3FIWA

Structure of sco0253, a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
173
Chain Sequence
KMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAEIDHESAFEAGLALITDGLVRHVDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title Structure of SCO0253, a Tetr-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription regulator
total genus 56
structure length 173
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fiwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3fiwA02
4GCTA 5IOYA 3DCFA 4M3BA 2XRLA 3B6AA 1IV6A 2NP3A 2UXOA 2WV1A 1B8IA 2IU5A 3COLA 3EUPA 5EDNA 3HOZJ 3LHQA 2E1OA 4A69C 2XB5A 4NN1A 3NXCA 1ETXA 2G7GA 3LSJA 3Q0WA 3Q3SA 5AQCA 1TWGJ 5HSZA 1WH7A 1HOMA 2NVYJ 3HTHA 1ZR2A 4M3FA 1JKPC 2PMZN 4L62A 1P7IA 2DN0A 2HKUA 4XK4A 3ON2A 2JWTA 3VVYA 1W0UA 1HDPA 5IP7J 3TP3A 3T6NA 3JRCA 4AC0A 1K83J 1JT6A 3GTPJ 5CXIA 2O7OA 3HEFA 4M6VA 1JUPA 3HOXJ 2GM4A 4JNNA 3A02A 2MG4A 4W1UA 1NK3P 3KNWA 1ETYA 3FISA 5EZGA 3HE0A 2VKEA 5FKLA 1MBKA 3QPLA 1ZQ3P 4PXIA 1BW5A 1UHSA 2LKXA 1AKHA 2LR8A 2ME6A 2IAIA 2ZCNA 5F08A 4LOCA 1WGXA 5EGOA 2FBQA 5K58A 4A3BJ 3SDGA 1LFBA 1HLVA 4XRSA 2NVTJ 3DEWA 5FKOA 3HGYA 2P81A 2WGBA 2DMUA 3FK7A 3H0GJ 3FKIJ 2L9RA 5HAWA 1FIAA 2CQXA 3ON4A 2Y2ZA 1JKOC 2NP5A 2REKA 2GBYA 2L7FP 2EQRA 2JMWA 1B72B 2LP0A 1SFOJ 1POGA 2WAQN 2EZLA 3O8HA 1JKRC 1UMQA 4XICA 4M3GA 2HOSA 1ZTRA 2TCTA 3B81A 2HOTA 1Q1VA 2R5ZB 4S0HB 2DMQA 3GTKJ 3NNRA 2HDDA 4B3AA 3FIWA 3G56A 4ICHA 3S1MJ 1MH3A 5FHPA 4DYRA 3E7QA 5H9TA 2UXUA 1HDDC 4AF5A 1PUFB 1Z0XA 3VW0A 2YS9A 3BJBA 2X48A 1QVTA 3FK6A 3W6VA 5F0HA 3P9TA 1JUSA 3GBGA 4UUSB 4HKUA 1MBJA 3CQZJ 1RKWA 3S1RJ 4BKXA 1SGMA 3KKDA 1FTZA 3WHCA 2NS8A 2ME0A 4FE4A 2H8RA 3PO2J 2QF7A 2G0EA 4QSHA 2K9QA 4GCKA 3ZQLA 5F0FA 1IJWC 4A3GJ 4RDUA 2EH3A 3FRQA 3JREA 2CJJA 1VI0A 2OERA 4C3IJ 1HCRA 4JX4A 3A03A 5DTDA 3PO3J 5M3FJ 1X2MA 2DG8A 4GFKA 2GUHA 2XPUA 1TWFJ 2IEKA 1XS9A 1Y1WJ 5C4YA 5D18A 3S17J 3V78A 4X1EA 2M2EA 2R5YB 3DPJA 2OI8A 1ZK8A 2CUFA 2FD5A 1DU0A 5GPCA 3QKXA 2UXIA 3LOCA 1Y1VJ 4GFBA 4A3MJ 1RR7A 3OSFA 1K61A 2M8GX 2Y0SN 3I4MJ 4XIDA 3GTJJ 4D7NA 2L7MP 3M4OJ 1T33A 3LSPA 4RBOA 2O8KA 2XDNA 1UG2A 4V2FA 5J1UA 1IC8A 1LFUP 3HBLA 4FE7A 1ETKA 2YU9J 4X6AJ 1ZR4A 3NRGA 3BRUA 2M34A 3SFIA 4HNVA 1FIPA 1ENHA 4A3LJ 1U9OA 4NELA 1IG7A 2PZ9A 3HM5A 4QIWN 5EFYA 1OCTC 5HBUA 2AO9A 2RAEA 3JRDA 3GTMJ 1ETOA 3VPRA 2L7ZA 1F43A 4KWAA 4BXXJ 4BBSJ 2W53A 2LY9A 2G3BA 3HKZN 3CMYA 4MLOA 5E3LA 1ITYA 1ZKGA 3K7AJ 5EYRA 1H88C 3CRJA 1MBHA 3NI7A 2DMTA 2TRTA 2KT0A 1U9NA 2LTPA 3QQAA 2CRGA 2DJNA 2JJ7A 3BG9A 3BR5A 1MNMC 3S2DJ 2ZCMA 3ANPA 5CXGA 3RZOJ 1A6IA 2XGEA 3HOUJ 3CDLA 2AHQA 3S1NJ 1FJLA 5F0CA 2I10A 4AYBN 2OF7A 2ZCXA 3IH3A 1TWCJ 3ZQGA 3HOVJ 3TW7A 1UI6A 4JKZA 3CWRA 4A3KJ 2DA3A 3BTLA 5C4JJ 3EGQA 4B4CA 3BR0A 3VIBA 2E2JJ 1W0TA 1E3OC 3NAUA 1YRNB 1AKHB 2O7TA 3VOXA 2K9NA 3WHBA 3QBMA 2Y30A 3BG3A 3H3VK 5HODA 2D6YA 3BT9A 3BQYA 3G1LA 1S7EA 1JJ6C 4UUTA 1A5JA 3BNIA 4CYCA 3BQZA 1QVUA 2XPVA 2COBA 5J3LA 3I4NJ 3G7RA 1ETWA 4AUXA 1OJLA 3A01B 2Y9ZA 2R93J 2LLKA 2JA6J 5IP9J 1B72A 4M3DA 1RKTA 5FKKA 2VKVA 1JTYA 2V57A 4UDSA 3ZQCA 1XG1A 3ZQFA 4GCLA 5FKMA 5D19A 3TEDA 1MSFC 2R5ZA 2CQQA 3TW6A 1QPIA 2NS7A 2ID3A 1ETVA 3IV5A 3JRIA 5IPAA 4A3IJ 1IDZA 5E3NA 3HTJA 1I3QJ 2QWTA 3E7LA 4MIMA 3OIOA 1PUFA 3VVXA 2DA4A 4L5EA 3MKLA 4FTHA 3G1OA 5BNGA 5E3MA 4Y52J 4UUSA 1TC3C 4XRSG 5DS9A 1JTXA 2K9SA 2CU7A 4M3EA 5E3OA 2GFNA 2ECBA 3HTAA 2M0CA 3GTQJ 3RH2A 2DMPA 2LFBA 4C2MJ 3D1NI 3O60A 1RPWA 2DTZA 1WPKA 1O4XA 3HB9A 1I6HJ 2EZIA 3BR6A 3MVPA 5IYDJ 4IHYA 4BBRJ 3AQTA 3VW1A 2DA1A 3IUVA 1JUMA 1APLC 5K7ZA 4V2GA 5IP6A 1RETA 4Y7NJ 2DA6A 2WB1N 1EF4A 2RHAA 3GZIA 1MBFA 3VVZA 1X2NA 4NDLA 2ID6A 1HF0A 2M9HA 5IYBJ 1WI3A 1JT0A 2JA5J 5M3MJ 3QPSA 4A3DJ 2VPRA 3F0CA 1NTCA 1LE8B 2VI6A 2R5YA 4D5CA 5EG0B 3CCYA 3RKQA 4W97A 2R7ZJ 3Q0UA 5IYCJ 4C3JJ 2QCOA 4DZJA 1BA5A 3VOKA 2HXOA 2NVQJ 2ZOYA 2Y9YA 3OSGA 1D5YA 3F1BA 4MFDA 3LSRA 3ZQHA 1JJ8C 3ANGA 3HGGA 1ORKA 1OFCX 2L0KA 4G12A 1GUUA 4B1RA 1XC5A 2DMNA 1VNDA 2ECCA 2E2HJ 1FEXA 2H1KA 1F36A 2WUIA 3BR2A 5K7HA 2XGCA 3TP0A 5GP9A 2R92J 3K2AA 4I76A 2JN6A 2YUSA 1H8AC 1B8IB 9ANTA 2DG7A 1BJZA 3BTCA 1GT0C 2F07A 3M3YJ 1T56A 2KDZA 2MSYA 2FQ4A 2JA8J 1ETQA 2HYJA 5F27A 1JGGA 3PM1A 5GPAA 4JL3A 2YVHA 1I50J 2HYTA 2X6OA 3PASA 3IH4A 3HTIA 3LWJA 2XB0X 1WH5A 3KKCA 2MW8A 2QOPA 3S2HJ 2UXPA 4MK6A 1MBEA 3BR3A 3L1PA 3RD3A 5FKNA 3LNQA 5FMPA 2Q24A 3HIMA 1ZGWA 3SJMA 5CW8A 4DYQA 1QRYA 2EBIA 4DZPA 1CQTA 3V6GA 1R9TJ 2E19A 4JX6A 3JRGA 3VP5A 1G2HA 2FX0A 3GTGJ 2HXIA 5M5WJ 3BHQA 1GDTA 3HOYJ 5EGOB 2GENA 2UXHA 2XSDC 5FGLA 1DU6A 2QKOA 1UI5A 4ME9A 4JYKA 3GEUA 3JRHA 2DA5A 3JRBA 3VUQA 3LJLA 2EZHA 4D5FA 2XPWA 1YRNA 1X58A 2HI3A 5JLXA 3BG5A 2K40A 1MSEC 3GTLJ 5FLVA 5D1RA 1BL0A 4A3EJ 2JK3A 2NOGA 4CGRA 4J19A 2QIBA 2N8GA 2DA7A 3C07A 4JP0A 3ZQIA 5M5YJ 4MFEA 1TWHJ 3C2BA 1IGNA 3RQIA 2G7LA 1SANA 2EZKA 3JRAA 1WCMJ 4QTRA 4JX5A 4CYCB 3A01A 3NPIA 2NVXJ 1AU7A 5FLMJ 1MH4A 3OOUA 1IDYA 5F04A 5C44J 1AHDP 1BW6A 2W48A 4C3HJ 2LVSA 2G7SA 5C4XJ 2HOAA 5F1JA 2XGDA 2NX4A 1IRZA 1VFCA 3ZOBA 5DAJA 3HOWJ 4A3JJ 4A3CJ 3JSJA 5J1RA 2MGQA 3NARA 4ACIA 3S16J 3MNLA 2LK2A 2LD5A 2IBDA 2FJ1A 4IEJA 1RESA 3BCGA 4YZEA 2R0QC 2B63J 3O8GA 5IOZA 1VF9A 4ABZA 2O9LA 4IHWA 1Z77A 4XRMA 3S15J 1JKQC 3GTOJ 2DA2A 2QTQA 3CJDA 1GV2A 3AQSA 3BTIA 1MBGA 2ELKA 2JA7J 3S14J 3BR1A 3LSGA 3UKGA 2VUMJ 3G1MA 4GFLA 2D5VA 4MO7A 4AC6A 2ZB9A 1TWAJ 3JR9A 3RZDJ 1GVDA 1OCPA 4DW6A 4FISA 3S5RA 2X9DA 2RASA 1GV5A 2PBXA 5M5XJ 3PPBA 4A93J 3Q0VA 5EEAA 1IUFA 5EF6A 2E2IJ 4IHXA 1NK2P 1LE8A 2CUEA 5EG0A 4MXMA 3B6CA 3KZ9A 4FCYA 3IH2A 1P7JA 5K7FA 4IHVA 5JLWA 1U8BA 1FTTA 2Y31A 2ZOZA 1H89C 2GLOA 4BY7J 3HDDA 4DYCA 5J1YA 2OPTA 3JRFA 2HQ5A 3BTJA 2YVEA 3S1QJ 5C3EJ 1U78A 5FJ8J 3VW2A 4I6ZA 4A3FJ 3MN2A 5EZHA 4EEFG 4BY1J 4D7MA
chains in the Genus database with same CATH superfamily
3KIOA 4R1HA 4GCTA 2WBMA 2NP3A 1D8KA 3OYFA 3K4KA 4ZC3A 2WV1A 4G7OF 3MZ8A 3NWSA 2RC4A 4A0XA 2BY2A 2XAGA 1VQPI 1TP4A 2AQFA 2E1OA 4GCVA 4A69C 1ETXA 1J5YA 2BBYA 3FBIB 1R5HA 3Q0WA 5AQCA 4XKWA 3GFIA 1TWGJ 5HSZA 3DPTA 2IGMA 3HTHA 4L62A 2PMZN 2ELJA 2C6YA 4BS9A 1T8IA 4LB6B 5HDNA 3TP3A 5K5QA 3GTPJ 3L2WA 2B3WA 5K5OA 4OWRB 2OUMA 1U5TB 2PFVA 5CXIA 2O7OA 4M6VA 1O3SA 2VJJA 2KP6A 1DDNA 1NK3P 3KNWA 1H0MA 3OYLA 3HE0A 3QOEA 4KFCA 3QPLA 1ZQ3P 3PIPF 5CJ9A 2LKXA 2IAIA 4XONA 2XKPA 2LSOA 2V1NA 2FBQA 1WHUA 2UV1A 3K9TA 4LD5A 3N97A 1MDMA 3HGYA 5K5RA 3ECHA 1G3WA 2FNAA 4LG3A 1G6NA 3FKIJ 2CQNA 2CUZA 4UHTA 1U5TC 2DDBA 1BI3A 3ON4A 3I71A 1WKMA 2XASA 1N75A 1VQLI 2LOOA 1SFXA 2REKA 5JFRA 2DODA 1KYWA 2LP0A 2EINH 2WAQN 3O8HA 2YX4A 1Y6IA 2G9WA 1T08B 2TCTA 1GVJA 3H9QA 3IKVA 4Y15A 4PFPA 3G73A 2JZYA 2VL8A 3WU1B 2OBPA 4XNFA 1BC8C 2JTVA 4KIFA 4XLPF 4CCLA 3PIOF 4EJVA 3HOSA 3S1MJ 2B1EA 1MH3A 3MZHA 2NRAC 3ZCOA 3GX4X 4AF5A 2XSJC 1QBJA 3VW0A 3AL0C 1QZYA 1QVTA 2X48A 2EK5A 1YW8A 3FK6A 5FFZA 4FT8A 3W6KB 3W6VA 1TNTA 2BY3A 4UUSB 2OTJI 4XBFA 3CQZJ 1TW3A 3OS1A 4I99C 1Q1HA 3KKDA 3KP3A 2KJCA 4BQQA 2OA4A 3J80K 2ME0A 2MLKA 2H8RA 4MTEA 4U9NA 2QF7A 2G0EA 1T39A 3V8LA 4UY8I 1VQNI 3CD6I 2ZBKA 1A31A 4EGYA 2EH3A 2JRTA 3GYHX 2OERA 2MD0A 4C3IJ 4JX4A 2DFEA 1W7PD 3RPQA 2EFPA 1ULYA 3BZ6A 5J4YA 2ZFWA 4LITA 1Y1WJ 5C4YA 4Q47A 1E17A 4X1EA 3NEUA 2P7VB 3SZPA 1T2KA 2M2EA 1G59A 4BU2A 2K86A 4HOBA 2FD5A 2LYCA 2VASA 2R7OA 3LOCA 3TL4X 2HWVA 2CWEA 2W4SA 4XLNF 4GFBA 4RAGA 1BJAA 3CP2A 4A3MJ 2E5ZA 2Y0SN 3E5QA 2MC3A 1WFXA 2XUBA 3QYFA 4YFKF 4XIDA 4RAFA 3DPUA 2RVCA 2H09A 4C9YA 4KYWA 5BPIA 2O8KA 4ASNA 1IC8A 1V5EA 1LFUP 4FE7A 4OINF 2GA1A 2AQEA 2BHYA 3NRGA 1SC7A 2ZJ2A 3H35A 4HNVA 4A3LJ 1ENHA 1IG7A 1T0FC 2L4AA 1IO2A 1QZZA 3VFZA 1IV8A 3KYDB 5EFYA 3BC8A 4ENMA 3FXOA 4I7HA 4IOCF 2K4BA 2OAZA 1F43A 2P4WA 3IUOA 2LY9A 2VIXA 3W6JB 1BM9A 3FBNB 3CMYA 1VQ6I 4C2MA 3BJOA 2ACJA 3Q5FA 2HR3A 2DFIA 3HC7A 3QQAA 4UVBA 2G7UA 3I53A 2ZCMA 3V78A 2DJNA 3MKYB 3S2DJ 2VC1A 3ANPA 4BEHA 3RZOJ 3HOUJ 1FP2A 2AHQA 3ZXSA 4CO8A 3OYBA 4BACA 2XVCA 4XORA 4P9FA 3LAPA 3I55I 3CC4I 1E2XA 2XGXA 5C4JJ 3EGQA 1MMDA 5GTHC 3BR0A 5CQEA 1OCOH 1W0TA 3GFLA 2M4KA 3TQNA 3CUQA 1AKHB 2O7TA 4UB6C 5LHIA 4M73A 4MHGA 4HLXA 2Z3YA 2A6EF 3M07A 3BG3A 3H3VK 2DOFA 2EA4A 2X1CA 5CKTA 1S7EA 4PJJA 3F8BA 3GW2A 4G8XA 5DEQA 1D1AA 4LLGF 2XPVA 3G7RA 3PJRA 4AUXA 1A6QA 2E7WA 3V8KA 2W1OA 1WWXA 2LLKA 2OD5A 4XN0A 3KLOA 1B72A 2QEXI 2HVRA 3SQNA 1LEAA 5L3CA 4GGGA 1TZLA 2BVMA 1W36C 1XG1A 3LFUA 2IGOA 5J4VA 2F48A 3S2WA 1FOXA 2FBKA 2CQQA 3TW6A 1LDDA 2ID3A 4KITB 3F72A 4A3IJ 2QENA 4IQ4A 3E0JB 2FMYA 1FLIA 3T5XA 2Z99A 3M1EA 4MIMA 5KVRA 1PUFA 3VVXA 2DPUA 2BW3B 4CH7A 4F7ZA 1TC3C 4XRSG 1BIBA 4BHBA 1JTXA 2QQAA 2PFBA 1IF1A 2ECBA 3HTAA 2M0CA 4BQOA 2O61A 2DMPA 4C2MJ 1PJRA 1U0JA 2DCEA 3BROA 3F21A 2FOWA 4LK0F 1WRJA 2Z1DA 1SVLA 4ZTFA 3BR6A 3MVPA 4IHYA 3RSNA 4YFNF 2HQNA 3ZMSA 1APLC 4PGGA 4BHCA 3F3XA 5K7ZA 2V7FA 4V2GA 3I5UA 4XLHA 4KMFA 4Y7NJ 2WB1N 1E3PA 1NHAA 3RDIA 3F23A 2M1BA 1MBFA 3DBRB 2ID6A 2QBYA 3VEPA 3HL2A 1EV7A 5IYBJ 1RNLA 2O3FA 5M3MJ 3QPSA 4A3DJ 2VPRA 3LSHA 4HV5A 2R5YA 4D5CA 5EG0B 2JUGA 2L9NA 5IYCJ 1XCVA 3LQRA 4RLQA 4DZJA 1BA5A 1O3RA 4IKFA 1X1DA 1YS7A 2NVQJ 2NNNA 5EEGA 3C3WA 3GMEA 3OSGA 5L3BA 2HGCA 3BP8A 3VDXA 3LSRA 1OCCH 3ZQHA 1V5GA 1E3HA 1YHQI 2EPFA 1ORKA 4UNOA 2OZ6A 2QLZA 4G12A 1XGMA 2R7QA 2DMNA 2JUCA 1VNDA 5F6FA 1FEXA 3WTSC 2H1KA 2KRHA 2WUIA 3GWZA 2R92J 2XGCA 5L3GA 4I76A 3CLOA 2VONA 1DPUA 3BDDA 3DBHB 1H8AC 4Q4ZF 3GZNB 4ETSA 1BJZA 2F07A 2FXAA 2L2OA 3ABMH 5HS9A 1XGOA 3U1DA 1P4WA 2JA8J 1J75A 3M1CA 3OYNA 4PJNA 1D0ZA 1FOWA 2BYVE 4P96A 3PASA 2DPDA 1UHMA 3ABUA 3VWBA 2P6SA 3KKCA 1S5LC 2MW8A 3JCUC 2QOPA 4MK6A 3RD3A 2XV4S 2FMLA 3LNQA 2B9SA 2Z9OA 2VE9A 3HIMA 1ZGWA 3IC7A 4FHTA 3SJMA 1PP8F 2FEZA 2EFQA 2D2WA 4Q48A 4DZPA 1ZGAA 3V6GA 1R9TJ 2X6YA 3L2UA 1IN6A 3F8NA 3JRGA 5IT9Z 2FQ3A 3DKYA 3GTGJ 5CVRA 1VQ7I 2XSDC 3MQ0A 2W25A 3ZMVA 1V3FA 4JYKA 2HTSA 1ZRCA 3JRBA 5D4SA 1MDMB 1MKMA 3OWTA 5E20A 4IXAA 2IPQX 1MSEC 2GIZA 5FLVA 2R4GA 2NOGA 2EFWA 2IA2A 2VJIA 3BZKA 2N8GA 4F91B 1I39A 2RGVA 3U2RA 3C2BA 2DK5A 4RGUA 4B3XA 3S3MA 1WCMJ 1TT5B 3O3KA 3WE3A 4E4HA 2WA0A 2FRHA 3CESA 3WE2A 1AU7A 1FBSA 5FLMJ 1R58A 3OYEA 1A04A 1Y56A 2RNJA 3FHZA 4OMYA 5C44J 1AHDP 1BW6A 3HPGA 2LVSA 2G7SA 3S32A 4KUMA 2NX4A 2DFFA 3ZOBA 5DAJA 4A3JJ 3MEXA 1L0OC 3IWZA 4BE2A 1BI2A 1TTYA 4MNUA 1R5ID 1QU3A 2OU2A 1EKEA 2PJPA 2IBDA 2ZJRF 2WY7Q 4ZZDA 3CDIA 2QVOA 3FWEA 4KICA 3CC2I 4RS8A 2KZVA 2EV0A 3MKWB 2DJIA 1GV2A 5BS6A 3AQSA 1MBGA 4HRIA 2LNBA 2ELHA 2K7LA 3K69A 4RB3C 5D5VB 4ZYEA 4I98B 3H9JA 5ERIA 2A68F 3DPLC 3RZDJ 1ZYRF 1GVDA 1X1AA 2CW0F 4P9UA 2YR2A 4EJOA 5H6QA 2K5CA 1U3EM 5J8CA 1YTYA 4LGWA 4NNJA 1PP7U 2E1CA 4A93J 5EF6A 3ZP5A 2E2IJ 4IHXA 2CUEA 2LDUA 1W7PB 3KZ9A 2HNHA 4FCYA 3IH2A 1ACIA 1X3WB 3ZR8X 1OR7C 3BPXA 5JLWA 3HIFA 2PLYA 1KQ9A 2YU3A 3JRFA 4NQWA 5C3EJ 2P5VA 3ELKA 1SFUA 4IOAF 5DYMA 3MN2A 5EZHA 2JVHA 2QM3A 1DU0A 2HTJA 5IOYA 4HQEA 4HF2A 1HC8A 2UXOA 5LEJA 4AU7A 2GXBA 2F2EA 4DGWB 1B6AA 4E6KG 6PAXA 4HX7A 5GAEJ 3NXCA 1E0EA 3AG2H 1W1WE 4D9JA 2Y69H 3LSJA 3Q3SA 1MJ9A 1WH7A 2NYXA 3F6OA 2HVQA 3PQKA 5CVJA 1ZN2A 4BEHB 1T98A 2HKUA 3ON2A 2JWTA 4X0GA 1HDPA 5IP7J 1N25A 3JRCA 1XPXA 1IUYA 1O3TA 4JK1X 2ZXHA 3EYIA 4PGHA 1A35A 3HEFA 1KU7A 4JNNA 3A02A 2R3SA 3MMYB 4FETA 5EZGA 1DGWY 3KYCB 5FKLA 1M1EB 2H1LA 4PXIA 3SEZA 1BW5A 1UHSA 1EH8A 1AKHA 2ME6A 2VT2A 3K0LA 3VSKA 1LKXA 1XDSA 5EGOA 3CUQB 1FZPB 2MFZA 3SDGA 1LFBA 3DQVC 3GZ5A 4XRSA 1HLVA 2IS1A 2NVTJ 5FKOA 2UXXA 3P5JA 1VQ9I 1OYIA 1N78A 3LWFA 4WIBA 2DMUA 2X85A 1YX5A 2V9PA 1FIAA 3KEQA 5FB2A 1JKOC 4IL6C 3U9GA 4LG0A 3WTYC 3A1YA 3EPZA 2XDVA 2EQRA 1UB9A 2JMWA 1B72B 4IRIA 1POGA 1S9HA 2KISA 1BBYA 1FT9A 1PYVA 2EFNA 3JSPA 3CUQC 1VQOI 3J7AO 2ZMEC 4S04A 2O6GE 2PN6A 3DXJF 3G2BA 3D5LA 4S0HB 4BJ5C 2Q2EA 3GTKJ 3SHFA 4B3AA 1PVEA 3CCVI 3BJAA 1S72I 3CDHA 5FHPA 2V26A 4DYRA 3E7QA 2WAEA 2Q0OA 2MD5A 1PUFB 1Z0XA 2BY0A 3F8CA 3HRUA 3NS4A 1R71A 4XOPA 5JR3A 1JUSA 4PFOA 1UCRA 1MBJA 5E18F 5B5EC 4GYGA 3S1RJ 4JQFA 4B09A 4O5VA 1SGMA 1FTZA 4L9JA 1ZRDA 2NS8A 3K6GA 4WXDA 5A2QZ 1XD7A 3D5SC 4GCKA 1K7AA 4OOIA 3OYMA 1IJWC 2V4JC 3AG4H 3RTRA 2DQRA 4L9TA 5BMZA 4L9NA 2X0LA 3MCZA 3KPHA 1HCRA 4HPQA 3SZTA 4LK1F 5DTDA 3N4MA 2DG8A 3SWHA 2UUZA 2XPUA 1AWCA 2DFHA 1TWFJ 3ZMTA 2DTRA 2QBYB 4IRHA 2GZWA 2F6CA 3E6BA 2OC6A 1G3SA 2JSCA 2M87A 3K1PA 2HKXA 2R5YB 3LFKA 3MWMA 1J9IA 2E7XA 4YEJA 1RR7A 3K10A 3OMYA 2L3DA 2M8GX 1XB4A 1K61A 4RB2C 2XKOA 4HNUA 3M4OJ 4HSTA 4RBOA 3V42A 5ILUA 2IGKA 4HYEA 4RAZA 4OIRF 5FO5A 4XL9A 3MD2A 2DBBA 3OV8A 4U0WA 4EATA 3E6CC 2JA2A 1OYYA 2PZ9A 4QIWN 4NC7A 5HBUA 1KQ0A 2O5RA 4O6JA 5LEKA 3PNVA 3ERED 2HQAA 1BIAA 3QRFF 4G6QA 3H5RA 1IN4A 4BXXJ 2TDXA 3WG7H 3NRVA 1X3UA 1RZ4A 2KRFA 4XQFA 3K4MA 3ZRGA 2XC7A 4BBSJ 3HTSB 4PJMA 2V79A 5B3SH 4MLOA 5E3LA 3CRJA 2NAZA 4E7ZA 1SVMA 4ZYAA 4CICA 3DFGA 2TRTA 2OTLI 2O8XA 5HNFA 1MNMC 3ASOH 1BR1A 1H9GA 3S1NJ 4OD4A 1FJLA 2P8TA 3FMQA 2VKHA 2I10A 4AYBN 2QZ8A 2OF7A 4XRFA 2ZCXA 1TWCJ 1XSXA 4FASD 1UI6A 4JKZA 1J59A 2B7EA 2KHMA 2DA3A 1YLFA 5TISC 5HLIA 4EM0B 4PJLA 3W3CA 4LIVA 1G4DA 2R7TA 3KEOA 1LNWA 1IRGA 3VIBA 3BPVA 3NAUA 3H0DA 2LKPA 2QQ8A 4OD5A 2R7FA 3Q9VA 3T1BA 1XSVA 5TJJA 4KNYA 2JVGA 2LBFA 3VYTB 3PL8A 5CVUA 3KETA 4RM3A 2GIVA 4EGZA 1K4SA 1ERDA 1DQUA 2CW7A 3GVAA 5LGNA 1J0RA 4WXCA 3K70D 1MMAA 2ZY9A 2COBA 3I4NJ 2BZTA 1ETWA 3E3VA 1K4TA 5HDGA 5IP9J 2QKMB 4RAYA 4A5MA 4BUPA 1RKTA 3WTWC 5FKKA 3MFKA 2P5KA 3CCJI 1JTYA 3HRSA 4MEXF 4GO1A 2V57A 4UDSA 4E7HA 4WWCA 4DOZA 1XTAA 1ETVA 3KZZA 3I9V2 3U1KA 1IDZA 3L2VA 4OIOF 3HYIA 4HW0A 1HW5A 3KEYA 3QYBA 3G4SI 1K78A 2VBWA 2LREA 3DLLF 3OIOA 2NNYA 2HDWA 3H92A 1G8XA 5AIPA 3X2QH 4L5EA 2HVSA 2ZSIB 3KLNA 3OR1C 4Y52J 2K9LA 2F5FA 5DS9A 4PDKA 2K9SA 4YIFA 4JOMA 3JW4A 2H6BA 2PQ8A 3VB2A 3CCLI 2GFNA 2WV0A 2E60A 4JBAA 3KFWX 4HX4A 5DD8A 3GTQJ 1WJ5A 3O60A 3REOA 5ICFA 4HBLA 1WPKA 2OZUA 1LQ1A 3HB9A 1I6HJ 1YOVB 1UFMA 1IN8A 4ESFA 5IYDJ 1R5GA 3AQTA 3VW1A 1W4MA 3ABTA 1JUMA 3L7WA 4PZJA 2QA4I 1EF4A 2J5PA 1Y0UA 2RHAA 4KIGA 3E5UA 1X2NA 1ZG5A 1ZRFA 1NG6A 3W2WA 3LA7A 1HF0A 1TNSA 5D5XB 2JA5J 3FKJA 2X51A 1G3YA 5JVGF 1W7PA 4P55A 1NTCA 2DI3A 1OISA 3J7YJ 3RKQA 3BCAA 2DT7B 3GFJA 1MMNA 3TDZC 2DU9A 2E1MB 3DP7A 3G3ZA 3EUHA 2O03A 3KP2A 1D3YA 2R7WA 5H20A 1O7LA 4XKCA 1GXQA 3H3UA 3FHNA 3KZYA 4NQWB 2A07F 4LMYA 3CMEI 1JJ8C 3HGGA 3ISPA 4B1RA 3ZMUA 4OIQF 3I59A 2ECCA 4XKVA 1F36A 3BR2A 1FY7A 3CP8A 5EEHA 3TP0A 3OS2A 3MZYA 1HBXG 2JN6A 2OQRA 2KIQA 3C1DA 9ANTA 2E1MC 3BOQA 2L4MA 3QU6A 5FLXZ 4EJUA 2KDZA 2R7UA 4XLFA 3CCEI 1OQYA 2FQ4A 2HYJA 3PNYA 3ZMDA 4G6TB 3R0AA 3WTUC 4CHUA 1FBUA 4HDVA 2VLAA 5IT9K 2HYTA 4MQ9F 5J8FA 2IRFG 4DJAA 3FM5A 5DCMA 1YQAA 3J81Z 3LWJA 3QPHA 3CTAA 3L1PA 5FKNA 1T38A 5FMPA 2I5UA 5CW8A 3K4NA 1WJAA 3QPTA 1H9TA 2EBIA 2FE3A 1GLNA 2K85A 4M9SA 1I1GA 2RN7A 2LF8A 2JSPA 2KIUA 2ICWG 3CCSI 2WAFA 1G2HA 2FX0A 4RLFA 3RKXA 2GENA 3HOYJ 5EGOB 2UXHA 1DU6A 1UI5A 1Y8RB 4ME9A 3JRHA 3E5XA 3TO9A 2ISZA 2R7RA 2XPWA 2HI3A 1IRFA 1DPRA 1TL8A 3CUOA 3HJEA 5LGUA 5H2FC 3HOTA 1BL0A 2M7AA 4F3QA 1UELB 4A3EJ 2JK3A 1KYZA 2ISYA 2JPCA 4J19A 2M30A 2NXNB 2OJED 2XAQA 4A5NA 4G7HF 3CCRI 4BQAA 4LG0B 3C07A 1IGNA 2KFDA 3LSMA 3RQIA 3QWLA 2FA5A 3JRAA 2HKOA 4JX5A 4CYCB 4NC8A 1R7JA 2CG4A 3NPIA 3K1NA 1JXSA 2NVXJ 2NS0A 2DW4A 3OOUA 2K9MA 2XRNA 1S7AA 1X3ZB 2Q2EB 1T95A 2ZCWA 1LPQA 4C3HJ 2WADA 5C4XJ 2HOAA 1WJDA 5F1JA 2XGDA 4RGXA 3IL2A 1XMKA 4H4KC 1SEUA 4A0YA 3HPHA 5D8KB 5J1RA 1R1VA 4GDFA 1I27A 5HLHA 5HDKA 3BG6A 1VQKI 4EJTA 3S16J 4IVNA 1HSTA 2DYRH 2FJ1A 2GXAA 4Y13A 2VPLA 2R0QC 2DXIA 1Z21A 2IVMA 1QO0D 2BE5F 2P6TA 2MBFA 3PFYA 2VC0A 3F8MA 4ABZA 2LY1A 2X1DA 2GQQA 4XRMA 4M74A 3RPUD 4MTDA 3CJQB 2L5QA 2DA2A 1ZGJA 1Y39A 4UVAA 3IAM2 4IRVA 2HOEA 4YFXF 2EIJH 3CJRB 2RV8A 1JHHA 3PUFA 3S14J 5HNHA 1FMVA 3PSIA 4AM3A 2A5YB 1YJWI 2VUMJ 1RR8C 2IA1A 3HHGA 2ZB9A 2EIMH 2MABA 3I64A 3OYHA 4BJ6C 1HQCA 3EUAA 3RPUA 3OYCA 4FISA 3QAHA 3F8FA 2KPMA 2RASA 2PG4A 2VE8A 4R79A 5EEAA 5LHHA 3DU6A 3AAFA 5FRNA 1IUFA 1KONA 1FBQA 3I58A 4MXMA 1ODDA 4CZZA 2QUFA 3FXJA 2WC2A 4U7DA 3L9FA 1P7JA 4IHVA 2LY2A 1U8BA 3K8PC 1FTTA 3MKZA 3CJNA 5LRSA 3H5AA 4BY7J 3LSTA 1USTA 2VXDA 3BTJA 4XOTA 2YVEA 3S1QJ 4ON0A 3VW2A 1YJ9I 4IHTA 1Z3YA 4BQNA 4D7MA 4L18B 2QWWA 3DCFA 3I56I 4EM1A 1IV6A 4AWXB 3LA2A 1B8IA 3COLA 3WG9A 3EUPA 3V7SA 2QQBA 1F1ZA 1Y8QB 2QQ9A 1YI2I 2G7GA 4BAYA 1MZBA 1HOMA 2NVYJ 1JKPC 4M3FA 3VTIA 3L2RA 2E35A 3VVYA 1W0UA 5ICEA 5GTIC 5JI6A 2IJLA 3IHUA 5ILSA 3K1MA 3T6NA 3QOPA 1JT6A 5DV5A 4L5IA 2QKLB 4E70A 5D6EA 2BEOA 5BPDA 2FSWA 2JT1A 1Z3XA 3HOXJ 1JUPA 2GM4A 2QSGX 1BN5A 4F55A 2MG4A 4W1UA 3OR2C 2ZXWH 2ZFUA 3FISA 4BL0B 2VKEA 2ZJQF 2EA2A 2LR8A 1MW7A 2ZCNA 4E7LA 2EILH 3ESWB 4A6EA 3I3LA 5F08A 4LOCA 1WGXA 3L00A 4F52A 5D5UB 2M0MA 2V6EA 5K58A 1I3AA 4A0ZA 1Z91A 2LBFB 3DEWA 2STTA 4G6DA 1ZREA 3OYJA 1OLTA 2F5EA 4EV0A 4KN7X 4RM2A 1I5ZA 5KK1A 4AIKA 4UUVA 2M8EA 2PI0A 3FK7A 4AVPA 3H0GJ 2L9RA 3FXQA 1YW7A 5HAWA 1MMGA 2Y2ZA 2NP5A 2GBYA 2YPRA 3R60A 3KYLA 2R7SA 1SFOJ 1JGSA 2D1VA 3DTEA 1ZAOA 3JSOA 1JKRC 1UMQA 3GO5A 4M3GA 2HOSA 3B81A 2VJ4A 2HOTA 1Q1VA 2DMQA 1QA6A 3FMSA 3NNRA 4MQVA 3VYRB 2HDDA 1JI8A 3I4PA 4BHPA 4U88A 5A2QK 1F4KA 1CGPA 2O0YA 1K78B 2A2FX 5H9TA 4RMNA 2KMUA 1HDDC 4I01A 3K4LA 3BJBA 1O3QA 5FGMA 1S29A 1REPC 4BKXA 3SXYA 3SFZA 2MC4A 1TQMA 4NC6A 1HSJA 3WHCA 1J09A 5J47A 1SD7A 3PO2J 4QSHA 4H0EA 3K70C 2F4MB 4DQ2A 4PCQA 1YFHA 3L2QA 1FYLA 1CF7B 5F0FA 4PK4A 2DO7A 1X4OA 4CDGA 2Q1ZB 4RDUA 3RYRA 2CJJA 4IX7A 3FM3A 2NVUB 3SZGA 3HSFA 4KJZA 5H6RA 3W2AA 1X2MA 5AIQA 4ZDOA 2J5OA 2KQRA 4XLCA 5LLQA 4GFKA 1EA3A 1XS9A 2IEKA 4YRVA 1MGTA 1ZELA 2A6HF 2E71A 1P92A 3F9KA 1EH7A 3FXMA 2A3SA 4I02A 1ZK8A 2OI8A 1LVKA 2HEOA 5GPCA 3QKXA 2ZSHB 4RGSA 2CUJA 2L9VA 3FXKA 3IRRA 1S7OA 2A61A 3GUDA 3I4MJ 1B1BA 1OKRA 2XROA 3JTGA 3HZJA 2LMDA 4IF4A 4WX9A 1F9NA 1T33A 3LSPA 1MJBA 2XDNA 2M5WA 1QQIA 3CO6C 1UG2A 4V2FA 2YU9J 3I59B 3HBLA 4X6AJ 3RKYA 2VQHA 2KLOA 2E1NA 4NELA 1FIPA 1ZLJA 3FXUA 2DDAA 4CA0A 3HM5A 2CS3A 3ERMA 3ULQB 3CO7C 1X1PA 5E1XA 1OCTC 2AO9A 2RAEA 3JRDA 1SVOA 3GTMJ 3EUHC 3VPRA 2F4IA 1XSDA 1F5TA 1BI0A 1LUJB 4KWAA 2DOEA 1B9MA 1IXRC 2VXZA 2IP2A 3DLAA 2W53A 3GLLA 4BNCA 2G3BA 2W82A 1FSEA 2RQQA 2H94A 3EDPA 3K7AJ 5EYRA 3UR3C 1MBHA 4B43A 1ITYA 5DCMB 2KT0A 1U9NA 2CRGA 3BG9A 4YG2F 4M9XA 3AKZA 1YS6A 1A6IA 5LRRA 5JVTA 3CDLA 3M8EA 3OOPA 5F0CA 2IT0A 3DKWA 3HOVJ 3DKXA 2KIFA 5CLSA 2R7VA 4A3KJ 2HU9A 3CWRA 2P0WA 2K02A 3WGIA 4U0YA 4B4CA 2DT5A 3ROUA 1G3TA 1MNDA 4BH9A 2E2JJ 1P2FA 3AG3H 1TT0A 2BY1A 1A36A 1XX5A 3H3ZA 3S3OA 3VOXA 2K9NA 2PJRA 1XN7A 4QPOA 4G7ZF 2LRDA 4B48A 5HODA 2KL4A 3BQYA 5DUKA 1JJ6C 1O57A 4ZYDA 1OYWA 1HA8A 3V7CA 4CYCA 1WJBA 3BQZA 1QVUA 4G94A 1OJLA 2OCCH 1IN5A 5FD5A 2R93J 3WU2C 5F1RA 2JA6J 1ON2A 4M3DA 4II3A 3T0YA 1YITI 4KMUX 3ZGKA 3ZQCA 1BR4A 2V1XA 3ML6A 5DCFA 4PSXA 5ED4A 4HF1A 4GCLA 3TEDA 1USSA 3WODF 2R5ZA 2MA3A 1QPIA 2M45A 2VB6A 3HUGA 1PDNC 3IV5A 1RRJA 4U0VA 1B59A 2XAJA 5DD4A 3JRIA 1GHCA 2WY8Q 4U87A 5E3NA 3HTJA 4KT6A 3HXLA 4J01A 1I3QJ 3E7LA 3GFMA 1U6GA 3W2VA 2FBHA 4M6YA 4EJWA 4XR6A 1IRXA 1D1BA 2LFBA 4IHSA 4O3MA 1RPWA 2DTZA 3ECOA 1O4XA 1UG0A 3C2GA 1HW2A 2EFOA 3EQLF 1P6RA 2I8DA 4DBRA 2WAQA 3IUVA 2DOAA 3DBLB 1R49A 2BXYA 2HYGD 3V4GA 4RGRA 2M4GA 1R1TA 5IP6A 2CW8A 3TO6A 3B02A 2DA6A 4PUSA 2F5DA 5D6FA 3GZIA 4NDLA 4UB8C 2JPBA 3LL7A 1R4NB 1X1BA 2M9HA 1WI3A 1JT0A 3BY6A 5KNLA 3F0CA 2VBZA 2XAFA 4HX8A 1W5CC 3ABKH 2V1DA 5D5WB 1HKSA 2VN2A 4Z2YA 1VQMI 2Y48A 1D8JA 3F6VA 5HS7A 2QSHX 4CCKA 1IXSB 3TOBA 3VOKA 1UJ8A 1LFPA 2HXOA 4ZTJA 3OS0A 4ANJA 2ZJPF 1TQPA 2Y9YA 5FLXK 2IA0A 2ZKZA 3PFIA 3OYAA 2AXTC 4BXFA 3F1BA 2Q8KA 4F93B 2L0KA 1OFCX 3OIQA 1GUUA 4M6XA 3CCUI 3DU5A 4BDZA 3AFHA 3A4CA 3CCMI 2CMPA 5K7HA 5JHFA 2GXGA 5DUIA 2BGCA 2BVLA 2RDPA 2YUSA 3A0HC 3J81K 4WCGA 1B8IB 2DG7A 1S6LA 1SD4A 3M3YJ 4ENNA 3FMRA 4KT5C 1ETQA 1FWZA 5J40A 1JE8A 2Z5UA 4I2OA 2CV1A 1SAUA 2V6CA 2FBIA 1HKQA 3ZPLA 4JL3A 3GF2A 3HTIA 2XB0X 3FZVA 3I54A 2Y0SA 4BXUA 2UXPA 1MBEA 3RQ4A 2RNGA 4XN3A 5LD2C 1EH6A 3TOAA 4EM2A 3SYTA 3OIPA 5D8LB 3RI4A 1LB2A 3LMMA 4E7JA 4XSXF 3ABLH 2E19A 4ZDPA 3C2HA 3HG9A 4JX6A 1XCBA 3DV8A 4ZDLA 1RUNA 4QLCU 3CC7I 2HXIA 5FGLA 3R61A 4BDYA 4U7BA 1N77A 1T6SA 4CUGA 2DA5A 2IW5A 2V9VA 2HPIA 3VUQA 2EZHA 1I6XA 2X6XA 4D5FA 5JLXA 1C0WA 1YRNA 3BG5A 3GTLJ 3GEZA 4RB0A 5BOXA 2X6WA 2L54A 3TDUC 4YELA 5D1RA 4CZCA 3HRTA 4A6DA 1FOKA 4CGRA 1BI1A 3ASNH 2LG4A 4PJ0C 2COMA 2DA7A 4IO9F 3ZQIA 5M5YJ 1QPMA 1R00A 1TWHJ 4MFEA 1B9NA 1TLHB 4ZYGA 2G7LA 1SANA 2EZKA 4OU0A 4I0BA 1D0XA 3A01A 3DTIA 3BZCA 1R4MB 3AL0B 3OYKA 1FNNA 4RB1A 3HHHA 1YIOA 4I0AA 4ZJZA 3JTHA 1VQ5I 2XHKA 1K79A 1ZH5A 2Y0MA 5GAGJ 1IZ1A 2W48A 2CFXA 2Z16A 3HSEA 3JAMZ 5FD6A 3PNTA 1IRZA 1YYVA 1VFCA 2DK8A 2OV7A 3EYYA 4NB5A 5IT3A 1FOYA 2VQGA 4L5JA 4A3CJ 5KHDA 1EJ9A 3WGHA 3NARA 1FX7A 4ACIA 5E1ZB 2LK2A 3KCCA 3MNLA 2LD5A 1Z1DA 4IEJA 1RESA 4YZEA 2PX9A 4DBQA 3O8GA 5IOZA 4V19K 2P5LC 2QSFX 2O9LA 4IHWA 1Z77A 3S15J 2ESHA 1L3LA 1CF7A 1RIOH 1VQ8I 1JKQC 1RI7A 2EIKH 1YIJI 1SFKA 4B44A 2QTQA 1ZG3A 2PMHA 4HAMA 3FF5A 2ELKA 2JA7J 3BR1A 1VQ4I 3LSGA 2IXSA 4QPQA 2A69F 1TBXA 3G71I 4HSRA 4AC6A 4ITVA 3LA3A 1V54H 1SD5A 3HTUA 1OCPA 1OR7A 4ZYHA 2X9DA 2UWMA 1GV5A 5M5XJ 3PPBA 1VZ0A 3Q0VA 4IJAA 3OY9A 1FYKA 1NK2P 1LE8A 4ZZLA 2JRMA 3B6CA 4G9YA 5HS8A 1LVAA 3C7JA 5L3EA 5LBQA 1X4PA 4ENJA 5LFAA 1Z05A 1O7FA 4ESJA 1VTNC 2Y31A 2ZOZA 4QWQA 2A6TA 4DYCA 2OPTA 4AD9A 4UVCA 2HQ5A 3ZQQA 3DEUA 1HW1A 3NQOA 5FJ8J 3QP6A 2A5WA 1WQ2A 4KN4X 3IRQA 2MYSA 4M3BA 3R6SA 3A2KA 2FF4A 2XRLA 3LSIA 3B6AA 3D5RC 2WB1A 5CYVA 5B66C 4HNTA 2W7NA 4E7KA 5E8GA 2IU5A 5EDNA 3HOZJ 3LHQA 2ZC2A 2XB5A 4NN1A 1U8RA 1I1SA 1YX3A 2BXZA 2BOLA 3GCMA 2YSRA 2MH9A 3K4CA 3S93A 2W00A 2UZKA 1ZR2A 1P7IA 2DN0A 2AXLA 5DM7F 4M9ZA 4XK4A 2KKOA 2CO5A 4HLYA 1D1CA 4FX4A 3E6MA 5EJCA 4AC0A 1K83J 5L3FA 2BV6A 4N4OB 3CCQI 3N05A 3WGGA 3TBIA 1ETYA 5LGTA 3RIRA 1SFEA 1MBKA 2H8WA 1DP7P 2GOMA 5FRMA 4C30A 1P9QC 3WU0A 5DM6F 1WI9A 1SAXA 4A3BJ 2DT6A 3HKZA 2W85A 3BJ6A 3DWLE 2PJRB 3DF8A 1W5SA 3EUKL 1Z6TA 3RKWA 2DLLA 2P81A 2WGBA 4EMSA 3IKTA 1Z7UA 2ZMEA 3LSKA 1WJEA 2CQXA 3M9AA 4CYDA 2L7FP 1OCZH 4DNCA 2CV2A 2EB7A 1ONVA 2EZLA 2L7KA 4HV6A 4RA2A 4XICA 4C2TA 1ZTRA 2FNPA 2MLGA 4BE0A 5KCMA 4S05A 2R5ZB 4L9VA 1Z6RA 3HUGB 2R7DA 3M7GA 4AIDA 1XMAA 3WTVC 3E97A 3FIWA 3G56A 4ICHA 1QHHD 4BGDA 4CCJA 2UXUA 1TQIA 5GAHJ 2YS9A 3KZIC 1MNEA 2ZNYA 4M71A 4L0ZB 1LDJA 3M8FA 3P9TA 5F0HA 1Z9CA 4HF0A 2E36A 3GBGA 2RKHA 4HKUA 1ON1A 1RKWA 2X1EA 2DAOA 4B8XA 2KZGA 2X4HA 3H9GA 4ENKA 4FE4A 2HS5A 2LH9A 1XGSA 3OL3A 4Y4RA 1BOBA 3PUBA 2K9QA 1R1UA 2WWYA 3DEEA 2XIGA 3QU3A 3ZQLA 4XKBA 3BLYA 4U9LA 4A3GJ 3GZ6A 2HYFA 3JREA 2KRCA 3L09A 3FRQA 1VI0A 2A05A 2JQ7A 3A03A 3PO3J 5M3FJ 3RYPA 2GUHA 3J80Z 3KP7A 1KGSA 3QP5A 4OIPF 3K4BA 3DTKA 4AVZA 1RUOA 5D18A 3S17J 4N4NB 2VKDA 4IZZA 3DPJA 2CUFA 2LKSA 2UXIA 1Y1VJ 1BC7C 3LQQA 2W57A 1X19A 4E7SA 3O6BB 1KA8A 3OSFA 1IW7F 4YIRX 4Z6YA 2L02A 2V1UA 3GTJJ 4LLNA 4D7NA 2KDOA 3P9CA 1D0YA 2W84A 3TMOA 2L7MP 2DYSH 2VBXA 1ZHFA 2VT3A 3WTXC 2CSOA 5J1UA 2XF5A 1ETKA 4KISA 1ZR4A 2IS4A 3V7RA 5J6XA 3BRUA 1DUXC 2M34A 2ETHA 3SFIA 1LEBA 1U9OA 2P7CB 1R6RA 5E8IA 4Q5SF 3LAJA 3EETA 2CGPA 1P4XA 5CPRB 1QNTA 2D45A 1RC9A 1OMIA 1S3JA 1ETOA 4AIHA 5HLGA 5KAIC 2L7ZA 1FMWA 1WZ2A 5CVIA 3GXOA 1R36A 5AONA 1ZARA 3HKZN 1KU2A 1X1CA 3BG7A 4D1QA 4NBQA 1WVRA 1ZKGA 1H88C 3NI7A 2CYYA 1HKTA 4MGRA 4MEYF 2DMTA 2LTPA 1WJCA 2JJ7A 3BR5A 4A12A 3T8TA 5CXGA 1K6OA 3R0JA 1KZHA 2ZNZA 3SEQA 2XGEA 2XAUA 4N0BA 1FYMA 2DQLA 2QGUA 2NOJB 3IH3A 3ZQGA 3TW7A 4WK8F 3K2ZA 2VOPA 1U5TA 3SDBA 4CXFA 1NH3A 1UAAA 2KJBA 3H5NA 1V55H 3BTLA 3ZN0A 2CFOA 3VYSB 3WTTC 1E3OC 5ICCA 3A0BC 4TV7A 3E6DA 2LC2A 1YRNB 3MAJA 1QHGA 2ZXJA 3WHBA 1Z67A 3QBMA 2Y30A 4NHJA 4D0PA 3BT9A 5BQTA 2D6YA 1YJNI 3G1LA 4HQMA 3P9IA 5E79C 4UUTA 3L2CA 2HDCA 1A5JA 4CGZA 3BNIA 4CCOA 2LF7A 4A2UA 3TKYA 2FJI1 4BJTA 5J3LA 3COAC 1STZA 1IXCA 3A01B 2EV5A 3E1SA 2Y9ZA 1ZG1A 3ZQ7A 2VODA 3O2PE 2VKVA 4HDUA 1DP3A 3ZQFA 3ONQA 2VBYA 5CQGA 2G7HA 5FKMA 5D19A 1YO5C 1MSFC 5IY5H 2FOKA 4HG2A 3H36A 4LIUA 2NS7A 2GAUA 1BOAA 1YW9A 2Y75A 3Q9SA 1LDKB 1FPQA 5IPAA 3CF2A 1GXPA 4P1WA 3CLQA 4LJZF 2QWTA 2GWRA 2DA4A 3OYIA 3MKLA 1J2XA 4FTHA 1JHFA 3G1OA 5BNGA 4FX0A 5E3MA 1AA7A 2L01A 4UUSA 4AIJA 2PEXA 2CU7A 3VSLA 4M3EA 5DDGA 5E3OA 1B4AA 2Z2SB 2F5CA 3FXLA 4Y3OA 3RH2A 1BR2A 2OQGA 5ILVA 3D1NI 2IGNA 3B73A 2PBIA 1XMXA 2EZIA 1MJAA 4BBRJ 2DA1A 3IWFA 3RJPA 1NG7A 4K2EA 5L3DA 2GOXB 3KP4A 1YE9A 2STWA 2XF7A 4BE1A 1RETA 2F5VA 2ZO4A 1SMTA 4M72A 2CH0A 2ADUA 2HFHA 2ZXIA 3VVZA 2GA2A 5K1YA 1FSHA 3HRMA 2MH2A 3PQJA 4UV8A 2FUG2 4CSWA 2WTEA 2AS5F 1LE8B 2VI6A 2VOOA 3CCYA 1T0FA 4W97A 2R7ZJ 3Q0UA 4C3JJ 2QCOA 2RQPA 3CZ6A 3PSFA 2K4JA 3FXRA 3CMMA 4P5OA 4WF2A 2ZOYA 2VQCA 2IS6A 1UHWA 1D5YA 2BHZA 2K27A 4MFDA 5HLTA 3BWGA 4YIIA 5F64A 3RCOA 3ANGA 1XGNA 1D5VA 3C18A 4XM3A 5B1BH 1V5FA 1XC5A 2E2HJ 3QYEA 1ZLKA 5GP9A 3K2AA 3VODA 4WXHA 2Z33A 2OCEA 2L9SA 3D0SA 3BTCA 1GT0C 4OMZA 1R23A 2HZDA 4HEA2 3T8RA 3U21A 3OYDA 1T56A 3J7AY 1Z7LA 2MSYA 5TGTA 2VQLA 2IS2A 4J00A 4BYYA 2M3AA 5F27A 1JGGA 5CVVA 4IQJA 3PM1A 1SMYF 1MMSA 4XMYA 5GPAA 3S8PA 2YVHA 1I50J 2FU4A 2X6OA 3IH4A 1Y0NA 1K6YA 3P9KA 2RREA 1TW2A 1WH5A 3S2HJ 4HA8A 3BR3A 1MIJA 4R8HA 1AOYA 2HZTA 2Q24A 1W36D 4DYQA 4DVYP 1QRYA 4Y17A 1CQTA 3FX3A 3AG1H 3I0TA 3CJTB 2W24A 4Y33A 5FROA 1R22A 1W5TA 3ZN1A 1KQ8A 1YG2A 3VP5A 4GYIA 4IPAA 4GXOA 5M5WJ 1J7KA 1GDTA 1OPCA 3BHQA 4IRGA 4FQGA 2H27A 2K3FA 3VYUB 2R7XA 2QKOA 3GEUA 4EQQA 5E17F 5HOOA 3LJLA 1X58A 2K40A 3CMAI 5E1WA 2ZMEB 1QZEA 4OAZA 2KIMA 3OL4A 1P4AA 2PMZA 3JAMK 2EJRA 4HZFA 4KA4A 2QIBA 4II2A 4JP0A 4CCMA 4DIQA 4C2UA 3KP5A 4GRIA 4QTRA 3R4KA 3TGNA 5GADJ 1U2WA 4F92B 1FP1D 1SD6A 1KU3A 3OYGA 1MH4A 3WTZA 4AYBA 1IDYA 5F04A 4LFUA 2M7BA 4UV9A 4N9IA 4LLLA 1S8NA 3M8JA 1IN7A 3P7NA 3V8JA 2YVXA 3HOWJ 5HVQC 4EVIA 2EV6A 1UZCA 3JSJA 2MGQA 3BCBA 1HXDA 3HSRA 2XF6A 1OCRH 5JHUA 3KP6A 2K3PA 2BW3A 1LJ9A 1XDUA 3BCGA 3TO7A 2B63J 1VF9A 4KIBA 1WJFA 5D4RA 3KX2A 2E5NA 2V9KA 3FDYA 3CF5F 5ICGA 2VJ5A 1MD0A 3GTOJ 2D1HA 4CCNA 3CJDA 3BTIA 3ZMZA 2H6CA 3G6EI 4XSZF 3UKGA 2XAHA 2HPMA 3G1MA 4GFLA 2D5VA 4KDPA 3F22A 1FC3A 4MO7A 5TRDA 1TWAJ 2UXNA 2EWNA 4UXNA 3JR9A 4ESBA 2QYOA 2B0LA 5B1AH 3UNGC 5FFXA 2HQRA 3H1CA 4DW6A 4I09A 1IAWA 3S5RA 2CQ7A 3IP4B 2PBXA 4B47A 3GLXA 3K4JA 1PUEE 4XLEA 4N9HA 2ESNA 2CQKA 5EG0A 3IAS2 4OAYA 5LHGA 2CV0A 1KU9A 4ZH4F 5K7FA 4PSWA 4LB5A 1QGPA 5KAFC 1H89C 3KE2A 1WSUA 2GLOA 3NWTA 3HDDA 5J1YA 3VOEA 4E7IA 3QODA 3S3NA 1U78A 1V4RA 3J7ZI 4XLAA 1DGRM 4L0YB 2E34A 2YX7A 4I6ZA 4A3FJ 2F4OB 4EEFG 2PMUA 4NUBA 4BY1J
chains in the Genus database with same CATH topology
4GCTA 5IOYA 3DCFA 4M3BA 2XRLA 3B6AA 1IV6A 2NP3A 2UXOA 2WV1A 1B8IA 2IU5A 3COLA 3EUPA 5EDNA 3HOZJ 3LHQA 2E1OA 4A69C 2XB5A 4NN1A 3NXCA 1ETXA 2G7GA 3LSJA 3Q0WA 3Q3SA 5AQCA 1TWGJ 5HSZA 1WH7A 1HOMA 2NVYJ 3HTHA 1ZR2A 4M3FA 1JKPC 2PMZN 4L62A 1P7IA 2DN0A 2HKUA 4XK4A 3ON2A 2JWTA 3VVYA 1W0UA 1HDPA 5IP7J 3TP3A 3T6NA 3JRCA 4AC0A 1K83J 1JT6A 3GTPJ 5CXIA 2O7OA 3HEFA 4M6VA 1JUPA 3HOXJ 2GM4A 4JNNA 3A02A 2MG4A 4W1UA 1NK3P 3KNWA 1ETYA 3FISA 5EZGA 3HE0A 2VKEA 5FKLA 1MBKA 3QPLA 1ZQ3P 4PXIA 1BW5A 1UHSA 2LKXA 1AKHA 2LR8A 2ME6A 2IAIA 2ZCNA 5F08A 4LOCA 1WGXA 5EGOA 2FBQA 5K58A 4A3BJ 3SDGA 1LFBA 1HLVA 4XRSA 2NVTJ 3DEWA 5FKOA 3HGYA 2P81A 2WGBA 2DMUA 3FK7A 3H0GJ 3FKIJ 2L9RA 5HAWA 1FIAA 2CQXA 3ON4A 2Y2ZA 1JKOC 2NP5A 2REKA 2GBYA 2L7FP 2EQRA 2JMWA 1B72B 2LP0A 1SFOJ 1POGA 2WAQN 2EZLA 3O8HA 1JKRC 1UMQA 4XICA 4M3GA 2HOSA 1ZTRA 2TCTA 3B81A 2HOTA 1Q1VA 2R5ZB 4S0HB 2DMQA 3GTKJ 3NNRA 2HDDA 4B3AA 3FIWA 3G56A 4ICHA 3S1MJ 1MH3A 5FHPA 4DYRA 3E7QA 5H9TA 2UXUA 1HDDC 4AF5A 1PUFB 1Z0XA 3VW0A 2YS9A 3BJBA 2X48A 1QVTA 3FK6A 3W6VA 5F0HA 3P9TA 1JUSA 3GBGA 4UUSB 4HKUA 1MBJA 3CQZJ 1RKWA 3S1RJ 4BKXA 1SGMA 3KKDA 1FTZA 3WHCA 2NS8A 2ME0A 4FE4A 2H8RA 3PO2J 2QF7A 2G0EA 4QSHA 2K9QA 4GCKA 3ZQLA 5F0FA 1IJWC 4A3GJ 4RDUA 2EH3A 3FRQA 3JREA 2CJJA 1VI0A 2OERA 4C3IJ 1HCRA 4JX4A 3A03A 5DTDA 3PO3J 5M3FJ 1X2MA 2DG8A 4GFKA 2GUHA 2XPUA 1TWFJ 2IEKA 1XS9A 1Y1WJ 5C4YA 5D18A 3S17J 3V78A 4X1EA 2M2EA 2R5YB 3DPJA 2OI8A 1ZK8A 2CUFA 2FD5A 1DU0A 5GPCA 3QKXA 2UXIA 3LOCA 1Y1VJ 4GFBA 4A3MJ 1RR7A 3OSFA 1K61A 2M8GX 2Y0SN 3I4MJ 4XIDA 3GTJJ 4D7NA 2L7MP 3M4OJ 1T33A 3LSPA 4RBOA 2O8KA 2XDNA 1UG2A 4V2FA 5J1UA 1IC8A 1LFUP 3HBLA 4FE7A 1ETKA 2YU9J 4X6AJ 1ZR4A 3NRGA 3BRUA 2M34A 3SFIA 4HNVA 1FIPA 1ENHA 4A3LJ 1U9OA 4NELA 1IG7A 2PZ9A 3HM5A 4QIWN 5EFYA 1OCTC 5HBUA 2AO9A 2RAEA 3JRDA 3GTMJ 1ETOA 3VPRA 2L7ZA 1F43A 4KWAA 4BXXJ 4BBSJ 2W53A 2LY9A 2G3BA 3HKZN 3CMYA 4MLOA 5E3LA 1ITYA 1ZKGA 3K7AJ 5EYRA 1H88C 3CRJA 1MBHA 3NI7A 2DMTA 2TRTA 2KT0A 1U9NA 2LTPA 3QQAA 2CRGA 2DJNA 2JJ7A 3BG9A 3BR5A 1MNMC 3S2DJ 2ZCMA 3ANPA 5CXGA 3RZOJ 1A6IA 2XGEA 3HOUJ 3CDLA 2AHQA 3S1NJ 1FJLA 5F0CA 2I10A 4AYBN 2OF7A 2ZCXA 3IH3A 1TWCJ 3ZQGA 3HOVJ 3TW7A 1UI6A 4JKZA 3CWRA 4A3KJ 2DA3A 3BTLA 5C4JJ 3EGQA 4B4CA 3BR0A 3VIBA 2E2JJ 1W0TA 1E3OC 3NAUA 1YRNB 1AKHB 2O7TA 3VOXA 2K9NA 3WHBA 3QBMA 2Y30A 3BG3A 3H3VK 5HODA 2D6YA 3BT9A 3BQYA 3G1LA 1S7EA 1JJ6C 4UUTA 1A5JA 3BNIA 4CYCA 3BQZA 1QVUA 2XPVA 2COBA 5J3LA 3I4NJ 3G7RA 1ETWA 4AUXA 1OJLA 3A01B 2Y9ZA 2R93J 2LLKA 2JA6J 5IP9J 1B72A 4M3DA 1RKTA 5FKKA 2VKVA 1JTYA 2V57A 4UDSA 3ZQCA 1XG1A 3ZQFA 4GCLA 5FKMA 5D19A 3TEDA 1MSFC 2R5ZA 2CQQA 3TW6A 1QPIA 2NS7A 2ID3A 1ETVA 3IV5A 3JRIA 5IPAA 4A3IJ 1IDZA 5E3NA 3HTJA 1I3QJ 2QWTA 3E7LA 4MIMA 3OIOA 1PUFA 3VVXA 2DA4A 4L5EA 3MKLA 4FTHA 3G1OA 5BNGA 5E3MA 4Y52J 4UUSA 1TC3C 4XRSG 5DS9A 1JTXA 2K9SA 2CU7A 4M3EA 5E3OA 2GFNA 2ECBA 3HTAA 2M0CA 3GTQJ 3RH2A 2DMPA 2LFBA 4C2MJ 3D1NI 3O60A 1RPWA 2DTZA 1WPKA 1O4XA 3HB9A 1I6HJ 2EZIA 3BR6A 3MVPA 5IYDJ 4IHYA 4BBRJ 3AQTA 3VW1A 2DA1A 3IUVA 1JUMA 1APLC 5K7ZA 4V2GA 5IP6A 1RETA 4Y7NJ 2DA6A 2WB1N 1EF4A 2RHAA 3GZIA 1MBFA 3VVZA 1X2NA 4NDLA 2ID6A 1HF0A 2M9HA 5IYBJ 1WI3A 1JT0A 2JA5J 5M3MJ 3QPSA 4A3DJ 2VPRA 3F0CA 1NTCA 1LE8B 2VI6A 2R5YA 4D5CA 5EG0B 3CCYA 3RKQA 4W97A 2R7ZJ 3Q0UA 5IYCJ 4C3JJ 2QCOA 4DZJA 1BA5A 3VOKA 2HXOA 2NVQJ 2ZOYA 2Y9YA 3OSGA 1D5YA 3F1BA 4MFDA 3LSRA 3ZQHA 1JJ8C 3ANGA 3HGGA 1ORKA 1OFCX 2L0KA 4G12A 1GUUA 4B1RA 1XC5A 2DMNA 1VNDA 2ECCA 2E2HJ 1FEXA 2H1KA 1F36A 2WUIA 3BR2A 5K7HA 2XGCA 3TP0A 5GP9A 2R92J 3K2AA 4I76A 2JN6A 2YUSA 1H8AC 1B8IB 9ANTA 2DG7A 1BJZA 3BTCA 1GT0C 2F07A 3M3YJ 1T56A 2KDZA 2MSYA 2FQ4A 2JA8J 1ETQA 2HYJA 5F27A 1JGGA 3PM1A 5GPAA 4JL3A 2YVHA 1I50J 2HYTA 2X6OA 3PASA 3IH4A 3HTIA 3LWJA 2XB0X 1WH5A 3KKCA 2MW8A 2QOPA 3S2HJ 2UXPA 4MK6A 1MBEA 3BR3A 3L1PA 3RD3A 5FKNA 3LNQA 5FMPA 2Q24A 3HIMA 1ZGWA 3SJMA 5CW8A 4DYQA 1QRYA 2EBIA 4DZPA 1CQTA 3V6GA 1R9TJ 2E19A 4JX6A 3JRGA 3VP5A 1G2HA 2FX0A 3GTGJ 2HXIA 5M5WJ 3BHQA 1GDTA 3HOYJ 5EGOB 2GENA 2UXHA 2XSDC 5FGLA 1DU6A 2QKOA 1UI5A 4ME9A 4JYKA 3GEUA 3JRHA 2DA5A 3JRBA 3VUQA 3LJLA 2EZHA 4D5FA 2XPWA 1YRNA 1X58A 2HI3A 5JLXA 3BG5A 2K40A 1MSEC 3GTLJ 5FLVA 5D1RA 1BL0A 4A3EJ 2JK3A 2NOGA 4CGRA 4J19A 2QIBA 2N8GA 2DA7A 3C07A 4JP0A 3ZQIA 5M5YJ 4MFEA 1TWHJ 3C2BA 1IGNA 3RQIA 2G7LA 1SANA 2EZKA 3JRAA 1WCMJ 4QTRA 4JX5A 4CYCB 3A01A 3NPIA 2NVXJ 1AU7A 5FLMJ 1MH4A 3OOUA 1IDYA 5F04A 5C44J 1AHDP 1BW6A 2W48A 4C3HJ 2LVSA 2G7SA 5C4XJ 2HOAA 5F1JA 2XGDA 2NX4A 1IRZA 1VFCA 3ZOBA 5DAJA 3HOWJ 4A3JJ 4A3CJ 3JSJA 5J1RA 2MGQA 3NARA 4ACIA 3S16J 3MNLA 2LK2A 2LD5A 2IBDA 2FJ1A 4IEJA 1RESA 3BCGA 4YZEA 2R0QC 2B63J 3O8GA 5IOZA 1VF9A 4ABZA 2O9LA 4IHWA 1Z77A 4XRMA 3S15J 1JKQC 3GTOJ 2DA2A 2QTQA 3CJDA 1GV2A 3AQSA 3BTIA 1MBGA 2ELKA 2JA7J 3S14J 3BR1A 3LSGA 3UKGA 2VUMJ 3G1MA 4GFLA 2D5VA 4MO7A 4AC6A 2ZB9A 1TWAJ 3JR9A 3RZDJ 1GVDA 1OCPA 4DW6A 4FISA 3S5RA 2X9DA 2RASA 1GV5A 2PBXA 5M5XJ 3PPBA 4A93J 3Q0VA 5EEAA 1IUFA 5EF6A 2E2IJ 4IHXA 1NK2P 1LE8A 2CUEA 5EG0A 4MXMA 3B6CA 3KZ9A 4FCYA 3IH2A 1P7JA 5K7FA 4IHVA 5JLWA 1U8BA 1FTTA 2Y31A 2ZOZA 1H89C 2GLOA 4BY7J 3HDDA 4DYCA 5J1YA 2OPTA 3JRFA 2HQ5A 3BTJA 2YVEA 3S1QJ 5C3EJ 1U78A 5FJ8J 3VW2A 4I6ZA 4A3FJ 3MN2A 5EZHA 4EEFG 4BY1J 4D7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCT A;  5IOY A;  3DCF A;  4M3B A;  2XRL A;  3B6A A;  1IV6 A;  2NP3 A;  2UXO A;  2WV1 A;  1B8I A;  2IU5 A;  3COL A;  3EUP A;  5EDN A;  3HOZ J;  3LHQ A;  2E1O A;  4A69 C;  2XB5 A;  4NN1 A;  3NXC A;  1ETX A;  2G7G A;  3LSJ A;  3Q0W A;  3Q3S A;  5AQC A;  1TWG J;  5HSZ A;  1WH7 A;  1HOM A;  2NVY J;  3HTH A;  1ZR2 A;  4M3F A;  1JKP C;  2PMZ N;  4L62 A;  1P7I A;  2DN0 A;  2HKU A;  4XK4 A;  3ON2 A;  2JWT A;  3VVY A;  1W0U A;  1HDP A;  5IP7 J;  3TP3 A;  3T6N A;  3JRC A;  4AC0 A;  1K83 J;  1JT6 A;  3GTP J;  5CXI A;  2O7O A;  3HEF A;  4M6V A;  1JUP A;  3HOX J;  2GM4 A;  4JNN A;  3A02 A;  2MG4 A;  4W1U A;  1NK3 P;  3KNW A;  1ETY A;  3FIS A;  5EZG A;  3HE0 A;  2VKE A;  5FKL A;  1MBK A;  3QPL A;  1ZQ3 P;  4PXI A;  1BW5 A;  1UHS A;  2LKX A;  1AKH A;  2LR8 A;  2ME6 A;  2IAI A;  2ZCN A;  5F08 A;  4LOC A;  1WGX A;  5EGO A;  2FBQ A;  5K58 A;  4A3B J;  3SDG A;  1LFB A;  1HLV A;  4XRS A;  2NVT J;  3DEW A;  5FKO A;  3HGY A;  2P81 A;  2WGB A;  2DMU A;  3FK7 A;  3H0G J;  3FKI J;  2L9R A;  5HAW A;  1FIA A;  2CQX A;  3ON4 A;  2Y2Z A;  1JKO C;  2NP5 A;  2REK A;  2GBY A;  2L7F P;  2EQR A;  2JMW A;  1B72 B;  2LP0 A;  1SFO J;  1POG A;  2WAQ N;  2EZL A;  3O8H A;  1JKR C;  1UMQ A;  4XIC A;  4M3G A;  2HOS A;  1ZTR A;  2TCT A;  3B81 A;  2HOT A;  1Q1V A;  2R5Z B;  4S0H B;  2DMQ A;  3GTK J;  3NNR A;  2HDD A;  4B3A A;  3FIW A;  3G56 A;  4ICH A;  3S1M J;  1MH3 A;  5FHP A;  4DYR A;  3E7Q A;  5H9T A;  2UXU A;  1HDD C;  4AF5 A;  1PUF B;  1Z0X A;  3VW0 A;  2YS9 A;  3BJB A;  2X48 A;  1QVT A;  3FK6 A;  3W6V A;  5F0H A;  3P9T A;  1JUS A;  3GBG A;  4UUS B;  4HKU A;  1MBJ A;  3CQZ J;  1RKW A;  3S1R J;  4BKX A;  1SGM A;  3KKD A;  1FTZ A;  3WHC A;  2NS8 A;  2ME0 A;  4FE4 A;  2H8R A;  3PO2 J;  2QF7 A;  2G0E A;  4QSH A;  2K9Q A;  4GCK A;  3ZQL A;  5F0F A;  1IJW C;  4A3G J;  4RDU A;  2EH3 A;  3FRQ A;  3JRE A;  2CJJ A;  1VI0 A;  2OER A;  4C3I J;  1HCR A;  4JX4 A;  3A03 A;  5DTD A;  3PO3 J;  5M3F J;  1X2M A;  2DG8 A;  4GFK A;  2GUH A;  2XPU A;  1TWF J;  2IEK A;  1XS9 A;  1Y1W J;  5C4Y A;  5D18 A;  3S17 J;  3V78 A;  4X1E A;  2M2E A;  2R5Y B;  3DPJ A;  2OI8 A;  1ZK8 A;  2CUF A;  2FD5 A;  1DU0 A;  5GPC A;  3QKX A;  2UXI A;  3LOC A;  1Y1V J;  4GFB A;  4A3M J;  1RR7 A;  3OSF A;  1K61 A;  2M8G X;  2Y0S N;  3I4M J;  4XID A;  3GTJ J;  4D7N A;  2L7M P;  3M4O J;  1T33 A;  3LSP A;  4RBO A;  2O8K A;  2XDN A;  1UG2 A;  4V2F A;  5J1U A;  1IC8 A;  1LFU P;  3HBL A;  4FE7 A;  1ETK A;  2YU9 J;  4X6A J;  1ZR4 A;  3NRG A;  3BRU A;  2M34 A;  3SFI A;  4HNV A;  1FIP A;  1ENH A;  4A3L J;  1U9O A;  4NEL A;  1IG7 A;  2PZ9 A;  3HM5 A;  4QIW N;  5EFY A;  1OCT C;  5HBU A;  2AO9 A;  2RAE A;  3JRD A;  3GTM J;  1ETO A;  3VPR A;  2L7Z A;  1F43 A;  4KWA A;  4BXX J;  4BBS J;  2W53 A;  2LY9 A;  2G3B A;  3HKZ N;  3CMY A;  4MLO A;  5E3L A;  1ITY A;  1ZKG A;  3K7A J;  5EYR A;  1H88 C;  3CRJ A;  1MBH A;  3NI7 A;  2DMT A;  2TRT A;  2KT0 A;  1U9N A;  2LTP A;  3QQA A;  2CRG A;  2DJN A;  2JJ7 A;  3BG9 A;  3BR5 A;  1MNM C;  3S2D J;  2ZCM A;  3ANP A;  5CXG A;  3RZO J;  1A6I A;  2XGE A;  3HOU J;  3CDL A;  2AHQ A;  3S1N J;  1FJL A;  5F0C A;  2I10 A;  4AYB N;  2OF7 A;  2ZCX A;  3IH3 A;  1TWC J;  3ZQG A;  3HOV J;  3TW7 A;  1UI6 A;  4JKZ A;  3CWR A;  4A3K J;  2DA3 A;  3BTL A;  5C4J J;  3EGQ A;  4B4C A;  3BR0 A;  3VIB A;  2E2J J;  1W0T A;  1E3O C;  3NAU A;  1YRN B;  1AKH B;  2O7T A;  3VOX A;  2K9N A;  3WHB A;  3QBM A;  2Y30 A;  3BG3 A;  3H3V K;  5HOD A;  2D6Y A;  3BT9 A;  3BQY A;  3G1L A;  1S7E A;  1JJ6 C;  4UUT A;  1A5J A;  3BNI A;  4CYC A;  3BQZ A;  1QVU A;  2XPV A;  2COB A;  5J3L A;  3I4N J;  3G7R A;  1ETW A;  4AUX A;  1OJL A;  3A01 B;  2Y9Z A;  2R93 J;  2LLK A;  2JA6 J;  5IP9 J;  1B72 A;  4M3D A;  1RKT A;  5FKK A;  2VKV A;  1JTY A;  2V57 A;  4UDS A;  3ZQC A;  1XG1 A;  3ZQF A;  4GCL A;  5FKM A;  5D19 A;  3TED A;  1MSF C;  2R5Z A;  2CQQ A;  3TW6 A;  1QPI A;  2NS7 A;  2ID3 A;  1ETV A;  3IV5 A;  3JRI A;  5IPA A;  4A3I J;  1IDZ A;  5E3N A;  3HTJ A;  1I3Q J;  2QWT A;  3E7L A;  4MIM A;  3OIO A;  1PUF A;  3VVX A;  2DA4 A;  4L5E A;  3MKL A;  4FTH A;  3G1O A;  5BNG A;  5E3M A;  4Y52 J;  4UUS A;  1TC3 C;  4XRS G;  5DS9 A;  1JTX A;  2K9S A;  2CU7 A;  4M3E A;  5E3O A;  2GFN A;  2ECB A;  3HTA A;  2M0C A;  3GTQ J;  3RH2 A;  2DMP A;  2LFB A;  4C2M J;  3D1N I;  3O60 A;  1RPW A;  2DTZ A;  1WPK A;  1O4X A;  3HB9 A;  1I6H J;  2EZI A;  3BR6 A;  3MVP A;  5IYD J;  4IHY A;  4BBR J;  3AQT A;  3VW1 A;  2DA1 A;  3IUV A;  1JUM A;  1APL C;  5K7Z A;  4V2G A;  5IP6 A;  1RET A;  4Y7N J;  2DA6 A;  2WB1 N;  1EF4 A;  2RHA A;  3GZI A;  1MBF A;  3VVZ A;  1X2N A;  4NDL A;  2ID6 A;  1HF0 A;  2M9H A;  5IYB J;  1WI3 A;  1JT0 A;  2JA5 J;  5M3M J;  3QPS A;  4A3D J;  2VPR A;  3F0C A;  1NTC A;  1LE8 B;  2VI6 A;  2R5Y A;  4D5C A;  5EG0 B;  3CCY A;  3RKQ A;  4W97 A;  2R7Z J;  3Q0U A;  5IYC J;  4C3J J;  2QCO A;  4DZJ A;  1BA5 A;  3VOK A;  2HXO A;  2NVQ J;  2ZOY A;  2Y9Y A;  3OSG A;  1D5Y A;  3F1B A;  4MFD A;  3LSR A;  3ZQH A;  1JJ8 C;  3ANG A;  3HGG A;  1ORK A;  1OFC X;  2L0K A;  4G12 A;  1GUU A;  4B1R A;  1XC5 A;  2DMN A;  1VND A;  2ECC A;  2E2H J;  1FEX A;  2H1K A;  1F36 A;  2WUI A;  3BR2 A;  5K7H A;  2XGC A;  3TP0 A;  5GP9 A;  2R92 J;  3K2A A;  4I76 A;  2JN6 A;  2YUS A;  1H8A C;  1B8I B;  9ANT A;  2DG7 A;  1BJZ A;  3BTC A;  1GT0 C;  2F07 A;  3M3Y J;  1T56 A;  2KDZ A;  2MSY A;  2FQ4 A;  2JA8 J;  1ETQ A;  2HYJ A;  5F27 A;  1JGG A;  3PM1 A;  5GPA A;  4JL3 A;  2YVH A;  1I50 J;  2HYT A;  2X6O A;  3PAS A;  3IH4 A;  3HTI A;  3LWJ A;  2XB0 X;  1WH5 A;  3KKC A;  2MW8 A;  2QOP A;  3S2H J;  2UXP A;  4MK6 A;  1MBE A;  3BR3 A;  3L1P A;  3RD3 A;  5FKN A;  3LNQ A;  5FMP A;  2Q24 A;  3HIM A;  1ZGW A;  3SJM A;  5CW8 A;  4DYQ A;  1QRY A;  2EBI A;  4DZP A;  1CQT A;  3V6G A;  1R9T J;  2E19 A;  4JX6 A;  3JRG A;  3VP5 A;  1G2H A;  2FX0 A;  3GTG J;  2HXI A;  5M5W J;  3BHQ A;  1GDT A;  3HOY J;  5EGO B;  2GEN A;  2UXH A;  2XSD C;  5FGL A;  1DU6 A;  2QKO A;  1UI5 A;  4ME9 A;  4JYK A;  3GEU A;  3JRH A;  2DA5 A;  3JRB A;  3VUQ A;  3LJL A;  2EZH A;  4D5F A;  2XPW A;  1YRN A;  1X58 A;  2HI3 A;  5JLX A;  3BG5 A;  2K40 A;  1MSE C;  3GTL J;  5FLV A;  5D1R A;  1BL0 A;  4A3E J;  2JK3 A;  2NOG A;  4CGR A;  4J19 A;  2QIB A;  2N8G A;  2DA7 A;  3C07 A;  4JP0 A;  3ZQI A;  5M5Y J;  4MFE A;  1TWH J;  3C2B A;  1IGN A;  3RQI A;  2G7L A;  1SAN A;  2EZK A;  3JRA A;  1WCM J;  4QTR A;  4JX5 A;  4CYC B;  3A01 A;  3NPI A;  2NVX J;  1AU7 A;  5FLM J;  1MH4 A;  3OOU A;  1IDY A;  5F04 A;  5C44 J;  1AHD P;  1BW6 A;  2W48 A;  4C3H J;  2LVS A;  2G7S A;  5C4X J;  2HOA A;  5F1J A;  2XGD A;  2NX4 A;  1IRZ A;  1VFC A;  3ZOB A;  5DAJ A;  3HOW J;  4A3J J;  4A3C J;  3JSJ A;  5J1R A;  2MGQ A;  3NAR A;  4ACI A;  3S16 J;  3MNL A;  2LK2 A;  2LD5 A;  2IBD A;  2FJ1 A;  4IEJ A;  1RES A;  3BCG A;  4YZE A;  2R0Q C;  2B63 J;  3O8G A;  5IOZ A;  1VF9 A;  4ABZ A;  2O9L A;  4IHW A;  1Z77 A;  4XRM A;  3S15 J;  1JKQ C;  3GTO J;  2DA2 A;  2QTQ A;  3CJD A;  1GV2 A;  3AQS A;  3BTI A;  1MBG A;  2ELK A;  2JA7 J;  3S14 J;  3BR1 A;  3LSG A;  3UKG A;  2VUM J;  3G1M A;  4GFL A;  2D5V A;  4MO7 A;  4AC6 A;  2ZB9 A;  1TWA J;  3JR9 A;  3RZD J;  1GVD A;  1OCP A;  4DW6 A;  4FIS A;  3S5R A;  2X9D A;  2RAS A;  1GV5 A;  2PBX A;  5M5X J;  3PPB A;  4A93 J;  3Q0V A;  5EEA A;  1IUF A;  5EF6 A;  2E2I J;  4IHX A;  1NK2 P;  1LE8 A;  2CUE A;  5EG0 A;  4MXM A;  3B6C A;  3KZ9 A;  4FCY A;  3IH2 A;  1P7J A;  5K7F A;  4IHV A;  5JLW A;  1U8B A;  1FTT A;  2Y31 A;  2ZOZ A;  1H89 C;  2GLO A;  4BY7 J;  3HDD A;  4DYC A;  5J1Y A;  2OPT A;  3JRF A;  2HQ5 A;  3BTJ A;  2YVE A;  3S1Q J;  5C3E J;  1U78 A;  5FJ8 J;  3VW2 A;  4I6Z A;  4A3F J;  3MN2 A;  5EZH A;  4EEF G;  4BY1 J;  4D7M A; 
#chains in the Genus database with same CATH topology
 3KIO A;  4R1H A;  4GCT A;  2WBM A;  2NP3 A;  1D8K A;  3OYF A;  3K4K A;  4ZC3 A;  2WV1 A;  4G7O F;  3MZ8 A;  3NWS A;  2RC4 A;  4A0X A;  2BY2 A;  2XAG A;  1VQP I;  1TP4 A;  2AQF A;  2E1O A;  4GCV A;  4A69 C;  1ETX A;  1J5Y A;  2BBY A;  3FBI B;  1R5H A;  3Q0W A;  5AQC A;  4XKW A;  3GFI A;  1TWG J;  5HSZ A;  3DPT A;  2IGM A;  3HTH A;  4L62 A;  2PMZ N;  2ELJ A;  2C6Y A;  4BS9 A;  1T8I A;  4LB6 B;  5HDN A;  3TP3 A;  5K5Q A;  3GTP J;  3L2W A;  2B3W A;  5K5O A;  4OWR B;  2OUM A;  1U5T B;  2PFV A;  5CXI A;  2O7O A;  4M6V A;  1O3S A;  2VJJ A;  2KP6 A;  1DDN A;  1NK3 P;  3KNW A;  1H0M A;  3OYL A;  3HE0 A;  3QOE A;  4KFC A;  3QPL A;  1ZQ3 P;  3PIP F;  5CJ9 A;  2LKX A;  2IAI A;  4XON A;  2XKP A;  2LSO A;  2V1N A;  2FBQ A;  1WHU A;  2UV1 A;  3K9T A;  4LD5 A;  3N97 A;  1MDM A;  3HGY A;  5K5R A;  3ECH A;  1G3W A;  2FNA A;  4LG3 A;  1G6N A;  3FKI J;  2CQN A;  2CUZ A;  4UHT A;  1U5T C;  2DDB A;  1BI3 A;  3ON4 A;  3I71 A;  1WKM A;  2XAS A;  1N75 A;  1VQL I;  2LOO A;  1SFX A;  2REK A;  5JFR A;  2DOD A;  1KYW A;  2LP0 A;  2EIN H;  2WAQ N;  3O8H A;  2YX4 A;  1Y6I A;  2G9W A;  1T08 B;  2TCT A;  1GVJ A;  3H9Q A;  3IKV A;  4Y15 A;  4PFP A;  3G73 A;  2JZY A;  2VL8 A;  3WU1 B;  2OBP A;  4XNF A;  1BC8 C;  2JTV A;  4KIF A;  4XLP F;  4CCL A;  3PIO F;  4EJV A;  3HOS A;  3S1M J;  2B1E A;  1MH3 A;  3MZH A;  2NRA C;  3ZCO A;  3GX4 X;  4AF5 A;  2XSJ C;  1QBJ A;  3VW0 A;  3AL0 C;  1QZY A;  1QVT A;  2X48 A;  2EK5 A;  1YW8 A;  3FK6 A;  5FFZ A;  4FT8 A;  3W6K B;  3W6V A;  1TNT A;  2BY3 A;  4UUS B;  2OTJ I;  4XBF A;  3CQZ J;  1TW3 A;  3OS1 A;  4I99 C;  1Q1H A;  3KKD A;  3KP3 A;  2KJC A;  4BQQ A;  2OA4 A;  3J80 K;  2ME0 A;  2MLK A;  2H8R A;  4MTE A;  4U9N A;  2QF7 A;  2G0E A;  1T39 A;  3V8L A;  4UY8 I;  1VQN I;  3CD6 I;  2ZBK A;  1A31 A;  4EGY A;  2EH3 A;  2JRT A;  3GYH X;  2OER A;  2MD0 A;  4C3I J;  4JX4 A;  2DFE A;  1W7P D;  3RPQ A;  2EFP A;  1ULY A;  3BZ6 A;  5J4Y A;  2ZFW A;  4LIT A;  1Y1W J;  5C4Y A;  4Q47 A;  1E17 A;  4X1E A;  3NEU A;  2P7V B;  3SZP A;  1T2K A;  2M2E A;  1G59 A;  4BU2 A;  2K86 A;  4HOB A;  2FD5 A;  2LYC A;  2VAS A;  2R7O A;  3LOC A;  3TL4 X;  2HWV A;  2CWE A;  2W4S A;  4XLN F;  4GFB A;  4RAG A;  1BJA A;  3CP2 A;  4A3M J;  2E5Z A;  2Y0S N;  3E5Q A;  2MC3 A;  1WFX A;  2XUB A;  3QYF A;  4YFK F;  4XID A;  4RAF A;  3DPU A;  2RVC A;  2H09 A;  4C9Y A;  4KYW A;  5BPI A;  2O8K A;  4ASN A;  1IC8 A;  1V5E A;  1LFU P;  4FE7 A;  4OIN F;  2GA1 A;  2AQE A;  2BHY A;  3NRG A;  1SC7 A;  2ZJ2 A;  3H35 A;  4HNV A;  4A3L J;  1ENH A;  1IG7 A;  1T0F C;  2L4A A;  1IO2 A;  1QZZ A;  3VFZ A;  1IV8 A;  3KYD B;  5EFY A;  3BC8 A;  4ENM A;  3FXO A;  4I7H A;  4IOC F;  2K4B A;  2OAZ A;  1F43 A;  2P4W A;  3IUO A;  2LY9 A;  2VIX A;  3W6J B;  1BM9 A;  3FBN B;  3CMY A;  1VQ6 I;  4C2M A;  3BJO A;  2ACJ A;  3Q5F A;  2HR3 A;  2DFI A;  3HC7 A;  3QQA A;  4UVB A;  2G7U A;  3I53 A;  2ZCM A;  3V78 A;  2DJN A;  3MKY B;  3S2D J;  2VC1 A;  3ANP A;  4BEH A;  3RZO J;  3HOU J;  1FP2 A;  2AHQ A;  3ZXS A;  4CO8 A;  3OYB A;  4BAC A;  2XVC A;  4XOR A;  4P9F A;  3LAP A;  3I55 I;  3CC4 I;  1E2X A;  2XGX A;  5C4J J;  3EGQ A;  1MMD A;  5GTH C;  3BR0 A;  5CQE A;  1OCO H;  1W0T A;  3GFL A;  2M4K A;  3TQN A;  3CUQ A;  1AKH B;  2O7T A;  4UB6 C;  5LHI A;  4M73 A;  4MHG A;  4HLX A;  2Z3Y A;  2A6E F;  3M07 A;  3BG3 A;  3H3V K;  2DOF A;  2EA4 A;  2X1C A;  5CKT A;  1S7E A;  4PJJ A;  3F8B A;  3GW2 A;  4G8X A;  5DEQ A;  1D1A A;  4LLG F;  2XPV A;  3G7R A;  3PJR A;  4AUX A;  1A6Q A;  2E7W A;  3V8K A;  2W1O A;  1WWX A;  2LLK A;  2OD5 A;  4XN0 A;  3KLO A;  1B72 A;  2QEX I;  2HVR A;  3SQN A;  1LEA A;  5L3C A;  4GGG A;  1TZL A;  2BVM A;  1W36 C;  1XG1 A;  3LFU A;  2IGO A;  5J4V A;  2F48 A;  3S2W A;  1FOX A;  2FBK A;  2CQQ A;  3TW6 A;  1LDD A;  2ID3 A;  4KIT B;  3F72 A;  4A3I J;  2QEN A;  4IQ4 A;  3E0J B;  2FMY A;  1FLI A;  3T5X A;  2Z99 A;  3M1E A;  4MIM A;  5KVR A;  1PUF A;  3VVX A;  2DPU A;  2BW3 B;  4CH7 A;  4F7Z A;  1TC3 C;  4XRS G;  1BIB A;  4BHB A;  1JTX A;  2QQA A;  2PFB A;  1IF1 A;  2ECB A;  3HTA A;  2M0C A;  4BQO A;  2O61 A;  2DMP A;  4C2M J;  1PJR A;  1U0J A;  2DCE A;  3BRO A;  3F21 A;  2FOW A;  4LK0 F;  1WRJ A;  2Z1D A;  1SVL A;  4ZTF A;  3BR6 A;  3MVP A;  4IHY A;  3RSN A;  4YFN F;  2HQN A;  3ZMS A;  1APL C;  4PGG A;  4BHC A;  3F3X A;  5K7Z A;  2V7F A;  4V2G A;  3I5U A;  4XLH A;  4KMF A;  4Y7N J;  2WB1 N;  1E3P A;  1NHA A;  3RDI A;  3F23 A;  2M1B A;  1MBF A;  3DBR B;  2ID6 A;  2QBY A;  3VEP A;  3HL2 A;  1EV7 A;  5IYB J;  1RNL A;  2O3F A;  5M3M J;  3QPS A;  4A3D J;  2VPR A;  3LSH A;  4HV5 A;  2R5Y A;  4D5C A;  5EG0 B;  2JUG A;  2L9N A;  5IYC J;  1XCV A;  3LQR A;  4RLQ A;  4DZJ A;  1BA5 A;  1O3R A;  4IKF A;  1X1D A;  1YS7 A;  2NVQ J;  2NNN A;  5EEG A;  3C3W A;  3GME A;  3OSG A;  5L3B A;  2HGC A;  3BP8 A;  3VDX A;  3LSR A;  1OCC H;  3ZQH A;  1V5G A;  1E3H A;  1YHQ I;  2EPF A;  1ORK A;  4UNO A;  2OZ6 A;  2QLZ A;  4G12 A;  1XGM A;  2R7Q A;  2DMN A;  2JUC A;  1VND A;  5F6F A;  1FEX A;  3WTS C;  2H1K A;  2KRH A;  2WUI A;  3GWZ A;  2R92 J;  2XGC A;  5L3G A;  4I76 A;  3CLO A;  2VON A;  1DPU A;  3BDD A;  3DBH B;  1H8A C;  4Q4Z F;  3GZN B;  4ETS A;  1BJZ A;  2F07 A;  2FXA A;  2L2O A;  3ABM H;  5HS9 A;  1XGO A;  3U1D A;  1P4W A;  2JA8 J;  1J75 A;  3M1C A;  3OYN A;  4PJN A;  1D0Z A;  1FOW A;  2BYV E;  4P96 A;  3PAS A;  2DPD A;  1UHM A;  3ABU A;  3VWB A;  2P6S A;  3KKC A;  1S5L C;  2MW8 A;  3JCU C;  2QOP A;  4MK6 A;  3RD3 A;  2XV4 S;  2FML A;  3LNQ A;  2B9S A;  2Z9O A;  2VE9 A;  3HIM A;  1ZGW A;  3IC7 A;  4FHT A;  3SJM A;  1PP8 F;  2FEZ A;  2EFQ A;  2D2W A;  4Q48 A;  4DZP A;  1ZGA A;  3V6G A;  1R9T J;  2X6Y A;  3L2U A;  1IN6 A;  3F8N A;  3JRG A;  5IT9 Z;  2FQ3 A;  3DKY A;  3GTG J;  5CVR A;  1VQ7 I;  2XSD C;  3MQ0 A;  2W25 A;  3ZMV A;  1V3F A;  4JYK A;  2HTS A;  1ZRC A;  3JRB A;  5D4S A;  1MDM B;  1MKM A;  3OWT A;  5E20 A;  4IXA A;  2IPQ X;  1MSE C;  2GIZ A;  5FLV A;  2R4G A;  2NOG A;  2EFW A;  2IA2 A;  2VJI A;  3BZK A;  2N8G A;  4F91 B;  1I39 A;  2RGV A;  3U2R A;  3C2B A;  2DK5 A;  4RGU A;  4B3X A;  3S3M A;  1WCM J;  1TT5 B;  3O3K A;  3WE3 A;  4E4H A;  2WA0 A;  2FRH A;  3CES A;  3WE2 A;  1AU7 A;  1FBS A;  5FLM J;  1R58 A;  3OYE A;  1A04 A;  1Y56 A;  2RNJ A;  3FHZ A;  4OMY A;  5C44 J;  1AHD P;  1BW6 A;  3HPG A;  2LVS A;  2G7S A;  3S32 A;  4KUM A;  2NX4 A;  2DFF A;  3ZOB A;  5DAJ A;  4A3J J;  3MEX A;  1L0O C;  3IWZ A;  4BE2 A;  1BI2 A;  1TTY A;  4MNU A;  1R5I D;  1QU3 A;  2OU2 A;  1EKE A;  2PJP A;  2IBD A;  2ZJR F;  2WY7 Q;  4ZZD A;  3CDI A;  2QVO A;  3FWE A;  4KIC A;  3CC2 I;  4RS8 A;  2KZV A;  2EV0 A;  3MKW B;  2DJI A;  1GV2 A;  5BS6 A;  3AQS A;  1MBG A;  4HRI A;  2LNB A;  2ELH A;  2K7L A;  3K69 A;  4RB3 C;  5D5V B;  4ZYE A;  4I98 B;  3H9J A;  5ERI A;  2A68 F;  3DPL C;  3RZD J;  1ZYR F;  1GVD A;  1X1A A;  2CW0 F;  4P9U A;  2YR2 A;  4EJO A;  5H6Q A;  2K5C A;  1U3E M;  5J8C A;  1YTY A;  4LGW A;  4NNJ A;  1PP7 U;  2E1C A;  4A93 J;  5EF6 A;  3ZP5 A;  2E2I J;  4IHX A;  2CUE A;  2LDU A;  1W7P B;  3KZ9 A;  2HNH A;  4FCY A;  3IH2 A;  1ACI A;  1X3W B;  3ZR8 X;  1OR7 C;  3BPX A;  5JLW A;  3HIF A;  2PLY A;  1KQ9 A;  2YU3 A;  3JRF A;  4NQW A;  5C3E J;  2P5V A;  3ELK A;  1SFU A;  4IOA F;  5DYM A;  3MN2 A;  5EZH A;  2JVH A;  2QM3 A;  1DU0 A;  2HTJ A;  5IOY A;  4HQE A;  4HF2 A;  1HC8 A;  2UXO A;  5LEJ A;  4AU7 A;  2GXB A;  2F2E A;  4DGW B;  1B6A A;  4E6K G;  6PAX A;  4HX7 A;  5GAE J;  3NXC A;  1E0E A;  3AG2 H;  1W1W E;  4D9J A;  2Y69 H;  3LSJ A;  3Q3S A;  1MJ9 A;  1WH7 A;  2NYX A;  3F6O A;  2HVQ A;  3PQK A;  5CVJ A;  1ZN2 A;  4BEH B;  1T98 A;  2HKU A;  3ON2 A;  2JWT A;  4X0G A;  1HDP A;  5IP7 J;  1N25 A;  3JRC A;  1XPX A;  1IUY A;  1O3T A;  4JK1 X;  2ZXH A;  3EYI A;  4PGH A;  1A35 A;  3HEF A;  1KU7 A;  4JNN A;  3A02 A;  2R3S A;  3MMY B;  4FET A;  5EZG A;  1DGW Y;  3KYC B;  5FKL A;  1M1E B;  2H1L A;  4PXI A;  3SEZ A;  1BW5 A;  1UHS A;  1EH8 A;  1AKH A;  2ME6 A;  2VT2 A;  3K0L A;  3VSK A;  1LKX A;  1XDS A;  5EGO A;  3CUQ B;  1FZP B;  2MFZ A;  3SDG A;  1LFB A;  3DQV C;  3GZ5 A;  4XRS A;  1HLV A;  2IS1 A;  2NVT J;  5FKO A;  2UXX A;  3P5J A;  1VQ9 I;  1OYI A;  1N78 A;  3LWF A;  4WIB A;  2DMU A;  2X85 A;  1YX5 A;  2V9P A;  1FIA A;  3KEQ A;  5FB2 A;  1JKO C;  4IL6 C;  3U9G A;  4LG0 A;  3WTY C;  3A1Y A;  3EPZ A;  2XDV A;  2EQR A;  1UB9 A;  2JMW A;  1B72 B;  4IRI A;  1POG A;  1S9H A;  2KIS A;  1BBY A;  1FT9 A;  1PYV A;  2EFN A;  3JSP A;  3CUQ C;  1VQO I;  3J7A O;  2ZME C;  4S04 A;  2O6G E;  2PN6 A;  3DXJ F;  3G2B A;  3D5L A;  4S0H B;  4BJ5 C;  2Q2E A;  3GTK J;  3SHF A;  4B3A A;  1PVE A;  3CCV I;  3BJA A;  1S72 I;  3CDH A;  5FHP A;  2V26 A;  4DYR A;  3E7Q A;  2WAE A;  2Q0O A;  2MD5 A;  1PUF B;  1Z0X A;  2BY0 A;  3F8C A;  3HRU A;  3NS4 A;  1R71 A;  4XOP A;  5JR3 A;  1JUS A;  4PFO A;  1UCR A;  1MBJ A;  5E18 F;  5B5E C;  4GYG A;  3S1R J;  4JQF A;  4B09 A;  4O5V A;  1SGM A;  1FTZ A;  4L9J A;  1ZRD A;  2NS8 A;  3K6G A;  4WXD A;  5A2Q Z;  1XD7 A;  3D5S C;  4GCK A;  1K7A A;  4OOI A;  3OYM A;  1IJW C;  2V4J C;  3AG4 H;  3RTR A;  2DQR A;  4L9T A;  5BMZ A;  4L9N A;  2X0L A;  3MCZ A;  3KPH A;  1HCR A;  4HPQ A;  3SZT A;  4LK1 F;  5DTD A;  3N4M A;  2DG8 A;  3SWH A;  2UUZ A;  2XPU A;  1AWC A;  2DFH A;  1TWF J;  3ZMT A;  2DTR A;  2QBY B;  4IRH A;  2GZW A;  2F6C A;  3E6B A;  2OC6 A;  1G3S A;  2JSC A;  2M87 A;  3K1P A;  2HKX A;  2R5Y B;  3LFK A;  3MWM A;  1J9I A;  2E7X A;  4YEJ A;  1RR7 A;  3K10 A;  3OMY A;  2L3D A;  2M8G X;  1XB4 A;  1K61 A;  4RB2 C;  2XKO A;  4HNU A;  3M4O J;  4HST A;  4RBO A;  3V42 A;  5ILU A;  2IGK A;  4HYE A;  4RAZ A;  4OIR F;  5FO5 A;  4XL9 A;  3MD2 A;  2DBB A;  3OV8 A;  4U0W A;  4EAT A;  3E6C C;  2JA2 A;  1OYY A;  2PZ9 A;  4QIW N;  4NC7 A;  5HBU A;  1KQ0 A;  2O5R A;  4O6J A;  5LEK A;  3PNV A;  3ERE D;  2HQA A;  1BIA A;  3QRF F;  4G6Q A;  3H5R A;  1IN4 A;  4BXX J;  2TDX A;  3WG7 H;  3NRV A;  1X3U A;  1RZ4 A;  2KRF A;  4XQF A;  3K4M A;  3ZRG A;  2XC7 A;  4BBS J;  3HTS B;  4PJM A;  2V79 A;  5B3S H;  4MLO A;  5E3L A;  3CRJ A;  2NAZ A;  4E7Z A;  1SVM A;  4ZYA A;  4CIC A;  3DFG A;  2TRT A;  2OTL I;  2O8X A;  5HNF A;  1MNM C;  3ASO H;  1BR1 A;  1H9G A;  3S1N J;  4OD4 A;  1FJL A;  2P8T A;  3FMQ A;  2VKH A;  2I10 A;  4AYB N;  2QZ8 A;  2OF7 A;  4XRF A;  2ZCX A;  1TWC J;  1XSX A;  4FAS D;  1UI6 A;  4JKZ A;  1J59 A;  2B7E A;  2KHM A;  2DA3 A;  1YLF A;  5TIS C;  5HLI A;  4EM0 B;  4PJL A;  3W3C A;  4LIV A;  1G4D A;  2R7T A;  3KEO A;  1LNW A;  1IRG A;  3VIB A;  3BPV A;  3NAU A;  3H0D A;  2LKP A;  2QQ8 A;  4OD5 A;  2R7F A;  3Q9V A;  3T1B A;  1XSV A;  5TJJ A;  4KNY A;  2JVG A;  2LBF A;  3VYT B;  3PL8 A;  5CVU A;  3KET A;  4RM3 A;  2GIV A;  4EGZ A;  1K4S A;  1ERD A;  1DQU A;  2CW7 A;  3GVA A;  5LGN A;  1J0R A;  4WXC A;  3K70 D;  1MMA A;  2ZY9 A;  2COB A;  3I4N J;  2BZT A;  1ETW A;  3E3V A;  1K4T A;  5HDG A;  5IP9 J;  2QKM B;  4RAY A;  4A5M A;  4BUP A;  1RKT A;  3WTW C;  5FKK A;  3MFK A;  2P5K A;  3CCJ I;  1JTY A;  3HRS A;  4MEX F;  4GO1 A;  2V57 A;  4UDS A;  4E7H A;  4WWC A;  4DOZ A;  1XTA A;  1ETV A;  3KZZ A;  3I9V 2;  3U1K A;  1IDZ A;  3L2V A;  4OIO F;  3HYI A;  4HW0 A;  1HW5 A;  3KEY A;  3QYB A;  3G4S I;  1K78 A;  2VBW A;  2LRE A;  3DLL F;  3OIO A;  2NNY A;  2HDW A;  3H92 A;  1G8X A;  5AIP A;  3X2Q H;  4L5E A;  2HVS A;  2ZSI B;  3KLN A;  3OR1 C;  4Y52 J;  2K9L A;  2F5F A;  5DS9 A;  4PDK A;  2K9S A;  4YIF A;  4JOM A;  3JW4 A;  2H6B A;  2PQ8 A;  3VB2 A;  3CCL I;  2GFN A;  2WV0 A;  2E60 A;  4JBA A;  3KFW X;  4HX4 A;  5DD8 A;  3GTQ J;  1WJ5 A;  3O60 A;  3REO A;  5ICF A;  4HBL A;  1WPK A;  2OZU A;  1LQ1 A;  3HB9 A;  1I6H J;  1YOV B;  1UFM A;  1IN8 A;  4ESF A;  5IYD J;  1R5G A;  3AQT A;  3VW1 A;  1W4M A;  3ABT A;  1JUM A;  3L7W A;  4PZJ A;  2QA4 I;  1EF4 A;  2J5P A;  1Y0U A;  2RHA A;  4KIG A;  3E5U A;  1X2N A;  1ZG5 A;  1ZRF A;  1NG6 A;  3W2W A;  3LA7 A;  1HF0 A;  1TNS A;  5D5X B;  2JA5 J;  3FKJ A;  2X51 A;  1G3Y A;  5JVG F;  1W7P A;  4P55 A;  1NTC A;  2DI3 A;  1OIS A;  3J7Y J;  3RKQ A;  3BCA A;  2DT7 B;  3GFJ A;  1MMN A;  3TDZ C;  2DU9 A;  2E1M B;  3DP7 A;  3G3Z A;  3EUH A;  2O03 A;  3KP2 A;  1D3Y A;  2R7W A;  5H20 A;  1O7L A;  4XKC A;  1GXQ A;  3H3U A;  3FHN A;  3KZY A;  4NQW B;  2A07 F;  4LMY A;  3CME I;  1JJ8 C;  3HGG A;  3ISP A;  4B1R A;  3ZMU A;  4OIQ F;  3I59 A;  2ECC A;  4XKV A;  1F36 A;  3BR2 A;  1FY7 A;  3CP8 A;  5EEH A;  3TP0 A;  3OS2 A;  3MZY A;  1HBX G;  2JN6 A;  2OQR A;  2KIQ A;  3C1D A;  9ANT A;  2E1M C;  3BOQ A;  2L4M A;  3QU6 A;  5FLX Z;  4EJU A;  2KDZ A;  2R7U A;  4XLF A;  3CCE I;  1OQY A;  2FQ4 A;  2HYJ A;  3PNY A;  3ZMD A;  4G6T B;  3R0A A;  3WTU C;  4CHU A;  1FBU A;  4HDV A;  2VLA A;  5IT9 K;  2HYT A;  4MQ9 F;  5J8F A;  2IRF G;  4DJA A;  3FM5 A;  5DCM A;  1YQA A;  3J81 Z;  3LWJ A;  3QPH A;  3CTA A;  3L1P A;  5FKN A;  1T38 A;  5FMP A;  2I5U A;  5CW8 A;  3K4N A;  1WJA A;  3QPT A;  1H9T A;  2EBI A;  2FE3 A;  1GLN A;  2K85 A;  4M9S A;  1I1G A;  2RN7 A;  2LF8 A;  2JSP A;  2KIU A;  2ICW G;  3CCS I;  2WAF A;  1G2H A;  2FX0 A;  4RLF A;  3RKX A;  2GEN A;  3HOY J;  5EGO B;  2UXH A;  1DU6 A;  1UI5 A;  1Y8R B;  4ME9 A;  3JRH A;  3E5X A;  3TO9 A;  2ISZ A;  2R7R A;  2XPW A;  2HI3 A;  1IRF A;  1DPR A;  1TL8 A;  3CUO A;  3HJE A;  5LGU A;  5H2F C;  3HOT A;  1BL0 A;  2M7A A;  4F3Q A;  1UEL B;  4A3E J;  2JK3 A;  1KYZ A;  2ISY A;  2JPC A;  4J19 A;  2M30 A;  2NXN B;  2OJE D;  2XAQ A;  4A5N A;  4G7H F;  3CCR I;  4BQA A;  4LG0 B;  3C07 A;  1IGN A;  2KFD A;  3LSM A;  3RQI A;  3QWL A;  2FA5 A;  3JRA A;  2HKO A;  4JX5 A;  4CYC B;  4NC8 A;  1R7J A;  2CG4 A;  3NPI A;  3K1N A;  1JXS A;  2NVX J;  2NS0 A;  2DW4 A;  3OOU A;  2K9M A;  2XRN A;  1S7A A;  1X3Z B;  2Q2E B;  1T95 A;  2ZCW A;  1LPQ A;  4C3H J;  2WAD A;  5C4X J;  2HOA A;  1WJD A;  5F1J A;  2XGD A;  4RGX A;  3IL2 A;  1XMK A;  4H4K C;  1SEU A;  4A0Y A;  3HPH A;  5D8K B;  5J1R A;  1R1V A;  4GDF A;  1I27 A;  5HLH A;  5HDK A;  3BG6 A;  1VQK I;  4EJT A;  3S16 J;  4IVN A;  1HST A;  2DYR H;  2FJ1 A;  2GXA A;  4Y13 A;  2VPL A;  2R0Q C;  2DXI A;  1Z21 A;  2IVM A;  1QO0 D;  2BE5 F;  2P6T A;  2MBF A;  3PFY A;  2VC0 A;  3F8M A;  4ABZ A;  2LY1 A;  2X1D A;  2GQQ A;  4XRM A;  4M74 A;  3RPU D;  4MTD A;  3CJQ B;  2L5Q A;  2DA2 A;  1ZGJ A;  1Y39 A;  4UVA A;  3IAM 2;  4IRV A;  2HOE A;  4YFX F;  2EIJ H;  3CJR B;  2RV8 A;  1JHH A;  3PUF A;  3S14 J;  5HNH A;  1FMV A;  3PSI A;  4AM3 A;  2A5Y B;  1YJW I;  2VUM J;  1RR8 C;  2IA1 A;  3HHG A;  2ZB9 A;  2EIM H;  2MAB A;  3I64 A;  3OYH A;  4BJ6 C;  1HQC A;  3EUA A;  3RPU A;  3OYC A;  4FIS A;  3QAH A;  3F8F A;  2KPM A;  2RAS A;  2PG4 A;  2VE8 A;  4R79 A;  5EEA A;  5LHH A;  3DU6 A;  3AAF A;  5FRN A;  1IUF A;  1KON A;  1FBQ A;  3I58 A;  4MXM A;  1ODD A;  4CZZ A;  2QUF A;  3FXJ A;  2WC2 A;  4U7D A;  3L9F A;  1P7J A;  4IHV A;  2LY2 A;  1U8B A;  3K8P C;  1FTT A;  3MKZ A;  3CJN A;  5LRS A;  3H5A A;  4BY7 J;  3LST A;  1UST A;  2VXD A;  3BTJ A;  4XOT A;  2YVE A;  3S1Q J;  4ON0 A;  3VW2 A;  1YJ9 I;  4IHT A;  1Z3Y A;  4BQN A;  4D7M A;  4L18 B;  2QWW A;  3DCF A;  3I56 I;  4EM1 A;  1IV6 A;  4AWX B;  3LA2 A;  1B8I A;  3COL A;  3WG9 A;  3EUP A;  3V7S A;  2QQB A;  1F1Z A;  1Y8Q B;  2QQ9 A;  1YI2 I;  2G7G A;  4BAY A;  1MZB A;  1HOM A;  2NVY J;  1JKP C;  4M3F A;  3VTI A;  3L2R A;  2E35 A;  3VVY A;  1W0U A;  5ICE A;  5GTI C;  5JI6 A;  2IJL A;  3IHU A;  5ILS A;  3K1M A;  3T6N A;  3QOP A;  1JT6 A;  5DV5 A;  4L5I A;  2QKL B;  4E70 A;  5D6E A;  2BEO A;  5BPD A;  2FSW A;  2JT1 A;  1Z3X A;  3HOX J;  1JUP A;  2GM4 A;  2QSG X;  1BN5 A;  4F55 A;  2MG4 A;  4W1U A;  3OR2 C;  2ZXW H;  2ZFU A;  3FIS A;  4BL0 B;  2VKE A;  2ZJQ F;  2EA2 A;  2LR8 A;  1MW7 A;  2ZCN A;  4E7L A;  2EIL H;  3ESW B;  4A6E A;  3I3L A;  5F08 A;  4LOC A;  1WGX A;  3L00 A;  4F52 A;  5D5U B;  2M0M A;  2V6E A;  5K58 A;  1I3A A;  4A0Z A;  1Z91 A;  2LBF B;  3DEW A;  2STT A;  4G6D A;  1ZRE A;  3OYJ A;  1OLT A;  2F5E A;  4EV0 A;  4KN7 X;  4RM2 A;  1I5Z A;  5KK1 A;  4AIK A;  4UUV A;  2M8E A;  2PI0 A;  3FK7 A;  4AVP A;  3H0G J;  2L9R A;  3FXQ A;  1YW7 A;  5HAW A;  1MMG A;  2Y2Z A;  2NP5 A;  2GBY A;  2YPR A;  3R60 A;  3KYL A;  2R7S A;  1SFO J;  1JGS A;  2D1V A;  3DTE A;  1ZAO A;  3JSO A;  1JKR C;  1UMQ A;  3GO5 A;  4M3G A;  2HOS A;  3B81 A;  2VJ4 A;  2HOT A;  1Q1V A;  2DMQ A;  1QA6 A;  3FMS A;  3NNR A;  4MQV A;  3VYR B;  2HDD A;  1JI8 A;  3I4P A;  4BHP A;  4U88 A;  5A2Q K;  1F4K A;  1CGP A;  2O0Y A;  1K78 B;  2A2F X;  5H9T A;  4RMN A;  2KMU A;  1HDD C;  4I01 A;  3K4L A;  3BJB A;  1O3Q A;  5FGM A;  1S29 A;  1REP C;  4BKX A;  3SXY A;  3SFZ A;  2MC4 A;  1TQM A;  4NC6 A;  1HSJ A;  3WHC A;  1J09 A;  5J47 A;  1SD7 A;  3PO2 J;  4QSH A;  4H0E A;  3K70 C;  2F4M B;  4DQ2 A;  4PCQ A;  1YFH A;  3L2Q A;  1FYL A;  1CF7 B;  5F0F A;  4PK4 A;  2DO7 A;  1X4O A;  4CDG A;  2Q1Z B;  4RDU A;  3RYR A;  2CJJ A;  4IX7 A;  3FM3 A;  2NVU B;  3SZG A;  3HSF A;  4KJZ A;  5H6R A;  3W2A A;  1X2M A;  5AIQ A;  4ZDO A;  2J5O A;  2KQR A;  4XLC A;  5LLQ A;  4GFK A;  1EA3 A;  1XS9 A;  2IEK A;  4YRV A;  1MGT A;  1ZEL A;  2A6H F;  2E71 A;  1P92 A;  3F9K A;  1EH7 A;  3FXM A;  2A3S A;  4I02 A;  1ZK8 A;  2OI8 A;  1LVK A;  2HEO A;  5GPC A;  3QKX A;  2ZSH B;  4RGS A;  2CUJ A;  2L9V A;  3FXK A;  3IRR A;  1S7O A;  2A61 A;  3GUD A;  3I4M J;  1B1B A;  1OKR A;  2XRO A;  3JTG A;  3HZJ A;  2LMD A;  4IF4 A;  4WX9 A;  1F9N A;  1T33 A;  3LSP A;  1MJB A;  2XDN A;  2M5W A;  1QQI A;  3CO6 C;  1UG2 A;  4V2F A;  2YU9 J;  3I59 B;  3HBL A;  4X6A J;  3RKY A;  2VQH A;  2KLO A;  2E1N A;  4NEL A;  1FIP A;  1ZLJ A;  3FXU A;  2DDA A;  4CA0 A;  3HM5 A;  2CS3 A;  3ERM A;  3ULQ B;  3CO7 C;  1X1P A;  5E1X A;  1OCT C;  2AO9 A;  2RAE A;  3JRD A;  1SVO A;  3GTM J;  3EUH C;  3VPR A;  2F4I A;  1XSD A;  1F5T A;  1BI0 A;  1LUJ B;  4KWA A;  2DOE A;  1B9M A;  1IXR C;  2VXZ A;  2IP2 A;  3DLA A;  2W53 A;  3GLL A;  4BNC A;  2G3B A;  2W82 A;  1FSE A;  2RQQ A;  2H94 A;  3EDP A;  3K7A J;  5EYR A;  3UR3 C;  1MBH A;  4B43 A;  1ITY A;  5DCM B;  2KT0 A;  1U9N A;  2CRG A;  3BG9 A;  4YG2 F;  4M9X A;  3AKZ A;  1YS6 A;  1A6I A;  5LRR A;  5JVT A;  3CDL A;  3M8E A;  3OOP A;  5F0C A;  2IT0 A;  3DKW A;  3HOV J;  3DKX A;  2KIF A;  5CLS A;  2R7V A;  4A3K J;  2HU9 A;  3CWR A;  2P0W A;  2K02 A;  3WGI A;  4U0Y A;  4B4C A;  2DT5 A;  3ROU A;  1G3T A;  1MND A;  4BH9 A;  2E2J J;  1P2F A;  3AG3 H;  1TT0 A;  2BY1 A;  1A36 A;  1XX5 A;  3H3Z A;  3S3O A;  3VOX A;  2K9N A;  2PJR A;  1XN7 A;  4QPO A;  4G7Z F;  2LRD A;  4B48 A;  5HOD A;  2KL4 A;  3BQY A;  5DUK A;  1JJ6 C;  1O57 A;  4ZYD A;  1OYW A;  1HA8 A;  3V7C A;  4CYC A;  1WJB A;  3BQZ A;  1QVU A;  4G94 A;  1OJL A;  2OCC H;  1IN5 A;  5FD5 A;  2R93 J;  3WU2 C;  5F1R A;  2JA6 J;  1ON2 A;  4M3D A;  4II3 A;  3T0Y A;  1YIT I;  4KMU X;  3ZGK A;  3ZQC A;  1BR4 A;  2V1X A;  3ML6 A;  5DCF A;  4PSX A;  5ED4 A;  4HF1 A;  4GCL A;  3TED A;  1USS A;  3WOD F;  2R5Z A;  2MA3 A;  1QPI A;  2M45 A;  2VB6 A;  3HUG A;  1PDN C;  3IV5 A;  1RRJ A;  4U0V A;  1B59 A;  2XAJ A;  5DD4 A;  3JRI A;  1GHC A;  2WY8 Q;  4U87 A;  5E3N A;  3HTJ A;  4KT6 A;  3HXL A;  4J01 A;  1I3Q J;  3E7L A;  3GFM A;  1U6G A;  3W2V A;  2FBH A;  4M6Y A;  4EJW A;  4XR6 A;  1IRX A;  1D1B A;  2LFB A;  4IHS A;  4O3M A;  1RPW A;  2DTZ A;  3ECO A;  1O4X A;  1UG0 A;  3C2G A;  1HW2 A;  2EFO A;  3EQL F;  1P6R A;  2I8D A;  4DBR A;  2WAQ A;  3IUV A;  2DOA A;  3DBL B;  1R49 A;  2BXY A;  2HYG D;  3V4G A;  4RGR A;  2M4G A;  1R1T A;  5IP6 A;  2CW8 A;  3TO6 A;  3B02 A;  2DA6 A;  4PUS A;  2F5D A;  5D6F A;  3GZI A;  4NDL A;  4UB8 C;  2JPB A;  3LL7 A;  1R4N B;  1X1B A;  2M9H A;  1WI3 A;  1JT0 A;  3BY6 A;  5KNL A;  3F0C A;  2VBZ A;  2XAF A;  4HX8 A;  1W5C C;  3ABK H;  2V1D A;  5D5W B;  1HKS A;  2VN2 A;  4Z2Y A;  1VQM I;  2Y48 A;  1D8J A;  3F6V A;  5HS7 A;  2QSH X;  4CCK A;  1IXS B;  3TOB A;  3VOK A;  1UJ8 A;  1LFP A;  2HXO A;  4ZTJ A;  3OS0 A;  4ANJ A;  2ZJP F;  1TQP A;  2Y9Y A;  5FLX K;  2IA0 A;  2ZKZ A;  3PFI A;  3OYA A;  2AXT C;  4BXF A;  3F1B A;  2Q8K A;  4F93 B;  2L0K A;  1OFC X;  3OIQ A;  1GUU A;  4M6X A;  3CCU I;  3DU5 A;  4BDZ A;  3AFH A;  3A4C A;  3CCM I;  2CMP A;  5K7H A;  5JHF A;  2GXG A;  5DUI A;  2BGC A;  2BVL A;  2RDP A;  2YUS A;  3A0H C;  3J81 K;  4WCG A;  1B8I B;  2DG7 A;  1S6L A;  1SD4 A;  3M3Y J;  4ENN A;  3FMR A;  4KT5 C;  1ETQ A;  1FWZ A;  5J40 A;  1JE8 A;  2Z5U A;  4I2O A;  2CV1 A;  1SAU A;  2V6C A;  2FBI A;  1HKQ A;  3ZPL A;  4JL3 A;  3GF2 A;  3HTI A;  2XB0 X;  3FZV A;  3I54 A;  2Y0S A;  4BXU A;  2UXP A;  1MBE A;  3RQ4 A;  2RNG A;  4XN3 A;  5LD2 C;  1EH6 A;  3TOA A;  4EM2 A;  3SYT A;  3OIP A;  5D8L B;  3RI4 A;  1LB2 A;  3LMM A;  4E7J A;  4XSX F;  3ABL H;  2E19 A;  4ZDP A;  3C2H A;  3HG9 A;  4JX6 A;  1XCB A;  3DV8 A;  4ZDL A;  1RUN A;  4QLC U;  3CC7 I;  2HXI A;  5FGL A;  3R61 A;  4BDY A;  4U7B A;  1N77 A;  1T6S A;  4CUG A;  2DA5 A;  2IW5 A;  2V9V A;  2HPI A;  3VUQ A;  2EZH A;  1I6X A;  2X6X A;  4D5F A;  5JLX A;  1C0W A;  1YRN A;  3BG5 A;  3GTL J;  3GEZ A;  4RB0 A;  5BOX A;  2X6W A;  2L54 A;  3TDU C;  4YEL A;  5D1R A;  4CZC A;  3HRT A;  4A6D A;  1FOK A;  4CGR A;  1BI1 A;  3ASN H;  2LG4 A;  4PJ0 C;  2COM A;  2DA7 A;  4IO9 F;  3ZQI A;  5M5Y J;  1QPM A;  1R00 A;  1TWH J;  4MFE A;  1B9N A;  1TLH B;  4ZYG A;  2G7L A;  1SAN A;  2EZK A;  4OU0 A;  4I0B A;  1D0X A;  3A01 A;  3DTI A;  3BZC A;  1R4M B;  3AL0 B;  3OYK A;  1FNN A;  4RB1 A;  3HHH A;  1YIO A;  4I0A A;  4ZJZ A;  3JTH A;  1VQ5 I;  2XHK A;  1K79 A;  1ZH5 A;  2Y0M A;  5GAG J;  1IZ1 A;  2W48 A;  2CFX A;  2Z16 A;  3HSE A;  3JAM Z;  5FD6 A;  3PNT A;  1IRZ A;  1YYV A;  1VFC A;  2DK8 A;  2OV7 A;  3EYY A;  4NB5 A;  5IT3 A;  1FOY A;  2VQG A;  4L5J A;  4A3C J;  5KHD A;  1EJ9 A;  3WGH A;  3NAR A;  1FX7 A;  4ACI A;  5E1Z B;  2LK2 A;  3KCC A;  3MNL A;  2LD5 A;  1Z1D A;  4IEJ A;  1RES A;  4YZE A;  2PX9 A;  4DBQ A;  3O8G A;  5IOZ A;  4V19 K;  2P5L C;  2QSF X;  2O9L A;  4IHW A;  1Z77 A;  3S15 J;  2ESH A;  1L3L A;  1CF7 A;  1RIO H;  1VQ8 I;  1JKQ C;  1RI7 A;  2EIK H;  1YIJ I;  1SFK A;  4B44 A;  2QTQ A;  1ZG3 A;  2PMH A;  4HAM A;  3FF5 A;  2ELK A;  2JA7 J;  3BR1 A;  1VQ4 I;  3LSG A;  2IXS A;  4QPQ A;  2A69 F;  1TBX A;  3G71 I;  4HSR A;  4AC6 A;  4ITV A;  3LA3 A;  1V54 H;  1SD5 A;  3HTU A;  1OCP A;  1OR7 A;  4ZYH A;  2X9D A;  2UWM A;  1GV5 A;  5M5X J;  3PPB A;  1VZ0 A;  3Q0V A;  4IJA A;  3OY9 A;  1FYK A;  1NK2 P;  1LE8 A;  4ZZL A;  2JRM A;  3B6C A;  4G9Y A;  5HS8 A;  1LVA A;  3C7J A;  5L3E A;  5LBQ A;  1X4P A;  4ENJ A;  5LFA A;  1Z05 A;  1O7F A;  4ESJ A;  1VTN C;  2Y31 A;  2ZOZ A;  4QWQ A;  2A6T A;  4DYC A;  2OPT A;  4AD9 A;  4UVC A;  2HQ5 A;  3ZQQ A;  3DEU A;  1HW1 A;  3NQO A;  5FJ8 J;  3QP6 A;  2A5W A;  1WQ2 A;  4KN4 X;  3IRQ A;  2MYS A;  4M3B A;  3R6S A;  3A2K A;  2FF4 A;  2XRL A;  3LSI A;  3B6A A;  3D5R C;  2WB1 A;  5CYV A;  5B66 C;  4HNT A;  2W7N A;  4E7K A;  5E8G A;  2IU5 A;  5EDN A;  3HOZ J;  3LHQ A;  2ZC2 A;  2XB5 A;  4NN1 A;  1U8R A;  1I1S A;  1YX3 A;  2BXZ A;  2BOL A;  3GCM A;  2YSR A;  2MH9 A;  3K4C A;  3S93 A;  2W00 A;  2UZK A;  1ZR2 A;  1P7I A;  2DN0 A;  2AXL A;  5DM7 F;  4M9Z A;  4XK4 A;  2KKO A;  2CO5 A;  4HLY A;  1D1C A;  4FX4 A;  3E6M A;  5EJC A;  4AC0 A;  1K83 J;  5L3F A;  2BV6 A;  4N4O B;  3CCQ I;  3N05 A;  3WGG A;  3TBI A;  1ETY A;  5LGT A;  3RIR A;  1SFE A;  1MBK A;  2H8W A;  1DP7 P;  2GOM A;  5FRM A;  4C30 A;  1P9Q C;  3WU0 A;  5DM6 F;  1WI9 A;  1SAX A;  4A3B J;  2DT6 A;  3HKZ A;  2W85 A;  3BJ6 A;  3DWL E;  2PJR B;  3DF8 A;  1W5S A;  3EUK L;  1Z6T A;  3RKW A;  2DLL A;  2P81 A;  2WGB A;  4EMS A;  3IKT A;  1Z7U A;  2ZME A;  3LSK A;  1WJE A;  2CQX A;  3M9A A;  4CYD A;  2L7F P;  1OCZ H;  4DNC A;  2CV2 A;  2EB7 A;  1ONV A;  2EZL A;  2L7K A;  4HV6 A;  4RA2 A;  4XIC A;  4C2T A;  1ZTR A;  2FNP A;  2MLG A;  4BE0 A;  5KCM A;  4S05 A;  2R5Z B;  4L9V A;  1Z6R A;  3HUG B;  2R7D A;  3M7G A;  4AID A;  1XMA A;  3WTV C;  3E97 A;  3FIW A;  3G56 A;  4ICH A;  1QHH D;  4BGD A;  4CCJ A;  2UXU A;  1TQI A;  5GAH J;  2YS9 A;  3KZI C;  1MNE A;  2ZNY A;  4M71 A;  4L0Z B;  1LDJ A;  3M8F A;  3P9T A;  5F0H A;  1Z9C A;  4HF0 A;  2E36 A;  3GBG A;  2RKH A;  4HKU A;  1ON1 A;  1RKW A;  2X1E A;  2DAO A;  4B8X A;  2KZG A;  2X4H A;  3H9G A;  4ENK A;  4FE4 A;  2HS5 A;  2LH9 A;  1XGS A;  3OL3 A;  4Y4R A;  1BOB A;  3PUB A;  2K9Q A;  1R1U A;  2WWY A;  3DEE A;  2XIG A;  3QU3 A;  3ZQL A;  4XKB A;  3BLY A;  4U9L A;  4A3G J;  3GZ6 A;  2HYF A;  3JRE A;  2KRC A;  3L09 A;  3FRQ A;  1VI0 A;  2A05 A;  2JQ7 A;  3A03 A;  3PO3 J;  5M3F J;  3RYP A;  2GUH A;  3J80 Z;  3KP7 A;  1KGS A;  3QP5 A;  4OIP F;  3K4B A;  3DTK A;  4AVZ A;  1RUO A;  5D18 A;  3S17 J;  4N4N B;  2VKD A;  4IZZ A;  3DPJ A;  2CUF A;  2LKS A;  2UXI A;  1Y1V J;  1BC7 C;  3LQQ A;  2W57 A;  1X19 A;  4E7S A;  3O6B B;  1KA8 A;  3OSF A;  1IW7 F;  4YIR X;  4Z6Y A;  2L02 A;  2V1U A;  3GTJ J;  4LLN A;  4D7N A;  2KDO A;  3P9C A;  1D0Y A;  2W84 A;  3TMO A;  2L7M P;  2DYS H;  2VBX A;  1ZHF A;  2VT3 A;  3WTX C;  2CSO A;  5J1U A;  2XF5 A;  1ETK A;  4KIS A;  1ZR4 A;  2IS4 A;  3V7R A;  5J6X A;  3BRU A;  1DUX C;  2M34 A;  2ETH A;  3SFI A;  1LEB A;  1U9O A;  2P7C B;  1R6R A;  5E8I A;  4Q5S F;  3LAJ A;  3EET A;  2CGP A;  1P4X A;  5CPR B;  1QNT A;  2D45 A;  1RC9 A;  1OMI A;  1S3J A;  1ETO A;  4AIH A;  5HLG A;  5KAI C;  2L7Z A;  1FMW A;  1WZ2 A;  5CVI A;  3GXO A;  1R36 A;  5AON A;  1ZAR A;  3HKZ N;  1KU2 A;  1X1C A;  3BG7 A;  4D1Q A;  4NBQ A;  1WVR A;  1ZKG A;  1H88 C;  3NI7 A;  2CYY A;  1HKT A;  4MGR A;  4MEY F;  2DMT A;  2LTP A;  1WJC A;  2JJ7 A;  3BR5 A;  4A12 A;  3T8T A;  5CXG A;  1K6O A;  3R0J A;  1KZH A;  2ZNZ A;  3SEQ A;  2XGE A;  2XAU A;  4N0B A;  1FYM A;  2DQL A;  2QGU A;  2NOJ B;  3IH3 A;  3ZQG A;  3TW7 A;  4WK8 F;  3K2Z A;  2VOP A;  1U5T A;  3SDB A;  4CXF A;  1NH3 A;  1UAA A;  2KJB A;  3H5N A;  1V55 H;  3BTL A;  3ZN0 A;  2CFO A;  3VYS B;  3WTT C;  1E3O C;  5ICC A;  3A0B C;  4TV7 A;  3E6D A;  2LC2 A;  1YRN B;  3MAJ A;  1QHG A;  2ZXJ A;  3WHB A;  1Z67 A;  3QBM A;  2Y30 A;  4NHJ A;  4D0P A;  3BT9 A;  5BQT A;  2D6Y A;  1YJN I;  3G1L A;  4HQM A;  3P9I A;  5E79 C;  4UUT A;  3L2C A;  2HDC A;  1A5J A;  4CGZ A;  3BNI A;  4CCO A;  2LF7 A;  4A2U A;  3TKY A;  2FJI 1;  4BJT A;  5J3L A;  3COA C;  1STZ A;  1IXC A;  3A01 B;  2EV5 A;  3E1S A;  2Y9Z A;  1ZG1 A;  3ZQ7 A;  2VOD A;  3O2P E;  2VKV A;  4HDU A;  1DP3 A;  3ZQF A;  3ONQ A;  2VBY A;  5CQG A;  2G7H A;  5FKM A;  5D19 A;  1YO5 C;  1MSF C;  5IY5 H;  2FOK A;  4HG2 A;  3H36 A;  4LIU A;  2NS7 A;  2GAU A;  1BOA A;  1YW9 A;  2Y75 A;  3Q9S A;  1LDK B;  1FPQ A;  5IPA A;  3CF2 A;  1GXP A;  4P1W A;  3CLQ A;  4LJZ F;  2QWT A;  2GWR A;  2DA4 A;  3OYI A;  3MKL A;  1J2X A;  4FTH A;  1JHF A;  3G1O A;  5BNG A;  4FX0 A;  5E3M A;  1AA7 A;  2L01 A;  4UUS A;  4AIJ A;  2PEX A;  2CU7 A;  3VSL A;  4M3E A;  5DDG A;  5E3O A;  1B4A A;  2Z2S B;  2F5C A;  3FXL A;  4Y3O A;  3RH2 A;  1BR2 A;  2OQG A;  5ILV A;  3D1N I;  2IGN A;  3B73 A;  2PBI A;  1XMX A;  2EZI A;  1MJA A;  4BBR J;  2DA1 A;  3IWF A;  3RJP A;  1NG7 A;  4K2E A;  5L3D A;  2GOX B;  3KP4 A;  1YE9 A;  2STW A;  2XF7 A;  4BE1 A;  1RET A;  2F5V A;  2ZO4 A;  1SMT A;  4M72 A;  2CH0 A;  2ADU A;  2HFH A;  2ZXI A;  3VVZ A;  2GA2 A;  5K1Y A;  1FSH A;  3HRM A;  2MH2 A;  3PQJ A;  4UV8 A;  2FUG 2;  4CSW A;  2WTE A;  2AS5 F;  1LE8 B;  2VI6 A;  2VOO A;  3CCY A;  1T0F A;  4W97 A;  2R7Z J;  3Q0U A;  4C3J J;  2QCO A;  2RQP A;  3CZ6 A;  3PSF A;  2K4J A;  3FXR A;  3CMM A;  4P5O A;  4WF2 A;  2ZOY A;  2VQC A;  2IS6 A;  1UHW A;  1D5Y A;  2BHZ A;  2K27 A;  4MFD A;  5HLT A;  3BWG A;  4YII A;  5F64 A;  3RCO A;  3ANG A;  1XGN A;  1D5V A;  3C18 A;  4XM3 A;  5B1B H;  1V5F A;  1XC5 A;  2E2H J;  3QYE A;  1ZLK A;  5GP9 A;  3K2A A;  3VOD A;  4WXH A;  2Z33 A;  2OCE A;  2L9S A;  3D0S A;  3BTC A;  1GT0 C;  4OMZ A;  1R23 A;  2HZD A;  4HEA 2;  3T8R A;  3U21 A;  3OYD A;  1T56 A;  3J7A Y;  1Z7L A;  2MSY A;  5TGT A;  2VQL A;  2IS2 A;  4J00 A;  4BYY A;  2M3A A;  5F27 A;  1JGG A;  5CVV A;  4IQJ A;  3PM1 A;  1SMY F;  1MMS A;  4XMY A;  5GPA A;  3S8P A;  2YVH A;  1I50 J;  2FU4 A;  2X6O A;  3IH4 A;  1Y0N A;  1K6Y A;  3P9K A;  2RRE A;  1TW2 A;  1WH5 A;  3S2H J;  4HA8 A;  3BR3 A;  1MIJ A;  4R8H A;  1AOY A;  2HZT A;  2Q24 A;  1W36 D;  4DYQ A;  4DVY P;  1QRY A;  4Y17 A;  1CQT A;  3FX3 A;  3AG1 H;  3I0T A;  3CJT B;  2W24 A;  4Y33 A;  5FRO A;  1R22 A;  1W5T A;  3ZN1 A;  1KQ8 A;  1YG2 A;  3VP5 A;  4GYI A;  4IPA A;  4GXO A;  5M5W J;  1J7K A;  1GDT A;  1OPC A;  3BHQ A;  4IRG A;  4FQG A;  2H27 A;  2K3F A;  3VYU B;  2R7X A;  2QKO A;  3GEU A;  4EQQ A;  5E17 F;  5HOO A;  3LJL A;  1X58 A;  2K40 A;  3CMA I;  5E1W A;  2ZME B;  1QZE A;  4OAZ A;  2KIM A;  3OL4 A;  1P4A A;  2PMZ A;  3JAM K;  2EJR A;  4HZF A;  4KA4 A;  2QIB A;  4II2 A;  4JP0 A;  4CCM A;  4DIQ A;  4C2U A;  3KP5 A;  4GRI A;  4QTR A;  3R4K A;  3TGN A;  5GAD J;  1U2W A;  4F92 B;  1FP1 D;  1SD6 A;  1KU3 A;  3OYG A;  1MH4 A;  3WTZ A;  4AYB A;  1IDY A;  5F04 A;  4LFU A;  2M7B A;  4UV9 A;  4N9I A;  4LLL A;  1S8N A;  3M8J A;  1IN7 A;  3P7N A;  3V8J A;  2YVX A;  3HOW J;  5HVQ C;  4EVI A;  2EV6 A;  1UZC A;  3JSJ A;  2MGQ A;  3BCB A;  1HXD A;  3HSR A;  2XF6 A;  1OCR H;  5JHU A;  3KP6 A;  2K3P A;  2BW3 A;  1LJ9 A;  1XDU A;  3BCG A;  3TO7 A;  2B63 J;  1VF9 A;  4KIB A;  1WJF A;  5D4R A;  3KX2 A;  2E5N A;  2V9K A;  3FDY A;  3CF5 F;  5ICG A;  2VJ5 A;  1MD0 A;  3GTO J;  2D1H A;  4CCN A;  3CJD A;  3BTI A;  3ZMZ A;  2H6C A;  3G6E I;  4XSZ F;  3UKG A;  2XAH A;  2HPM A;  3G1M A;  4GFL A;  2D5V A;  4KDP A;  3F22 A;  1FC3 A;  4MO7 A;  5TRD A;  1TWA J;  2UXN A;  2EWN A;  4UXN A;  3JR9 A;  4ESB A;  2QYO A;  2B0L A;  5B1A H;  3UNG C;  5FFX A;  2HQR A;  3H1C A;  4DW6 A;  4I09 A;  1IAW A;  3S5R A;  2CQ7 A;  3IP4 B;  2PBX A;  4B47 A;  3GLX A;  3K4J A;  1PUE E;  4XLE A;  4N9H A;  2ESN A;  2CQK A;  5EG0 A;  3IAS 2;  4OAY A;  5LHG A;  2CV0 A;  1KU9 A;  4ZH4 F;  5K7F A;  4PSW A;  4LB5 A;  1QGP A;  5KAF C;  1H89 C;  3KE2 A;  1WSU A;  2GLO A;  3NWT A;  3HDD A;  5J1Y A;  3VOE A;  4E7I A;  3QOD A;  3S3N A;  1U78 A;  1V4R A;  3J7Z I;  4XLA A;  1DGR M;  4L0Y B;  2E34 A;  2YX7 A;  4I6Z A;  4A3F J;  2F4O B;  4EEF G;  2PMU A;  4NUB A;  4BY1 J; 
#chains in the Genus database with same CATH homology
 4GCT A;  5IOY A;  3DCF A;  4M3B A;  2XRL A;  3B6A A;  1IV6 A;  2NP3 A;  2UXO A;  2WV1 A;  1B8I A;  2IU5 A;  3COL A;  3EUP A;  5EDN A;  3HOZ J;  3LHQ A;  2E1O A;  4A69 C;  2XB5 A;  4NN1 A;  3NXC A;  1ETX A;  2G7G A;  3LSJ A;  3Q0W A;  3Q3S A;  5AQC A;  1TWG J;  5HSZ A;  1WH7 A;  1HOM A;  2NVY J;  3HTH A;  1ZR2 A;  4M3F A;  1JKP C;  2PMZ N;  4L62 A;  1P7I A;  2DN0 A;  2HKU A;  4XK4 A;  3ON2 A;  2JWT A;  3VVY A;  1W0U A;  1HDP A;  5IP7 J;  3TP3 A;  3T6N A;  3JRC A;  4AC0 A;  1K83 J;  1JT6 A;  3GTP J;  5CXI A;  2O7O A;  3HEF A;  4M6V A;  1JUP A;  3HOX J;  2GM4 A;  4JNN A;  3A02 A;  2MG4 A;  4W1U A;  1NK3 P;  3KNW A;  1ETY A;  3FIS A;  5EZG A;  3HE0 A;  2VKE A;  5FKL A;  1MBK A;  3QPL A;  1ZQ3 P;  4PXI A;  1BW5 A;  1UHS A;  2LKX A;  1AKH A;  2LR8 A;  2ME6 A;  2IAI A;  2ZCN A;  5F08 A;  4LOC A;  1WGX A;  5EGO A;  2FBQ A;  5K58 A;  4A3B J;  3SDG A;  1LFB A;  1HLV A;  4XRS A;  2NVT J;  3DEW A;  5FKO A;  3HGY A;  2P81 A;  2WGB A;  2DMU A;  3FK7 A;  3H0G J;  3FKI J;  2L9R A;  5HAW A;  1FIA A;  2CQX A;  3ON4 A;  2Y2Z A;  1JKO C;  2NP5 A;  2REK A;  2GBY A;  2L7F P;  2EQR A;  2JMW A;  1B72 B;  2LP0 A;  1SFO J;  1POG A;  2WAQ N;  2EZL A;  3O8H A;  1JKR C;  1UMQ A;  4XIC A;  4M3G A;  2HOS A;  1ZTR A;  2TCT A;  3B81 A;  2HOT A;  1Q1V A;  2R5Z B;  4S0H B;  2DMQ A;  3GTK J;  3NNR A;  2HDD A;  4B3A A;  3FIW A;  3G56 A;  4ICH A;  3S1M J;  1MH3 A;  5FHP A;  4DYR A;  3E7Q A;  5H9T A;  2UXU A;  1HDD C;  4AF5 A;  1PUF B;  1Z0X A;  3VW0 A;  2YS9 A;  3BJB A;  2X48 A;  1QVT A;  3FK6 A;  3W6V A;  5F0H A;  3P9T A;  1JUS A;  3GBG A;  4UUS B;  4HKU A;  1MBJ A;  3CQZ J;  1RKW A;  3S1R J;  4BKX A;  1SGM A;  3KKD A;  1FTZ A;  3WHC A;  2NS8 A;  2ME0 A;  4FE4 A;  2H8R A;  3PO2 J;  2QF7 A;  2G0E A;  4QSH A;  2K9Q A;  4GCK A;  3ZQL A;  5F0F A;  1IJW C;  4A3G J;  4RDU A;  2EH3 A;  3FRQ A;  3JRE A;  2CJJ A;  1VI0 A;  2OER A;  4C3I J;  1HCR A;  4JX4 A;  3A03 A;  5DTD A;  3PO3 J;  5M3F J;  1X2M A;  2DG8 A;  4GFK A;  2GUH A;  2XPU A;  1TWF J;  2IEK A;  1XS9 A;  1Y1W J;  5C4Y A;  5D18 A;  3S17 J;  3V78 A;  4X1E A;  2M2E A;  2R5Y B;  3DPJ A;  2OI8 A;  1ZK8 A;  2CUF A;  2FD5 A;  1DU0 A;  5GPC A;  3QKX A;  2UXI A;  3LOC A;  1Y1V J;  4GFB A;  4A3M J;  1RR7 A;  3OSF A;  1K61 A;  2M8G X;  2Y0S N;  3I4M J;  4XID A;  3GTJ J;  4D7N A;  2L7M P;  3M4O J;  1T33 A;  3LSP A;  4RBO A;  2O8K A;  2XDN A;  1UG2 A;  4V2F A;  5J1U A;  1IC8 A;  1LFU P;  3HBL A;  4FE7 A;  1ETK A;  2YU9 J;  4X6A J;  1ZR4 A;  3NRG A;  3BRU A;  2M34 A;  3SFI A;  4HNV A;  1FIP A;  1ENH A;  4A3L J;  1U9O A;  4NEL A;  1IG7 A;  2PZ9 A;  3HM5 A;  4QIW N;  5EFY A;  1OCT C;  5HBU A;  2AO9 A;  2RAE A;  3JRD A;  3GTM J;  1ETO A;  3VPR A;  2L7Z A;  1F43 A;  4KWA A;  4BXX J;  4BBS J;  2W53 A;  2LY9 A;  2G3B A;  3HKZ N;  3CMY A;  4MLO A;  5E3L A;  1ITY A;  1ZKG A;  3K7A J;  5EYR A;  1H88 C;  3CRJ A;  1MBH A;  3NI7 A;  2DMT A;  2TRT A;  2KT0 A;  1U9N A;  2LTP A;  3QQA A;  2CRG A;  2DJN A;  2JJ7 A;  3BG9 A;  3BR5 A;  1MNM C;  3S2D J;  2ZCM A;  3ANP A;  5CXG A;  3RZO J;  1A6I A;  2XGE A;  3HOU J;  3CDL A;  2AHQ A;  3S1N J;  1FJL A;  5F0C A;  2I10 A;  4AYB N;  2OF7 A;  2ZCX A;  3IH3 A;  1TWC J;  3ZQG A;  3HOV J;  3TW7 A;  1UI6 A;  4JKZ A;  3CWR A;  4A3K J;  2DA3 A;  3BTL A;  5C4J J;  3EGQ A;  4B4C A;  3BR0 A;  3VIB A;  2E2J J;  1W0T A;  1E3O C;  3NAU A;  1YRN B;  1AKH B;  2O7T A;  3VOX A;  2K9N A;  3WHB A;  3QBM A;  2Y30 A;  3BG3 A;  3H3V K;  5HOD A;  2D6Y A;  3BT9 A;  3BQY A;  3G1L A;  1S7E A;  1JJ6 C;  4UUT A;  1A5J A;  3BNI A;  4CYC A;  3BQZ A;  1QVU A;  2XPV A;  2COB A;  5J3L A;  3I4N J;  3G7R A;  1ETW A;  4AUX A;  1OJL A;  3A01 B;  2Y9Z A;  2R93 J;  2LLK A;  2JA6 J;  5IP9 J;  1B72 A;  4M3D A;  1RKT A;  5FKK A;  2VKV A;  1JTY A;  2V57 A;  4UDS A;  3ZQC A;  1XG1 A;  3ZQF A;  4GCL A;  5FKM A;  5D19 A;  3TED A;  1MSF C;  2R5Z A;  2CQQ A;  3TW6 A;  1QPI A;  2NS7 A;  2ID3 A;  1ETV A;  3IV5 A;  3JRI A;  5IPA A;  4A3I J;  1IDZ A;  5E3N A;  3HTJ A;  1I3Q J;  2QWT A;  3E7L A;  4MIM A;  3OIO A;  1PUF A;  3VVX A;  2DA4 A;  4L5E A;  3MKL A;  4FTH A;  3G1O A;  5BNG A;  5E3M A;  4Y52 J;  4UUS A;  1TC3 C;  4XRS G;  5DS9 A;  1JTX A;  2K9S A;  2CU7 A;  4M3E A;  5E3O A;  2GFN A;  2ECB A;  3HTA A;  2M0C A;  3GTQ J;  3RH2 A;  2DMP A;  2LFB A;  4C2M J;  3D1N I;  3O60 A;  1RPW A;  2DTZ A;  1WPK A;  1O4X A;  3HB9 A;  1I6H J;  2EZI A;  3BR6 A;  3MVP A;  5IYD J;  4IHY A;  4BBR J;  3AQT A;  3VW1 A;  2DA1 A;  3IUV A;  1JUM A;  1APL C;  5K7Z A;  4V2G A;  5IP6 A;  1RET A;  4Y7N J;  2DA6 A;  2WB1 N;  1EF4 A;  2RHA A;  3GZI A;  1MBF A;  3VVZ A;  1X2N A;  4NDL A;  2ID6 A;  1HF0 A;  2M9H A;  5IYB J;  1WI3 A;  1JT0 A;  2JA5 J;  5M3M J;  3QPS A;  4A3D J;  2VPR A;  3F0C A;  1NTC A;  1LE8 B;  2VI6 A;  2R5Y A;  4D5C A;  5EG0 B;  3CCY A;  3RKQ A;  4W97 A;  2R7Z J;  3Q0U A;  5IYC J;  4C3J J;  2QCO A;  4DZJ A;  1BA5 A;  3VOK A;  2HXO A;  2NVQ J;  2ZOY A;  2Y9Y A;  3OSG A;  1D5Y A;  3F1B A;  4MFD A;  3LSR A;  3ZQH A;  1JJ8 C;  3ANG A;  3HGG A;  1ORK A;  1OFC X;  2L0K A;  4G12 A;  1GUU A;  4B1R A;  1XC5 A;  2DMN A;  1VND A;  2ECC A;  2E2H J;  1FEX A;  2H1K A;  1F36 A;  2WUI A;  3BR2 A;  5K7H A;  2XGC A;  3TP0 A;  5GP9 A;  2R92 J;  3K2A A;  4I76 A;  2JN6 A;  2YUS A;  1H8A C;  1B8I B;  9ANT A;  2DG7 A;  1BJZ A;  3BTC A;  1GT0 C;  2F07 A;  3M3Y J;  1T56 A;  2KDZ A;  2MSY A;  2FQ4 A;  2JA8 J;  1ETQ A;  2HYJ A;  5F27 A;  1JGG A;  3PM1 A;  5GPA A;  4JL3 A;  2YVH A;  1I50 J;  2HYT A;  2X6O A;  3PAS A;  3IH4 A;  3HTI A;  3LWJ A;  2XB0 X;  1WH5 A;  3KKC A;  2MW8 A;  2QOP A;  3S2H J;  2UXP A;  4MK6 A;  1MBE A;  3BR3 A;  3L1P A;  3RD3 A;  5FKN A;  3LNQ A;  5FMP A;  2Q24 A;  3HIM A;  1ZGW A;  3SJM A;  5CW8 A;  4DYQ A;  1QRY A;  2EBI A;  4DZP A;  1CQT A;  3V6G A;  1R9T J;  2E19 A;  4JX6 A;  3JRG A;  3VP5 A;  1G2H A;  2FX0 A;  3GTG J;  2HXI A;  5M5W J;  3BHQ A;  1GDT A;  3HOY J;  5EGO B;  2GEN A;  2UXH A;  2XSD C;  5FGL A;  1DU6 A;  2QKO A;  1UI5 A;  4ME9 A;  4JYK A;  3GEU A;  3JRH A;  2DA5 A;  3JRB A;  3VUQ A;  3LJL A;  2EZH A;  4D5F A;  2XPW A;  1YRN A;  1X58 A;  2HI3 A;  5JLX A;  3BG5 A;  2K40 A;  1MSE C;  3GTL J;  5FLV A;  5D1R A;  1BL0 A;  4A3E J;  2JK3 A;  2NOG A;  4CGR A;  4J19 A;  2QIB A;  2N8G A;  2DA7 A;  3C07 A;  4JP0 A;  3ZQI A;  5M5Y J;  4MFE A;  1TWH J;  3C2B A;  1IGN A;  3RQI A;  2G7L A;  1SAN A;  2EZK A;  3JRA A;  1WCM J;  4QTR A;  4JX5 A;  4CYC B;  3A01 A;  3NPI A;  2NVX J;  1AU7 A;  5FLM J;  1MH4 A;  3OOU A;  1IDY A;  5F04 A;  5C44 J;  1AHD P;  1BW6 A;  2W48 A;  4C3H J;  2LVS A;  2G7S A;  5C4X J;  2HOA A;  5F1J A;  2XGD A;  2NX4 A;  1IRZ A;  1VFC A;  3ZOB A;  5DAJ A;  3HOW J;  4A3J J;  4A3C J;  3JSJ A;  5J1R A;  2MGQ A;  3NAR A;  4ACI A;  3S16 J;  3MNL A;  2LK2 A;  2LD5 A;  2IBD A;  2FJ1 A;  4IEJ A;  1RES A;  3BCG A;  4YZE A;  2R0Q C;  2B63 J;  3O8G A;  5IOZ A;  1VF9 A;  4ABZ A;  2O9L A;  4IHW A;  1Z77 A;  4XRM A;  3S15 J;  1JKQ C;  3GTO J;  2DA2 A;  2QTQ A;  3CJD A;  1GV2 A;  3AQS A;  3BTI A;  1MBG A;  2ELK A;  2JA7 J;  3S14 J;  3BR1 A;  3LSG A;  3UKG A;  2VUM J;  3G1M A;  4GFL A;  2D5V A;  4MO7 A;  4AC6 A;  2ZB9 A;  1TWA J;  3JR9 A;  3RZD J;  1GVD A;  1OCP A;  4DW6 A;  4FIS A;  3S5R A;  2X9D A;  2RAS A;  1GV5 A;  2PBX A;  5M5X J;  3PPB A;  4A93 J;  3Q0V A;  5EEA A;  1IUF A;  5EF6 A;  2E2I J;  4IHX A;  1NK2 P;  1LE8 A;  2CUE A;  5EG0 A;  4MXM A;  3B6C A;  3KZ9 A;  4FCY A;  3IH2 A;  1P7J A;  5K7F A;  4IHV A;  5JLW A;  1U8B A;  1FTT A;  2Y31 A;  2ZOZ A;  1H89 C;  2GLO A;  4BY7 J;  3HDD A;  4DYC A;  5J1Y A;  2OPT A;  3JRF A;  2HQ5 A;  3BTJ A;  2YVE A;  3S1Q J;  5C3E J;  1U78 A;  5FJ8 J;  3VW2 A;  4I6Z A;  4A3F J;  3MN2 A;  5EZH A;  4EEF G;  4BY1 J;  4D7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...