 1GT0C 4A3JJ 4NDLA 4CYCA 3JRGA 2NS8A 2WV1A 4KWAA 2MG4A 1P7IA 3HOWJ 2B63J 4Y52J 2R5ZB 3G1MA 4BXXJ 5C44J 1HDPA 3LJLA 2GFNA 4DYCA 3HEFA 1QVTA 1Y1VJ 2DTZA 2ECCA 3TP3A 2R5YB 2HOTA 2R93J 2IAIA 4A3DJ 3SFIA 1ETWA 2EBIA 2Y9YA 1PUFB 3VW2A 3DPJA 2YVHA 3ZQLA 2JA6J 3E7LA 1AU7A 3T6NA 2UXHA 4X1EA 4V2FA 3MNLA 2DMPA 3HOVJ 2M34A 4BBSJ 1R9TJ 1ENHA 2E1OA 5F27A 3NPIA 2CUFA 2O9LA 2ECBA 2QIBA 3ZQCA 3CCYA 3HOZJ 1ORKA 2DA6A 3FKIJ 2NVTJ 5M3FJ 3HM5A 3FRQA 3QQAA 5IP7J 2DG8A 4RBOA 3Q0UA 4IHWA 5BNGA 4BY1J 5FKLA 3CDLA 3JR9A 2WAQN 2L7FP 5GPAA 5DAJA 1FTTA 1MNMC 4Y7NJ 3HOUJ 2E2IJ 2XPVA 4C3HJ 3WHBA 1K61A 5F04A 2VKEA 1HLVA 1IDYA 5IP6A 3COLA 1IUFA 1WGXA 2JJ7A 1D5YA 5HODA 3G7RA 1ITYA 5J3LA 2L7ZA 4A3BJ 4IHXA 1RPWA 1U9OA 4JX5A 4V2GA 4JNNA 2XGCA 4J19A 3D1NI 2GENA 3BTIA 1NTCA 3BT9A 3GTOJ 2D5VA 1AHDP 5CXIA 4D5CA 5E3NA 4JL3A 3SJMA 4IHVA 2M9HA 3VOXA 3B81A 4AF5A 1JKOC 4JP0A 1T33A 3JRFA 5IYDJ 4ICHA 4XK4A 1HF0A 3S17J 4JKZA 1ETOA 1B72A 2R92J 1MBHA 4X6AJ 4M3BA 2DMNA 1JGGA 3Q0WA 5FLMJ 2M8GX 2CRGA 1U8BA 3BQZA 4A3KJ 4XIDA 1FIAA 1FEXA 4C3IJ 3JRIA 2UXUA 2DA1A 2Y30A 1JKRC 2Y9ZA 2ZOYA 2CQQA 5FKKA 1JUMA 1ZTRA 3GEUA 2DG7A 5M5XJ 3VW1A 4GFKA 3LSGA 2K9QA 5EFYA 5FJ8J 1VNDA 3BQYA 2ID6A 2JN6A 2XDNA 2ZOZA 2QTQA 5FGLA 4MLOA 3RH2A 3HDDA 3WHCA 2UXPA 2LTPA 1P7JA 2XGDA 2FBQA 3S1NJ 4GFLA 1QRYA 2NP5A 3PO3J 4CYCB 4UUSB 5HBUA 1JJ6C 4MK6A 2DA3A 4NN1A 1Z0XA 3C07A 1UI6A 1UG2A 5EDNA 3CRJA 1JTYA 2DA4A 5JLXA 2LKXA 3S15J 3B6AA 3SDGA 5HAWA 4FCYA 1GV2A 1T56A 4G12A 3JREA 3KKDA 3VP5A 3IH4A 2PBXA 4B1RA 3HTHA 4PXIA 5K7HA 1JUSA 2REKA 1JKQC 2Q24A 2HQ5A 2EH3A 5F1JA 1MBKA 2XSDC 3RQIA 2EQRA 5IOYA 1EF4A 2R0QC 3DCFA 4DZPA 3L1PA 1BW6A 4UUSA 3A02A 2OF7A 4D7MA 1RR7A 2CUEA 2DA7A 1MH4A 3BTJA 4DYQA 1A5JA 1UI5A 2NVQJ 3BR3A 3OIOA 2GM4A 3LSJA 4W97A 2TCTA 5EG0A 2LVSA 3JSJA 2RHAA 2DJNA 2VUMJ 1U9NA 1XG1A 2HOAA 3CMYA 1RKTA 5CW8A 2HYTA 4IEJA 4IHYA 2IEKA 3GTMJ 3GBGA 2LK2A 5IOZA 3S2HJ 2HDDA 3CWRA 1TWFJ 4AUXA 1LFUP 3UKGA 3RKQA 3H0GJ 3IH3A 3F0CA 3EUPA 2VKVA 4GCKA 3H3VK 1QVUA 1ETVA 3TP0A 3QPLA 1MH3A 4XRSA 5CXGA 5D19A 2KDZA 2PZ9A 1ETQA 4XRMA 3VVZA 3LHQA 1O4XA 4DW6A 2GUHA 5J1YA 1F36A 5FHPA 5M5WJ 1IDZA 1SANA 2DMQA 3BR6A 2NP3A 3OSFA 1I50J 1JT0A 3VPRA 3M3YJ 3G1OA 2UXOA 3V6GA 1NK3P 4GCTA 1B72B 4JX4A 1G2HA 1VI0A 2ZCMA 1TWHJ 2VI6A 4DYRA 1FJLA 4BKXA 3A01A 2FQ4A 3RZDJ 3P9TA 1X58A 2LLKA 1A6IA 1APLC 3I4MJ 2G0EA 2O7OA 1HCRA 3HIMA 1IC8A 3RD3A 2M2EA 4XRSG 5FKOA 2Y0SN 5E3LA 5M5YJ 2AHQA 2CJJA 3KKCA 2QWTA 3PASA 5IPAA 4MIMA 3BHQA 2QCOA 3BTLA 1WH7A 5EZHA 5K7FA 3BTCA 4A3LJ 1ETKA 1LE8B 1RETA 2NS7A 4ME9A 2G7GA 1ZQ3P 1CQTA 3CQZJ 3G1LA 4M3EA 1FIPA 1UHSA 3QBMA 3S14J 3M4OJ 3LWJA 1RESA 2LR8A 1RKWA 3CJDA 5J1RA 4FE7A 4MFDA 2UXIA 3BG3A 3KZ9A 3PPBA 3I4NJ 1ETYA 4XICA 3PO2J 2QKOA 4FISA 4QIWN 5EEAA 1GDTA 2WGBA 1I3QJ 4HNVA 3OOUA 3BR1A 1LE8A 2EZKA 5DS9A 5M3MJ 1BL0A 2YUSA 3LSRA 4FTHA 2CQXA 3JRBA 2QF7A 3QKXA 4MXMA 1X2MA 4A3EJ 2DMTA 1ZK8A 2N8GA 3HOXJ 5C4YA 3HOYJ 3HGGA 2G7LA 2W53A 1MSFC 2H8RA 2K9NA 1MBJA 1Q1VA 3OSGA 1B8IA 3GTGJ 1MBFA 2E19A 5EGOA 2PMZN 3TEDA 1H88C 1OCTC 3ANGA 4W1UA 4I6ZA 2EZIA 1WH5A 5C3EJ 2YS9A 2JMWA 3BR5A 4C3JJ 3JRCA 5EG0B 3MN2A 2NVYJ 2LP0A 1F43A 2JA8J 5DTDA 3GZIA 1VFCA 4A3FJ 3HTJA 4MO7A 1I6HJ 2L7MP 2X6OA 2FD5A 4A93J 3LNQA 2DA2A 3S5RA 3FK7A 2XGEA 5EF6A 3JRDA 2GLOA 2HKUA 2ZCNA 1JJ8C 1ETXA 4HKUA 3B6CA 2I10A 2IBDA 1IG7A 2HOSA 4M3FA 2D6YA 2GBYA 5D1RA 2WUIA 2Y2ZA 3LOCA 3TW6A 3JRAA 1QPIA 3VIBA 2COBA 3GTJJ 5JLWA 4I76A 1MSEC 3GTLJ 5E3MA 2G7SA 1U78A 1BA5A 1NK2P 2JWTA 1E3OC 4ACIA 3PM1A 4A69C 1ZR4A 5EYRA 3F1BA 4NELA 2ZCXA 1IJWC 3EGQA 1TC3C 2XPWA 2H1KA 3V78A 4A3IJ 3GTKJ 2G3BA 2V57A 5AQCA 2XB0X 4FE4A 2X9DA 5J1UA 3A01B 1HDDC 4L62A 2OI8A 3BNIA 3VUQA 4RDUA 3IV5A 4MFEA 2E2HJ 3GTPJ 1WCMJ 4EEFG 2EZLA 4LOCA 3HTAA 5F0CA 4L5EA 5F0FA 1W0TA 1H89C 2XB5A 5FKNA 5IP9J 3AQTA 3ON4A 3Q3SA 3IH2A 3S16J 3VVYA 3AQSA 2DN0A 3ZOBA 5K58A 1JUPA 2X48A 3HKZN 3GTQJ 1TWGJ 4A3MJ 1YRNA 5D18A 1AKHB 5FLVA 1MBGA 1JT6A 4C2MJ 1X2NA 2JA7J 3S1RJ 3S2DJ 3FIWA 3IUVA 1WPKA 3BR2A 4AC6A 2ME6A 2R5ZA 1IGNA 3KNWA 3VW0A 3NI7A 1GV5A 3ON2A 2NX4A 1XS9A 3RZOJ 3ANPA 2FJ1A 3C2BA 2DA5A 2R5YA 1FTZA 3NRGA 1H8AC 3S1QJ 1TWCJ 1Z77A 1BW5A 3ZQFA 1JTXA 4UDSA 1DU0A 3HGYA 1PUFA 4B3AA 1OCPA 4BBRJ 2M0CA 4D7NA 5GP9A 3G56A 4CGRA 3BG9A 1AKHA 4AYBN 3JRHA 3O60A 2O8KA 2XRLA 1SFOJ 1OFCX 1JKPC 4D5FA 3HBLA 4S0HB 4DZJA 4QTRA 2CU7A 1ZR2A 2ME0A 4ABZA 2YU9J 3Q0VA 4M3DA 2L0KA 3FK6A 1HOMA 5K7ZA 3ZQHA 2TRTA 3S1MJ 2LY9A 5GPCA 2NVXJ 2WB1N 3FISA 2VPRA 1MBEA 2YVEA 2QOPA 1B8IB 2OPTA 2O7TA 5EGOB 4JX6A 1BJZA 5FKMA 1IRZA 2K40A 1WI3A 1DU6A 9ANTA 5F0HA 3VVXA 4AC0A 5C4XJ 4M6VA 2MGQA 3ZQIA 2AO9A 5IYCJ 4GCLA 2P81A 2MSYA 2L9RA 3VOKA 2NOGA 3BJBA 4YZEA 1POGA 2JK3A 3O8HA 1S7EA 5HSZA 2ELKA 3HE0A 3BRUA 5E3OA 1TWAJ 1ZKGA 5IYBJ 3HB9A 2R7ZJ 2E2JJ 4UUTA 3ZQGA 2HYJA 4GFBA 2ID3A 1GUUA 1W0UA
chains in the Genus database with same CATH superfamily
4KMFA 3NEUA 2FEZA 3E7QA 3NNRA 3EQLF 2EZHA 2KIUA 2K9MA 2KJBA 2Y31A 3ZN1A 4IZZA 1R49A 1NG7A 2HPIA 3QPSA 3DEEA 5TGTA 5JVGF 2GXBA 3LSPA 5J8CA 5EZGA 3HTIA 3A1YA 4M72A 1TW2A 4BJ5C 3AKZA 1XC5A 2HXOA 3DEWA 5HDNA 1VF9A 1X1DA 4KUMA 3JSOA 4NC8A 3CCUI 1SGMA 3AFHA 3BCAA 4WK8F 2K86A 4UV8A 3NARA 1IV6A 2IXSA 5F6FA 1FPQA 1TP4A 2DT7B 3MVPA 1MMDA 2IU5A 1Z1DA 3IKVA 1ZLJA 4ETSA 1X1CA 2EFQA 4U9LA 1WRJA 2G9WA 1YITI 3P9IA 3L2CA 4NDLA 2NS8A 4HF2A 2XV4S 4U9NA 3KZYA 3H5RA 2R5ZB 4PZJA 2DBBA 1HDPA 4AVPA 3G4SI 3LJLA 2J5PA 2GFNA 5J6XA 3RKWA 1LDJA 3HEFA 2XDNA 2R93J 3VDXA 1VQLI 3SQNA 3HHGA 2JVGA 1QZZA 3FM5A 3KE2A 4RM3A 1ETWA 4ASNA 1MNDA 3SHFA 3U21A 2LDUA 2UUZA 1UAAA 4XONA 2R7TA 2E60A 2DPDA 3EUAA 4UB6C 1SAUA 3SDBA 3LMMA 1ENHA 3GCMA 2VQGA 3TDZC 3GLXA 1T2KA 2QIBA 3HOTA 1R5HA 3ZQCA 3CCYA 3M8EA 4LIUA 3W2VA 3BZKA 3FKIJ 2NVTJ 5M3FJ 4EM0B 3F9KA 1K4TA 2XHKA 2MABA 4H0EA 1BR1A 2WY8Q 3JTHA 4RBOA 4IHWA 3MMYB 5FKLA 2XAGA 2FBHA 3DPUA 1XX5A 1MNMC 3CCEI 4C3HJ 3BZ6A 2STWA 2R4GA 2O03A 1YX5A 2XGXA 1B59A 2X51A 4Z2YA 4B48A 1HLVA 4BH9A 1FYKA 2V6EA 1WSUA 1D5YA 4A6EA 4UVCA 3R4KA 1YOVB 4B3XA 1UG0A 2WADA 2VXZA 4JX5A 3QPHA 4JNNA 3AG2H 1K78B 4CCKA 2OAZA 2BXYA 2B3WA 1JHHA 4KIGA 1X3WB 3DKWA 4G94A 2JA2A 4JP0A 1T33A 1HF0A 4XKBA 5IT9Z 2R92J 4BQNA 4X6AJ 3FZVA 1G3YA 3Q0WA 4JBAA 2X6YA 4LK0F 2CRGA 1MMNA 3RPUA 4RB0A 4G8XA 4A3KJ 4XIDA 4MQ9F 5D6FA 5D8LB 2JPBA 1V3FA 5LHHA 2Y9ZA 1FSHA 1JUMA 4DNCA 1SFUA 1VQ4I 2KRHA 4M6YA 1KU9A 3V7CA 2Z1DA 5FJ8J 2M3AA 2CH0A 2RNJA 2ID6A 2JN6A 3ABMH 2ZOZA 2BGCA 5FGLA 1LUJB 5L3FA 4MLOA 1QHHD 2XASA 2FRHA 1XGNA 3A4CA 3SZGA 3E1SA 4U7BA 5D4SA 2LTPA 1DGRM 3CO7C 4ENJA 4Q5SF 2QLZA 1I5ZA 1E2XA 1IXSB 4HF1A 4YEJA 1QRYA 3PO3J 3CMMA 3HRTA 4LK1F 4KJZA 1LFPA 5CVIA 2VODA 1FSEA 3ROUA 4RGUA 3DFGA 3PSFA 1EKEA 1ZG1A 2HDCA 5EDNA 3CRJA 1M1EB 3S15J 2RKHA 2LKXA 2K02A 4A5MA 3DPTA 3B6AA 2Y75A 2CFOA 1HXDA 2RQQA 4FCYA 1GV2A 1T56A 1K79A 3JREA 1HW5A 3VP5A 2WV0A 2PBXA 4B1RA 3G2BA 1FBUA 3HTHA 4WCGA 2VE9A 2HQ5A 3WTSC 1L0OC 1D1CA 2BW3B 4HAMA 5TRDA 4B44A 1MBKA 3CD6I 2XSDC 5IOYA 1EF4A 3DBHB 4RMNA 4ZYEA 3JAMZ 3CUOA 3H5AA 1OCZH 1TL8A 1BW6A 3TGNA 2KRCA 3A02A 2OF7A 2FBKA 4RGXA 2G7UA 1VQ5I 1MH4A 4ZTFA 2X1CA 4Z6YA 4L5IA 3BZCA 2MLKA 3G6EI 3KIOA 2DDBA 4W97A 3K0LA 1MW7A 3JSJA 2DJNA 2QGUA 4XORA 3E6DA 4YFKF 2VUMJ 1XG1A 2HOAA 2A6HF 3EPZA 1RKTA 5CW8A 2HYTA 1IZ1A 1C0WA 1LEAA 2V1XA 2IEKA 3GBGA 1FZPB 2HDDA 3V8KA 1FYMA 1T08B 4EJTA 1X4OA 3QRFF 3CF2A 1ZRCA 1DP7P 4J01A 2YSRA 2M7AA 2VKVA 2STTA 4OMZA 1ETVA 3TP0A 3J80K 5D19A 2MH9A 5BOXA 5LRRA 3MAJA 1LDDA 4I0AA 1U5TC 5FHPA 2E35A 4WIBA 1IDZA 2GOXB 3KZIC 1EV7A 2UZKA 1I50J 3FBIB 1DGWY 3M3YJ 4CGZA 1NK3P 2HKOA 4A0XA 1B72B 4ZDOA 4ZH4F 1VI0A 1G2HA 3WTUC 4DYRA 4M6XA 2R7DA 4WXHA 2GXGA 1ZRDA 1N75A 1O3RA 1PP7U 2LLKA 1A6IA 5FGMA 3J7YJ 2HVQA 5DD4A 2LKSA 2LNBA 2ZNYA 1T98A 2W7NA 1MMSA 1IC8A 1MJBA 2X0LA 3H36A 5FKOA 2AHQA 2VKDA 3LQQA 4XQFA 2YR2A 2FUG2 3HPGA 4AVZA 3FXLA 1LVKA 3PIPF 5D6EA 5E18F 2BE5F 1Z6TA 1ZQ3P 1R7JA 5E1XA 4H4KC 2RV8A 2FA5A 3BROA 3M4OJ 1KA8A 4IRVA 3CCVI 1K7AA 3U1DA 4IQ4A 1D1BA 1TQMA 4FE7A 3N4MA 1J5YA 3BG3A 3KZ9A 3PPBA 3I4NJ 1ETYA 3G3ZA 4XICA 4G6TB 1X19A 3DTIA 1I3QJ 4B8XA 1FMVA 3BR1A 3E0JB 4NC7A 5DEQA 2CW0F 1SD7A 4KISA 2YUSA 3VSLA 4IVNA 4EV0A 3A0BC 2X6XA 2A69F 3V4GA 2BZTA 4CICA 1OYIA 5LGUA 3F23A 1J2XA 2QF7A 2DMTA 2N8GA 4WXDA 4MTDA 3F6OA 3HOXJ 4LG3A 3C2HA 2JTVA 4Q48A 4ENKA 3ABKH 3RJPA 2E1MB 2G7LA 2W53A 2O8XA 2H8RA 2K9NA 4CCJA 4CO8A 1MBJA 3RPQA 4RB2C 1YI2I 1ZLKA 2GOMA 2E19A 1H88C 3TEDA 1IN4A 2M4KA 1SMTA 2DOAA 2BVMA 3BR5A 4PFOA 4DQ2A 5EG0B 2VKHA 4LLGF 4HW0A 5KAIC 1WJFA 3C3WA 1QBJA 4A3FJ 2ETHA 3J7ZI 1J0RA 2A6EF 3SWHA 2FD5A 3ASNH 3T1BA 4JQFA 4U0WA 1ZRFA 2A3SA 4A93J 1ZGJA 2V6CA 3TMOA 3FK7A 2XGEA 2HKUA 3JRDA 2ZCNA 2EIKH 4MEYF 4BU2A 4Y33A 1TW3A 4V19K 3K4NA 2HOSA 3EUHC 2FU4A 1W7PB 2DK5A 3TW6A 1EA3A 3JRAA 3GTJJ 4I76A 4KIFA 1UJ8A 2G7SA 1U78A 2PFVA 2ZXJA 2VC1A 4I99C 3P7NA 2V4JC 1N77A 4ACIA 2WY7Q 1ZR4A 4B43A 3U2RA 5FB2A 1BM9A 3V78A 3QP5A 3H3ZA 3LSMA 4A3IJ 1HBXG 4MGRA 4HLYA 3BCBA 1YFHA 3JCUC 4KT5C 4L62A 2PQ8A 3DPLC 3JSPA 2L4AA 2E2HJ 3GTPJ 2RC4A 4YRVA 1W7PA 4P96A 2EZLA 3HTAA 3L2WA 4L5EA 3IP4B 3HIFA 2XB5A 3ON4A 1IN7A 3GF2A 2P4WA 2DI3A 2Q1ZB 4IOAF 2DT6A 4PSXA 3VWBA 5HDGA 3HKZN 4ESJA 4G6QA 3LA7A 1AKHB 4ZYGA 1YW7A 1VQPI 4M73A 3PFIA 1XGSA 3S1RJ 5H20A 3BR2A 1EH8A 1R4NB 2KIFA 1IGNA 3WE3A 3M9AA 3K10A 1GV5A 2LG4A 2KMUA 3VSKA 2K5CA 3FHNA 4F7ZA 2RNGA 3C2BA 2R5YA 1WFXA 3NRGA 3S1QJ 5IT9K 3WGIA 1Z77A 1TTYA 1D5VA 4HYEA 1PUFA 4G7ZF 6PAXA 3VEPA 1RC9A 4A6DA 2PMHA 3ECOA 2WC2A 1S7AA 1K6OA 1PJRA 3AG1H 4AIHA 2CV2A 1AKHA 3JRHA 2L5QA 2DDAA 2R7XA 3LFUA 4D5FA 4S0HB 2ME0A 2CW8A 3L09A 2FQ3A 2CUZA 4WF2A 3QP6A 2GA2A 3VFZA 3ABLH 5FO5A 4PFPA 4UV9A 4PJNA 3FISA 1J75A 2Z99A 5FD5A 2VPRA 5CQGA 1MJ9A 3OYFA 1ON1A 2OPTA 5HLHA 5EGOB 1IF1A 4ZZDA 1QU3A 3WTYC 1JGSA 2Y69H 5IYCJ 2MFZA 4AU7A 2RREA 3QU3A 2KL4A 3RIRA 1BI2A 3K4BA 1POGA 4UVAA 1S7EA 3GFLA 2BV6A 3HE0A 5LGTA 5E3OA 1ZKGA 4RB1A 3K4KA 1Z7UA 1G59A 4LMYA 4GFBA 1BI3A 2ID3A 1VQMI 2BYVE 4D1QA 1W0UA 1PVEA 4C2TA 4EM2A 2WTEA 2EB7A 1E17A 1UHMA 3HTUA 4BHPA 3JAMK 4BQQA 4XLHA 4ZJZA 1YQAA 2LFBA 2V1NA 2VBYA 3TW7A 2LD5A 3FXKA 2JA5J 2LBFB 1D8JA 2FX0A 4RM2A 3EDPA 2HXIA 5F08A 1ZELA 3VOEA 3KLOA 4M3GA 4D0PA 4BY7J 3I9V2 1O7LA 3F6VA 3MKLA 3V7SA 4HX8A 2LC2A 3CUQB 3IWFA 1OJLA 1KGSA 4ZYAA 3ESWB 2M4GA 3OR1C 2YX4A 4Y3OA 3RTRA 4NHJA 2RASA 1R00A 4XN0A 1ZGWA 2EFOA 2C6YA 3RDIA 3OYDA 3IKTA 5B3SH 5CYVA 2VC0A 2CQKA 3G73A 2ESNA 3CLQA 4F3QA 2LF7A 2JQ7A 2W48A 3VYTB 1YRNB 3W6VA 4RS8A 2A6TA 4A3JJ 4CYCA 2GXAA 1D0YA 1G3TA 1LNWA 2XAUA 2WV1A 1DQUA 2MG4A 3X2QH 1F4KA 4KWAA 3HOWJ 2WBMA 4Y52J 1HKQA 1P9QC 3G1MA 2BHYA 3CDIA 5EEHA 1AWCA 2ECCA 2K9LA 2CQNA 2HOTA 4PJLA 1R5GA 3J7AY 3WTVC 3SFIA 1OISA 1Y0UA 1USTA 2MC4A 1W36C 2W24A 1XN7A 4PK4A 1YW9A 5FRMA 3ZQLA 2JA6J 2LF8A 4LLLA 4X1EA 4V2FA 1XMAA 3KP6A 3LL7A 2HQNA 3HOVJ 2FOKA 4BBSJ 1Y8QB 3I54A 4CXFA 2I8DA 3MCZA 5E79C 3NPIA 5KVRA 5BQTA 4NQWA 1D0ZA 4BQOA 4XR6A 2XIGA 2XC7A 1ORKA 1T0FC 2HVRA 1V54H 2GA1A 3FRQA 4A0YA 3QQAA 5D5VB 1EJ9A 2DG8A 3TDUC 2A5WA 2IA0A 3BJOA 1TZLA 3S3MA 2E1MC 5B1AH 1DDNA 1QPMA 2WAQN 2L7FP 3JR9A 2HOEA 1G3SA 2BY2A 3SFZA 1FTTA 2E2IJ 2XPVA 3R60A 4HZFA 4M74A 5KHDA 1WKMA 3WHBA 1K61A 2K3PA 3ZMTA 2H6BA 4MTEA 3UR3C 2Z3YA 5IP6A 1LB2A 4BQAA 1Z3YA 2JJ7A 3FMRA 4Y15A 3RI4A 3G7RA 2XAFA 1ITYA 4A3BJ 2UV1A 5TISC 1U9OA 1XCVA 5FD6A 4II3A 2GENA 1NTCA 2ZJQF 2CFXA 3H1CA 2D5VA 2IRFG 3KP4A 2HR3A 3K1MA 3SJMA 1QZEA 4E7ZA 4XK4A 1WJAA 1U6GA 1ETOA 4XLNF 3PJRA 1MBHA 3R0JA 1SAXA 2DMNA 4R1HA 2K3FA 3BPXA 5FLMJ 2M8GX 2CO5A 3T0YA 2F5CA 2W82A 3BQZA 3C18A 3WTZA 5AIPA 2IGKA 3VYUB 1R58A 2DLLA 4C3IJ 1J9IA 3M1EA 2E1NA 2Y30A 2IJLA 5GTIC 1JKRC 1FOXA 3HKZA 4N4OB 1KU3A 2VL8A 3K4CA 2WAFA 2M8EA 4YIFA 1QQIA 3GEUA 5M5XJ 2HVSA 1DP3A 3VW1A 1WQ2A 3ZXSA 3ZCOA 1WJBA 2E34A 5LRSA 5EFYA 1VNDA 2DOFA 3GZ5A 3W6JB 3JTGA 4IOCF 2CS3A 1YYVA 4BJTA 1WJDA 4N0BA 3FXRA 3OS2A 3LFKA 2FE3A 2L9NA 5LD2C 5CQEA 1O3TA 1BN5A 1P7JA 4I09A 4GFLA 3HUGA 2NP5A 3W3CA 4QLCU 1EH6A 5LEKA 4LB6B 2P5KA 5HBUA 3I4PA 1QO0D 3MD2A 3MKWB 4NN1A 3IC7A 1Z0XA 2CWEA 1UG2A 4DBQA 5H2FC 5JLXA 1FOYA 5DUKA 3K70D 3ZMUA 2FF4A 3SDGA 4AWXB 3W2WA 4NNJA 3IHUA 1FOWA 5AONA 3TKYA 1IXCA 4PXIA 5K7HA 1JUSA 2IS6A 2REKA 4G7HF 3I64A 2VQHA 5F1JA 2EA2A 1V4RA 3CJRB 3GO5A 2EQRA 3RQIA 3TO7A 4F55A 3N05A 1VQ6I 3DCFA 3DLLF 4P9UA 1OYWA 2DA7A 3V7RA 4OAZA 2HTJA 2O3FA 3B73A 3F8NA 2FSWA 3BR3A 3V8LA 2TCTA 3CCMI 3MZHA 4M9ZA 1ZG5A 1XMXA 3OYCA 3OYIA 1U9NA 4HG2A 1B9NA 1OCRH 4BS9A 2ELJA 3OYGA 1WJEA 2PN6A 3CTAA 5J4YA 2ISZA 3CC7I 4R79A 3ONQA 4KA4A 5H6RA 3K70C 2O61A 2CSOA 1IW7F 2PMZA 1A36A 2DFIA 2R7UA 4CA0A 4PJJA 3WGGA 3RKQA 4O3MA 3IH3A 1QHGA 3F0CA 2ZBKA 2PJRA 3PNTA 4YG2F 4BL0B 2ZJ2A 2ZMEC 3DTEA 1TNSA 3QPLA 4YFXF 4XRSA 4OMYA 2EPFA 4EMSA 3V8JA 5D5UB 1ETQA 2PZ9A 1T6SA 2A61A 4L18B 2GUHA 3V42A 1FLIA 5J1YA 2DT5A 3C7JA 2NAZA 3S93A 4J00A 2DFFA 1SANA 3BR6A 2NP3A 3OSFA 2DJIA 3VPRA 3G1OA 2KJCA 3OIQA 1U3EM 4GCTA 2EV5A 3HJEA 1D1AA 1WHUA 4BKXA 2LRDA 3K1NA 2BY3A 3LWFA 1I3AA 3RZDJ 1X58A 1APLC 1IN8A 1HCRA 5GAGJ 1IV8A 4XL9A 1SD5A 1WJCA 3K6GA 3REOA 2Y0SN 5E3LA 3KEYA 1OKRA 3I5UA 5IPAA 3BTLA 1LVAA 4P55A 1PUEE 4A3LJ 1ETKA 1R1UA 1HA8A 4L0ZB 3F22A 2A68F 1LE8B 4KT6A 2G7GA 3CUQC 4HQEA 4GGGA 4ANJA 3VTIA 3F3XA 2FOWA 2KZGA 3BDDA 4BAYA 2OTLI 1OCCH 1UHSA 2XAQA 1IN5A 2R7WA 3S14J 1A6QA 3LWJA 3TO6A 3D0SA 1FMWA 3KFWX 2JSPA 3QPTA 2B1EA 3WTXC 4YIIA 3TOAA 4E70A 3GX4X 3NS4A 1H9GA 2YVXA 1LDKB 3GWZA 3HSFA 4U7DA 4NBQA 4FISA 2IS2A 5L3GA 1O3SA 4CYDA 1V5GA 2AXTC 2EZKA 5DS9A 1LE8A 2W84A 4MEXF 2LH9A 3I71A 1LQ1A 2CQXA 1ONVA 2ACJA 4MXMA 3PFYA 1X2MA 1P4XA 4FX0A 3HOYJ 5IT3A 2OC6A 3PIOF 1SVOA 2DO7A 1F1ZA 3WTWC 4BHBA 1FP1D 3VB2A 3OSGA 3R6SA 3U1KA 1MBFA 4ENMA 1BIBA 2QBYA 4W1UA 4I6ZA 2LSOA 2JUGA 2OCCH 5KK1A 2YS9A 1TQPA 2VT3A 1R1VA 4C3JJ 3L2RA 2X6WA 3OYKA 3OS0A 1F43A 1USSA 1X1BA 4OWRB 3GZIA 3HTJA 2ZCWA 5KNLA 4A0ZA 4XLPF 3OYEA 2DFHA 4EGYA 2EFWA 1HQCA 2W85A 3LNQA 5JHUA 2DA2A 2ZFWA 3GFIA 2D2WA 1JJ8C 3B6CA 4N9HA 3P5JA 2P7VB 1NG6A 4M3FA 3HHHA 2KKOA 4BE0A 2TDXA 3JW4A 2XKPA 3LOCA 3D5LA 2H8WA 2COBA 1OLTA 1R6RA 5JLWA 1HW1A 1MSEC 1FOKA 2OUMA 2KISA 1BA5A 2I5UA 2XKOA 2MYSA 4EM1A 3PM1A 2QKLB 4A69C 4XBFA 2ZC2A 2ZCXA 1ODDA 3F8BA 1VZ0A 2XPWA 2V57A 2Y0MA 4FE4A 2OBPA 2VPLA 1EH7A 1SVLA 4E7IA 3VUQA 4YFNF 3J81Z 3IV5A 4MFEA 2HWVA 2DXIA 5E17F 2JUCA 2Z5UA 3F8FA 3FXJA 4EEFG 4XLAA 3UNGC 4CUGA 2HNHA 3ZQ7A 5F0CA 5D5WB 3KETA 3KP7A 3W6KB 5FKNA 2X1DA 3Q3SA 2JPCA 2HFHA 3AQSA 2CQ7A 3ZOBA 1PP8F 4A3MJ 5D18A 2W4SA 5FLVA 3RYPA 1JT6A 4II2A 3NWSA 2AQEA 3KCCA 5D5XB 4C2MJ 3QODA 5LHIA 3KNWA 1KU7A 3ON2A 3RZOJ 3VODA 3ANPA 2FJ1A 2DA5A 1FTZA 1TWCJ 1F5TA 3ZQFA 1Z3XA 4B3AA 4BBRJ 3WODF 5EJCA 1A35A 2G7HA 2XRNA 4CZCA 3G56A 3PQJA 4R8HA 5E1WA 4AYBN 1SEUA 3WE2A 1OFCX 1X1PA 1SFOJ 4I7HA 1JKPC 1ZGAA 2OU2A 2P6SA 3FXUA 1XCBA 2CU7A 4DZJA 2HZTA 3QYFA 4ABZA 4QTRA 1BI0A 5JR3A 4M3DA 5LGNA 3K69A 3ZQHA 4QPQA 2BOLA 1YLFA 3GMEA 3PL8A 5GPCA 1VQOI 2WB1N 4KYWA 4RB3C 2VE8A 2D45A 1VTNC 2QQBA 2YVEA 2QOPA 4WXCA 1TBXA 2HYGD 4OAYA 5FKMA 1IRZA 2F4MB 2FBIA 3O6BB 1WI3A 4M9SA 1DU6A 5IY5H 5F0HA 2RQPA 5C4XJ 5E8IA 3ZQIA 2MGQA 2DTRA 1S72I 1S7OA 4ZZLA 2P81A 2BY1A 3L00A 1P2FA 4LJZF 1AOYA 3BJBA 2VJ5A 1U0JA 3U9GA 2IS1A 2JK3A 4E7JA 3O8HA 4PCQA 1Y8RB 3W2AA 2K85A 2ZJPF 2LMDA 2R7ZJ 1MDMA 2E5ZA 4LLNA 4NUBA 3NQOA 5TJJA 2J5OA 3CF5F 1HSTA 4GCVA 1G3WA 4CCLA 4IHSA 2KPMA 1YIJI 2OERA 2RDPA 1T8IA 2PX9A 4B4CA 4NB5A 5LHGA 2PFBA 1KQ0A 3F8MA 3BG5A 1FC3A 3EUKL 3I53A 4K2EA 1K83J 2K9SA 4A3CJ 4JYKA 2P0WA 1XGMA 3A2KA 2RAEA 4IXAA 2KT0A 1VQKI 5CVUA 1UCRA 3K2AA 1P92A 1Y0NA 4FX4A 4QSHA 4A5NA 1S5LC 1YE9A 1XDUA 5CJ9A 4BXFA 2CW7A 3NAUA 2ZB9A 4XN3A 3O8GA 1GVDA 1IAWA 5FMPA 1UB9A 3NXCA 1Y1WJ 3OMYA 3AG4H 4A3GJ 1OR7A 2ZJRF 2B7EA 4IJAA 1IO2A 1GT0C 1WZ2A 2R7VA 4XOTA 3JRGA 2F5FA 1Y6IA 5CPRB 1H9TA 1T39A 1STZA 1W4MA 3FKJA 2QQ9A 2B63J 2Z33A 5L3DA 2CV1A 4BXXJ 2O0YA 5ILSA 3H9QA 3CLOA 5C44J 2A2FX 2EFPA 2HKXA 4CH7A 1VQ8I 2MC3A 4DYCA 3TP3A 1NHAA 2DTZA 2R7OA 1IRFA 5DV5A 2R5YB 4A3DJ 4DBRA 2IT0A 2Y9YA 1PUFB 1ACIA 3VW2A 4E7KA 3DPJA 5GAEJ 2O5RA 1XDSA 3OYHA 3E7LA 2IGMA 1LKXA 2UXHA 1W5TA 2ELHA 3AL0B 2M34A 1R9TJ 3HYIA 4GRIA 4IQJA 2E1OA 1BC8C 1OYYA 3I59A 2CUFA 4FT8A 1WVRA 4N9IA 3MKYB 2NYXA 4P5OA 1XTAA 2DQLA 2EK5A 2RVCA 5EEGA 1LPQA 4BXUA 1ZAOA 1J7KA 2DA6A 3ELKA 1X4PA 3SXYA 3BY6A 3Q0UA 4GYGA 2P5VA 5BNGA 3DQVC 3VYRB 1G4DA 2P7CB 3CDLA 5GPAA 4L9TA 5CLSA 4Y7NJ 3CESA 3E97A 4F92B 3KLNA 1BJAA 2GIVA 2W00A 5F04A 4E7HA 3LSTA 3QYEA 1E3PA 1IDYA 2V7FA 4HQMA 3SEQA 5FFXA 3COLA 5J47A 1IUFA 2JSCA 2Y48A 3H5NA 5HODA 4IHXA 2QUFA 1JI8A 1RPWA 4V2GA 2XGCA 4J19A 3D1NI 3BT9A 1BOBA 1KZHA 1AHDP 1G6NA 4JL3A 3HRUA 2M9HA 3PSIA 4RAGA 4IHVA 2UWMA 3B81A 3VOXA 1I27A 1JKOC 3JRFA 3MKZA 4ICHA 1Z21A 1ZHFA 3S17J 5HLGA 2QSHX 4M3BA 2KHMA 1QGPA 3BLYA 2L54A 4OIOF 1TLHB 3KYLA 1B9MA 4LG0A 4OIQF 3K4JA 3ZMSA 2VJIA 2O6GE 1OQYA 2ZOYA 4LGWA 5FKKA 3Q5FA 1ZTRA 4ESBA 2DG7A 1B6AA 4PUSA 2W25A 3S3OA 2K9QA 1MMAA 3CJQB 2V1DA 3BQYA 3FMQA 2MD5A 3IWZA 1JHFA 3I3LA 2LKPA 3QOEA 1QA6A 3RH2A 3TBIA 2CMPA 3HDDA 1FP2A 2VBXA 3CP8A 4G9YA 1IRXA 2XGDA 5FRNA 2B9SA 1SFKA 3S1NJ 4UHTA 4HDUA 2F48A 4CYCB 3OWTA 4DIQA 1KYZA 4UUSB 1W36D 4CCNA 1JJ6C 4MK6A 1MZBA 2DA3A 5B66C 1PDNC 3ISPA 1UI6A 2P8TA 1JTYA 2DA4A 2H94A 1XGOA 3Q9VA 3HOSA 5DYMA 2IGNA 3FDYA 4G12A 4Q47A 3DU5A 3KKDA 4U88A 4AD9A 5HOOA 2E71A 1JKQC 4ZYDA 2WB1A 2BVLA 2L02A 1HSJA 4CCMA 2Z16A 3DXJF 3OL3A 1ULYA 3J81K 2E7XA 2X85A 3E5UA 2ADUA 2VJ4A 3BP8A 4DZPA 2MA3A 4UUSA 4OD5A 1RR7A 4EATA 2VN2A 4S04A 2HZDA 3BTJA 1A5JA 1UI5A 2MBFA 4NQWB 5L3CA 3OV8A 2NVQJ 3OIOA 1ZH5A 3QAHA 5HS8A 2NXNB 3WGHA 2PLYA 3CMYA 3ERMA 4IEJA 3IL2A 4RLQA 2IW5A 4XLCA 2Q8KA 2LYCA 2HPMA 2CGPA 2H09A 1QZYA 1QNTA 5CVVA 1H0MA 2BY0A 3M8FA 1VQ7I 4IHTA 1OCOH 5LFAA 4XRFA 1W5SA 2XUBA 4LB5A 3EUPA 4GCKA 5CKTA 3H3VK 1KONA 5DCFA 1QVUA 3BG7A 2K4JA 1S3JA 2JVHA 1MH3A 2HGCA 2KDZA 2D1VA 4XRMA 3LHQA 5ILVA 1RUNA 1O4XA 1W7PD 3ZP5A 1V55H 4U87A 5K1YA 1YS7A 2WAEA 1U2WA 3GFMA 4Q4ZF 1SC7A 2QSGX 2JZYA 3V6GA 1ZN2A 4HV5A 4BYYA 4JX4A 1XPXA 2ZCMA 1TWHJ 2VI6A 1J09A 3TL4X 1FJLA 2NRAC 3K8PC 1BI1A 1O57A 2M45A 3A01A 2FQ4A 4DGWB 5FFZA 3M1CA 2G0EA 4BDZA 3GZNB 3BG6A 1MD0A 1SFEA 4IRIA 2VASA 4A2UA 4HX7A 1CF7A 5M5YJ 3HL2A 2CJJA 2R7QA 1SVMA 3KKCA 3OS1A 4EJOA 3PASA 1SMYF 2QCOA 1J59A 1D0XA 5EZHA 4HNUA 2E1CA 3BHQA 1RETA 4RLFA 4ME9A 4YELA 2NS0A 1T95A 3HRMA 4BJ6C 3LAPA 2LREA 3CQZJ 3CZ6A 3KEQA 4PJMA 4DVYP 4GDFA 2FMYA 1TNTA 1FBQA 2XF5A 1HKSA 3SZTA 3BPVA 1SD4A 2OA4A 1RESA 2QQAA 5E20A 3L2QA 4AM3A 2L3DA 4QWQA 1RKWA 3HUGB 5J1RA 1B1BA 3ZPLA 4Y4RA 3H9JA 4QIWN 5EEAA 1GDTA 2HEOA 4RGRA 4KNYA 2WGBA 2KZVA 4HNVA 2ZNZA 2OQGA 2MH2A 4KFCA 3GFJA 3M07A 1BL0A 2L4MA 5CVJA 4FTHA 1XB4A 3CC4I 3HZJA 1T38A 1Z6RA 4ZYHA 3L7WA 2W57A 3T8TA 4LITA 4EVIA 3H9GA 2DW4A 2QKMB 5LLQA 3ASOH 4XM3A 4A3EJ 3ML6A 1U5TB 2ZY9A 3TO9A 1UFMA 3DTKA 3LSIA 2Q0OA 3HTSB 1Y56A 1MSFC 2Q2EB 3QU6A 2VJJA 5ERIA 3PNYA 1OPCA 1B8IA 1S9HA 3OYMA 4BE1A 1OCTC 3ANGA 2OJED 3R61A 5DCMB 2EZIA 4O6JA 1WH5A 5C3EJ 1ZREA 2JMWA 1O7FA 1FY7A 4TV7A 3JRCA 2KDOA 3MN2A 3NRVA 1RIOH 4IKFA 2PMUA 3WU0A 1VFCA 2RGVA 4MO7A 3RKXA 2EV0A 2L7MP 1U5TA 5LBQA 3MZYA 2LY2A 1ERDA 2Q2EA 2QYOA 2M7BA 5E8GA 1ETXA 2LY1A 2PJRB 1Z91A 3ZGKA 2DU9A 1X3UA 1MNEA 4Y13A 5D1RA 5DCMA 1BIAA 2Y2ZA 2P6TA 1QPIA 3VIBA 3H0DA 2F5DA 1MJAA 2XF7A 4OIRF 5E3MA 3OYBA 2PEXA 3IRQA 3DBLB 4M71A 1NK2P 2L7KA 3G71I 3PUBA 1E3OC 1WWXA 3F1BA 4HDVA 1TC3C 2H1KA 2G3BA 5AQCA 2XB0X 1WJ5A 2KRFA 5JI6A 1HDDC 3KP5A 1ZG3A 2OI8A 5HS9A 4RDUA 3T5XA 2PG4A 3ECHA 4LOCA 1XSVA 5D8KB 1H89C 5F0FA 3DF8A 2ISYA 3C1DA 5IP9J 2MLGA 4I02A 3S16J 1HC8A 4DOZA 3OY9A 4UUVA 5FLXZ 2DN0A 4PJ0C 3GTQJ 1TWGJ 4IPAA 3FMSA 1FNNA 3FXOA 3IAM2 3KZZA 2L01A 1MBGA 1W1WE 3HXLA 5ILUA 3ZMVA 3S2DJ 1X2NA 4PGGA 2JA7J 3IUVA 1WPKA 4AC6A 2ME6A 4BEHB 2R5ZA 3VW0A 2YPRA 1XSXA 5HNHA 1H8AC 1YJNI 2DODA 4HPQA 1P6RA 2OCEA 1BW5A 3K4MA 1RUOA 4C30A 2FJI1 4FETA 3BC8A 4ZDLA 4G6DA 4XMYA 4XNFA 3GVAA 3MFKA 4CGRA 3BG9A 3PUFA 2A05A 2O8KA 5AIQA 4XLFA 3HBLA 2ZFUA 3ABTA 4BEHA 3FF5A 1YIOA 2P5LC 4KICA 3FK6A 4WX9A 5K7ZA 1HOMA 2TRTA 5ICCA 4GYIA 3ZQQA 2M0MA 4OOIA 2EFNA 3CCJI 3WG9A 3COAC 2XAJA 4HLXA 1CGPA 1SD6A 2AQFA 4IL6C 1UZCA 1IRGA 4JX6A 3NWTA 5ICGA 2CG4A 2K40A 3SZPA 2QBYB 3CC2I 2YU3A 2V79A 4ZTJA 4CDGA 4M6VA 3EUHA 4GCLA 3RQ4A 3ZMZA 3VOKA 2NOGA 4YZEA 3B02A 3IRRA 3DV8A 3QOPA 3KYDB 3D5RC 3H92A 5HSZA 5HLIA 1K78A 2WAQA 2DYRH 2HQRA 5L3BA 5K5QA 5IYBJ 3P9KA 3HB9A 4CCOA 3L9FA 4UUTA 3ZQGA 5HDKA 1YTYA 2HYJA 2NNYA 4HOBA 4HX4A 2XROA 2EIMH 2IA2A 2QENA 4ON0A 1DUXC 4GO1A 2F5VA 3HC7A 3BCGA 1FWZA 3OL4A 4HF0A 3ULQB 4U0VA 3AAFA 3BR0A 3D5SC 2V9VA 5C4JJ 4KIBA 3K7AJ 2HI3A 2MW8A 3LSHA 3ZRGA 2OTJI 4P1WA 2DQRA 2XPUA 5BMZA 4L0YB 2WWYA 2OZ6A 4BUPA 1BR4A 3I55I 1YX3A 3A03A 5L3EA 3PQKA 1TT5B 3OYNA 2IPQX 3EETA 1Z67A 2F07A 1LFBA 3M8JA 1GLNA 5HVQC 2R7SA 2HU9A 2DMUA 4XKWA 4MQVA 4HNTA 4EJWA 4L5JA 5H9TA 4ESFA 1SFXA 1UMQA 2H27A 2EJRA 5A2QZ 1JE8A 4C9YA 1IN6A 2M5WA 3FBNB 2QSFX 3WTTC 1P7IA 3QYBA 4DJAA 2GWRA 4CZZA 1QVTA 1Y1VJ 2IAIA 4I01A 4RA2A 3KP2A 2EBIA 4ITVA 4HV6A 4RAZA 3VYSB 1RI7A 5H6QA 2BW3A 3E6MA 3EYYA 2VONA 5HNFA 2HTSA 2YVHA 2VQLA 2EA4A 1AU7A 4WWCA 3LSKA 3ERED 3T6NA 4HA8A 2PI0A 2QA4I 3MNLA 4EJVA 2DMPA 1LJ9A 4ZC3A 1K4SA 1YJWI 5F27A 2HS5A 2O9LA 2ZKZA 2ECBA 3I0TA 3KYCB 3OYAA 2UXNA 3HOZJ 4PGHA 1UELB 4AIKA 3C2GA 2WA0A 5J8FA 3HM5A 5IP7J 4HEA2 4IRGA 4FQGA 2EILH 4BY1J 1S29A 3OYLA 4KDPA 5DAJA 1P4WA 1DPRA 2DPUA 3HOUJ 4OINF 4EJUA 4IX7A 4OD4A 2W1OA 3J7AO 2LOOA 2VKEA 5ICFA 4O5VA 1WGXA 2FNAA 1BBYA 4HRIA 1KU2A 5J3LA 4E7SA 2L7ZA 2ZXHA 3F21A 1R1TA 2QM3A 1I1GA 2DCEA 1FBSA 3BTIA 3FXMA 4B09A 1YJ9I 3GTOJ 5CXIA 4D5CA 5E3NA 1MDMB 2MD0A 4AF5A 3M7GA 4F91B 3CJTB 1YW8A 3BOQA 5JHFA 5IYDJ 2AXLA 2AS5F 4JKZA 3K4LA 1BOAA 1B72A 4PSWA 4RGSA 1JGGA 2F2EA 1GVJA 3HRSA 3PNVA 2NOJB 1LEBA 3CO6C 1W5CC 1U8BA 1MIJA 4F93B 2RN7A 3CDHA 1FYLA 4E4HA 5KAFC 1FIAA 1FEXA 4B47A 1ON2A 4FASD 3JRIA 4AIJA 2UXUA 2DA1A 3RPUD 3LA2A 3CP2A 2BBYA 2CQQA 1MKMA 2KQRA 4RAFA 1KQ8A 2DK8A 3GLLA 4IF4A 5B5EC 3KX2A 4GFKA 1XD7A 1I39A 3LSGA 2Z2SB 2JRTA 4A12A 1R36A 3E5QA 3K9TA 2QTQA 1D8KA 4D9JA 1REPC 4EGZA 2VXDA 4P9FA 4C2UA 3WHCA 4XLEA 2UXPA 4E7LA 2Y0SA 3WG7H 1R23A 2UXXA 2FBQA 2QVOA 4ENNA 4L9VA 1VQNI 2GAUA 4RAYA 4ZDPA 5GTHC 2EWNA 3C07A 3OOPA 1YO5C 2QWWA 2V9PA 3ZR8X 2M30A 3MZ8A 5HAWA 1TQIA 1GXQA 2GIZA 4I98B 3IH4A 3BJAA 2CYYA 3MEXA 2IS4A 2Q24A 1ZYRF 1T0FA 1TT0A 2EH3A 3KEOA 2F5EA 2D1HA 3KP3A 2R0QC 2PBIA 3L1PA 5BPDA 2XSJC 5B1BH 4D7MA 2CUEA 2ZSIB 5ICEA 1F9NA 3WU2C 2F4IA 3CMEI 2R7RA 4DYQA 3I59B 1I1SA 5FLXK 2XVCA 1ZARA 2GM4A 3S8PA 2FMLA 3LSJA 4OU0A 1FT9A 3EYIA 5DM7F 2LVSA 5EG0A 2RHAA 4I0BA 3E3VA 1KQ9A 1G8XA 1HW2A 4IHYA 3GTMJ 2YX7A 2LK2A 5IOZA 3S2HJ 3CWRA 1TWFJ 4AUXA 4XSZF 3CCQI 3FHZA 3H3UA 1LFUP 5JFRA 3UKGA 1R4MB 1X3ZB 2L9SA 4KMUX 2BHZA 2OZUA 4E6KG 2R7FA 3H0GJ 1E3HA 5D4RA 1D3YA 4BHCA 2R3SA 4PDKA 3DKXA 1O3QA 2XDVA 5CXGA 1R5ID 5HS7A 4BNCA 3VVZA 2M1BA 1N78A 4DW6A 1V5FA 1F36A 2IP2A 3K2ZA 4EQQA 3RSNA 3TQNA 5M5WJ 2DMQA 2VBWA 1JT0A 4UXNA 4IRHA 2NVUB 4AIDA 2UXOA 2PJPA 5ED4A 4JOMA 5K5OA 2L9VA 3GW2A 3GYHX 5F64A 2KLOA 2DAOA 2CV0A 4UY8I 3P9TA 3DKYA 3I4MJ 3GEZA 2O7OA 3T8RA 5BPIA 4LG0B 3GUDA 3HIMA 4QPOA 3RD3A 2M2EA 4KN4X 4XRSG 3LA3A 2A07F 2VB6A 2QWTA 4MIMA 1RZ4A 1A31A 1WH7A 2OD5A 2HQAA 3BTCA 3HSEA 5K7FA 4BE2A 4UNOA 2NS7A 3FM3A 1CQTA 4U0YA 1YHQI 3G1LA 4M3EA 2A5YB 4YIRX 1FIPA 3FX3A 3QBMA 2FNPA 2HDWA 3L2UA 3I58A 2K27A 2E7WA 2LR8A 2CUJA 1VQ9I 3CJDA 2GZWA 3E5XA 2V1UA 2F4OB 4MFDA 5F1RA 2UXIA 2QQ8A 3PO2J 1JXSA 2QKOA 1GXPA 2E5NA 1Q1HA 3H35A 4JK1X 1E0EA 1XSDA 3DU6A 3OOUA 3I56I 5M3MJ 2JRMA 2V26A 5K5RA 3LSRA 2NNNA 5HLTA 4UVBA 2ZMEB 2IGOA 3JRBA 2X1EA 3K1PA 1R71A 5FROA 3RKYA 1U8RA 2OV7A 3QKXA 1ZK8A 5C4YA 3HGGA 1MGTA 1MMGA 3CCRI 1A04A 1RNLA 1IUYA 4MNUA 1Q1VA 4AYBA 3GTGJ 5EGOA 2PMZN 2VIXA 1N25A 4LIVA 3LAJA 1UHWA 3FXQA 5A2QK 3CJNA 1OMIA 4I2OA 2ZMEA 2H1LA 2NVYJ 2LP0A 2JA8J 2VOOA 5DTDA 3DLAA 3QWLA 2E36A 1I6HJ 2X6OA 3DWLE 2DYSH 3N97A 4G7OF 1WI9A 4FHTA 2QEXI 2KIMA 2BXZA 4MHGA 3S5RA 5LEJA 3SYTA 2XF6A 4F52A 5EF6A 2OQRA 4S05A 3DBRB 2GLOA 4KITB 4HKUA 2I10A 2IBDA 4XOPA 2VLAA 1IG7A 2D6YA 2GBYA 2GQQA 1K6YA 2KIQA 3LQRA 2WUIA 3MWMA 5DUIA 3GZ6A 3GTLJ 2EIJH 2KFDA 2EV6A 2COMA 2EINH 1R22A 3BWGA 1YG2A 2KP6A 2JWTA 2BEOA 2XAHA 2F6CA 2LBFA 5EYRA 4C2MA 4CSWA 1DPUA 1IJWC 4NELA 3EGQA 3ABUA 3E6BA 3MQ0A 2L2OA 3F8CA 3GTKJ 2VBZA 2X9DA 4XSXF 5J1UA 3S2WA 1L3LA 3CUQA 3A01B 4IO9F 2JT1A 3BNIA 2B0LA 5J40A 5GADJ 3IAS2 2FXAA 3ZN0A 3KPHA 1FX7A 4XKCA 5BS6A 1WCMJ 2K4BA 2ZXIA 3OIPA 4BGDA 1W0TA 3RYRA 1CF7B 3AQTA 4UB8C 3IH2A 3VVYA 5K58A 3IUOA 1JUPA 4X0GA 2IVMA 2X48A 1B4AA 4N4NB 4HSRA 5DDGA 2ZXWH 1YRNA 1V5EA 4OIPF 4LD5A 1I6XA 5JVTA 5KCMA 1IXRC 3FIWA 4CHUA 1KYWA 4XKVA 1RRJA 1RR8C 3NI7A 3DEUA 3Q9SA 2NX4A 1XS9A 1S6LA 2DFEA 4NC6A 3GXOA 1JTXA 1OR7C 2X4HA 1PYVA 5DD8A 3RCOA 1DU0A 3HGYA 4UDSA 4HSTA 1OCPA 1Z05A 2M0CA 2ESHA 4D7NA 1YS6A 3J80Z 5GP9A 3SEZA 2K7LA 1NH3A 3A0HC 3O60A 2ZSHB 2ZO4A 3F72A 2ICWG 3O3KA 3CCLI 1AA7A 2XRLA 3DP7A 3HG9A 3S32A 1ZR2A 2YU9J 3Q0VA 3CCSI 2Z9OA 4Y17A 2L0KA 1HKTA 3S1MJ 5GAHJ 2LY9A 3CMAI 3E6CC 1BC7C 5CVRA 4BACA 5J4VA 2NVXJ 1MBEA 3HSRA 3P9CA 2M87A 4KN7X 1B8IB 3HPHA 2O7TA 2VOPA 1BJZA 5DM6F 4BDYA 3ZMDA 3WU1B 2VT2A 3TOBA 5E1ZB 4M9XA 9ANTA 4LFUA 3VVXA 4AC0A 1Y39A 2VQCA 2AO9A 1P4AA 3FWEA 3R0AA 4L9JA 2V9KA 2IA1A 2MSYA 2HYFA 2L9RA 2DOEA 4HBLA 1GHCA 2QZ8A 1S8NA 1XMKA 2H6CA 2ELKA 3S3NA 1Z7LA 3AG3H 4GXOA 3BRUA 1BR2A 3OR2C 3OYJA 1TWAJ 3BJ6A 2E2JJ 4L9NA 3AL0C 1Z9CA 3L2VA 1GUUA 3O2PE 1X1AA
chains in the Genus database with same CATH topology
3BCGA 3E7QA 4B4CA 3NNRA 2EZHA 3BR0A 5C4JJ 3BG5A 2Y31A 3K7AJ 2LFBA 2HI3A 2MW8A 1K83J 2K9SA 3QPSA 3TW7A 4JYKA 2LD5A 2JA5J 4A3CJ 2RAEA 2FX0A 2XPUA 2KT0A 3LSPA 5EZGA 2HXIA 5F08A 3HTIA 3K2AA 4M3GA 4BY7J 3MKLA 3A03A 4QSHA 1XC5A 2HXOA 3DEWA 1VF9A 1OJLA 2OERA 1SGMA 3NARA 2F07A 2RASA 1IV6A 3NAUA 1LFBA 2ZB9A 1ZGWA 3O8GA 1GVDA 2DMUA 5FMPA 3MVPA 3NXCA 2IU5A 1Y1WJ 5H9TA 4A3GJ 1UMQA 2W48A 1YRNB 3W6VA 1GT0C 4A3JJ 4NDLA 4CYCA 3JRGA 2NS8A 2WV1A 4KWAA 2MG4A 1P7IA 3HOWJ 2B63J 4Y52J 2R5ZB 3G1MA 4BXXJ 5C44J 1HDPA 3LJLA 2GFNA 4DYCA 3HEFA 1QVTA 1Y1VJ 2DTZA 2ECCA 3TP3A 2R5YB 2HOTA 2R93J 2IAIA 4A3DJ 3SFIA 1ETWA 2EBIA 2Y9YA 1PUFB 3VW2A 3DPJA 2YVHA 3ZQLA 2JA6J 3E7LA 1AU7A 3T6NA 2UXHA 4X1EA 4V2FA 3MNLA 2DMPA 3HOVJ 2M34A 4BBSJ 1R9TJ 1ENHA 2E1OA 5F27A 3NPIA 2CUFA 2O9LA 2ECBA 2QIBA 3ZQCA 3CCYA 3HOZJ 1ORKA 2DA6A 3FKIJ 2NVTJ 5M3FJ 3HM5A 3FRQA 3QQAA 5IP7J 2DG8A 4RBOA 3Q0UA 4IHWA 5BNGA 4BY1J 5FKLA 3CDLA 3JR9A 2WAQN 2L7FP 5GPAA 5DAJA 1FTTA 1MNMC 4Y7NJ 3HOUJ 2E2IJ 2XPVA 4C3HJ 3WHBA 1K61A 5F04A 2VKEA 1HLVA 1IDYA 5IP6A 3COLA 1IUFA 1WGXA 2JJ7A 1D5YA 5HODA 3G7RA 1ITYA 5J3LA 2L7ZA 4A3BJ 4IHXA 1RPWA 1U9OA 4JX5A 4V2GA 4JNNA 2XGCA 4J19A 3D1NI 2GENA 3BTIA 1NTCA 3BT9A 3GTOJ 2D5VA 1AHDP 5CXIA 4D5CA 5E3NA 4JL3A 3SJMA 4IHVA 2M9HA 3VOXA 3B81A 4AF5A 1JKOC 4JP0A 1T33A 3JRFA 5IYDJ 4ICHA 4XK4A 1HF0A 3S17J 4JKZA 1ETOA 1B72A 2R92J 1MBHA 4X6AJ 4M3BA 2DMNA 1JGGA 3Q0WA 5FLMJ 2M8GX 2CRGA 1U8BA 3BQZA 4A3KJ 4XIDA 1FIAA 1FEXA 4C3IJ 3JRIA 2UXUA 2DA1A 2Y30A 1JKRC 2Y9ZA 2ZOYA 2CQQA 5FKKA 1JUMA 1ZTRA 3GEUA 2DG7A 5M5XJ 3VW1A 4GFKA 3LSGA 2K9QA 5EFYA 5FJ8J 1VNDA 3BQYA 2ID6A 2JN6A 2XDNA 2ZOZA 2QTQA 5FGLA 4MLOA 3RH2A 3HDDA 3WHCA 2UXPA 2LTPA 1P7JA 2XGDA 2FBQA 3S1NJ 4GFLA 1QRYA 2NP5A 3PO3J 4CYCB 4UUSB 5HBUA 1JJ6C 4MK6A 2DA3A 4NN1A 1Z0XA 3C07A 1UI6A 1UG2A 5EDNA 3CRJA 1JTYA 2DA4A 5JLXA 2LKXA 3S15J 3B6AA 3SDGA 5HAWA 4FCYA 1GV2A 1T56A 4G12A 3JREA 3KKDA 3VP5A 3IH4A 2PBXA 4B1RA 3HTHA 4PXIA 5K7HA 1JUSA 2REKA 1JKQC 2Q24A 2HQ5A 2EH3A 5F1JA 1MBKA 2XSDC 3RQIA 2EQRA 5IOYA 1EF4A 2R0QC 3DCFA 4DZPA 3L1PA 1BW6A 4UUSA 3A02A 2OF7A 4D7MA 1RR7A 2CUEA 2DA7A 1MH4A 3BTJA 4DYQA 1A5JA 1UI5A 2NVQJ 3BR3A 3OIOA 2GM4A 3LSJA 4W97A 2TCTA 5EG0A 2LVSA 3JSJA 2RHAA 2DJNA 2VUMJ 1U9NA 1XG1A 2HOAA 3CMYA 1RKTA 5CW8A 2HYTA 4IEJA 4IHYA 2IEKA 3GTMJ 3GBGA 2LK2A 5IOZA 3S2HJ 2HDDA 3CWRA 1TWFJ 4AUXA 1LFUP 3UKGA 3RKQA 3H0GJ 3IH3A 3F0CA 3EUPA 2VKVA 4GCKA 3H3VK 1QVUA 1ETVA 3TP0A 3QPLA 1MH3A 4XRSA 5CXGA 5D19A 2KDZA 2PZ9A 1ETQA 4XRMA 3VVZA 3LHQA 1O4XA 4DW6A 2GUHA 5J1YA 1F36A 5FHPA 5M5WJ 1IDZA 1SANA 2DMQA 3BR6A 2NP3A 3OSFA 1I50J 1JT0A 3VPRA 3M3YJ 3G1OA 2UXOA 3V6GA 1NK3P 4GCTA 1B72B 4JX4A 1G2HA 1VI0A 2ZCMA 1TWHJ 2VI6A 4DYRA 1FJLA 4BKXA 3A01A 2FQ4A 3RZDJ 3P9TA 1X58A 2LLKA 1A6IA 1APLC 3I4MJ 2G0EA 2O7OA 1HCRA 3HIMA 1IC8A 3RD3A 2M2EA 4XRSG 5FKOA 2Y0SN 5E3LA 5M5YJ 2AHQA 2CJJA 3KKCA 2QWTA 3PASA 5IPAA 4MIMA 3BHQA 2QCOA 3BTLA 1WH7A 5EZHA 5K7FA 3BTCA 4A3LJ 1ETKA 1LE8B 1RETA 2NS7A 4ME9A 2G7GA 1ZQ3P 1CQTA 3CQZJ 3G1LA 4M3EA 1FIPA 1UHSA 3QBMA 3S14J 3M4OJ 3LWJA 1RESA 2LR8A 1RKWA 3CJDA 5J1RA 4FE7A 4MFDA 2UXIA 3BG3A 3KZ9A 3PPBA 3I4NJ 1ETYA 4XICA 3PO2J 2QKOA 4FISA 4QIWN 5EEAA 1GDTA 2WGBA 1I3QJ 4HNVA 3OOUA 3BR1A 1LE8A 2EZKA 5DS9A 5M3MJ 1BL0A 2YUSA 3LSRA 4FTHA 2CQXA 3JRBA 2QF7A 3QKXA 4MXMA 1X2MA 4A3EJ 2DMTA 1ZK8A 2N8GA 3HOXJ 5C4YA 3HOYJ 3HGGA 2G7LA 2W53A 1MSFC 2H8RA 2K9NA 1MBJA 1Q1VA 3OSGA 1B8IA 3GTGJ 1MBFA 2E19A 5EGOA 2PMZN 3TEDA 1H88C 1OCTC 3ANGA 4W1UA 4I6ZA 2EZIA 1WH5A 5C3EJ 2YS9A 2JMWA 3BR5A 4C3JJ 3JRCA 5EG0B 3MN2A 2NVYJ 2LP0A 1F43A 2JA8J 5DTDA 3GZIA 1VFCA 4A3FJ 3HTJA 4MO7A 1I6HJ 2L7MP 2X6OA 2FD5A 4A93J 3LNQA 2DA2A 3S5RA 3FK7A 2XGEA 5EF6A 3JRDA 2GLOA 2HKUA 2ZCNA 1JJ8C 1ETXA 4HKUA 3B6CA 2I10A 2IBDA 1IG7A 2HOSA 4M3FA 2D6YA 2GBYA 5D1RA 2WUIA 2Y2ZA 3LOCA 3TW6A 3JRAA 1QPIA 3VIBA 2COBA 3GTJJ 5JLWA 4I76A 1MSEC 3GTLJ 5E3MA 2G7SA 1U78A 1BA5A 1NK2P 2JWTA 1E3OC 4ACIA 3PM1A 4A69C 1ZR4A 5EYRA 3F1BA 4NELA 2ZCXA 1IJWC 3EGQA 1TC3C 2XPWA 2H1KA 3V78A 4A3IJ 3GTKJ 2G3BA 2V57A 5AQCA 2XB0X 4FE4A 2X9DA 5J1UA 3A01B 1HDDC 4L62A 2OI8A 3BNIA 3VUQA 4RDUA 3IV5A 4MFEA 2E2HJ 3GTPJ 1WCMJ 4EEFG 2EZLA 4LOCA 3HTAA 5F0CA 4L5EA 5F0FA 1W0TA 1H89C 2XB5A 5FKNA 5IP9J 3AQTA 3ON4A 3Q3SA 3IH2A 3S16J 3VVYA 3AQSA 2DN0A 3ZOBA 5K58A 1JUPA 2X48A 3HKZN 3GTQJ 1TWGJ 4A3MJ 1YRNA 5D18A 1AKHB 5FLVA 1MBGA 1JT6A 4C2MJ 1X2NA 2JA7J 3S1RJ 3S2DJ 3FIWA 3IUVA 1WPKA 3BR2A 4AC6A 2ME6A 2R5ZA 1IGNA 3KNWA 3VW0A 3NI7A 1GV5A 3ON2A 2NX4A 1XS9A 3RZOJ 3ANPA 2FJ1A 3C2BA 2DA5A 2R5YA 1FTZA 3NRGA 1H8AC 3S1QJ 1TWCJ 1Z77A 1BW5A 3ZQFA 1JTXA 4UDSA 1DU0A 3HGYA 1PUFA 4B3AA 1OCPA 4BBRJ 2M0CA 4D7NA 5GP9A 3G56A 4CGRA 3BG9A 1AKHA 4AYBN 3JRHA 3O60A 2O8KA 2XRLA 1SFOJ 1OFCX 1JKPC 4D5FA 3HBLA 4S0HB 4DZJA 4QTRA 2CU7A 1ZR2A 2ME0A 4ABZA 2YU9J 3Q0VA 4M3DA 2L0KA 3FK6A 1HOMA 5K7ZA 3ZQHA 2TRTA 3S1MJ 2LY9A 5GPCA 2NVXJ 2WB1N 3FISA 2VPRA 1MBEA 2YVEA 2QOPA 1B8IB 2OPTA 2O7TA 5EGOB 4JX6A 1BJZA 5FKMA 1IRZA 2K40A 1WI3A 1DU6A 9ANTA 5F0HA 3VVXA 4AC0A 5C4XJ 4M6VA 2MGQA 3ZQIA 2AO9A 5IYCJ 4GCLA 2P81A 2MSYA 2L9RA 3VOKA 2NOGA 3BJBA 4YZEA 1POGA 2JK3A 3O8HA 1S7EA 5HSZA 2ELKA 3HE0A 3BRUA 5E3OA 1TWAJ 1ZKGA 5IYBJ 3HB9A 2R7ZJ 2E2JJ 4UUTA 3ZQGA 2HYJA 4GFBA 2ID3A 1GUUA 1W0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCG A;  3E7Q A;  4B4C A;  3NNR A;  2EZH A;  3BR0 A;  5C4J J;  3BG5 A;  2Y31 A;  3K7A J;  2LFB A;  2HI3 A;  2MW8 A;  1K83 J;  2K9S A;  3QPS A;  3TW7 A;  4JYK A;  2LD5 A;  2JA5 J;  4A3C J;  2RAE A;  2FX0 A;  2XPU A;  2KT0 A;  3LSP A;  5EZG A;  2HXI A;  5F08 A;  3HTI A;  3K2A A;  4M3G A;  4BY7 J;  3MKL A;  3A03 A;  4QSH A;  1XC5 A;  2HXO A;  3DEW A;  1VF9 A;  1OJL A;  2OER A;  1SGM A;  3NAR A;  2F07 A;  2RAS A;  1IV6 A;  3NAU A;  1LFB A;  2ZB9 A;  1ZGW A;  3O8G A;  1GVD A;  2DMU A;  5FMP A;  3MVP A;  3NXC A;  2IU5 A;  1Y1W J;  5H9T A;  4A3G J;  1UMQ A;  2W48 A;  1YRN B;  3W6V A;  1GT0 C;  4A3J J;  4NDL A;  4CYC A;  3JRG A;  2NS8 A;  2WV1 A;  4KWA A;  2MG4 A;  1P7I A;  3HOW J;  2B63 J;  4Y52 J;  2R5Z B;  3G1M A;  4BXX J;  5C44 J;  1HDP A;  3LJL A;  2GFN A;  4DYC A;  3HEF A;  1QVT A;  1Y1V J;  2DTZ A;  2ECC A;  3TP3 A;  2R5Y B;  2HOT A;  2R93 J;  2IAI A;  4A3D J;  3SFI A;  1ETW A;  2EBI A;  2Y9Y A;  1PUF B;  3VW2 A;  3DPJ A;  2YVH A;  3ZQL A;  2JA6 J;  3E7L A;  1AU7 A;  3T6N A;  2UXH A;  4X1E A;  4V2F A;  3MNL A;  2DMP A;  3HOV J;  2M34 A;  4BBS J;  1R9T J;  1ENH A;  2E1O A;  5F27 A;  3NPI A;  2CUF A;  2O9L A;  2ECB A;  2QIB A;  3ZQC A;  3CCY A;  3HOZ J;  1ORK A;  2DA6 A;  3FKI J;  2NVT J;  5M3F J;  3HM5 A;  3FRQ A;  3QQA A;  5IP7 J;  2DG8 A;  4RBO A;  3Q0U A;  4IHW A;  5BNG A;  4BY1 J;  5FKL A;  3CDL A;  3JR9 A;  2WAQ N;  2L7F P;  5GPA A;  5DAJ A;  1FTT A;  1MNM C;  4Y7N J;  3HOU J;  2E2I J;  2XPV A;  4C3H J;  3WHB A;  1K61 A;  5F04 A;  2VKE A;  1HLV A;  1IDY A;  5IP6 A;  3COL A;  1IUF A;  1WGX A;  2JJ7 A;  1D5Y A;  5HOD A;  3G7R A;  1ITY A;  5J3L A;  2L7Z A;  4A3B J;  4IHX A;  1RPW A;  1U9O A;  4JX5 A;  4V2G A;  4JNN A;  2XGC A;  4J19 A;  3D1N I;  2GEN A;  3BTI A;  1NTC A;  3BT9 A;  3GTO J;  2D5V A;  1AHD P;  5CXI A;  4D5C A;  5E3N A;  4JL3 A;  3SJM A;  4IHV A;  2M9H A;  3VOX A;  3B81 A;  4AF5 A;  1JKO C;  4JP0 A;  1T33 A;  3JRF A;  5IYD J;  4ICH A;  4XK4 A;  1HF0 A;  3S17 J;  4JKZ A;  1ETO A;  1B72 A;  2R92 J;  1MBH A;  4X6A J;  4M3B A;  2DMN A;  1JGG A;  3Q0W A;  5FLM J;  2M8G X;  2CRG A;  1U8B A;  3BQZ A;  4A3K J;  4XID A;  1FIA A;  1FEX A;  4C3I J;  3JRI A;  2UXU A;  2DA1 A;  2Y30 A;  1JKR C;  2Y9Z A;  2ZOY A;  2CQQ A;  5FKK A;  1JUM A;  1ZTR A;  3GEU A;  2DG7 A;  5M5X J;  3VW1 A;  4GFK A;  3LSG A;  2K9Q A;  5EFY A;  5FJ8 J;  1VND A;  3BQY A;  2ID6 A;  2JN6 A;  2XDN A;  2ZOZ A;  2QTQ A;  5FGL A;  4MLO A;  3RH2 A;  3HDD A;  3WHC A;  2UXP A;  2LTP A;  1P7J A;  2XGD A;  2FBQ A;  3S1N J;  4GFL A;  1QRY A;  2NP5 A;  3PO3 J;  4CYC B;  4UUS B;  5HBU A;  1JJ6 C;  4MK6 A;  2DA3 A;  4NN1 A;  1Z0X A;  3C07 A;  1UI6 A;  1UG2 A;  5EDN A;  3CRJ A;  1JTY A;  2DA4 A;  5JLX A;  2LKX A;  3S15 J;  3B6A A;  3SDG A;  5HAW A;  4FCY A;  1GV2 A;  1T56 A;  4G12 A;  3JRE A;  3KKD A;  3VP5 A;  3IH4 A;  2PBX A;  4B1R A;  3HTH A;  4PXI A;  5K7H A;  1JUS A;  2REK A;  1JKQ C;  2Q24 A;  2HQ5 A;  2EH3 A;  5F1J A;  1MBK A;  2XSD C;  3RQI A;  2EQR A;  5IOY A;  1EF4 A;  2R0Q C;  3DCF A;  4DZP A;  3L1P A;  1BW6 A;  4UUS A;  3A02 A;  2OF7 A;  4D7M A;  1RR7 A;  2CUE A;  2DA7 A;  1MH4 A;  3BTJ A;  4DYQ A;  1A5J A;  1UI5 A;  2NVQ J;  3BR3 A;  3OIO A;  2GM4 A;  3LSJ A;  4W97 A;  2TCT A;  5EG0 A;  2LVS A;  3JSJ A;  2RHA A;  2DJN A;  2VUM J;  1U9N A;  1XG1 A;  2HOA A;  3CMY A;  1RKT A;  5CW8 A;  2HYT A;  4IEJ A;  4IHY A;  2IEK A;  3GTM J;  3GBG A;  2LK2 A;  5IOZ A;  3S2H J;  2HDD A;  3CWR A;  1TWF J;  4AUX A;  1LFU P;  3UKG A;  3RKQ A;  3H0G J;  3IH3 A;  3F0C A;  3EUP A;  2VKV A;  4GCK A;  3H3V K;  1QVU A;  1ETV A;  3TP0 A;  3QPL A;  1MH3 A;  4XRS A;  5CXG A;  5D19 A;  2KDZ A;  2PZ9 A;  1ETQ A;  4XRM A;  3VVZ A;  3LHQ A;  1O4X A;  4DW6 A;  2GUH A;  5J1Y A;  1F36 A;  5FHP A;  5M5W J;  1IDZ A;  1SAN A;  2DMQ A;  3BR6 A;  2NP3 A;  3OSF A;  1I50 J;  1JT0 A;  3VPR A;  3M3Y J;  3G1O A;  2UXO A;  3V6G A;  1NK3 P;  4GCT A;  1B72 B;  4JX4 A;  1G2H A;  1VI0 A;  2ZCM A;  1TWH J;  2VI6 A;  4DYR A;  1FJL A;  4BKX A;  3A01 A;  2FQ4 A;  3RZD J;  3P9T A;  1X58 A;  2LLK A;  1A6I A;  1APL C;  3I4M J;  2G0E A;  2O7O A;  1HCR A;  3HIM A;  1IC8 A;  3RD3 A;  2M2E A;  4XRS G;  5FKO A;  2Y0S N;  5E3L A;  5M5Y J;  2AHQ A;  2CJJ A;  3KKC A;  2QWT A;  3PAS A;  5IPA A;  4MIM A;  3BHQ A;  2QCO A;  3BTL A;  1WH7 A;  5EZH A;  5K7F A;  3BTC A;  4A3L J;  1ETK A;  1LE8 B;  1RET A;  2NS7 A;  4ME9 A;  2G7G A;  1ZQ3 P;  1CQT A;  3CQZ J;  3G1L A;  4M3E A;  1FIP A;  1UHS A;  3QBM A;  3S14 J;  3M4O J;  3LWJ A;  1RES A;  2LR8 A;  1RKW A;  3CJD A;  5J1R A;  4FE7 A;  4MFD A;  2UXI A;  3BG3 A;  3KZ9 A;  3PPB A;  3I4N J;  1ETY A;  4XIC A;  3PO2 J;  2QKO A;  4FIS A;  4QIW N;  5EEA A;  1GDT A;  2WGB A;  1I3Q J;  4HNV A;  3OOU A;  3BR1 A;  1LE8 A;  2EZK A;  5DS9 A;  5M3M J;  1BL0 A;  2YUS A;  3LSR A;  4FTH A;  2CQX A;  3JRB A;  2QF7 A;  3QKX A;  4MXM A;  1X2M A;  4A3E J;  2DMT A;  1ZK8 A;  2N8G A;  3HOX J;  5C4Y A;  3HOY J;  3HGG A;  2G7L A;  2W53 A;  1MSF C;  2H8R A;  2K9N A;  1MBJ A;  1Q1V A;  3OSG A;  1B8I A;  3GTG J;  1MBF A;  2E19 A;  5EGO A;  2PMZ N;  3TED A;  1H88 C;  1OCT C;  3ANG A;  4W1U A;  4I6Z A;  2EZI A;  1WH5 A;  5C3E J;  2YS9 A;  2JMW A;  3BR5 A;  4C3J J;  3JRC A;  5EG0 B;  3MN2 A;  2NVY J;  2LP0 A;  1F43 A;  2JA8 J;  5DTD A;  3GZI A;  1VFC A;  4A3F J;  3HTJ A;  4MO7 A;  1I6H J;  2L7M P;  2X6O A;  2FD5 A;  4A93 J;  3LNQ A;  2DA2 A;  3S5R A;  3FK7 A;  2XGE A;  5EF6 A;  3JRD A;  2GLO A;  2HKU A;  2ZCN A;  1JJ8 C;  1ETX A;  4HKU A;  3B6C A;  2I10 A;  2IBD A;  1IG7 A;  2HOS A;  4M3F A;  2D6Y A;  2GBY A;  5D1R A;  2WUI A;  2Y2Z A;  3LOC A;  3TW6 A;  3JRA A;  1QPI A;  3VIB A;  2COB A;  3GTJ J;  5JLW A;  4I76 A;  1MSE C;  3GTL J;  5E3M A;  2G7S A;  1U78 A;  1BA5 A;  1NK2 P;  2JWT A;  1E3O C;  4ACI A;  3PM1 A;  4A69 C;  1ZR4 A;  5EYR A;  3F1B A;  4NEL A;  2ZCX A;  1IJW C;  3EGQ A;  1TC3 C;  2XPW A;  2H1K A;  3V78 A;  4A3I J;  3GTK J;  2G3B A;  2V57 A;  5AQC A;  2XB0 X;  4FE4 A;  2X9D A;  5J1U A;  3A01 B;  1HDD C;  4L62 A;  2OI8 A;  3BNI A;  3VUQ A;  4RDU A;  3IV5 A;  4MFE A;  2E2H J;  3GTP J;  1WCM J;  4EEF G;  2EZL A;  4LOC A;  3HTA A;  5F0C A;  4L5E A;  5F0F A;  1W0T A;  1H89 C;  2XB5 A;  5FKN A;  5IP9 J;  3AQT A;  3ON4 A;  3Q3S A;  3IH2 A;  3S16 J;  3VVY A;  3AQS A;  2DN0 A;  3ZOB A;  5K58 A;  1JUP A;  2X48 A;  3HKZ N;  3GTQ J;  1TWG J;  4A3M J;  1YRN A;  5D18 A;  1AKH B;  5FLV A;  1MBG A;  1JT6 A;  4C2M J;  1X2N A;  2JA7 J;  3S1R J;  3S2D J;  3FIW A;  3IUV A;  1WPK A;  3BR2 A;  4AC6 A;  2ME6 A;  2R5Z A;  1IGN A;  3KNW A;  3VW0 A;  3NI7 A;  1GV5 A;  3ON2 A;  2NX4 A;  1XS9 A;  3RZO J;  3ANP A;  2FJ1 A;  3C2B A;  2DA5 A;  2R5Y A;  1FTZ A;  3NRG A;  1H8A C;  3S1Q J;  1TWC J;  1Z77 A;  1BW5 A;  3ZQF A;  1JTX A;  4UDS A;  1DU0 A;  3HGY A;  1PUF A;  4B3A A;  1OCP A;  4BBR J;  2M0C A;  4D7N A;  5GP9 A;  3G56 A;  4CGR A;  3BG9 A;  1AKH A;  4AYB N;  3JRH A;  3O60 A;  2O8K A;  2XRL A;  1SFO J;  1OFC X;  1JKP C;  4D5F A;  3HBL A;  4S0H B;  4DZJ A;  4QTR A;  2CU7 A;  1ZR2 A;  2ME0 A;  4ABZ A;  2YU9 J;  3Q0V A;  4M3D A;  2L0K A;  3FK6 A;  1HOM A;  5K7Z A;  3ZQH A;  2TRT A;  3S1M J;  2LY9 A;  5GPC A;  2NVX J;  2WB1 N;  3FIS A;  2VPR A;  1MBE A;  2YVE A;  2QOP A;  1B8I B;  2OPT A;  2O7T A;  5EGO B;  4JX6 A;  1BJZ A;  5FKM A;  1IRZ A;  2K40 A;  1WI3 A;  1DU6 A;  9ANT A;  5F0H A;  3VVX A;  4AC0 A;  5C4X J;  4M6V A;  2MGQ A;  3ZQI A;  2AO9 A;  5IYC J;  4GCL A;  2P81 A;  2MSY A;  2L9R A;  3VOK A;  2NOG A;  3BJB A;  4YZE A;  1POG A;  2JK3 A;  3O8H A;  1S7E A;  5HSZ A;  2ELK A;  3HE0 A;  3BRU A;  5E3O A;  1TWA J;  1ZKG A;  5IYB J;  3HB9 A;  2R7Z J;  2E2J J;  4UUT A;  3ZQG A;  2HYJ A;  4GFB A;  2ID3 A;  1GUU A;  1W0U A; 
#chains in the Genus database with same CATH topology
 4KMF A;  3NEU A;  2FEZ A;  3E7Q A;  3NNR A;  3EQL F;  2EZH A;  2KIU A;  2K9M A;  2KJB A;  2Y31 A;  3ZN1 A;  4IZZ A;  1R49 A;  1NG7 A;  2HPI A;  3QPS A;  3DEE A;  5TGT A;  5JVG F;  2GXB A;  3LSP A;  5J8C A;  5EZG A;  3HTI A;  3A1Y A;  4M72 A;  1TW2 A;  4BJ5 C;  3AKZ A;  1XC5 A;  2HXO A;  3DEW A;  5HDN A;  1VF9 A;  1X1D A;  4KUM A;  3JSO A;  4NC8 A;  3CCU I;  1SGM A;  3AFH A;  3BCA A;  4WK8 F;  2K86 A;  4UV8 A;  3NAR A;  1IV6 A;  2IXS A;  5F6F A;  1FPQ A;  1TP4 A;  2DT7 B;  3MVP A;  1MMD A;  2IU5 A;  1Z1D A;  3IKV A;  1ZLJ A;  4ETS A;  1X1C A;  2EFQ A;  4U9L A;  1WRJ A;  2G9W A;  1YIT I;  3P9I A;  3L2C A;  4NDL A;  2NS8 A;  4HF2 A;  2XV4 S;  4U9N A;  3KZY A;  3H5R A;  2R5Z B;  4PZJ A;  2DBB A;  1HDP A;  4AVP A;  3G4S I;  3LJL A;  2J5P A;  2GFN A;  5J6X A;  3RKW A;  1LDJ A;  3HEF A;  2XDN A;  2R93 J;  3VDX A;  1VQL I;  3SQN A;  3HHG A;  2JVG A;  1QZZ A;  3FM5 A;  3KE2 A;  4RM3 A;  1ETW A;  4ASN A;  1MND A;  3SHF A;  3U21 A;  2LDU A;  2UUZ A;  1UAA A;  4XON A;  2R7T A;  2E60 A;  2DPD A;  3EUA A;  4UB6 C;  1SAU A;  3SDB A;  3LMM A;  1ENH A;  3GCM A;  2VQG A;  3TDZ C;  3GLX A;  1T2K A;  2QIB A;  3HOT A;  1R5H A;  3ZQC A;  3CCY A;  3M8E A;  4LIU A;  3W2V A;  3BZK A;  3FKI J;  2NVT J;  5M3F J;  4EM0 B;  3F9K A;  1K4T A;  2XHK A;  2MAB A;  4H0E A;  1BR1 A;  2WY8 Q;  3JTH A;  4RBO A;  4IHW A;  3MMY B;  5FKL A;  2XAG A;  2FBH A;  3DPU A;  1XX5 A;  1MNM C;  3CCE I;  4C3H J;  3BZ6 A;  2STW A;  2R4G A;  2O03 A;  1YX5 A;  2XGX A;  1B59 A;  2X51 A;  4Z2Y A;  4B48 A;  1HLV A;  4BH9 A;  1FYK A;  2V6E A;  1WSU A;  1D5Y A;  4A6E A;  4UVC A;  3R4K A;  1YOV B;  4B3X A;  1UG0 A;  2WAD A;  2VXZ A;  4JX5 A;  3QPH A;  4JNN A;  3AG2 H;  1K78 B;  4CCK A;  2OAZ A;  2BXY A;  2B3W A;  1JHH A;  4KIG A;  1X3W B;  3DKW A;  4G94 A;  2JA2 A;  4JP0 A;  1T33 A;  1HF0 A;  4XKB A;  5IT9 Z;  2R92 J;  4BQN A;  4X6A J;  3FZV A;  1G3Y A;  3Q0W A;  4JBA A;  2X6Y A;  4LK0 F;  2CRG A;  1MMN A;  3RPU A;  4RB0 A;  4G8X A;  4A3K J;  4XID A;  4MQ9 F;  5D6F A;  5D8L B;  2JPB A;  1V3F A;  5LHH A;  2Y9Z A;  1FSH A;  1JUM A;  4DNC A;  1SFU A;  1VQ4 I;  2KRH A;  4M6Y A;  1KU9 A;  3V7C A;  2Z1D A;  5FJ8 J;  2M3A A;  2CH0 A;  2RNJ A;  2ID6 A;  2JN6 A;  3ABM H;  2ZOZ A;  2BGC A;  5FGL A;  1LUJ B;  5L3F A;  4MLO A;  1QHH D;  2XAS A;  2FRH A;  1XGN A;  3A4C A;  3SZG A;  3E1S A;  4U7B A;  5D4S A;  2LTP A;  1DGR M;  3CO7 C;  4ENJ A;  4Q5S F;  2QLZ A;  1I5Z A;  1E2X A;  1IXS B;  4HF1 A;  4YEJ A;  1QRY A;  3PO3 J;  3CMM A;  3HRT A;  4LK1 F;  4KJZ A;  1LFP A;  5CVI A;  2VOD A;  1FSE A;  3ROU A;  4RGU A;  3DFG A;  3PSF A;  1EKE A;  1ZG1 A;  2HDC A;  5EDN A;  3CRJ A;  1M1E B;  3S15 J;  2RKH A;  2LKX A;  2K02 A;  4A5M A;  3DPT A;  3B6A A;  2Y75 A;  2CFO A;  1HXD A;  2RQQ A;  4FCY A;  1GV2 A;  1T56 A;  1K79 A;  3JRE A;  1HW5 A;  3VP5 A;  2WV0 A;  2PBX A;  4B1R A;  3G2B A;  1FBU A;  3HTH A;  4WCG A;  2VE9 A;  2HQ5 A;  3WTS C;  1L0O C;  1D1C A;  2BW3 B;  4HAM A;  5TRD A;  4B44 A;  1MBK A;  3CD6 I;  2XSD C;  5IOY A;  1EF4 A;  3DBH B;  4RMN A;  4ZYE A;  3JAM Z;  3CUO A;  3H5A A;  1OCZ H;  1TL8 A;  1BW6 A;  3TGN A;  2KRC A;  3A02 A;  2OF7 A;  2FBK A;  4RGX A;  2G7U A;  1VQ5 I;  1MH4 A;  4ZTF A;  2X1C A;  4Z6Y A;  4L5I A;  3BZC A;  2MLK A;  3G6E I;  3KIO A;  2DDB A;  4W97 A;  3K0L A;  1MW7 A;  3JSJ A;  2DJN A;  2QGU A;  4XOR A;  3E6D A;  4YFK F;  2VUM J;  1XG1 A;  2HOA A;  2A6H F;  3EPZ A;  1RKT A;  5CW8 A;  2HYT A;  1IZ1 A;  1C0W A;  1LEA A;  2V1X A;  2IEK A;  3GBG A;  1FZP B;  2HDD A;  3V8K A;  1FYM A;  1T08 B;  4EJT A;  1X4O A;  3QRF F;  3CF2 A;  1ZRC A;  1DP7 P;  4J01 A;  2YSR A;  2M7A A;  2VKV A;  2STT A;  4OMZ A;  1ETV A;  3TP0 A;  3J80 K;  5D19 A;  2MH9 A;  5BOX A;  5LRR A;  3MAJ A;  1LDD A;  4I0A A;  1U5T C;  5FHP A;  2E35 A;  4WIB A;  1IDZ A;  2GOX B;  3KZI C;  1EV7 A;  2UZK A;  1I50 J;  3FBI B;  1DGW Y;  3M3Y J;  4CGZ A;  1NK3 P;  2HKO A;  4A0X A;  1B72 B;  4ZDO A;  4ZH4 F;  1VI0 A;  1G2H A;  3WTU C;  4DYR A;  4M6X A;  2R7D A;  4WXH A;  2GXG A;  1ZRD A;  1N75 A;  1O3R A;  1PP7 U;  2LLK A;  1A6I A;  5FGM A;  3J7Y J;  2HVQ A;  5DD4 A;  2LKS A;  2LNB A;  2ZNY A;  1T98 A;  2W7N A;  1MMS A;  1IC8 A;  1MJB A;  2X0L A;  3H36 A;  5FKO A;  2AHQ A;  2VKD A;  3LQQ A;  4XQF A;  2YR2 A;  2FUG 2;  3HPG A;  4AVZ A;  3FXL A;  1LVK A;  3PIP F;  5D6E A;  5E18 F;  2BE5 F;  1Z6T A;  1ZQ3 P;  1R7J A;  5E1X A;  4H4K C;  2RV8 A;  2FA5 A;  3BRO A;  3M4O J;  1KA8 A;  4IRV A;  3CCV I;  1K7A A;  3U1D A;  4IQ4 A;  1D1B A;  1TQM A;  4FE7 A;  3N4M A;  1J5Y A;  3BG3 A;  3KZ9 A;  3PPB A;  3I4N J;  1ETY A;  3G3Z A;  4XIC A;  4G6T B;  1X19 A;  3DTI A;  1I3Q J;  4B8X A;  1FMV A;  3BR1 A;  3E0J B;  4NC7 A;  5DEQ A;  2CW0 F;  1SD7 A;  4KIS A;  2YUS A;  3VSL A;  4IVN A;  4EV0 A;  3A0B C;  2X6X A;  2A69 F;  3V4G A;  2BZT A;  4CIC A;  1OYI A;  5LGU A;  3F23 A;  1J2X A;  2QF7 A;  2DMT A;  2N8G A;  4WXD A;  4MTD A;  3F6O A;  3HOX J;  4LG3 A;  3C2H A;  2JTV A;  4Q48 A;  4ENK A;  3ABK H;  3RJP A;  2E1M B;  2G7L A;  2W53 A;  2O8X A;  2H8R A;  2K9N A;  4CCJ A;  4CO8 A;  1MBJ A;  3RPQ A;  4RB2 C;  1YI2 I;  1ZLK A;  2GOM A;  2E19 A;  1H88 C;  3TED A;  1IN4 A;  2M4K A;  1SMT A;  2DOA A;  2BVM A;  3BR5 A;  4PFO A;  4DQ2 A;  5EG0 B;  2VKH A;  4LLG F;  4HW0 A;  5KAI C;  1WJF A;  3C3W A;  1QBJ A;  4A3F J;  2ETH A;  3J7Z I;  1J0R A;  2A6E F;  3SWH A;  2FD5 A;  3ASN H;  3T1B A;  4JQF A;  4U0W A;  1ZRF A;  2A3S A;  4A93 J;  1ZGJ A;  2V6C A;  3TMO A;  3FK7 A;  2XGE A;  2HKU A;  3JRD A;  2ZCN A;  2EIK H;  4MEY F;  4BU2 A;  4Y33 A;  1TW3 A;  4V19 K;  3K4N A;  2HOS A;  3EUH C;  2FU4 A;  1W7P B;  2DK5 A;  3TW6 A;  1EA3 A;  3JRA A;  3GTJ J;  4I76 A;  4KIF A;  1UJ8 A;  2G7S A;  1U78 A;  2PFV A;  2ZXJ A;  2VC1 A;  4I99 C;  3P7N A;  2V4J C;  1N77 A;  4ACI A;  2WY7 Q;  1ZR4 A;  4B43 A;  3U2R A;  5FB2 A;  1BM9 A;  3V78 A;  3QP5 A;  3H3Z A;  3LSM A;  4A3I J;  1HBX G;  4MGR A;  4HLY A;  3BCB A;  1YFH A;  3JCU C;  4KT5 C;  4L62 A;  2PQ8 A;  3DPL C;  3JSP A;  2L4A A;  2E2H J;  3GTP J;  2RC4 A;  4YRV A;  1W7P A;  4P96 A;  2EZL A;  3HTA A;  3L2W A;  4L5E A;  3IP4 B;  3HIF A;  2XB5 A;  3ON4 A;  1IN7 A;  3GF2 A;  2P4W A;  2DI3 A;  2Q1Z B;  4IOA F;  2DT6 A;  4PSX A;  3VWB A;  5HDG A;  3HKZ N;  4ESJ A;  4G6Q A;  3LA7 A;  1AKH B;  4ZYG A;  1YW7 A;  1VQP I;  4M73 A;  3PFI A;  1XGS A;  3S1R J;  5H20 A;  3BR2 A;  1EH8 A;  1R4N B;  2KIF A;  1IGN A;  3WE3 A;  3M9A A;  3K10 A;  1GV5 A;  2LG4 A;  2KMU A;  3VSK A;  2K5C A;  3FHN A;  4F7Z A;  2RNG A;  3C2B A;  2R5Y A;  1WFX A;  3NRG A;  3S1Q J;  5IT9 K;  3WGI A;  1Z77 A;  1TTY A;  1D5V A;  4HYE A;  1PUF A;  4G7Z F;  6PAX A;  3VEP A;  1RC9 A;  4A6D A;  2PMH A;  3ECO A;  2WC2 A;  1S7A A;  1K6O A;  1PJR A;  3AG1 H;  4AIH A;  2CV2 A;  1AKH A;  3JRH A;  2L5Q A;  2DDA A;  2R7X A;  3LFU A;  4D5F A;  4S0H B;  2ME0 A;  2CW8 A;  3L09 A;  2FQ3 A;  2CUZ A;  4WF2 A;  3QP6 A;  2GA2 A;  3VFZ A;  3ABL H;  5FO5 A;  4PFP A;  4UV9 A;  4PJN A;  3FIS A;  1J75 A;  2Z99 A;  5FD5 A;  2VPR A;  5CQG A;  1MJ9 A;  3OYF A;  1ON1 A;  2OPT A;  5HLH A;  5EGO B;  1IF1 A;  4ZZD A;  1QU3 A;  3WTY C;  1JGS A;  2Y69 H;  5IYC J;  2MFZ A;  4AU7 A;  2RRE A;  3QU3 A;  2KL4 A;  3RIR A;  1BI2 A;  3K4B A;  1POG A;  4UVA A;  1S7E A;  3GFL A;  2BV6 A;  3HE0 A;  5LGT A;  5E3O A;  1ZKG A;  4RB1 A;  3K4K A;  1Z7U A;  1G59 A;  4LMY A;  4GFB A;  1BI3 A;  2ID3 A;  1VQM I;  2BYV E;  4D1Q A;  1W0U A;  1PVE A;  4C2T A;  4EM2 A;  2WTE A;  2EB7 A;  1E17 A;  1UHM A;  3HTU A;  4BHP A;  3JAM K;  4BQQ A;  4XLH A;  4ZJZ A;  1YQA A;  2LFB A;  2V1N A;  2VBY A;  3TW7 A;  2LD5 A;  3FXK A;  2JA5 J;  2LBF B;  1D8J A;  2FX0 A;  4RM2 A;  3EDP A;  2HXI A;  5F08 A;  1ZEL A;  3VOE A;  3KLO A;  4M3G A;  4D0P A;  4BY7 J;  3I9V 2;  1O7L A;  3F6V A;  3MKL A;  3V7S A;  4HX8 A;  2LC2 A;  3CUQ B;  3IWF A;  1OJL A;  1KGS A;  4ZYA A;  3ESW B;  2M4G A;  3OR1 C;  2YX4 A;  4Y3O A;  3RTR A;  4NHJ A;  2RAS A;  1R00 A;  4XN0 A;  1ZGW A;  2EFO A;  2C6Y A;  3RDI A;  3OYD A;  3IKT A;  5B3S H;  5CYV A;  2VC0 A;  2CQK A;  3G73 A;  2ESN A;  3CLQ A;  4F3Q A;  2LF7 A;  2JQ7 A;  2W48 A;  3VYT B;  1YRN B;  3W6V A;  4RS8 A;  2A6T A;  4A3J J;  4CYC A;  2GXA A;  1D0Y A;  1G3T A;  1LNW A;  2XAU A;  2WV1 A;  1DQU A;  2MG4 A;  3X2Q H;  1F4K A;  4KWA A;  3HOW J;  2WBM A;  4Y52 J;  1HKQ A;  1P9Q C;  3G1M A;  2BHY A;  3CDI A;  5EEH A;  1AWC A;  2ECC A;  2K9L A;  2CQN A;  2HOT A;  4PJL A;  1R5G A;  3J7A Y;  3WTV C;  3SFI A;  1OIS A;  1Y0U A;  1UST A;  2MC4 A;  1W36 C;  2W24 A;  1XN7 A;  4PK4 A;  1YW9 A;  5FRM A;  3ZQL A;  2JA6 J;  2LF8 A;  4LLL A;  4X1E A;  4V2F A;  1XMA A;  3KP6 A;  3LL7 A;  2HQN A;  3HOV J;  2FOK A;  4BBS J;  1Y8Q B;  3I54 A;  4CXF A;  2I8D A;  3MCZ A;  5E79 C;  3NPI A;  5KVR A;  5BQT A;  4NQW A;  1D0Z A;  4BQO A;  4XR6 A;  2XIG A;  2XC7 A;  1ORK A;  1T0F C;  2HVR A;  1V54 H;  2GA1 A;  3FRQ A;  4A0Y A;  3QQA A;  5D5V B;  1EJ9 A;  2DG8 A;  3TDU C;  2A5W A;  2IA0 A;  3BJO A;  1TZL A;  3S3M A;  2E1M C;  5B1A H;  1DDN A;  1QPM A;  2WAQ N;  2L7F P;  3JR9 A;  2HOE A;  1G3S A;  2BY2 A;  3SFZ A;  1FTT A;  2E2I J;  2XPV A;  3R60 A;  4HZF A;  4M74 A;  5KHD A;  1WKM A;  3WHB A;  1K61 A;  2K3P A;  3ZMT A;  2H6B A;  4MTE A;  3UR3 C;  2Z3Y A;  5IP6 A;  1LB2 A;  4BQA A;  1Z3Y A;  2JJ7 A;  3FMR A;  4Y15 A;  3RI4 A;  3G7R A;  2XAF A;  1ITY A;  4A3B J;  2UV1 A;  5TIS C;  1U9O A;  1XCV A;  5FD6 A;  4II3 A;  2GEN A;  1NTC A;  2ZJQ F;  2CFX A;  3H1C A;  2D5V A;  2IRF G;  3KP4 A;  2HR3 A;  3K1M A;  3SJM A;  1QZE A;  4E7Z A;  4XK4 A;  1WJA A;  1U6G A;  1ETO A;  4XLN F;  3PJR A;  1MBH A;  3R0J A;  1SAX A;  2DMN A;  4R1H A;  2K3F A;  3BPX A;  5FLM J;  2M8G X;  2CO5 A;  3T0Y A;  2F5C A;  2W82 A;  3BQZ A;  3C18 A;  3WTZ A;  5AIP A;  2IGK A;  3VYU B;  1R58 A;  2DLL A;  4C3I J;  1J9I A;  3M1E A;  2E1N A;  2Y30 A;  2IJL A;  5GTI C;  1JKR C;  1FOX A;  3HKZ A;  4N4O B;  1KU3 A;  2VL8 A;  3K4C A;  2WAF A;  2M8E A;  4YIF A;  1QQI A;  3GEU A;  5M5X J;  2HVS A;  1DP3 A;  3VW1 A;  1WQ2 A;  3ZXS A;  3ZCO A;  1WJB A;  2E34 A;  5LRS A;  5EFY A;  1VND A;  2DOF A;  3GZ5 A;  3W6J B;  3JTG A;  4IOC F;  2CS3 A;  1YYV A;  4BJT A;  1WJD A;  4N0B A;  3FXR A;  3OS2 A;  3LFK A;  2FE3 A;  2L9N A;  5LD2 C;  5CQE A;  1O3T A;  1BN5 A;  1P7J A;  4I09 A;  4GFL A;  3HUG A;  2NP5 A;  3W3C A;  4QLC U;  1EH6 A;  5LEK A;  4LB6 B;  2P5K A;  5HBU A;  3I4P A;  1QO0 D;  3MD2 A;  3MKW B;  4NN1 A;  3IC7 A;  1Z0X A;  2CWE A;  1UG2 A;  4DBQ A;  5H2F C;  5JLX A;  1FOY A;  5DUK A;  3K70 D;  3ZMU A;  2FF4 A;  3SDG A;  4AWX B;  3W2W A;  4NNJ A;  3IHU A;  1FOW A;  5AON A;  3TKY A;  1IXC A;  4PXI A;  5K7H A;  1JUS A;  2IS6 A;  2REK A;  4G7H F;  3I64 A;  2VQH A;  5F1J A;  2EA2 A;  1V4R A;  3CJR B;  3GO5 A;  2EQR A;  3RQI A;  3TO7 A;  4F55 A;  3N05 A;  1VQ6 I;  3DCF A;  3DLL F;  4P9U A;  1OYW A;  2DA7 A;  3V7R A;  4OAZ A;  2HTJ A;  2O3F A;  3B73 A;  3F8N A;  2FSW A;  3BR3 A;  3V8L A;  2TCT A;  3CCM I;  3MZH A;  4M9Z A;  1ZG5 A;  1XMX A;  3OYC A;  3OYI A;  1U9N A;  4HG2 A;  1B9N A;  1OCR H;  4BS9 A;  2ELJ A;  3OYG A;  1WJE A;  2PN6 A;  3CTA A;  5J4Y A;  2ISZ A;  3CC7 I;  4R79 A;  3ONQ A;  4KA4 A;  5H6R A;  3K70 C;  2O61 A;  2CSO A;  1IW7 F;  2PMZ A;  1A36 A;  2DFI A;  2R7U A;  4CA0 A;  4PJJ A;  3WGG A;  3RKQ A;  4O3M A;  3IH3 A;  1QHG A;  3F0C A;  2ZBK A;  2PJR A;  3PNT A;  4YG2 F;  4BL0 B;  2ZJ2 A;  2ZME C;  3DTE A;  1TNS A;  3QPL A;  4YFX F;  4XRS A;  4OMY A;  2EPF A;  4EMS A;  3V8J A;  5D5U B;  1ETQ A;  2PZ9 A;  1T6S A;  2A61 A;  4L18 B;  2GUH A;  3V42 A;  1FLI A;  5J1Y A;  2DT5 A;  3C7J A;  2NAZ A;  3S93 A;  4J00 A;  2DFF A;  1SAN A;  3BR6 A;  2NP3 A;  3OSF A;  2DJI A;  3VPR A;  3G1O A;  2KJC A;  3OIQ A;  1U3E M;  4GCT A;  2EV5 A;  3HJE A;  1D1A A;  1WHU A;  4BKX A;  2LRD A;  3K1N A;  2BY3 A;  3LWF A;  1I3A A;  3RZD J;  1X58 A;  1APL C;  1IN8 A;  1HCR A;  5GAG J;  1IV8 A;  4XL9 A;  1SD5 A;  1WJC A;  3K6G A;  3REO A;  2Y0S N;  5E3L A;  3KEY A;  1OKR A;  3I5U A;  5IPA A;  3BTL A;  1LVA A;  4P55 A;  1PUE E;  4A3L J;  1ETK A;  1R1U A;  1HA8 A;  4L0Z B;  3F22 A;  2A68 F;  1LE8 B;  4KT6 A;  2G7G A;  3CUQ C;  4HQE A;  4GGG A;  4ANJ A;  3VTI A;  3F3X A;  2FOW A;  2KZG A;  3BDD A;  4BAY A;  2OTL I;  1OCC H;  1UHS A;  2XAQ A;  1IN5 A;  2R7W A;  3S14 J;  1A6Q A;  3LWJ A;  3TO6 A;  3D0S A;  1FMW A;  3KFW X;  2JSP A;  3QPT A;  2B1E A;  3WTX C;  4YII A;  3TOA A;  4E70 A;  3GX4 X;  3NS4 A;  1H9G A;  2YVX A;  1LDK B;  3GWZ A;  3HSF A;  4U7D A;  4NBQ A;  4FIS A;  2IS2 A;  5L3G A;  1O3S A;  4CYD A;  1V5G A;  2AXT C;  2EZK A;  5DS9 A;  1LE8 A;  2W84 A;  4MEX F;  2LH9 A;  3I71 A;  1LQ1 A;  2CQX A;  1ONV A;  2ACJ A;  4MXM A;  3PFY A;  1X2M A;  1P4X A;  4FX0 A;  3HOY J;  5IT3 A;  2OC6 A;  3PIO F;  1SVO A;  2DO7 A;  1F1Z A;  3WTW C;  4BHB A;  1FP1 D;  3VB2 A;  3OSG A;  3R6S A;  3U1K A;  1MBF A;  4ENM A;  1BIB A;  2QBY A;  4W1U A;  4I6Z A;  2LSO A;  2JUG A;  2OCC H;  5KK1 A;  2YS9 A;  1TQP A;  2VT3 A;  1R1V A;  4C3J J;  3L2R A;  2X6W A;  3OYK A;  3OS0 A;  1F43 A;  1USS A;  1X1B A;  4OWR B;  3GZI A;  3HTJ A;  2ZCW A;  5KNL A;  4A0Z A;  4XLP F;  3OYE A;  2DFH A;  4EGY A;  2EFW A;  1HQC A;  2W85 A;  3LNQ A;  5JHU A;  2DA2 A;  2ZFW A;  3GFI A;  2D2W A;  1JJ8 C;  3B6C A;  4N9H A;  3P5J A;  2P7V B;  1NG6 A;  4M3F A;  3HHH A;  2KKO A;  4BE0 A;  2TDX A;  3JW4 A;  2XKP A;  3LOC A;  3D5L A;  2H8W A;  2COB A;  1OLT A;  1R6R A;  5JLW A;  1HW1 A;  1MSE C;  1FOK A;  2OUM A;  2KIS A;  1BA5 A;  2I5U A;  2XKO A;  2MYS A;  4EM1 A;  3PM1 A;  2QKL B;  4A69 C;  4XBF A;  2ZC2 A;  2ZCX A;  1ODD A;  3F8B A;  1VZ0 A;  2XPW A;  2V57 A;  2Y0M A;  4FE4 A;  2OBP A;  2VPL A;  1EH7 A;  1SVL A;  4E7I A;  3VUQ A;  4YFN F;  3J81 Z;  3IV5 A;  4MFE A;  2HWV A;  2DXI A;  5E17 F;  2JUC A;  2Z5U A;  3F8F A;  3FXJ A;  4EEF G;  4XLA A;  3UNG C;  4CUG A;  2HNH A;  3ZQ7 A;  5F0C A;  5D5W B;  3KET A;  3KP7 A;  3W6K B;  5FKN A;  2X1D A;  3Q3S A;  2JPC A;  2HFH A;  3AQS A;  2CQ7 A;  3ZOB A;  1PP8 F;  4A3M J;  5D18 A;  2W4S A;  5FLV A;  3RYP A;  1JT6 A;  4II2 A;  3NWS A;  2AQE A;  3KCC A;  5D5X B;  4C2M J;  3QOD A;  5LHI A;  3KNW A;  1KU7 A;  3ON2 A;  3RZO J;  3VOD A;  3ANP A;  2FJ1 A;  2DA5 A;  1FTZ A;  1TWC J;  1F5T A;  3ZQF A;  1Z3X A;  4B3A A;  4BBR J;  3WOD F;  5EJC A;  1A35 A;  2G7H A;  2XRN A;  4CZC A;  3G56 A;  3PQJ A;  4R8H A;  5E1W A;  4AYB N;  1SEU A;  3WE2 A;  1OFC X;  1X1P A;  1SFO J;  4I7H A;  1JKP C;  1ZGA A;  2OU2 A;  2P6S A;  3FXU A;  1XCB A;  2CU7 A;  4DZJ A;  2HZT A;  3QYF A;  4ABZ A;  4QTR A;  1BI0 A;  5JR3 A;  4M3D A;  5LGN A;  3K69 A;  3ZQH A;  4QPQ A;  2BOL A;  1YLF A;  3GME A;  3PL8 A;  5GPC A;  1VQO I;  2WB1 N;  4KYW A;  4RB3 C;  2VE8 A;  2D45 A;  1VTN C;  2QQB A;  2YVE A;  2QOP A;  4WXC A;  1TBX A;  2HYG D;  4OAY A;  5FKM A;  1IRZ A;  2F4M B;  2FBI A;  3O6B B;  1WI3 A;  4M9S A;  1DU6 A;  5IY5 H;  5F0H A;  2RQP A;  5C4X J;  5E8I A;  3ZQI A;  2MGQ A;  2DTR A;  1S72 I;  1S7O A;  4ZZL A;  2P81 A;  2BY1 A;  3L00 A;  1P2F A;  4LJZ F;  1AOY A;  3BJB A;  2VJ5 A;  1U0J A;  3U9G A;  2IS1 A;  2JK3 A;  4E7J A;  3O8H A;  4PCQ A;  1Y8R B;  3W2A A;  2K85 A;  2ZJP F;  2LMD A;  2R7Z J;  1MDM A;  2E5Z A;  4LLN A;  4NUB A;  3NQO A;  5TJJ A;  2J5O A;  3CF5 F;  1HST A;  4GCV A;  1G3W A;  4CCL A;  4IHS A;  2KPM A;  1YIJ I;  2OER A;  2RDP A;  1T8I A;  2PX9 A;  4B4C A;  4NB5 A;  5LHG A;  2PFB A;  1KQ0 A;  3F8M A;  3BG5 A;  1FC3 A;  3EUK L;  3I53 A;  4K2E A;  1K83 J;  2K9S A;  4A3C J;  4JYK A;  2P0W A;  1XGM A;  3A2K A;  2RAE A;  4IXA A;  2KT0 A;  1VQK I;  5CVU A;  1UCR A;  3K2A A;  1P92 A;  1Y0N A;  4FX4 A;  4QSH A;  4A5N A;  1S5L C;  1YE9 A;  1XDU A;  5CJ9 A;  4BXF A;  2CW7 A;  3NAU A;  2ZB9 A;  4XN3 A;  3O8G A;  1GVD A;  1IAW A;  5FMP A;  1UB9 A;  3NXC A;  1Y1W J;  3OMY A;  3AG4 H;  4A3G J;  1OR7 A;  2ZJR F;  2B7E A;  4IJA A;  1IO2 A;  1GT0 C;  1WZ2 A;  2R7V A;  4XOT A;  3JRG A;  2F5F A;  1Y6I A;  5CPR B;  1H9T A;  1T39 A;  1STZ A;  1W4M A;  3FKJ A;  2QQ9 A;  2B63 J;  2Z33 A;  5L3D A;  2CV1 A;  4BXX J;  2O0Y A;  5ILS A;  3H9Q A;  3CLO A;  5C44 J;  2A2F X;  2EFP A;  2HKX A;  4CH7 A;  1VQ8 I;  2MC3 A;  4DYC A;  3TP3 A;  1NHA A;  2DTZ A;  2R7O A;  1IRF A;  5DV5 A;  2R5Y B;  4A3D J;  4DBR A;  2IT0 A;  2Y9Y A;  1PUF B;  1ACI A;  3VW2 A;  4E7K A;  3DPJ A;  5GAE J;  2O5R A;  1XDS A;  3OYH A;  3E7L A;  2IGM A;  1LKX A;  2UXH A;  1W5T A;  2ELH A;  3AL0 B;  2M34 A;  1R9T J;  3HYI A;  4GRI A;  4IQJ A;  2E1O A;  1BC8 C;  1OYY A;  3I59 A;  2CUF A;  4FT8 A;  1WVR A;  4N9I A;  3MKY B;  2NYX A;  4P5O A;  1XTA A;  2DQL A;  2EK5 A;  2RVC A;  5EEG A;  1LPQ A;  4BXU A;  1ZAO A;  1J7K A;  2DA6 A;  3ELK A;  1X4P A;  3SXY A;  3BY6 A;  3Q0U A;  4GYG A;  2P5V A;  5BNG A;  3DQV C;  3VYR B;  1G4D A;  2P7C B;  3CDL A;  5GPA A;  4L9T A;  5CLS A;  4Y7N J;  3CES A;  3E97 A;  4F92 B;  3KLN A;  1BJA A;  2GIV A;  2W00 A;  5F04 A;  4E7H A;  3LST A;  3QYE A;  1E3P A;  1IDY A;  2V7F A;  4HQM A;  3SEQ A;  5FFX A;  3COL A;  5J47 A;  1IUF A;  2JSC A;  2Y48 A;  3H5N A;  5HOD A;  4IHX A;  2QUF A;  1JI8 A;  1RPW A;  4V2G A;  2XGC A;  4J19 A;  3D1N I;  3BT9 A;  1BOB A;  1KZH A;  1AHD P;  1G6N A;  4JL3 A;  3HRU A;  2M9H A;  3PSI A;  4RAG A;  4IHV A;  2UWM A;  3B81 A;  3VOX A;  1I27 A;  1JKO C;  3JRF A;  3MKZ A;  4ICH A;  1Z21 A;  1ZHF A;  3S17 J;  5HLG A;  2QSH X;  4M3B A;  2KHM A;  1QGP A;  3BLY A;  2L54 A;  4OIO F;  1TLH B;  3KYL A;  1B9M A;  4LG0 A;  4OIQ F;  3K4J A;  3ZMS A;  2VJI A;  2O6G E;  1OQY A;  2ZOY A;  4LGW A;  5FKK A;  3Q5F A;  1ZTR A;  4ESB A;  2DG7 A;  1B6A A;  4PUS A;  2W25 A;  3S3O A;  2K9Q A;  1MMA A;  3CJQ B;  2V1D A;  3BQY A;  3FMQ A;  2MD5 A;  3IWZ A;  1JHF A;  3I3L A;  2LKP A;  3QOE A;  1QA6 A;  3RH2 A;  3TBI A;  2CMP A;  3HDD A;  1FP2 A;  2VBX A;  3CP8 A;  4G9Y A;  1IRX A;  2XGD A;  5FRN A;  2B9S A;  1SFK A;  3S1N J;  4UHT A;  4HDU A;  2F48 A;  4CYC B;  3OWT A;  4DIQ A;  1KYZ A;  4UUS B;  1W36 D;  4CCN A;  1JJ6 C;  4MK6 A;  1MZB A;  2DA3 A;  5B66 C;  1PDN C;  3ISP A;  1UI6 A;  2P8T A;  1JTY A;  2DA4 A;  2H94 A;  1XGO A;  3Q9V A;  3HOS A;  5DYM A;  2IGN A;  3FDY A;  4G12 A;  4Q47 A;  3DU5 A;  3KKD A;  4U88 A;  4AD9 A;  5HOO A;  2E71 A;  1JKQ C;  4ZYD A;  2WB1 A;  2BVL A;  2L02 A;  1HSJ A;  4CCM A;  2Z16 A;  3DXJ F;  3OL3 A;  1ULY A;  3J81 K;  2E7X A;  2X85 A;  3E5U A;  2ADU A;  2VJ4 A;  3BP8 A;  4DZP A;  2MA3 A;  4UUS A;  4OD5 A;  1RR7 A;  4EAT A;  2VN2 A;  4S04 A;  2HZD A;  3BTJ A;  1A5J A;  1UI5 A;  2MBF A;  4NQW B;  5L3C A;  3OV8 A;  2NVQ J;  3OIO A;  1ZH5 A;  3QAH A;  5HS8 A;  2NXN B;  3WGH A;  2PLY A;  3CMY A;  3ERM A;  4IEJ A;  3IL2 A;  4RLQ A;  2IW5 A;  4XLC A;  2Q8K A;  2LYC A;  2HPM A;  2CGP A;  2H09 A;  1QZY A;  1QNT A;  5CVV A;  1H0M A;  2BY0 A;  3M8F A;  1VQ7 I;  4IHT A;  1OCO H;  5LFA A;  4XRF A;  1W5S A;  2XUB A;  4LB5 A;  3EUP A;  4GCK A;  5CKT A;  3H3V K;  1KON A;  5DCF A;  1QVU A;  3BG7 A;  2K4J A;  1S3J A;  2JVH A;  1MH3 A;  2HGC A;  2KDZ A;  2D1V A;  4XRM A;  3LHQ A;  5ILV A;  1RUN A;  1O4X A;  1W7P D;  3ZP5 A;  1V55 H;  4U87 A;  5K1Y A;  1YS7 A;  2WAE A;  1U2W A;  3GFM A;  4Q4Z F;  1SC7 A;  2QSG X;  2JZY A;  3V6G A;  1ZN2 A;  4HV5 A;  4BYY A;  4JX4 A;  1XPX A;  2ZCM A;  1TWH J;  2VI6 A;  1J09 A;  3TL4 X;  1FJL A;  2NRA C;  3K8P C;  1BI1 A;  1O57 A;  2M45 A;  3A01 A;  2FQ4 A;  4DGW B;  5FFZ A;  3M1C A;  2G0E A;  4BDZ A;  3GZN B;  3BG6 A;  1MD0 A;  1SFE A;  4IRI A;  2VAS A;  4A2U A;  4HX7 A;  1CF7 A;  5M5Y J;  3HL2 A;  2CJJ A;  2R7Q A;  1SVM A;  3KKC A;  3OS1 A;  4EJO A;  3PAS A;  1SMY F;  2QCO A;  1J59 A;  1D0X A;  5EZH A;  4HNU A;  2E1C A;  3BHQ A;  1RET A;  4RLF A;  4ME9 A;  4YEL A;  2NS0 A;  1T95 A;  3HRM A;  4BJ6 C;  3LAP A;  2LRE A;  3CQZ J;  3CZ6 A;  3KEQ A;  4PJM A;  4DVY P;  4GDF A;  2FMY A;  1TNT A;  1FBQ A;  2XF5 A;  1HKS A;  3SZT A;  3BPV A;  1SD4 A;  2OA4 A;  1RES A;  2QQA A;  5E20 A;  3L2Q A;  4AM3 A;  2L3D A;  4QWQ A;  1RKW A;  3HUG B;  5J1R A;  1B1B A;  3ZPL A;  4Y4R A;  3H9J A;  4QIW N;  5EEA A;  1GDT A;  2HEO A;  4RGR A;  4KNY A;  2WGB A;  2KZV A;  4HNV A;  2ZNZ A;  2OQG A;  2MH2 A;  4KFC A;  3GFJ A;  3M07 A;  1BL0 A;  2L4M A;  5CVJ A;  4FTH A;  1XB4 A;  3CC4 I;  3HZJ A;  1T38 A;  1Z6R A;  4ZYH A;  3L7W A;  2W57 A;  3T8T A;  4LIT A;  4EVI A;  3H9G A;  2DW4 A;  2QKM B;  5LLQ A;  3ASO H;  4XM3 A;  4A3E J;  3ML6 A;  1U5T B;  2ZY9 A;  3TO9 A;  1UFM A;  3DTK A;  3LSI A;  2Q0O A;  3HTS B;  1Y56 A;  1MSF C;  2Q2E B;  3QU6 A;  2VJJ A;  5ERI A;  3PNY A;  1OPC A;  1B8I A;  1S9H A;  3OYM A;  4BE1 A;  1OCT C;  3ANG A;  2OJE D;  3R61 A;  5DCM B;  2EZI A;  4O6J A;  1WH5 A;  5C3E J;  1ZRE A;  2JMW A;  1O7F A;  1FY7 A;  4TV7 A;  3JRC A;  2KDO A;  3MN2 A;  3NRV A;  1RIO H;  4IKF A;  2PMU A;  3WU0 A;  1VFC A;  2RGV A;  4MO7 A;  3RKX A;  2EV0 A;  2L7M P;  1U5T A;  5LBQ A;  3MZY A;  2LY2 A;  1ERD A;  2Q2E A;  2QYO A;  2M7B A;  5E8G A;  1ETX A;  2LY1 A;  2PJR B;  1Z91 A;  3ZGK A;  2DU9 A;  1X3U A;  1MNE A;  4Y13 A;  5D1R A;  5DCM A;  1BIA A;  2Y2Z A;  2P6T A;  1QPI A;  3VIB A;  3H0D A;  2F5D A;  1MJA A;  2XF7 A;  4OIR F;  5E3M A;  3OYB A;  2PEX A;  3IRQ A;  3DBL B;  4M71 A;  1NK2 P;  2L7K A;  3G71 I;  3PUB A;  1E3O C;  1WWX A;  3F1B A;  4HDV A;  1TC3 C;  2H1K A;  2G3B A;  5AQC A;  2XB0 X;  1WJ5 A;  2KRF A;  5JI6 A;  1HDD C;  3KP5 A;  1ZG3 A;  2OI8 A;  5HS9 A;  4RDU A;  3T5X A;  2PG4 A;  3ECH A;  4LOC A;  1XSV A;  5D8K B;  1H89 C;  5F0F A;  3DF8 A;  2ISY A;  3C1D A;  5IP9 J;  2MLG A;  4I02 A;  3S16 J;  1HC8 A;  4DOZ A;  3OY9 A;  4UUV A;  5FLX Z;  2DN0 A;  4PJ0 C;  3GTQ J;  1TWG J;  4IPA A;  3FMS A;  1FNN A;  3FXO A;  3IAM 2;  3KZZ A;  2L01 A;  1MBG A;  1W1W E;  3HXL A;  5ILU A;  3ZMV A;  3S2D J;  1X2N A;  4PGG A;  2JA7 J;  3IUV A;  1WPK A;  4AC6 A;  2ME6 A;  4BEH B;  2R5Z A;  3VW0 A;  2YPR A;  1XSX A;  5HNH A;  1H8A C;  1YJN I;  2DOD A;  4HPQ A;  1P6R A;  2OCE A;  1BW5 A;  3K4M A;  1RUO A;  4C30 A;  2FJI 1;  4FET A;  3BC8 A;  4ZDL A;  4G6D A;  4XMY A;  4XNF A;  3GVA A;  3MFK A;  4CGR A;  3BG9 A;  3PUF A;  2A05 A;  2O8K A;  5AIQ A;  4XLF A;  3HBL A;  2ZFU A;  3ABT A;  4BEH A;  3FF5 A;  1YIO A;  2P5L C;  4KIC A;  3FK6 A;  4WX9 A;  5K7Z A;  1HOM A;  2TRT A;  5ICC A;  4GYI A;  3ZQQ A;  2M0M A;  4OOI A;  2EFN A;  3CCJ I;  3WG9 A;  3COA C;  2XAJ A;  4HLX A;  1CGP A;  1SD6 A;  2AQF A;  4IL6 C;  1UZC A;  1IRG A;  4JX6 A;  3NWT A;  5ICG A;  2CG4 A;  2K40 A;  3SZP A;  2QBY B;  3CC2 I;  2YU3 A;  2V79 A;  4ZTJ A;  4CDG A;  4M6V A;  3EUH A;  4GCL A;  3RQ4 A;  3ZMZ A;  3VOK A;  2NOG A;  4YZE A;  3B02 A;  3IRR A;  3DV8 A;  3QOP A;  3KYD B;  3D5R C;  3H92 A;  5HSZ A;  5HLI A;  1K78 A;  2WAQ A;  2DYR H;  2HQR A;  5L3B A;  5K5Q A;  5IYB J;  3P9K A;  3HB9 A;  4CCO A;  3L9F A;  4UUT A;  3ZQG A;  5HDK A;  1YTY A;  2HYJ A;  2NNY A;  4HOB A;  4HX4 A;  2XRO A;  2EIM H;  2IA2 A;  2QEN A;  4ON0 A;  1DUX C;  4GO1 A;  2F5V A;  3HC7 A;  3BCG A;  1FWZ A;  3OL4 A;  4HF0 A;  3ULQ B;  4U0V A;  3AAF A;  3BR0 A;  3D5S C;  2V9V A;  5C4J J;  4KIB A;  3K7A J;  2HI3 A;  2MW8 A;  3LSH A;  3ZRG A;  2OTJ I;  4P1W A;  2DQR A;  2XPU A;  5BMZ A;  4L0Y B;  2WWY A;  2OZ6 A;  4BUP A;  1BR4 A;  3I55 I;  1YX3 A;  3A03 A;  5L3E A;  3PQK A;  1TT5 B;  3OYN A;  2IPQ X;  3EET A;  1Z67 A;  2F07 A;  1LFB A;  3M8J A;  1GLN A;  5HVQ C;  2R7S A;  2HU9 A;  2DMU A;  4XKW A;  4MQV A;  4HNT A;  4EJW A;  4L5J A;  5H9T A;  4ESF A;  1SFX A;  1UMQ A;  2H27 A;  2EJR A;  5A2Q Z;  1JE8 A;  4C9Y A;  1IN6 A;  2M5W A;  3FBN B;  2QSF X;  3WTT C;  1P7I A;  3QYB A;  4DJA A;  2GWR A;  4CZZ A;  1QVT A;  1Y1V J;  2IAI A;  4I01 A;  4RA2 A;  3KP2 A;  2EBI A;  4ITV A;  4HV6 A;  4RAZ A;  3VYS B;  1RI7 A;  5H6Q A;  2BW3 A;  3E6M A;  3EYY A;  2VON A;  5HNF A;  2HTS A;  2YVH A;  2VQL A;  2EA4 A;  1AU7 A;  4WWC A;  3LSK A;  3ERE D;  3T6N A;  4HA8 A;  2PI0 A;  2QA4 I;  3MNL A;  4EJV A;  2DMP A;  1LJ9 A;  4ZC3 A;  1K4S A;  1YJW I;  5F27 A;  2HS5 A;  2O9L A;  2ZKZ A;  2ECB A;  3I0T A;  3KYC B;  3OYA A;  2UXN A;  3HOZ J;  4PGH A;  1UEL B;  4AIK A;  3C2G A;  2WA0 A;  5J8F A;  3HM5 A;  5IP7 J;  4HEA 2;  4IRG A;  4FQG A;  2EIL H;  4BY1 J;  1S29 A;  3OYL A;  4KDP A;  5DAJ A;  1P4W A;  1DPR A;  2DPU A;  3HOU J;  4OIN F;  4EJU A;  4IX7 A;  4OD4 A;  2W1O A;  3J7A O;  2LOO A;  2VKE A;  5ICF A;  4O5V A;  1WGX A;  2FNA A;  1BBY A;  4HRI A;  1KU2 A;  5J3L A;  4E7S A;  2L7Z A;  2ZXH A;  3F21 A;  1R1T A;  2QM3 A;  1I1G A;  2DCE A;  1FBS A;  3BTI A;  3FXM A;  4B09 A;  1YJ9 I;  3GTO J;  5CXI A;  4D5C A;  5E3N A;  1MDM B;  2MD0 A;  4AF5 A;  3M7G A;  4F91 B;  3CJT B;  1YW8 A;  3BOQ A;  5JHF A;  5IYD J;  2AXL A;  2AS5 F;  4JKZ A;  3K4L A;  1BOA A;  1B72 A;  4PSW A;  4RGS A;  1JGG A;  2F2E A;  1GVJ A;  3HRS A;  3PNV A;  2NOJ B;  1LEB A;  3CO6 C;  1W5C C;  1U8B A;  1MIJ A;  4F93 B;  2RN7 A;  3CDH A;  1FYL A;  4E4H A;  5KAF C;  1FIA A;  1FEX A;  4B47 A;  1ON2 A;  4FAS D;  3JRI A;  4AIJ A;  2UXU A;  2DA1 A;  3RPU D;  3LA2 A;  3CP2 A;  2BBY A;  2CQQ A;  1MKM A;  2KQR A;  4RAF A;  1KQ8 A;  2DK8 A;  3GLL A;  4IF4 A;  5B5E C;  3KX2 A;  4GFK A;  1XD7 A;  1I39 A;  3LSG A;  2Z2S B;  2JRT A;  4A12 A;  1R36 A;  3E5Q A;  3K9T A;  2QTQ A;  1D8K A;  4D9J A;  1REP C;  4EGZ A;  2VXD A;  4P9F A;  4C2U A;  3WHC A;  4XLE A;  2UXP A;  4E7L A;  2Y0S A;  3WG7 H;  1R23 A;  2UXX A;  2FBQ A;  2QVO A;  4ENN A;  4L9V A;  1VQN I;  2GAU A;  4RAY A;  4ZDP A;  5GTH C;  2EWN A;  3C07 A;  3OOP A;  1YO5 C;  2QWW A;  2V9P A;  3ZR8 X;  2M30 A;  3MZ8 A;  5HAW A;  1TQI A;  1GXQ A;  2GIZ A;  4I98 B;  3IH4 A;  3BJA A;  2CYY A;  3MEX A;  2IS4 A;  2Q24 A;  1ZYR F;  1T0F A;  1TT0 A;  2EH3 A;  3KEO A;  2F5E A;  2D1H A;  3KP3 A;  2R0Q C;  2PBI A;  3L1P A;  5BPD A;  2XSJ C;  5B1B H;  4D7M A;  2CUE A;  2ZSI B;  5ICE A;  1F9N A;  3WU2 C;  2F4I A;  3CME I;  2R7R A;  4DYQ A;  3I59 B;  1I1S A;  5FLX K;  2XVC A;  1ZAR A;  2GM4 A;  3S8P A;  2FML A;  3LSJ A;  4OU0 A;  1FT9 A;  3EYI A;  5DM7 F;  2LVS A;  5EG0 A;  2RHA A;  4I0B A;  3E3V A;  1KQ9 A;  1G8X A;  1HW2 A;  4IHY A;  3GTM J;  2YX7 A;  2LK2 A;  5IOZ A;  3S2H J;  3CWR A;  1TWF J;  4AUX A;  4XSZ F;  3CCQ I;  3FHZ A;  3H3U A;  1LFU P;  5JFR A;  3UKG A;  1R4M B;  1X3Z B;  2L9S A;  4KMU X;  2BHZ A;  2OZU A;  4E6K G;  2R7F A;  3H0G J;  1E3H A;  5D4R A;  1D3Y A;  4BHC A;  2R3S A;  4PDK A;  3DKX A;  1O3Q A;  2XDV A;  5CXG A;  1R5I D;  5HS7 A;  4BNC A;  3VVZ A;  2M1B A;  1N78 A;  4DW6 A;  1V5F A;  1F36 A;  2IP2 A;  3K2Z A;  4EQQ A;  3RSN A;  3TQN A;  5M5W J;  2DMQ A;  2VBW A;  1JT0 A;  4UXN A;  4IRH A;  2NVU B;  4AID A;  2UXO A;  2PJP A;  5ED4 A;  4JOM A;  5K5O A;  2L9V A;  3GW2 A;  3GYH X;  5F64 A;  2KLO A;  2DAO A;  2CV0 A;  4UY8 I;  3P9T A;  3DKY A;  3I4M J;  3GEZ A;  2O7O A;  3T8R A;  5BPI A;  4LG0 B;  3GUD A;  3HIM A;  4QPO A;  3RD3 A;  2M2E A;  4KN4 X;  4XRS G;  3LA3 A;  2A07 F;  2VB6 A;  2QWT A;  4MIM A;  1RZ4 A;  1A31 A;  1WH7 A;  2OD5 A;  2HQA A;  3BTC A;  3HSE A;  5K7F A;  4BE2 A;  4UNO A;  2NS7 A;  3FM3 A;  1CQT A;  4U0Y A;  1YHQ I;  3G1L A;  4M3E A;  2A5Y B;  4YIR X;  1FIP A;  3FX3 A;  3QBM A;  2FNP A;  2HDW A;  3L2U A;  3I58 A;  2K27 A;  2E7W A;  2LR8 A;  2CUJ A;  1VQ9 I;  3CJD A;  2GZW A;  3E5X A;  2V1U A;  2F4O B;  4MFD A;  5F1R A;  2UXI A;  2QQ8 A;  3PO2 J;  1JXS A;  2QKO A;  1GXP A;  2E5N A;  1Q1H A;  3H35 A;  4JK1 X;  1E0E A;  1XSD A;  3DU6 A;  3OOU A;  3I56 I;  5M3M J;  2JRM A;  2V26 A;  5K5R A;  3LSR A;  2NNN A;  5HLT A;  4UVB A;  2ZME B;  2IGO A;  3JRB A;  2X1E A;  3K1P A;  1R71 A;  5FRO A;  3RKY A;  1U8R A;  2OV7 A;  3QKX A;  1ZK8 A;  5C4Y A;  3HGG A;  1MGT A;  1MMG A;  3CCR I;  1A04 A;  1RNL A;  1IUY A;  4MNU A;  1Q1V A;  4AYB A;  3GTG J;  5EGO A;  2PMZ N;  2VIX A;  1N25 A;  4LIV A;  3LAJ A;  1UHW A;  3FXQ A;  5A2Q K;  3CJN A;  1OMI A;  4I2O A;  2ZME A;  2H1L A;  2NVY J;  2LP0 A;  2JA8 J;  2VOO A;  5DTD A;  3DLA A;  3QWL A;  2E36 A;  1I6H J;  2X6O A;  3DWL E;  2DYS H;  3N97 A;  4G7O F;  1WI9 A;  4FHT A;  2QEX I;  2KIM A;  2BXZ A;  4MHG A;  3S5R A;  5LEJ A;  3SYT A;  2XF6 A;  4F52 A;  5EF6 A;  2OQR A;  4S05 A;  3DBR B;  2GLO A;  4KIT B;  4HKU A;  2I10 A;  2IBD A;  4XOP A;  2VLA A;  1IG7 A;  2D6Y A;  2GBY A;  2GQQ A;  1K6Y A;  2KIQ A;  3LQR A;  2WUI A;  3MWM A;  5DUI A;  3GZ6 A;  3GTL J;  2EIJ H;  2KFD A;  2EV6 A;  2COM A;  2EIN H;  1R22 A;  3BWG A;  1YG2 A;  2KP6 A;  2JWT A;  2BEO A;  2XAH A;  2F6C A;  2LBF A;  5EYR A;  4C2M A;  4CSW A;  1DPU A;  1IJW C;  4NEL A;  3EGQ A;  3ABU A;  3E6B A;  3MQ0 A;  2L2O A;  3F8C A;  3GTK J;  2VBZ A;  2X9D A;  4XSX F;  5J1U A;  3S2W A;  1L3L A;  3CUQ A;  3A01 B;  4IO9 F;  2JT1 A;  3BNI A;  2B0L A;  5J40 A;  5GAD J;  3IAS 2;  2FXA A;  3ZN0 A;  3KPH A;  1FX7 A;  4XKC A;  5BS6 A;  1WCM J;  2K4B A;  2ZXI A;  3OIP A;  4BGD A;  1W0T A;  3RYR A;  1CF7 B;  3AQT A;  4UB8 C;  3IH2 A;  3VVY A;  5K58 A;  3IUO A;  1JUP A;  4X0G A;  2IVM A;  2X48 A;  1B4A A;  4N4N B;  4HSR A;  5DDG A;  2ZXW H;  1YRN A;  1V5E A;  4OIP F;  4LD5 A;  1I6X A;  5JVT A;  5KCM A;  1IXR C;  3FIW A;  4CHU A;  1KYW A;  4XKV A;  1RRJ A;  1RR8 C;  3NI7 A;  3DEU A;  3Q9S A;  2NX4 A;  1XS9 A;  1S6L A;  2DFE A;  4NC6 A;  3GXO A;  1JTX A;  1OR7 C;  2X4H A;  1PYV A;  5DD8 A;  3RCO A;  1DU0 A;  3HGY A;  4UDS A;  4HST A;  1OCP A;  1Z05 A;  2M0C A;  2ESH A;  4D7N A;  1YS6 A;  3J80 Z;  5GP9 A;  3SEZ A;  2K7L A;  1NH3 A;  3A0H C;  3O60 A;  2ZSH B;  2ZO4 A;  3F72 A;  2ICW G;  3O3K A;  3CCL I;  1AA7 A;  2XRL A;  3DP7 A;  3HG9 A;  3S32 A;  1ZR2 A;  2YU9 J;  3Q0V A;  3CCS I;  2Z9O A;  4Y17 A;  2L0K A;  1HKT A;  3S1M J;  5GAH J;  2LY9 A;  3CMA I;  3E6C C;  1BC7 C;  5CVR A;  4BAC A;  5J4V A;  2NVX J;  1MBE A;  3HSR A;  3P9C A;  2M87 A;  4KN7 X;  1B8I B;  3HPH A;  2O7T A;  2VOP A;  1BJZ A;  5DM6 F;  4BDY A;  3ZMD A;  3WU1 B;  2VT2 A;  3TOB A;  5E1Z B;  4M9X A;  9ANT A;  4LFU A;  3VVX A;  4AC0 A;  1Y39 A;  2VQC A;  2AO9 A;  1P4A A;  3FWE A;  3R0A A;  4L9J A;  2V9K A;  2IA1 A;  2MSY A;  2HYF A;  2L9R A;  2DOE A;  4HBL A;  1GHC A;  2QZ8 A;  1S8N A;  1XMK A;  2H6C A;  2ELK A;  3S3N A;  1Z7L A;  3AG3 H;  4GXO A;  3BRU A;  1BR2 A;  3OR2 C;  3OYJ A;  1TWA J;  3BJ6 A;  2E2J J;  4L9N A;  3AL0 C;  1Z9C A;  3L2V A;  1GUU A;  3O2P E;  1X1A A; 
#chains in the Genus database with same CATH homology
 3BCG A;  3E7Q A;  4B4C A;  3NNR A;  2EZH A;  3BR0 A;  5C4J J;  3BG5 A;  2Y31 A;  3K7A J;  2LFB A;  2HI3 A;  2MW8 A;  1K83 J;  2K9S A;  3QPS A;  3TW7 A;  4JYK A;  2LD5 A;  2JA5 J;  4A3C J;  2RAE A;  2FX0 A;  2XPU A;  2KT0 A;  3LSP A;  5EZG A;  2HXI A;  5F08 A;  3HTI A;  3K2A A;  4M3G A;  4BY7 J;  3MKL A;  3A03 A;  4QSH A;  1XC5 A;  2HXO A;  3DEW A;  1VF9 A;  1OJL A;  2OER A;  1SGM A;  3NAR A;  2F07 A;  2RAS A;  1IV6 A;  3NAU A;  1LFB A;  2ZB9 A;  1ZGW A;  3O8G A;  1GVD A;  2DMU A;  5FMP A;  3MVP A;  3NXC A;  2IU5 A;  1Y1W J;  5H9T A;  4A3G J;  1UMQ A;  2W48 A;  1YRN B;  3W6V A;  1GT0 C;  4A3J J;  4NDL A;  4CYC A;  3JRG A;  2NS8 A;  2WV1 A;  4KWA A;  2MG4 A;  1P7I A;  3HOW J;  2B63 J;  4Y52 J;  2R5Z B;  3G1M A;  4BXX J;  5C44 J;  1HDP A;  3LJL A;  2GFN A;  4DYC A;  3HEF A;  1QVT A;  1Y1V J;  2DTZ A;  2ECC A;  3TP3 A;  2R5Y B;  2HOT A;  2R93 J;  2IAI A;  4A3D J;  3SFI A;  1ETW A;  2EBI A;  2Y9Y A;  1PUF B;  3VW2 A;  3DPJ A;  2YVH A;  3ZQL A;  2JA6 J;  3E7L A;  1AU7 A;  3T6N A;  2UXH A;  4X1E A;  4V2F A;  3MNL A;  2DMP A;  3HOV J;  2M34 A;  4BBS J;  1R9T J;  1ENH A;  2E1O A;  5F27 A;  3NPI A;  2CUF A;  2O9L A;  2ECB A;  2QIB A;  3ZQC A;  3CCY A;  3HOZ J;  1ORK A;  2DA6 A;  3FKI J;  2NVT J;  5M3F J;  3HM5 A;  3FRQ A;  3QQA A;  5IP7 J;  2DG8 A;  4RBO A;  3Q0U A;  4IHW A;  5BNG A;  4BY1 J;  5FKL A;  3CDL A;  3JR9 A;  2WAQ N;  2L7F P;  5GPA A;  5DAJ A;  1FTT A;  1MNM C;  4Y7N J;  3HOU J;  2E2I J;  2XPV A;  4C3H J;  3WHB A;  1K61 A;  5F04 A;  2VKE A;  1HLV A;  1IDY A;  5IP6 A;  3COL A;  1IUF A;  1WGX A;  2JJ7 A;  1D5Y A;  5HOD A;  3G7R A;  1ITY A;  5J3L A;  2L7Z A;  4A3B J;  4IHX A;  1RPW A;  1U9O A;  4JX5 A;  4V2G A;  4JNN A;  2XGC A;  4J19 A;  3D1N I;  2GEN A;  3BTI A;  1NTC A;  3BT9 A;  3GTO J;  2D5V A;  1AHD P;  5CXI A;  4D5C A;  5E3N A;  4JL3 A;  3SJM A;  4IHV A;  2M9H A;  3VOX A;  3B81 A;  4AF5 A;  1JKO C;  4JP0 A;  1T33 A;  3JRF A;  5IYD J;  4ICH A;  4XK4 A;  1HF0 A;  3S17 J;  4JKZ A;  1ETO A;  1B72 A;  2R92 J;  1MBH A;  4X6A J;  4M3B A;  2DMN A;  1JGG A;  3Q0W A;  5FLM J;  2M8G X;  2CRG A;  1U8B A;  3BQZ A;  4A3K J;  4XID A;  1FIA A;  1FEX A;  4C3I J;  3JRI A;  2UXU A;  2DA1 A;  2Y30 A;  1JKR C;  2Y9Z A;  2ZOY A;  2CQQ A;  5FKK A;  1JUM A;  1ZTR A;  3GEU A;  2DG7 A;  5M5X J;  3VW1 A;  4GFK A;  3LSG A;  2K9Q A;  5EFY A;  5FJ8 J;  1VND A;  3BQY A;  2ID6 A;  2JN6 A;  2XDN A;  2ZOZ A;  2QTQ A;  5FGL A;  4MLO A;  3RH2 A;  3HDD A;  3WHC A;  2UXP A;  2LTP A;  1P7J A;  2XGD A;  2FBQ A;  3S1N J;  4GFL A;  1QRY A;  2NP5 A;  3PO3 J;  4CYC B;  4UUS B;  5HBU A;  1JJ6 C;  4MK6 A;  2DA3 A;  4NN1 A;  1Z0X A;  3C07 A;  1UI6 A;  1UG2 A;  5EDN A;  3CRJ A;  1JTY A;  2DA4 A;  5JLX A;  2LKX A;  3S15 J;  3B6A A;  3SDG A;  5HAW A;  4FCY A;  1GV2 A;  1T56 A;  4G12 A;  3JRE A;  3KKD A;  3VP5 A;  3IH4 A;  2PBX A;  4B1R A;  3HTH A;  4PXI A;  5K7H A;  1JUS A;  2REK A;  1JKQ C;  2Q24 A;  2HQ5 A;  2EH3 A;  5F1J A;  1MBK A;  2XSD C;  3RQI A;  2EQR A;  5IOY A;  1EF4 A;  2R0Q C;  3DCF A;  4DZP A;  3L1P A;  1BW6 A;  4UUS A;  3A02 A;  2OF7 A;  4D7M A;  1RR7 A;  2CUE A;  2DA7 A;  1MH4 A;  3BTJ A;  4DYQ A;  1A5J A;  1UI5 A;  2NVQ J;  3BR3 A;  3OIO A;  2GM4 A;  3LSJ A;  4W97 A;  2TCT A;  5EG0 A;  2LVS A;  3JSJ A;  2RHA A;  2DJN A;  2VUM J;  1U9N A;  1XG1 A;  2HOA A;  3CMY A;  1RKT A;  5CW8 A;  2HYT A;  4IEJ A;  4IHY A;  2IEK A;  3GTM J;  3GBG A;  2LK2 A;  5IOZ A;  3S2H J;  2HDD A;  3CWR A;  1TWF J;  4AUX A;  1LFU P;  3UKG A;  3RKQ A;  3H0G J;  3IH3 A;  3F0C A;  3EUP A;  2VKV A;  4GCK A;  3H3V K;  1QVU A;  1ETV A;  3TP0 A;  3QPL A;  1MH3 A;  4XRS A;  5CXG A;  5D19 A;  2KDZ A;  2PZ9 A;  1ETQ A;  4XRM A;  3VVZ A;  3LHQ A;  1O4X A;  4DW6 A;  2GUH A;  5J1Y A;  1F36 A;  5FHP A;  5M5W J;  1IDZ A;  1SAN A;  2DMQ A;  3BR6 A;  2NP3 A;  3OSF A;  1I50 J;  1JT0 A;  3VPR A;  3M3Y J;  3G1O A;  2UXO A;  3V6G A;  1NK3 P;  4GCT A;  1B72 B;  4JX4 A;  1G2H A;  1VI0 A;  2ZCM A;  1TWH J;  2VI6 A;  4DYR A;  1FJL A;  4BKX A;  3A01 A;  2FQ4 A;  3RZD J;  3P9T A;  1X58 A;  2LLK A;  1A6I A;  1APL C;  3I4M J;  2G0E A;  2O7O A;  1HCR A;  3HIM A;  1IC8 A;  3RD3 A;  2M2E A;  4XRS G;  5FKO A;  2Y0S N;  5E3L A;  5M5Y J;  2AHQ A;  2CJJ A;  3KKC A;  2QWT A;  3PAS A;  5IPA A;  4MIM A;  3BHQ A;  2QCO A;  3BTL A;  1WH7 A;  5EZH A;  5K7F A;  3BTC A;  4A3L J;  1ETK A;  1LE8 B;  1RET A;  2NS7 A;  4ME9 A;  2G7G A;  1ZQ3 P;  1CQT A;  3CQZ J;  3G1L A;  4M3E A;  1FIP A;  1UHS A;  3QBM A;  3S14 J;  3M4O J;  3LWJ A;  1RES A;  2LR8 A;  1RKW A;  3CJD A;  5J1R A;  4FE7 A;  4MFD A;  2UXI A;  3BG3 A;  3KZ9 A;  3PPB A;  3I4N J;  1ETY A;  4XIC A;  3PO2 J;  2QKO A;  4FIS A;  4QIW N;  5EEA A;  1GDT A;  2WGB A;  1I3Q J;  4HNV A;  3OOU A;  3BR1 A;  1LE8 A;  2EZK A;  5DS9 A;  5M3M J;  1BL0 A;  2YUS A;  3LSR A;  4FTH A;  2CQX A;  3JRB A;  2QF7 A;  3QKX A;  4MXM A;  1X2M A;  4A3E J;  2DMT A;  1ZK8 A;  2N8G A;  3HOX J;  5C4Y A;  3HOY J;  3HGG A;  2G7L A;  2W53 A;  1MSF C;  2H8R A;  2K9N A;  1MBJ A;  1Q1V A;  3OSG A;  1B8I A;  3GTG J;  1MBF A;  2E19 A;  5EGO A;  2PMZ N;  3TED A;  1H88 C;  1OCT C;  3ANG A;  4W1U A;  4I6Z A;  2EZI A;  1WH5 A;  5C3E J;  2YS9 A;  2JMW A;  3BR5 A;  4C3J J;  3JRC A;  5EG0 B;  3MN2 A;  2NVY J;  2LP0 A;  1F43 A;  2JA8 J;  5DTD A;  3GZI A;  1VFC A;  4A3F J;  3HTJ A;  4MO7 A;  1I6H J;  2L7M P;  2X6O A;  2FD5 A;  4A93 J;  3LNQ A;  2DA2 A;  3S5R A;  3FK7 A;  2XGE A;  5EF6 A;  3JRD A;  2GLO A;  2HKU A;  2ZCN A;  1JJ8 C;  1ETX A;  4HKU A;  3B6C A;  2I10 A;  2IBD A;  1IG7 A;  2HOS A;  4M3F A;  2D6Y A;  2GBY A;  5D1R A;  2WUI A;  2Y2Z A;  3LOC A;  3TW6 A;  3JRA A;  1QPI A;  3VIB A;  2COB A;  3GTJ J;  5JLW A;  4I76 A;  1MSE C;  3GTL J;  5E3M A;  2G7S A;  1U78 A;  1BA5 A;  1NK2 P;  2JWT A;  1E3O C;  4ACI A;  3PM1 A;  4A69 C;  1ZR4 A;  5EYR A;  3F1B A;  4NEL A;  2ZCX A;  1IJW C;  3EGQ A;  1TC3 C;  2XPW A;  2H1K A;  3V78 A;  4A3I J;  3GTK J;  2G3B A;  2V57 A;  5AQC A;  2XB0 X;  4FE4 A;  2X9D A;  5J1U A;  3A01 B;  1HDD C;  4L62 A;  2OI8 A;  3BNI A;  3VUQ A;  4RDU A;  3IV5 A;  4MFE A;  2E2H J;  3GTP J;  1WCM J;  4EEF G;  2EZL A;  4LOC A;  3HTA A;  5F0C A;  4L5E A;  5F0F A;  1W0T A;  1H89 C;  2XB5 A;  5FKN A;  5IP9 J;  3AQT A;  3ON4 A;  3Q3S A;  3IH2 A;  3S16 J;  3VVY A;  3AQS A;  2DN0 A;  3ZOB A;  5K58 A;  1JUP A;  2X48 A;  3HKZ N;  3GTQ J;  1TWG J;  4A3M J;  1YRN A;  5D18 A;  1AKH B;  5FLV A;  1MBG A;  1JT6 A;  4C2M J;  1X2N A;  2JA7 J;  3S1R J;  3S2D J;  3FIW A;  3IUV A;  1WPK A;  3BR2 A;  4AC6 A;  2ME6 A;  2R5Z A;  1IGN A;  3KNW A;  3VW0 A;  3NI7 A;  1GV5 A;  3ON2 A;  2NX4 A;  1XS9 A;  3RZO J;  3ANP A;  2FJ1 A;  3C2B A;  2DA5 A;  2R5Y A;  1FTZ A;  3NRG A;  1H8A C;  3S1Q J;  1TWC J;  1Z77 A;  1BW5 A;  3ZQF A;  1JTX A;  4UDS A;  1DU0 A;  3HGY A;  1PUF A;  4B3A A;  1OCP A;  4BBR J;  2M0C A;  4D7N A;  5GP9 A;  3G56 A;  4CGR A;  3BG9 A;  1AKH A;  4AYB N;  3JRH A;  3O60 A;  2O8K A;  2XRL A;  1SFO J;  1OFC X;  1JKP C;  4D5F A;  3HBL A;  4S0H B;  4DZJ A;  4QTR A;  2CU7 A;  1ZR2 A;  2ME0 A;  4ABZ A;  2YU9 J;  3Q0V A;  4M3D A;  2L0K A;  3FK6 A;  1HOM A;  5K7Z A;  3ZQH A;  2TRT A;  3S1M J;  2LY9 A;  5GPC A;  2NVX J;  2WB1 N;  3FIS A;  2VPR A;  1MBE A;  2YVE A;  2QOP A;  1B8I B;  2OPT A;  2O7T A;  5EGO B;  4JX6 A;  1BJZ A;  5FKM A;  1IRZ A;  2K40 A;  1WI3 A;  1DU6 A;  9ANT A;  5F0H A;  3VVX A;  4AC0 A;  5C4X J;  4M6V A;  2MGQ A;  3ZQI A;  2AO9 A;  5IYC J;  4GCL A;  2P81 A;  2MSY A;  2L9R A;  3VOK A;  2NOG A;  3BJB A;  4YZE A;  1POG A;  2JK3 A;  3O8H A;  1S7E A;  5HSZ A;  2ELK A;  3HE0 A;  3BRU A;  5E3O A;  1TWA J;  1ZKG A;  5IYB J;  3HB9 A;  2R7Z J;  2E2J J;  4UUT A;  3ZQG A;  2HYJ A;  4GFB A;  2ID3 A;  1GUU A;  1W0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...