3HGYA

Crystal structure of cmer bound to taurocholic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: crystal structures of CmeR-bile acid complexes
rcsb
molecule tags Transcription repressor, drug binding
molecule keywords CmeR
total genus 75
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hgyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hgyA02
2K9QA 1Q1VA 2D6YA 4GFBA 3LSGA 2JK3A 2NS7A 3SFIA 1F43A 4XRSA 4GCLA 2EZKA 4A69C 1XC5A 3OSGA 4UUSA 2REKA 1MBEA 2O7OA 5IYBJ 2YVHA 3BQYA 2JWTA 1RPWA 1PUFA 1HCRA 3O60A 1SFOJ 1APLC 1MBFA 2MGQA 4BY7J 1UHSA 4MFEA 2VKVA 1ZQ3P 3TW7A 2ELKA 3GTQJ 3BCGA 4D5FA 3A01A 1DU0A 3HIMA 2VUMJ 2GBYA 3BR0A 2PMZN 1JJ8C 3FK6A 4C2MJ 3DEWA 1GDTA 4AC6A 3KZ9A 3LSJA 1HF0A 3HB9A 2N8GA 4CYCA 5D19A 3NARA 5E3MA 2HXOA 5M3MJ 2HI3A 4XICA 2V57A 3VVYA 3VW2A 1HDDC 1JKOC 3E7QA 1GT0C 1NTCA 1ETQA 1MBGA 2DMNA 2L0KA 3KKCA 4HKUA 1FTZA 2HOAA 2HOTA 3BR6A 2G3BA 2XRLA 3B6CA 4AYBN 2XB0X 1ETOA 3S17J 5FKMA 2MSYA 2E2IJ 1ETWA 1JTYA 3NNRA 4BBRJ 4D7NA 3CRJA 3I4MJ 3NI7A 3S14J 1JUSA 1CQTA 2I10A 4FISA 2DMUA 3ANPA 5C4YA 5FMPA 5F27A 5J1UA 4A3FJ 4MLOA 2DA3A 1X2NA 1OCTC 2K9NA 3GBGA 3JREA 4BBSJ 3GTOJ 3GEUA 2CUEA 1Z77A 2Y30A 4IHXA 2G7LA 2FX0A 3HTIA 1EF4A 2JA7J 4M3FA 2QTQA 4UDSA 2Y2ZA 4FE7A 5EYRA 3Q0WA 4HNVA 5M5YJ 1DU6A 2YUSA 2XDNA 5IP7J 3BT9A 2Y31A 5FLVA 4IHWA 5EG0B 2NVQJ 2G0EA 3QPLA 3JRHA 2R92J 2R5ZB 3GTKJ 2O9LA 3IH2A 2JN6A 1WH7A 5GP9A 5HODA 2XSDC 3TEDA 4GFLA 1VF9A 3JRIA 1I6HJ 5HBUA 3FKIJ 2M0CA 1MBKA 2DG7A 3BTJA 5EZHA 5EG0A 3V78A 4V2GA 5IOYA 3QBMA 2Y9ZA 1TWFJ 3VIBA 1HLVA 3NPIA 3HEFA 2GLOA 2VKEA 1MBHA 2R5ZA 2NP5A 3PPBA 1GUUA 2EH3A 3NAUA 4ABZA 2LTPA 3VW1A 2PZ9A 3HTJA 2VI6A 5C3EJ 1LE8A 3ZQFA 3OSFA 1ORKA 4MXMA 5D1RA 3CDLA 5E3NA 4B4CA 2XPUA 4GCKA 3S2DJ 3OOUA 4BY1J 4M3GA 5FGLA 1IC8A 3BQZA 5FJ8J 3VVXA 3BJBA 3PO2J 1QPIA 1GV5A 1RETA 2YU9J 1BW5A 2DA4A 3FIWA 1UG2A 2QKOA 3E7LA 2UXIA 3VOKA 2XPVA 2QOPA 1NK3P 2QWTA 1ETXA 3IV5A 2JA8J 4FTHA 1K61A 2JA5J 3PO3J 4YZEA 4C3IJ 4M3EA 5FLMJ 5F04A 2RHAA 5EZGA 2OPTA 2JJ7A 2K9SA 3Q0UA 4XIDA 3HGGA 4CYCB 2ZCMA 1TWCJ 3G1MA 3GTLJ 3G7RA 3V6GA 2E2HJ 5C44J 3VUQA 3GTMJ 4L5EA 2RASA 3GTPJ 4CGRA 3CCYA 2LK2A 2XGDA 3G1LA 2R0QC 5EDNA 5EGOA 1W0TA 2GM4A 1IGNA 2ECBA 3JRAA 2EZIA 3JRBA 2ZB9A 4S0HB 5CXIA 1PUFB 3PM1A 3ZQGA 3DCFA 2LY9A 4MO7A 4LOCA 1IUFA 3GTJJ 4ME9A 3RZDJ 4QTRA 4C3JJ 1VNDA 3TP3A 3BR3A 2H8RA 1AKHA 2QF7A 1U8BA 2FJ1A 3HOVJ 2XGEA 4A3DJ 1A5JA 3BR5A 4UUTA 1UI6A 2UXUA 5F0FA 3JSJA 4G12A 2CQXA 1IRZA 2E19A 2O7TA 4AC0A 4XK4A 3IH3A 3JRDA 4MK6A 2IAIA 2YVEA 3HOZJ 1YRNA 1TWGJ 4DW6A 5J1YA 1MNMC 3SJMA 1FIAA 4AF5A 1AHDP 3M3YJ 3W6VA 1ZTRA 3O8GA 2TCTA 4A3JJ 2MW8A 3QQAA 3NXCA 1E3OC 1K83J 2H1KA 1ZR4A 4DYRA 4MFDA 1VFCA 1Z0XA 4RBOA 1A6IA 2NOGA 1FEXA 4X1EA 1HDPA 5E3LA 4IHVA 5JLWA 3T6NA 5IPAA 2XGCA 5F0CA 2D5VA 1ETYA 2DA1A 3S5RA 3K7AJ 2WGBA 4KWAA 3PASA 3H3VK 2P81A 1LFUP 5K7ZA 1FTTA 2G7GA 1JKPC 2ZOYA 4M3BA 3WHBA 4I6ZA 5HSZA 2X48A 4NN1A 5F08A 3BG5A 2HXIA 4JP0A 1ZK8A 2JA6J 1F36A 3ZQLA 3I4NJ 5GPCA 1IDYA 2NP3A 3ON4A 3G1OA 3HTHA 2G7SA 4A3KJ 3UKGA 4X6AJ 5EGOB 3QKXA 1VI0A 1JKQC 2TRTA 2L7MP 2M8GX 3HOUJ 3HGYA 2OF7A 3ZOBA 3S15J 1R9TJ 2EQRA 2NX4A 2WAQN 4QIWN 2NS8A 3TW6A 4A3BJ 1OCPA 3JRFA 1RKWA 3C2BA 4IHYA 3LOCA 2HOSA 2ID6A 2Y0SN 3CMYA 1B8IA 9ANTA 3QPSA 5CXGA 3MVPA 3LHQA 2PBXA 5EEAA 1O4XA 3D1NI 4JYKA 5IYDJ 3GTGJ 3VPRA 3TP0A 3HE0A 2L7FP 3CJDA 3SDGA 3BTIA 5M3FJ 3G56A 2Y9YA 4BXXJ 4B1RA 3JRCA 1IV6A 4Y52J 1U78A 1B72B 3NRGA 4JX4A 1ZR2A 1JGGA 3O8HA 2GENA 1H89C 3F0CA 2FBQA 3S2HJ 3RKQA 2W53A 2R5YB 3BRUA 3M4OJ 1B72A 1TC3C 5DS9A 3HTAA 1UMQA 4QSHA 1XS9A 4M6VA 2ZCNA 2ZCXA 1OJLA 3WHCA 3RH2A 3K2AA 5DAJA 4I76A 3RD3A 3VVZA 5F1JA 1IDZA 5IOZA 1I50J 1RKTA 4W97A 2AHQA 1ZGWA 1BA5A 3LJLA 4GFKA 1G2HA 1S7EA 3LWJA 1H8AC 3HOYJ 4BKXA 1NK2P 1JT6A 1BL0A 4DYQA 1UI5A 3EGQA 4A3GJ 1JT0A 3S16J 4D5CA 2YS9A 3ZQCA 5BNGA 4JNNA 2NVXJ 1WCMJ 2DMTA 2DA5A 1MH3A 3Q3SA 3A03A 5EFYA 2B63J 4JL3A 2ME0A 4J19A 4ACIA 3A01B 2LLKA 5FKLA 3HOWJ 3LSRA 3FISA 2ZOZA 2WUIA 2XPWA 1BW6A 2CUFA 2LR8A 3DPJA 1POGA 1MSEC 4IEJA 3COLA 4JX6A 4FCYA 3S1QJ 1IJWC 2DTZA 3BR1A 3BTCA 5M5XJ 2NVYJ 5CW8A 2CQQA 3ZQIA 1U9NA 2M2EA 3AQTA 1JTXA 3MN2A 1Y1WJ 5DTDA 3ON2A 2UXPA 2X9DA 1H88C 4DZPA 3HDDA 1AU7A 4A93J 2DA2A 1FIPA 1IG7A 2FQ4A 1QVTA 3HM5A 5FHPA 1SGMA 5D18A 1D5YA 4A3CJ 1ZKGA 3IH4A 5C4XJ 4L62A 2X6OA 5J1RA 2QCOA 2IU5A 3KKDA 2DJNA 4EEFG 5IYCJ 2KDZA 1ETVA 2FD5A 3BHQA 3A02A 2HKUA 1RR7A 2XB5A 3LSPA 2IBDA 2DN0A 4V2FA 2R93J 4GCTA 2UXOA 1P7IA 2CJJA 2E1OA 2AO9A 2K40A 2DMQA 3B6AA 3HOXJ 1JJ6C 3HKZN 1TWHJ 3IUVA 2NVTJ 4JKZA 2LVSA 4AUXA 1ITYA 2Q24A 1GV2A 5AQCA 2LP0A 2WV1A 1I3QJ 3FK7A 5GPAA 4A3IJ 2QIBA 3ZQHA 3C07A 2M34A 2IEKA 3JR9A 3S1NJ 4ICHA 2HYTA 2DG8A 1QRYA 1ETKA 1JKRC 4A3EJ 1SANA 1MH4A 5IP9J 2UXHA 1OFCX 3AQSA 2KT0A 2L7ZA 3BG3A 3Q0VA 5E3OA 5K7HA 4NELA 1HOMA 1W0UA 3ANGA 4A3MJ 5FKKA 1AKHB 4JX5A 1JUPA 1T33A 3BG9A 5IP6A 1B8IB 1P7JA 3KNWA 2OERA 4D7MA 4C3HJ 2F07A 4DZJA 1YRNB 2CU7A 4RDUA 3CWRA 3VW0A 5M5WJ 2VPRA 3RZOJ 3BR2A 5JLXA 3B81A 3BNIA 4PXIA 2ECCA 2CRGA 2E2JJ 2ID3A 3F1BA 5C4JJ 1WGXA 1FJLA 1XG1A 2WB1N 2COBA 4FE4A 1RESA 2ME6A 1GVDA 2GUHA 1BJZA 2EZLA 2DMPA 3VP5A 2HQ5A 5H9TA 2R7ZJ 2DA6A 3H0GJ 3MKLA 5FKOA 3FRQA 2HYJA 4W1UA 4UUSB 3VOXA 2HDDA 1MBJA 1X58A 2DA7A 3S1MJ 5FKNA 5HAWA 4NDLA 2OI8A 4A3LJ 5K58A 1TWAJ 1U9OA 2O8KA 3P9TA 2W48A 1X2MA 5EF6A 3S1RJ 1QVUA 2R5YA 2JMWA 2EZHA 5J3LA 3RQIA 3MNLA 3HBLA 1WH5A 2RAEA 3JRGA 5F0HA 4MIMA 5K7FA 1ENHA 1WPKA 4XRMA 3GZIA 1LFBA 1Y1VJ 2LKXA 2M9HA 4B3AA 1JUMA 2LD5A 3LNQA 2LFBA 4DYCA 2MG4A 3BTLA 4M3DA 3L1PA 1WI3A 2L9RA 4XRSG 3EUPA 3OIOA 4Y7NJ 3CQZJ 1LE8B 1T56A 1MSFC 2GFNA 2EBIA
chains in the Genus database with same CATH superfamily
3S3NA 1XDUA 2D6YA 4HQEA 2JK3A 4XRFA 2EZKA 5GTHC 4GCLA 3JAMK 3GZ6A 1BIAA 1MBEA 2EIMH 5IYBJ 5CVRA 2H27A 3QU3A 4RB1A 1RPWA 3VYSB 1HCRA 4CUGA 1FP2A 5B66C 5ILUA 1APLC 3GLXA 2MGQA 1FOYA 2KDOA 3A1YA 5D8LB 2R4GA 3H35A 3F21A 2LKSA 3BY6A 3BCGA 4D5FA 5E17F 1YYVA 2K02A 5JHUA 3A01A 4LK1F 3GFJA 1Y6IA 3PSFA 3SZTA 2ZNYA 4E4HA 4I98B 5HOOA 3KZ9A 2YVXA 2BYVE 3HB9A 5D19A 3NARA 5LFAA 3REOA 3F9KA 5M3MJ 3S3OA 3VVYA 3VW2A 3SEQA 2HTJA 3E7QA 2IA0A 1GT0C 1R36A 2E1NA 1NTCA 1WRJA 3OOPA 3AL0B 2CQKA 2A05A 2QEXI 2ZMEA 1B6AA 2NRAC 4HKUA 3OY9A 2HOAA 3BZKA 2VE9A 1YI2I 3IWFA 2XRLA 3HSFA 2P5KA 4AYBN 5CVUA 2G7HA 2KIQA 1X19A 2E1MC 3B02A 4PJNA 2E2IJ 2Y48A 3VYRB 2QQBA 1ZLKA 1W7PD 3L7WA 1ZN2A 3LA2A 2Q8KA 2IGMA 3NI7A 4XORA 4H4KC 1G3YA 1JUSA 3ZN1A 4ESFA 2RVCA 4FISA 5FRNA 2VQCA 2V1NA 3OR1C 2A07F 3FKJA 2OZUA 3W2AA 5FMPA 4A0YA 4PSWA 3E6MA 2V26A 1X2NA 5BS6A 3DU6A 1I1GA 3JREA 4BBSJ 4IRVA 2WB1A 4WIBA 3ONQA 3GTOJ 4PGGA 2IS6A 2OCCH 4IHXA 3GF2A 4XLAA 2IS1A 3HTIA 2XC7A 1TW2A 2X4HA 4UDSA 1F5TA 5JVTA 1HKSA 3CF2A 2HYFA 3Q0WA 3C2HA 1X3UA 3DTEA 2DODA 1ERDA 3I3LA 2LYCA 3KP6A 3V4GA 3FDYA 1Y0NA 4EJUA 2M7AA 4YIFA 4FETA 3MZ8A 1WJCA 3QOPA 1RIOH 2G0EA 2M4GA 4NNJA 2XAJA 3OYAA 3JRHA 1KGSA 2PBIA 3EUHC 2XSDC 3CC2I 4CO8A 1VF9A 2FNAA 3DPTA 3TOBA 2VOOA 2M0CA 3BTJA 4ZYGA 2DPUA 1DGWY 2ICWG 1XD7A 2Y9ZA 4KMFA 1F4KA 1QZYA 3FXQA 2W25A 1GVJA 3EUKL 1V5GA 3HC7A 2UXXA 4P9FA 1X1DA 2H6BA 4F55A 4U0YA 1N25A 1BOBA 4XSXF 5EEGA 3ZQFA 1AA7A 2E34A 3A4CA 2X1DA 2HOEA 3CDLA 2XAUA 4HYEA 2BVLA 2ISYA 3G2BA 3K4KA 4M3GA 3WGIA 3CLQA 5FJ8J 2Z2SB 5JHFA 3CUOA 4CGZA 5D8KB 1BW5A 5LGTA 1WJFA 3K70D 1UG2A 1YS6A 2QKOA 3VOKA 3IP4B 3MWMA 2FNPA 2X6WA 4KITB 1Y56A 5F64A 4EVIA 1M1EB 3IV5A 3KZZA 1RUOA 2JA8J 4FTHA 3WTZA 2JA5J 4YZEA 2L9SA 1JXSA 2YX4A 5EZGA 2OPTA 4M9XA 1T08B 1CF7A 2HKOA 3ULQB 2ZNZA 4XIDA 4XOPA 3E3VA 1GXPA 2M8EA 2X1EA 2VLAA 2ZCMA 1IW7F 4E7HA 3VUQA 2H8WA 4IRHA 5C44J 1I1SA 2DCEA 1VQ5I 3GTPJ 3G1LA 3Q5FA 5EGOA 1HXDA 2RQQA 4HF0A 5AIPA 1IGNA 3AFHA 4AM3A 2ZB9A 2OUMA 5CXIA 3MZYA 2A3SA 1DP7P 1XGNA 1W1WE 2XAFA 4BQQA 4MO7A 5HNFA 1ACIA 2M30A 3GTJJ 3RZDJ 4KIBA 1W7PB 1BJAA 2ELHA 1OR7A 1VNDA 3H92A 4C3JJ 1N77A 3NWSA 4TV7A 2H8RA 3JSOA 3FZVA 1K78A 3HOVJ 4LB5A 3P5JA 2P5VA 1XTAA 3E6CC 4OIRF 4XL9A 2JA2A 1A5JA 3BR5A 2CS3A 1Q1HA 1UI6A 5F0FA 2UXUA 3JSJA 3KEQA 4G12A 5ED4A 1J59A 4XK4A 2HZTA 4JQFA 2VQLA 4L9NA 2Q0OA 3DBHB 1TWGJ 3QOEA 3M3YJ 3A2KA 3W6VA 2DT6A 1ZTRA 1U2WA 1J5YA 4N0BA 1E3OC 1K83J 1ZR4A 4DYRA 5IT3A 1U5TB 3CO7C 4JBAA 4MFDA 2DO7A 5ICGA 2NOGA 4HZFA 4A0XA 1HDPA 2F5FA 2KIMA 1HW1A 2UZKA 1C0WA 2V1UA 2HKXA 3T6NA 4X0GA 1UJ8A 2K86A 2J5OA 2LY1A 4ZZLA 2AXTC 2QKMB 5LEJA 3HRTA 1ETYA 4M6YA 4CCJA 4F7ZA 1QNTA 3WU0A 5LHGA 3G3ZA 3I71A 4RB0A 1LFUP 5HVQC 2EINH 1FTTA 2CV2A 5ERIA 4AIJA 2R7QA 4M3BA 3HXLA 3WHBA 3CCUI 1OPCA 2X48A 2O61A 3AL0C 3TGNA 3RJPA 2RQPA 4JP0A 4Y33A 2NP3A 4HF1A 3G1OA 4GYIA 2GOMA 3HTHA 5LHIA 4IJAA 2JVHA 5L3GA 1BR4A 5F6FA 1A35A 5CYVA 2M45A 1A6QA 2XAQA 4M9ZA 1VI0A 4M6XA 2OF7A 1R9TJ 3L2CA 1FP1D 1WI9A 2WAQN 3CJRB 1V5EA 1B59A 1YHQI 4RA2A 2O6GE 2KLOA 1VQ7I 2PFBA 2DDAA 3KP4A 1AOYA 3AG1H 1QQIA 4XLNF 4II2A 1D0YA 1REPC 1O4XA 3D1NI 1XMXA 1XDSA 2XDVA 1FBSA 3GTGJ 2O8XA 3ZQ7A 3VPRA 3TP0A 3K4LA 4AIKA 3BTIA 4MEXF 3G56A 4RM2A 2A5WA 4BXXJ 1TP4A 1VQ8I 3J7AY 2E1MB 2K4JA 2YSRA 4BDYA 1U78A 1B72B 3D5RC 3MQ0A 4ZYEA 1HC8A 3HPHA 2W4SA 3OYIA 2GENA 1Z9CA 4ZDLA 2OU2A 1I5ZA 2VONA 4XLFA 2VODA 2W53A 1R1UA 2ZBKA 4HBLA 4XQFA 2DU9A 5FD5A 2DI3A 3M4OJ 1DP3A 1LDJA 2KPMA 5DS9A 2CV0A 4KN7X 3IKTA 3HTAA 4QSHA 5KK1A 2ZCXA 4M6VA 2F4IA 2VE8A 4I76A 3SZGA 4ON0A 3VVZA 5F1JA 3HTSB 5IOZA 3ASNH 1BA5A 5HS8A 2JPBA 4PJMA 1S7EA 3C18A 4DIQA 3HOYJ 1NK2P 2P7VB 1JT6A 4QWQA 1TZLA 4UV8A 4KT5C 2HR3A 1UI5A 4A3GJ 4D5CA 2YS9A 3ZQCA 5JR3A 4JNNA 4EM1A 1RRJA 2WV0A 1TBXA 2DA5A 4MTDA 3Q3SA 2FOKA 5EFYA 5CKTA 3OYHA 3ABTA 3V42A 2R7FA 1ULYA 1S6LA 1PP7U 3HOWJ 2ZOZA 2HYGD 1W5SA 2XPWA 2QVOA 1W36C 4CSWA 4EATA 2BY2A 2BOLA 1XMKA 4PDKA 2KRHA 3OL4A 4FCYA 3S1QJ 3OR2C 3DKWA 3K4JA 3H0DA 1P9QC 3DBRB 3CCRI 3BR1A 2CQQA 1I27A 3ZQIA 1JGSA 1MMGA 4LGWA 5DTDA 1Y1WJ 3RPQA 3K9TA 4WWCA 3GZNB 4XBFA 4BAYA 4HSTA 4KIFA 5CLSA 2FQ4A 1OISA 1SC7A 2W84A 2QA4I 2DW4A 1D5YA 3IH4A 2PMUA 1LFPA 2X6OA 2H94A 1MNEA 1ETVA 5DM7F 2XB5A 4EGZA 4V2FA 3P9CA 4D9JA 1E2XA 1IN7A 1GXQA 4HEA2 1WFXA 4BS9A 2ZXWH 4B47A 4CDGA 1BN5A 1JJ6C 1ZGJA 3IUVA 2A6HF 5JVGF 2WV1A 1J09A 1I3QJ 2QIBA 4A3IJ 1ZELA 4UXNA 2IEKA 3JR9A 3SEZA 3HSEA 3ERED 3S1NJ 1ODDA 1K6OA 3BLYA 1S8NA 3V8JA 3PFIA 1UZCA 3RKYA 2FBHA 5IP9J 3F23A 1VQKI 3BG3A 2BY1A 2MLKA 3I0TA 4PUSA 2DFEA 1HOMA 2DDBA 3ANGA 1K78B 2UUZA 1YG2A 2FEZA 2F2EA 3KNWA 1PDNC 2OTJI 4D7MA 3HG9A 4DZJA 1YRNB 2CU7A 2CQ7A 3ZMDA 2ACJA 5M5WJ 2VPRA 1TL8A 3VYTB 3I59A 1IXRC 3BR2A 5JLXA 1BR2A 3KIOA 3WU2C 4HV6A 2XAHA 2ID3A 2NVUB 1TQMA 1MIJA 2BV6A 3ABKH 2JUGA 3H9JA 3LQRA 5GADJ 1FJLA 1XG1A 2WB1N 2ZO4A 2WADA 4E7LA 2ME6A 1GVDA 4NC6A 4IVNA 2DT5A 2GZWA 2A61A 4XKVA 4XM3A 4BDZA 3KP7A 4N4OB 4BYYA 2OD5A 2GXBA 4ZYHA 1RC9A 2E36A 3MKLA 2G9WA 4XOTA 4W1UA 5FKOA 3J7ZI 5JI6A 4KICA 3DKYA 3VOXA 2HDDA 4YIIA 1OYYA 5FKNA 5HAWA 5FFZA 1KQ9A 3A0BC 3KEYA 1FOXA 3L2QA 2J5PA 1YX5A 3RQ4A 2BXYA 3FXUA 2D45A 3PNYA 1KZHA 1SD6A 4HPQA 2L4AA 4LITA 3JRGA 3FXLA 1ENHA 1WJ5A 2L3DA 3K8PC 3GZIA 1LFBA 2ESNA 2R7TA 2M9HA 3LNQA 4MEYF 2P4WA 3L1PA 3JCUC 3EUPA 2LF7A 2VB6A 1U3EM 2JSCA 3FBIB 2EBIA 2K9QA 4GFBA 2HPIA 2GXAA 4G6DA 3OL3A 4XRSA 4FASD 2BY0A 1R7JA 4V19K 2KIFA 2JWTA 1PUFA 2LSOA 1SFOJ 1P92A 4D1QA 3RPUD 4P9UA 4A6EA 4BY7J 4RS8A 2FOWA 1CF7B 4XONA 1R22A 2BEOA 2VKVA 3CZ6A 1ZQ3P 1LDKB 3IAM2 4WXDA 3C3WA 1E17A 2DFIA 3GCMA 1ON1A 3I9V2 2VUMJ 3F8FA 3TMOA 4LG0A 3FK6A 3DEWA 1GDTA 1OCOH 3RYRA 4A6DA 2N8GA 4CYCA 1XSXA 2M5WA 2O03A 4NC8A 4ZDOA 4KN4X 1KU2A 2HI3A 4G8XA 5K5OA 1JKOC 2IVMA 4NHJA 2DLLA 1MBGA 5LBQA 3SHFA 1YFHA 1BOAA 1HW2A 3B6CA 1T6SA 2XB0X 5BPDA 5D5UB 2CFXA 2EWNA 3S17J 5FKMA 2MSYA 1ETWA 3FM3A 5DYMA 4RAYA 4BBRJ 3NNRA 3CRJA 5EJCA 1HBXG 2ZMEC 2PJPA 2EIJH 3ANPA 4ZDPA 5F27A 2RREA 2JRMA 2R7DA 1HSJA 2DA3A 1OCTC 3GBGA 3I55I 2GIZA 3M9AA 3GEUA 1YJ9I 2CUEA 1L3LA 4BQAA 2LOOA 3J80K 1X1BA 4IL6C 2MD5A 2FX0A 3CMAI 1EF4A 3ELKA 5HDKA 2JA7J 3BROA 1P4AA 2IW5A 3BDDA 4M3FA 3T8TA 1OYWA 4OIPF 1WWXA 5M5YJ 3K6GA 2IGKA 2NAZA 4HNVA 4CHUA 2QBYA 2GWRA 4A5NA 3BT9A 2W57A 4UV9A 5FLVA 2F48A 5EG0B 5HNHA 3G71I 3RIRA 4C2UA 3QPLA 2C6YA 5KCMA 4D0PA 2XKOA 1FT9A 3KFWX 4YEJA 5GP9A 5HODA 4U7BA 1S7OA 1I6HJ 3JRIA 3VEPA 1MBKA 1IN6A 2LREA 1VQ4I 3V78A 4V2GA 3HL2A 1MNDA 2DK5A 2W00A 2R7WA 3NPIA 3LAJA 3PPBA 1GUUA 2EH3A 2QLZA 1QHHD 1U5TC 2PZ9A 2VI6A 2P6TA 1XSDA 2R7OA 2KRFA 3OSFA 4UUVA 1ORKA 2G7UA 2VC1A 4MXMA 5GAGJ 3CCMI 2VJ4A 3G6EI 2XPUA 4GCKA 2ZMEB 3T8RA 3OOUA 4BY1J 3GXOA 5FGLA 1IC8A 2FBKA 3PIOF 2EA2A 1KA8A 3CDIA 3N05A 2XGXA 3FXJA 4EJOA 3BQZA 3F72A 1QA6A 1IO2A 4EMSA 3K10A 3PO2J 2YU9J 1NG6A 4YFNF 1MDMB 2UXIA 1QGPA 1NK3P 1Z6TA 2QWTA 1WZ2A 1K61A 3DV8A 4LK0F 4C3IJ 4MHGA 1WJEA 4M71A 5FLMJ 4E7KA 5F04A 2M3AA 3OYEA 2RHAA 4UB8C 4OU0A 3VDXA 3HUGA 1J7KA 2K9SA 4CCMA 2CV1A 1JI8A 1UHMA 3FMSA 4CYCB 3GWZA 3G1MA 1W7PA 4FX4A 3G7RA 5ICEA 2E2HJ 3GTMJ 3GFMA 2RASA 2LK2A 3O3KA 1H0MA 2XGDA 1W0TA 1LPQA 3JRAA 3U2RA 1IUYA 3JRBA 1IN5A 2FUG2 1SFKA 2KP6A 3R61A 4S0HB 4RB3C 3IKVA 3DCFA 2NS0A 2LY9A 3CD6I 4P55A 2CMPA 1Z3YA 4Z2YA 3BR3A 3M8JA 5FB2A 4WXCA 1U8BA 2FJ1A 1AKHA 1K4TA 1BI0A 4A3DJ 1U6GA 3TL4X 4MNUA 3GVAA 2CQXA 4JK1X 2O7TA 4AC0A 1OCCH 3JTHA 5B5EC 2IAIA 4PJJA 4Z6YA 1ZGAA 4EM2A 5FLXK 1MNMC 4AF5A 1FIAA 3WTXC 4A3JJ 2EV5A 1J9IA 3BWGA 4DQ2A 4IRGA 2IS2A 3UNGC 3NXCA 3ERMA 2ZY9A 1Z0XA 1G3WA 4HG2A 3OYCA 3H9QA 4RBOA 4IQJA 1A6IA 1LKXA 1MW7A 1Z7LA 3C7JA 1FEXA 2P5LC 3I53A 2CFOA 4RAZA 3WE3A 2R7VA 3OV8A 5LRSA 5IPAA 2PMZA 3CO6C 5F0CA 4HX4A 2DA1A 3HZJA 2QQAA 4BNCA 3HJEA 2WGBA 2VPLA 3H3VK 3PASA 1QO0D 2P81A 3OYNA 5L3DA 3ZMUA 4BJTA 1IRXA 4ENKA 5HSZA 2BE5F 2QSHX 5F08A 4CYDA 3BG5A 2MD0A 3O6BB 3DBLB 1ZK8A 1MJBA 2FA5A 1TNSA 2CG4A 1FMWA 3M7GA 4U9LA 4HRIA 1XMAA 3QKXA 2M8GX 4BJ6C 1RUNA 5D6EA 3ZOBA 2B1EA 3LSHA 2BZTA 4AYBA 2OTLI 3M1CA 3E6BA 1RKWA 2Z3YA 1SD5A 1R00A 5DD8A 5DM6F 1MDMA 2HOSA 4PK4A 4Q4ZF 3CMYA 1B8IA 4PFPA 3J81K 9ANTA 3VSLA 5CXGA 4WXHA 3L2RA 1N78A 3ASOH 3I5UA 1Z05A 3PQJA 5IYDJ 4Y4RA 4ZTJA 3HE0A 2L7FP 4M73A 2ZC2A 3SDGA 4BGDA 2IP2A 5M3FJ 3KE2A 2V4JC 4O6JA 5D4SA 1E3PA 2MABA 3KEOA 1IV6A 2X6XA 2K3FA 1O3QA 2R3SA 3K4BA 5CJ9A 3NRGA 4JX4A 2GIVA 4I7HA 2UWMA 1JGGA 3W3CA 3QPHA 1JE8A 2W7NA 2M87A 3RKQA 2FF4A 2VBXA 3LSKA 2R5YB 3BRUA 4I0AA 3BZCA 4KUMA 4HDUA 1TC3C 1G59A 4WCGA 1UMQA 1OJLA 1IDZA 1FBUA 2LF8A 1I50J 1RKTA 1ZGWA 3LJLA 1TTYA 2CSOA 3E1SA 3S3MA 1B9NA 3DPUA 5E1ZB 5DUIA 4PSXA 1O7LA 3EGQA 5BQTA 1G6NA 3GFLA 5DDGA 5BNGA 1BI2A 5B1BH 1YO5C 1R1TA 5GAEJ 2L54A 3L09A 1MH3A 3MKWB 2DJIA 3A03A 3ZRGA 2WY8Q 1P6RA 4OMYA 4JL3A 2LLKA 5FKLA 4OMZA 3F22A 2PX9A 1SFXA 1QPMA 2LR8A 1Y8QB 3L2WA 1POGA 1MSEC 1UG0A 2QBYB 2A68F 4Y17A 1R58A 1FNNA 2JPCA 4BXFA 2HQAA 1UAAA 1J0RA 3BTCA 3GLLA 2NVYJ 2ZJQF 1NHAA 4II3A 4B8XA 2M2EA 3MN2A 3OYJA 3QRFF 3M1EA 3DLLF 2X9DA 4ZYAA 2W82A 4C2TA 3W6KB 1SFUA 4A93J 2MC4A 1IG7A 4O3MA 1XGOA 2QQ8A 3SFZA 3L2UA 1SGMA 3M8FA 1JHHA 4A3CJ 5BMZA 4L62A 1KYZA 2EB7A 2QCOA 4LLGF 2CW8A 2IU5A 2DOAA 2L9NA 3S2WA 4UVAA 1ZRCA 3EDPA 3BHQA 3TDZC 3AG4H 3HIFA 3OS1A 3HSRA 4HDVA 2V9KA 2DN0A 5LHHA 1P7IA 2AS5F 2F5VA 2LRDA 3GYHX 1R4MB 2AO9A 2K40A 2ZXHA 3HOXJ 1FYLA 1TWHJ 3ABLH 2NVTJ 4JKZA 2LVSA 5H20A 2B0LA 2LP0A 2QENA 3K70C 3C07A 1W5TA 3EYYA 5GPAA 4B09A 2M34A 4CCKA 1Z21A 3F8CA 4IOCF 1VQNI 1Y8RB 3HHGA 1LUJB 2JTVA 3H3ZA 3DTKA 3K4CA 5E1XA 3AQSA 2DPDA 2L7ZA 2JZYA 2HEOA 4BHCA 1PVEA 3BZ6A 5FKKA 1AKHB 4EQQA 1T33A 3BG9A 2LKPA 4LFUA 5BPIA 2OERA 4O5VA 3SZPA 4PCQA 1AWCA 2ZXIA 1MMDA 1F1ZA 5LGNA 3W2VA 2I8DA 3LA7A 3BNIA 2CRGA 2E2JJ 3F1BA 2DYRH 5C4JJ 3MMYB 2MFZA 2ZJPF 2COBA 1OYIA 1RESA 4FE4A 4H0EA 1Y39A 2EA4A 2DFFA 1IN4A 2HQ5A 3U1KA 1RI7A 4OIQF 3H9GA 5H9TA 2R7ZJ 1BI1A 1UB9A 5FFXA 1X58A 4CZZA 4M74A 3KYLA 1IXSB 3DF8A 5AIQA 4A3LJ 1XGSA 1D8JA 1TWAJ 3VSKA 3RI4A 2W48A 4CA0A 3LSIA 5EEHA 2HVRA 1U5TA 5HLIA 5J3LA 5ICCA 3WGGA 5FRMA 3MNLA 1K7AA 1I39A 3WTUC 2HVSA 2VBYA 3HUGB 2H1LA 4F3QA 2CO5A 2K85A 1WPKA 4GGGA 2D1HA 2HNHA 1Y1VJ 3MAJA 2E7XA 5J47A 4B3AA 1B4AA 1JUMA 2XIGA 2LFBA 4DYCA 3BTLA 3DU5A 3BJAA 3GX4X 1T39A 3LMMA 1D5VA 2E60A 3V7CA 3OIOA 3R6SA 3NRVA 3K2ZA 3E0JB 2PG4A 3OIPA 2X6YA 3UR3C 2FJI1 4DVYP 1STZA 4A0ZA 2NS7A 3SFIA 4A69C 5ILVA 4IHTA 4KMUX 1YTYA 2ZFWA 3MKYB 1DGRM 3VOEA 2K7LA 1R49A 3VB2A 1MBFA 1UFMA 1X1PA 2EJRA 4Y3OA 1LEBA 2W85A 1FYKA 2EFNA 2EK5A 1WKMA 1YLFA 1MMSA 4AIDA 3TW7A 2ELKA 3GTQJ 2KFDA 3AKZA 4G7OF 2KISA 4HLXA 5DCMA 1X1AA 3FX3A 3V8KA 4XLPF 4KT6A 3TQNA 5BOXA 1WVRA 1DU0A 3HIMA 2UV1A 4U9NA 1JJ8C 4C2MJ 4F52A 4U0WA 4AC6A 2ESHA 2Z5UA 3K1PA 3LSJA 1F9NA 1HF0A 1KYWA 1V5FA 3KP5A 5E3MA 1W5CC 1U8RA 4Y13A 2HTSA 2HXOA 4XICA 1PP8F 2QUFA 2EFQA 1HDDC 3FHNA 5TISC 3VWBA 3HHHA 4E7SA 1ETQA 2DMNA 2L0KA 4BJ5C 3KKCA 1B9MA 3QPTA 2HOTA 3BR6A 2G3BA 3COAC 4N4NB 1LEAA 1MMNA 4CCLA 2FSWA 4DBRA 4OD4A 4LB6B 4F93B 5CPRB 2Y69H 2RNJA 1LVKA 3K4NA 1RR8C 3I4MJ 1CQTA 2H09A 2DYSH 1J75A 2ADUA 5J1UA 1X4OA 1R5ID 4EV0A 4BACA 5HDGA 4XLEA 1B1BA 3ZMTA 1A31A 3QP5A 3ABUA 3CMMA 3QWLA 3B73A 4CCOA 1K4SA 2OZ6A 1G8XA 2HDCA 2PJRB 2GA1A 4UB6C 4AIHA 2NXNB 2Y75A 3LWFA 1DU6A 2DQRA 2XUBA 1Z1DA 2IJLA 2YX7A 2OCEA 1T2KA 4IHWA 3L2VA 2HS5A 1ZG1A 2FQ3A 5LD2C 2Z99A 1G3SA 1UELB 2JN6A 1O57A 1WH7A 2TDXA 4OAYA 4GFLA 1IRGA 2V1DA 3FKIJ 4U0VA 3KYDB 2DG7A 5EZHA 4A5MA 2GAUA 5D4RA 4ESJA 1X1CA 2KZGA 4YIRX 1SMTA 1TWFJ 3TO9A 1Z3XA 3HEFA 2B9SA 3PL8A 2VKEA 1MBHA 4ZH4F 2NP5A 4P96A 1UCRA 4PJLA 3QODA 3NAUA 4ABZA 3VW1A 2LG4A 3HTJA 1QHGA 4IX7A 1LE8A 3RPUA 4G7ZF 3WTTC 4LD5A 2CYYA 3ECHA 3H36A 2L5QA 1OQYA 1EV7A 2O3FA 2BBYA 1O7FA 3S8PA 3VVXA 3P7NA 3BJBA 1QPIA 1GV5A 1RETA 1OCZH 2YPRA 1DDNA 2DA4A 3HRMA 4F91B 3FIWA 2VBZA 3E7LA 2KHMA 2XPVA 2QOPA 3K4MA 5E79C 4I99C 2FXAA 3PO3J 3BP8A 5CVJA 1A36A 2V1XA 1G3TA 2F4MB 4YFKF 2JJ7A 5HLHA 2DBBA 3KX2A 1VQMI 4L5IA 2LBFB 4UY8I 1TWCJ 3QYBA 4G6QA 4HX7A 2HZDA 4B48A 2ISZA 3H1CA 4NB5A 4CGRA 2AQFA 2R0QC 2ECBA 5L3BA 1FYMA 3GMEA 2EZIA 4MGRA 3IHUA 5D6FA 4QLCU 1BBYA 3ZQGA 4EJTA 3ECOA 4LOCA 4IHSA 1IUFA 4HV5A 4QTRA 5H6RA 3PQKA 1OLTA 1WJDA 1S72I 4HX8A 2QF7A 2XAGA 1ZG5A 5DD4A 2XGEA 4ZC3A 2PFVA 4UUTA 3ZMVA 4CH7A 4IZZA 1IRZA 2KZVA 2E19A 2NYXA 4LG3A 5E1WA 3I59B 3PUBA 3GEZA 1ZH5A 4IF4A 2YVEA 3HOZJ 1YRNA 4DW6A 5GTIC 1USTA 1XB4A 3O8GA 1E0EA 1ZYRF 4RGSA 2MA3A 2MW8A 3G4SI 2H1KA 3KP2A 2PI0A 2OQGA 5FO5A 4RGRA 2E35A 4XMYA 3LSTA 1K6YA 2OQRA 2RV8A 3HOTA 3CCVI 4X1EA 3TDUC 2QZ8A 1WSUA 1OMIA 3D5LA 4U7DA 4EJVA 5JLWA 1MD0A 6PAXA 2XGCA 1GHCA 2D5VA 2VQHA 1XSVA 2MH2A 5AONA 3CP8A 3WTSC 3S5RA 4B3XA 2HWVA 4KWAA 2QYOA 1N75A 3T0YA 3BJOA 2ZKZA 2BGCA 4PGHA 4E6KG 5K7ZA 5B3SH 3CCLI 2G7GA 2VC0A 4ZTFA 4I6ZA 4NN1A 1FY7A 2MLGA 3CJQB 1F36A 2JA6J 3I4NJ 4G7HF 1IDYA 4HSRA 1KU9A 3WTWC 2G7SA 4L0ZB 3VODA 2F5EA 4X6AJ 5EGOB 3C2GA 4XLCA 1D1BA 2RKHA 2TRTA 1FLIA 3GO5A 4E7IA 4A12A 1Z67A 2Q1ZB 4I2OA 2EQRA 3S15J 2VJIA 2XF5A 4QIWN 3CDHA 3TW6A 4A3BJ 4BQNA 1OCPA 2QQ9A 3C2BA 2HFHA 4IHYA 3LOCA 4LLNA 2Y0SN 5CQGA 1YJNI 3WE2A 2XSJC 4CZCA 2ZJRF 2ETHA 3OWTA 2GQQA 2VOPA 3X2QH 3RKXA 5EEAA 2QWWA 3LSMA 4RAFA 2M0MA 2Y0SA 1BR1A 1GLNA 1ZARA 3K69A 5J40A 1ZHFA 3ZMZA 3JRCA 3H5RA 2KL4A 2R7SA 3L00A 2NOJB 3CUQC 2P7CB 3O8HA 3F0CA 4AWXB 1D3YA 1YITI 1YIOA 5K1YA 1MKMA 2QGUA 2FBIA 1B72A 2XASA 3AAFA 2EV0A 4CXFA 3SQNA 1XS9A 2ZCNA 1T8IA 3RH2A 1UHWA 3RD3A 3RDIA 3JW4A 4IQ4A 2AHQA 4P1WA 1G2HA 3LWJA 1H8AC 4RMNA 3ZCOA 3F3XA 1JT0A 4DNCA 1D1AA 3CLOA 3IUOA 3D5SC 3KZYA 3V8LA 1WCMJ 4XR6A 5J4YA 2CUJA 2DMTA 2DOFA 1DPRA 3QP6A 1SVOA 3GFIA 3HTUA 1WHUA 3MD2A 5FD6A 2ME0A 1MJAA 4EM0B 3K0LA 1SAXA 3LSRA 1YE9A 2WAFA 2FRHA 2CUFA 4BH9A 1VQ6I 1IZ1A 3COLA 1LDDA 2PLYA 4JX6A 2CUZA 3ZP5A 1FZPB 3RCOA 1IJWC 1IN8A 3F6VA 2Z33A 5M5XJ 1FOKA 2PJRA 4C2MA 3I58A 1U9NA 2JRTA 4B43A 4ME9A 3AQTA 1ZG3A 2EPFA 3ON2A 2UXPA 1H88C 3FXKA 3HDDA 1I6XA 1X3WB 2K9MA 4C9YA 4DGWB 5ICFA 4XLHA 5LLQA 2LDUA 2W24A 3ESWB 1FIPA 3MEXA 1ON2A 4DBQA 1QVTA 2DK8A 1V3FA 4KFCA 5FHPA 4L18B 5KVRA 4CICA 5D18A 4KISA 1ZKGA 1S7AA 3DTIA 4EEFG 3Q9SA 4IO9F 2FD5A 1S5LC 4G6TB 1H9TA 5E18F 2IGOA 2IBDA 5LRRA 2R93J 4HF2A 2UXOA 3U9GA 4S05A 4BQOA 1TW3A 3R60A 3DXJF 5E8GA 4KYWA 4AUXA 5HDNA 2Q24A 1GV2A 3OYMA 3FK7A 2L02A 3TKYA 2A69F 2DQLA 1Z6RA 2GXGA 3BCBA 4L9JA 4ESBA 2HYTA 4ICHA 1QRYA 1ZAOA 4AU7A 4QPQA 2HPMA 1SANA 3HPGA 1WJAA 2K4BA 2KT0A 3IAS2 3Q0VA 3OYBA 3T5XA 5K7HA 4A3MJ 2B7EA 2F6CA 2VJ5A 3DLAA 4KJZA 5IP6A 2WY7Q 2CW0F 3E5UA 3CJTB 1B8IB 3OS0A 3EPZA 1SFEA 2V9VA 4RDUA 5FGMA 1ZREA 3TOAA 3RZOJ 4PXIA 3BC8A 4ENMA 1K79A 1KQ0A 2ECCA 4C30A 2R7XA 4LLLA 2V79A 2HVQA 1WGXA 4I01A 1HQCA 3U1DA 2RN7A 5IT9Z 3KP3A 5D5WB 3FHZA 4LG0B 4OD5A 2GUHA 2PEXA 2EZLA 1EKEA 1YW9A 3S93A 3T1BA 2VT3A 3ZPLA 4IXAA 3FRQA 2DA6A 5DCFA 3J80Z 3MKZA 2B3WA 2VKHA 1MBJA 3S1MJ 5A2QK 3RKWA 4AD9A 3OYGA 2OI8A 2AQEA 2VXZA 4HAMA 1FBQA 1U9OA 3P9TA 4B44A 4UVCA 1X2MA 1QVUA 3TO6A 2JMWA 3LAPA 3KLNA 3RQIA 1NH3A 2IA2A 1WH5A 3R0AA 5J8CA 4MIMA 1TQPA 5K7FA 4UHTA 4OINF 4HNTA 2F5CA 5L3FA 3IWZA 3FF5A 1SVMA 2M4KA 2PMHA 2IT0A 2IXSA 4BL0B 3ABMH 4M9SA 4M3DA 2R7RA 1WI3A 3QYEA 4XRSG 2VL8A 3HRSA 1O3SA 4E70A 3CQZJ 1LE8B 3HKZA 1T56A 1MSFC 1A04A 2V6EA 1VQLI 2GFNA 1KU3A 2R7UA 5A2QZ 1Q1VA 1BI3A 3LSGA 3N97A 1F43A 2XF6A 3OSGA 1VZ0A 1XC5A 2O0YA 4UUSA 4AVZA 1EH7A 4BE2A 2WAEA 2REKA 3EYIA 2O7OA 2YVHA 1T38A 3BQYA 2M7BA 3DP7A 2OV7A 3KETA 3RSNA 3O60A 5CQEA 1SMYF 3OS2A 3KLOA 1YOVB 1PYVA 1UHSA 4R79A 3CC7I 4MFEA 3Q9VA 4R1HA 4XSZF 5D5VB 1SVLA 5B1AH 1P4WA 4EGYA 2GBYA 2P6SA 1E3HA 3BR0A 4U87A 2PMZN 1QU3A 3FXMA 1FX7A 3H5NA 2KJBA 2IA1A 1YQAA 2EIKH 3JAMZ 2ELJA 1XPXA 2XF7A 2K5CA 3CJNA 4HW0A 3V7RA 4JOMA 1ZRFA 4I02A 1P2FA 3CP2A 3QYFA 1SEUA 2V57A 1IF1A 3NS4A 3RYPA 2A6EF 2XHKA 3BG7A 1LNWA 4XN3A 1FTZA 5K5QA 1OCRH 2A2FX 2BHZA 1ETOA 2QKLB 3FMRA 3NEUA 3R0JA 1W36D 3CTAA 1JTYA 2KRCA 4BE1A 4D7NA 1KONA 4LIVA 1R6RA 3S14J 3G73A 1FWZA 2I10A 3P9KA 2X51A 2DMUA 2L7KA 5C4YA 2FU4A 1SAUA 2A6TA 5J6XA 2KJCA 3IRRA 3E97A 4ENJA 4K2EA 1S3JA 4A3FJ 4MLOA 5E8IA 2K9NA 3VFZA 2E5NA 3SWHA 2STTA 3ROUA 4ETSA 4QPOA 1G4DA 2QSFX 1Z77A 2Y30A 3HYIA 2F5DA 2DFHA 2G7LA 2UXNA 2JVGA 3W2WA 3ZGKA 1BM9A 2QTQA 2Z9OA 3CUQB 2Y2ZA 4FE7A 2CH0A 5EYRA 2LNBA 5CVIA 2YUSA 3IC7A 1LB2A 3F8MA 2XDNA 5IP7J 4M72A 2I5UA 2FE3A 2Y31A 2VJJA 4GXOA 3SXYA 2NVQJ 3PSIA 3FXOA 3O2PE 1LQ1A 5DCMB 2R5ZB 2R92J 3GTKJ 4BHBA 3IH2A 2O9LA 4XKWA 2JQ7A 3TEDA 5DUKA 1V55H 5HBUA 5H2FC 4XKBA 4RM3A 3WGHA 5EG0A 3HRUA 2COMA 1R23A 1HSTA 5IOYA 3QBMA 2WAQA 3LA3A 3VIBA 2EILH 1HLVA 4HLYA 2GLOA 2HGCA 2DXIA 3SDBA 3CC4I 2FMYA 4GO1A 4NUBA 2R5ZA 3FMQA 2HQRA 2P8TA 1FPQA 2PQ8A 2LTPA 4LMYA 3BCAA 3NQOA 2NNYA 5C3EJ 2LMDA 2ZSHB 1HW5A 4G94A 4GCVA 4A2UA 1QBJA 1XGMA 2V7FA 4BE0A 4WF2A 3ML6A 5HS9A 3WTVC 5D1RA 3D0SA 2VKDA 5E3NA 3DQVC 4NBQA 4B4CA 1PJRA 3S2DJ 3CCEI 1XN7A 3DKXA 4RLQA 3PUFA 1VQ9I 3V7SA 2QM3A 3CCSI 3EUAA 1JHFA 2K3PA 3KYCB 1VTNC 2OAZA 1WJBA 1ETXA 1T95A 2D2WA 3FXRA 4MTEA 5L3EA 4M3EA 3P9IA 4ANJA 2E71A 2Q2EA 3FBNB 2MH9A 3PNVA 4PFOA 3Q0UA 2M1BA 2BW3A 4KA4A 2HQNA 3HGGA 4DOZA 3CUQA 4FHTA 1BC8C 3DEEA 3GTLJ 1SD7A 4I0BA 3V6GA 2IGNA 3LFUA 4L5EA 4NQWB 2MBFA 3CCYA 3FWEA 2CWEA 5EDNA 2GM4A 4OIOF 2YR2A 4BHPA 4YG2F 1I3AA 2JSPA 1PUFB 3PM1A 3OYDA 4J00A 1PUEE 3ZMSA 2XVCA 1FMVA 2WC2A 3BJ6A 1R5GA 3K1MA 3TP3A 3M07A 2XKPA 3WU1B 1VQPI 1D1CA 1O3RA 1T0FA 3BPXA 3AG2H 3F8NA 2WWYA 1ONVA 1QZEA 5KAFC 4PZJA 1X4PA 4J01A 4YFXF 2CW7A 3MFKA 2KQRA 2RGVA 2CGPA 4ZYDA 1EA3A 3C1DA 3IH3A 3QAHA 4F92B 3JRDA 4Q48A 4MK6A 4CCNA 1R4NB 4MQ9F 5J1YA 3SJMA 1AHDP 4HNUA 3OYFA 3N4MA 2TCTA 4L9TA 3JTGA 3QQAA 1TQIA 2EV6A 2X0LA 4OOIA 4ITVA 4DJAA 1VFCA 2VQGA 3DEUA 2STWA 4ENNA 1OKRA 3TO7A 5E3LA 4IHVA 2P0WA 2PN6A 3LQQA 3CCJI 3CCQI 1XCVA 2BHYA 4RB2C 1IRFA 2O5RA 2W1OA 1IV8A 3K7AJ 3IL2A 3ZR8X 2K9LA 2VN2A 2VIXA 5F1RA 1P4XA 4L0YB 1W4MA 2VASA 5IY5H 1JKPC 2ZOYA 5KNLA 5HLGA 1EH6A 2IPQX 2IRFG 2WTEA 2MC3A 3S32A 2IS4A 2HXIA 3EETA 3ZQLA 5GPCA 3ON4A 1TLHB 1Z91A 1CGPA 4A3KJ 3UKGA 3CESA 4N9IA 1MGTA 1Z7UA 4BU2A 4BXUA 3VTIA 5HS7A 5FLXZ 1JKQC 2L7MP 3HOUJ 4IOAF 3HGYA 1FC3A 4YRVA 2NX4A 2A5YB 2NS8A 4UVBA 1RNLA 4BEHA 3JRFA 3J7AO 2VBWA 1ZLJA 4XN0A 3CF5F 5JFRA 5CVVA 2ID6A 2RNGA 2D1VA 5H6QA 4GYGA 1R5HA 3QPSA 3MVPA 3LHQA 5D5XB 2PBXA 3I56I 3AG3H 1J2XA 1D8KA 4JYKA 2Z16A 1O3TA 4E7JA 3WODF 2BXZA 3WTYC 1WQ2A 1NG7A 2DTRA 4YELA 2Y0MA 4FT8A 3GZ5A 3CJDA 4R8HA 1QZZA 3ZXSA 1LJ9A 2Y9YA 2LBFA 4B1RA 5HLTA 2WBMA 3QU6A 2F4OB 2RDPA 2EFOA 4WK8F 4Y52J 3GUDA 2V9PA 1EH8A 2DT7B 1L0OC 1ZR2A 5K5RA 1DQUA 1H89C 2HDWA 1VQOI 3S2HJ 2FBQA 1XX5A 5E20A 3WG7H 4EJWA 3DFGA 5LEKA 4PJ0C 2L2OA 5TGTA 3H5AA 4RAGA 1KU7A 3ZQQA 2E1CA 3WHCA 2LY2A 2OBPA 3K2AA 5DAJA 4ZJZA 4AVPA 2VT2A 4GFKA 4W97A 3W6JB 2KKOA 4WX9A 2E5ZA 5KAIC 4KNYA 2Z1DA 1TNTA 3PJRA 4BKXA 3HOSA 2ZJ2A 3MCZA 3R4KA 4IKFA 1BL0A 1YX3A 4P5OA 4DYQA 5TJJA 3KPHA 1MZBA 3S16J 3E5XA 5DEQA 4LIUA 5DV5A 4HOBA 3FM5A 3PIPF 1V54H 2XRNA 2NVXJ 3TBIA 3I64A 4ASNA 2L01A 4BUPA 2B63J 3BOQA 3LFKA 3DPLC 4J19A 4ACIA 4G9YA 1X3ZB 3A01B 3CMEI 3FISA 2WUIA 1OR7C 4GDFA 1BW6A 3DPJA 2KIUA 1RZ4A 2OJED 2JT1A 4IEJA 4MQVA 2ZSIB 5ILSA 2EFPA 3A0HC 4L5JA 2DTZA 1HKQA 1YW7A 1YW8A 3VYUB 5CW8A 3ZN0A 1JTXA 2V6CA 1FSEA 4DZPA 3DWLE 2L4MA 2ZXJA 1AU7A 1DUXC 2DA2A 2BY3A 2ZFUA 3HM5A 4UNOA 5KHDA 1DPUA 4HQMA 4E7ZA 3SYTA 5C4XJ 5J1RA 3E5QA 3KKDA 3PFYA 1TT5B 2DJNA 5IYCJ 1T98A 3J81Z 2KDZA 4IRIA 1YS7A 2FMLA 2DOEA 2XROA 3A02A 1YIJI 2HKUA 1RR7A 3E6DA 3H3UA 3LSPA 2GOXB 4KDPA 3KZIC 4GCTA 2DAOA 3L9FA 2CJJA 2E1OA 4Q5SF 3F8BA 3B6AA 1IXCA 2DMQA 2JUCA 3HKZN 5J4VA 2EFWA 4ZZDA 2MYSA 1U0JA 3J7YJ 1ITYA 3U21A 1S9HA 5AQCA 4Q47A 1KQ8A 3PNTA 1H9GA 1FSHA 3ZQHA 4BEHB 1ZRDA 2LC2A 4OAZA 2DG8A 1ETKA 3K1NA 5FROA 1JKRC 4A3EJ 2LH9A 1MH4A 2UXHA 1OFCX 1S29A 2RC4A 3KCCA 5E3OA 2BVMA 4NELA 4GRIA 1W0UA 2VXDA 3LL7A 2OA4A 4JX5A 1JUPA 2KMUA 1D0XA 4KIGA 1P7JA 1XCBA 5J8FA 4C3HJ 2F07A 5L3CA 4I09A 3OYKA 1V4RA 2OC6A 3RTRA 1SD4A 5LGUA 3CWRA 3VW0A 1FOWA 2NNNA 2X1CA 2K27A 1D0ZA 4U88A 3B81A 4OWRB 4XKCA 2CQNA 3GW2A 2XV4S 1MMAA 1IAWA 4N9HA 3EUHA 2YU3A 3BG6A 1USSA 4RGXA 3MZHA 1BJZA 4L9VA 1EJ9A 2L9VA 2DMPA 1BIBA 3VP5A 1R71A 2BW3B 4S04A 4IPAA 3H0GJ 5GAHJ 2QSGX 2HYJA 2Q2EB 1HA8A 4UUSB 4HA8A 2DA7A 4LJZF 3WG9A 3OIQA 3M8EA 2GA2A 3I54A 4NDLA 4XNFA 5K58A 2O8KA 4NQWA 5IT9K 1LVAA 2ZCWA 1BC7C 1R1VA 3JSPA 5EF6A 2AXLA 3S1RJ 4RGUA 2R5YA 2EZHA 3OYLA 2HU9A 1T0FC 3HBLA 2RAEA 3F6OA 5F0HA 3BPVA 4FX0A 3ISPA 2E7WA 3I4PA 1YJWI 1MJ9A 1Y0UA 4XRMA 3IRQA 1TT0A 2WA0A 3NWTA 2LKXA 2LD5A 2H6CA 5TRDA 2MG4A 2L9RA 4FQGA 4NC7A 4Y7NJ 1HKTA 2X85A 3OMYA 3EQLF 4RLFA 4Y15A
chains in the Genus database with same CATH topology
2K9QA 1Q1VA 2D6YA 4GFBA 3LSGA 2JK3A 2NS7A 3SFIA 1F43A 4XRSA 4GCLA 2EZKA 4A69C 1XC5A 3OSGA 4UUSA 2REKA 1MBEA 2O7OA 5IYBJ 2YVHA 3BQYA 2JWTA 1RPWA 1PUFA 1HCRA 3O60A 1SFOJ 1APLC 1MBFA 2MGQA 4BY7J 1UHSA 4MFEA 2VKVA 1ZQ3P 3TW7A 2ELKA 3GTQJ 3BCGA 4D5FA 3A01A 1DU0A 3HIMA 2VUMJ 2GBYA 3BR0A 2PMZN 1JJ8C 3FK6A 4C2MJ 3DEWA 1GDTA 4AC6A 3KZ9A 3LSJA 1HF0A 3HB9A 2N8GA 4CYCA 5D19A 3NARA 5E3MA 2HXOA 5M3MJ 2HI3A 4XICA 2V57A 3VVYA 3VW2A 1HDDC 1JKOC 3E7QA 1GT0C 1NTCA 1ETQA 1MBGA 2DMNA 2L0KA 3KKCA 4HKUA 1FTZA 2HOAA 2HOTA 3BR6A 2G3BA 2XRLA 3B6CA 4AYBN 2XB0X 1ETOA 3S17J 5FKMA 2MSYA 2E2IJ 1ETWA 1JTYA 3NNRA 4BBRJ 4D7NA 3CRJA 3I4MJ 3NI7A 3S14J 1JUSA 1CQTA 2I10A 4FISA 2DMUA 3ANPA 5C4YA 5FMPA 5F27A 5J1UA 4A3FJ 4MLOA 2DA3A 1X2NA 1OCTC 2K9NA 3GBGA 3JREA 4BBSJ 3GTOJ 3GEUA 2CUEA 1Z77A 2Y30A 4IHXA 2G7LA 2FX0A 3HTIA 1EF4A 2JA7J 4M3FA 2QTQA 4UDSA 2Y2ZA 4FE7A 5EYRA 3Q0WA 4HNVA 5M5YJ 1DU6A 2YUSA 2XDNA 5IP7J 3BT9A 2Y31A 5FLVA 4IHWA 5EG0B 2NVQJ 2G0EA 3QPLA 3JRHA 2R92J 2R5ZB 3GTKJ 2O9LA 3IH2A 2JN6A 1WH7A 5GP9A 5HODA 2XSDC 3TEDA 4GFLA 1VF9A 3JRIA 1I6HJ 5HBUA 3FKIJ 2M0CA 1MBKA 2DG7A 3BTJA 5EZHA 5EG0A 3V78A 4V2GA 5IOYA 3QBMA 2Y9ZA 1TWFJ 3VIBA 1HLVA 3NPIA 3HEFA 2GLOA 2VKEA 1MBHA 2R5ZA 2NP5A 3PPBA 1GUUA 2EH3A 3NAUA 4ABZA 2LTPA 3VW1A 2PZ9A 3HTJA 2VI6A 5C3EJ 1LE8A 3ZQFA 3OSFA 1ORKA 4MXMA 5D1RA 3CDLA 5E3NA 4B4CA 2XPUA 4GCKA 3S2DJ 3OOUA 4BY1J 4M3GA 5FGLA 1IC8A 3BQZA 5FJ8J 3VVXA 3BJBA 3PO2J 1QPIA 1GV5A 1RETA 2YU9J 1BW5A 2DA4A 3FIWA 1UG2A 2QKOA 3E7LA 2UXIA 3VOKA 2XPVA 2QOPA 1NK3P 2QWTA 1ETXA 3IV5A 2JA8J 4FTHA 1K61A 2JA5J 3PO3J 4YZEA 4C3IJ 4M3EA 5FLMJ 5F04A 2RHAA 5EZGA 2OPTA 2JJ7A 2K9SA 3Q0UA 4XIDA 3HGGA 4CYCB 2ZCMA 1TWCJ 3G1MA 3GTLJ 3G7RA 3V6GA 2E2HJ 5C44J 3VUQA 3GTMJ 4L5EA 2RASA 3GTPJ 4CGRA 3CCYA 2LK2A 2XGDA 3G1LA 2R0QC 5EDNA 5EGOA 1W0TA 2GM4A 1IGNA 2ECBA 3JRAA 2EZIA 3JRBA 2ZB9A 4S0HB 5CXIA 1PUFB 3PM1A 3ZQGA 3DCFA 2LY9A 4MO7A 4LOCA 1IUFA 3GTJJ 4ME9A 3RZDJ 4QTRA 4C3JJ 1VNDA 3TP3A 3BR3A 2H8RA 1AKHA 2QF7A 1U8BA 2FJ1A 3HOVJ 2XGEA 4A3DJ 1A5JA 3BR5A 4UUTA 1UI6A 2UXUA 5F0FA 3JSJA 4G12A 2CQXA 1IRZA 2E19A 2O7TA 4AC0A 4XK4A 3IH3A 3JRDA 4MK6A 2IAIA 2YVEA 3HOZJ 1YRNA 1TWGJ 4DW6A 5J1YA 1MNMC 3SJMA 1FIAA 4AF5A 1AHDP 3M3YJ 3W6VA 1ZTRA 3O8GA 2TCTA 4A3JJ 2MW8A 3QQAA 3NXCA 1E3OC 1K83J 2H1KA 1ZR4A 4DYRA 4MFDA 1VFCA 1Z0XA 4RBOA 1A6IA 2NOGA 1FEXA 4X1EA 1HDPA 5E3LA 4IHVA 5JLWA 3T6NA 5IPAA 2XGCA 5F0CA 2D5VA 1ETYA 2DA1A 3S5RA 3K7AJ 2WGBA 4KWAA 3PASA 3H3VK 2P81A 1LFUP 5K7ZA 1FTTA 2G7GA 1JKPC 2ZOYA 4M3BA 3WHBA 4I6ZA 5HSZA 2X48A 4NN1A 5F08A 3BG5A 2HXIA 4JP0A 1ZK8A 2JA6J 1F36A 3ZQLA 3I4NJ 5GPCA 1IDYA 2NP3A 3ON4A 3G1OA 3HTHA 2G7SA 4A3KJ 3UKGA 4X6AJ 5EGOB 3QKXA 1VI0A 1JKQC 2TRTA 2L7MP 2M8GX 3HOUJ 3HGYA 2OF7A 3ZOBA 3S15J 1R9TJ 2EQRA 2NX4A 2WAQN 4QIWN 2NS8A 3TW6A 4A3BJ 1OCPA 3JRFA 1RKWA 3C2BA 4IHYA 3LOCA 2HOSA 2ID6A 2Y0SN 3CMYA 1B8IA 9ANTA 3QPSA 5CXGA 3MVPA 3LHQA 2PBXA 5EEAA 1O4XA 3D1NI 4JYKA 5IYDJ 3GTGJ 3VPRA 3TP0A 3HE0A 2L7FP 3CJDA 3SDGA 3BTIA 5M3FJ 3G56A 2Y9YA 4BXXJ 4B1RA 3JRCA 1IV6A 4Y52J 1U78A 1B72B 3NRGA 4JX4A 1ZR2A 1JGGA 3O8HA 2GENA 1H89C 3F0CA 2FBQA 3S2HJ 3RKQA 2W53A 2R5YB 3BRUA 3M4OJ 1B72A 1TC3C 5DS9A 3HTAA 1UMQA 4QSHA 1XS9A 4M6VA 2ZCNA 2ZCXA 1OJLA 3WHCA 3RH2A 3K2AA 5DAJA 4I76A 3RD3A 3VVZA 5F1JA 1IDZA 5IOZA 1I50J 1RKTA 4W97A 2AHQA 1ZGWA 1BA5A 3LJLA 4GFKA 1G2HA 1S7EA 3LWJA 1H8AC 3HOYJ 4BKXA 1NK2P 1JT6A 1BL0A 4DYQA 1UI5A 3EGQA 4A3GJ 1JT0A 3S16J 4D5CA 2YS9A 3ZQCA 5BNGA 4JNNA 2NVXJ 1WCMJ 2DMTA 2DA5A 1MH3A 3Q3SA 3A03A 5EFYA 2B63J 4JL3A 2ME0A 4J19A 4ACIA 3A01B 2LLKA 5FKLA 3HOWJ 3LSRA 3FISA 2ZOZA 2WUIA 2XPWA 1BW6A 2CUFA 2LR8A 3DPJA 1POGA 1MSEC 4IEJA 3COLA 4JX6A 4FCYA 3S1QJ 1IJWC 2DTZA 3BR1A 3BTCA 5M5XJ 2NVYJ 5CW8A 2CQQA 3ZQIA 1U9NA 2M2EA 3AQTA 1JTXA 3MN2A 1Y1WJ 5DTDA 3ON2A 2UXPA 2X9DA 1H88C 4DZPA 3HDDA 1AU7A 4A93J 2DA2A 1FIPA 1IG7A 2FQ4A 1QVTA 3HM5A 5FHPA 1SGMA 5D18A 1D5YA 4A3CJ 1ZKGA 3IH4A 5C4XJ 4L62A 2X6OA 5J1RA 2QCOA 2IU5A 3KKDA 2DJNA 4EEFG 5IYCJ 2KDZA 1ETVA 2FD5A 3BHQA 3A02A 2HKUA 1RR7A 2XB5A 3LSPA 2IBDA 2DN0A 4V2FA 2R93J 4GCTA 2UXOA 1P7IA 2CJJA 2E1OA 2AO9A 2K40A 2DMQA 3B6AA 3HOXJ 1JJ6C 3HKZN 1TWHJ 3IUVA 2NVTJ 4JKZA 2LVSA 4AUXA 1ITYA 2Q24A 1GV2A 5AQCA 2LP0A 2WV1A 1I3QJ 3FK7A 5GPAA 4A3IJ 2QIBA 3ZQHA 3C07A 2M34A 2IEKA 3JR9A 3S1NJ 4ICHA 2HYTA 2DG8A 1QRYA 1ETKA 1JKRC 4A3EJ 1SANA 1MH4A 5IP9J 2UXHA 1OFCX 3AQSA 2KT0A 2L7ZA 3BG3A 3Q0VA 5E3OA 5K7HA 4NELA 1HOMA 1W0UA 3ANGA 4A3MJ 5FKKA 1AKHB 4JX5A 1JUPA 1T33A 3BG9A 5IP6A 1B8IB 1P7JA 3KNWA 2OERA 4D7MA 4C3HJ 2F07A 4DZJA 1YRNB 2CU7A 4RDUA 3CWRA 3VW0A 5M5WJ 2VPRA 3RZOJ 3BR2A 5JLXA 3B81A 3BNIA 4PXIA 2ECCA 2CRGA 2E2JJ 2ID3A 3F1BA 5C4JJ 1WGXA 1FJLA 1XG1A 2WB1N 2COBA 4FE4A 1RESA 2ME6A 1GVDA 2GUHA 1BJZA 2EZLA 2DMPA 3VP5A 2HQ5A 5H9TA 2R7ZJ 2DA6A 3H0GJ 3MKLA 5FKOA 3FRQA 2HYJA 4W1UA 4UUSB 3VOXA 2HDDA 1MBJA 1X58A 2DA7A 3S1MJ 5FKNA 5HAWA 4NDLA 2OI8A 4A3LJ 5K58A 1TWAJ 1U9OA 2O8KA 3P9TA 2W48A 1X2MA 5EF6A 3S1RJ 1QVUA 2R5YA 2JMWA 2EZHA 5J3LA 3RQIA 3MNLA 3HBLA 1WH5A 2RAEA 3JRGA 5F0HA 4MIMA 5K7FA 1ENHA 1WPKA 4XRMA 3GZIA 1LFBA 1Y1VJ 2LKXA 2M9HA 4B3AA 1JUMA 2LD5A 3LNQA 2LFBA 4DYCA 2MG4A 3BTLA 4M3DA 3L1PA 1WI3A 2L9RA 4XRSG 3EUPA 3OIOA 4Y7NJ 3CQZJ 1LE8B 1T56A 1MSFC 2GFNA 2EBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9Q A;  1Q1V A;  2D6Y A;  4GFB A;  3LSG A;  2JK3 A;  2NS7 A;  3SFI A;  1F43 A;  4XRS A;  4GCL A;  2EZK A;  4A69 C;  1XC5 A;  3OSG A;  4UUS A;  2REK A;  1MBE A;  2O7O A;  5IYB J;  2YVH A;  3BQY A;  2JWT A;  1RPW A;  1PUF A;  1HCR A;  3O60 A;  1SFO J;  1APL C;  1MBF A;  2MGQ A;  4BY7 J;  1UHS A;  4MFE A;  2VKV A;  1ZQ3 P;  3TW7 A;  2ELK A;  3GTQ J;  3BCG A;  4D5F A;  3A01 A;  1DU0 A;  3HIM A;  2VUM J;  2GBY A;  3BR0 A;  2PMZ N;  1JJ8 C;  3FK6 A;  4C2M J;  3DEW A;  1GDT A;  4AC6 A;  3KZ9 A;  3LSJ A;  1HF0 A;  3HB9 A;  2N8G A;  4CYC A;  5D19 A;  3NAR A;  5E3M A;  2HXO A;  5M3M J;  2HI3 A;  4XIC A;  2V57 A;  3VVY A;  3VW2 A;  1HDD C;  1JKO C;  3E7Q A;  1GT0 C;  1NTC A;  1ETQ A;  1MBG A;  2DMN A;  2L0K A;  3KKC A;  4HKU A;  1FTZ A;  2HOA A;  2HOT A;  3BR6 A;  2G3B A;  2XRL A;  3B6C A;  4AYB N;  2XB0 X;  1ETO A;  3S17 J;  5FKM A;  2MSY A;  2E2I J;  1ETW A;  1JTY A;  3NNR A;  4BBR J;  4D7N A;  3CRJ A;  3I4M J;  3NI7 A;  3S14 J;  1JUS A;  1CQT A;  2I10 A;  4FIS A;  2DMU A;  3ANP A;  5C4Y A;  5FMP A;  5F27 A;  5J1U A;  4A3F J;  4MLO A;  2DA3 A;  1X2N A;  1OCT C;  2K9N A;  3GBG A;  3JRE A;  4BBS J;  3GTO J;  3GEU A;  2CUE A;  1Z77 A;  2Y30 A;  4IHX A;  2G7L A;  2FX0 A;  3HTI A;  1EF4 A;  2JA7 J;  4M3F A;  2QTQ A;  4UDS A;  2Y2Z A;  4FE7 A;  5EYR A;  3Q0W A;  4HNV A;  5M5Y J;  1DU6 A;  2YUS A;  2XDN A;  5IP7 J;  3BT9 A;  2Y31 A;  5FLV A;  4IHW A;  5EG0 B;  2NVQ J;  2G0E A;  3QPL A;  3JRH A;  2R92 J;  2R5Z B;  3GTK J;  2O9L A;  3IH2 A;  2JN6 A;  1WH7 A;  5GP9 A;  5HOD A;  2XSD C;  3TED A;  4GFL A;  1VF9 A;  3JRI A;  1I6H J;  5HBU A;  3FKI J;  2M0C A;  1MBK A;  2DG7 A;  3BTJ A;  5EZH A;  5EG0 A;  3V78 A;  4V2G A;  5IOY A;  3QBM A;  2Y9Z A;  1TWF J;  3VIB A;  1HLV A;  3NPI A;  3HEF A;  2GLO A;  2VKE A;  1MBH A;  2R5Z A;  2NP5 A;  3PPB A;  1GUU A;  2EH3 A;  3NAU A;  4ABZ A;  2LTP A;  3VW1 A;  2PZ9 A;  3HTJ A;  2VI6 A;  5C3E J;  1LE8 A;  3ZQF A;  3OSF A;  1ORK A;  4MXM A;  5D1R A;  3CDL A;  5E3N A;  4B4C A;  2XPU A;  4GCK A;  3S2D J;  3OOU A;  4BY1 J;  4M3G A;  5FGL A;  1IC8 A;  3BQZ A;  5FJ8 J;  3VVX A;  3BJB A;  3PO2 J;  1QPI A;  1GV5 A;  1RET A;  2YU9 J;  1BW5 A;  2DA4 A;  3FIW A;  1UG2 A;  2QKO A;  3E7L A;  2UXI A;  3VOK A;  2XPV A;  2QOP A;  1NK3 P;  2QWT A;  1ETX A;  3IV5 A;  2JA8 J;  4FTH A;  1K61 A;  2JA5 J;  3PO3 J;  4YZE A;  4C3I J;  4M3E A;  5FLM J;  5F04 A;  2RHA A;  5EZG A;  2OPT A;  2JJ7 A;  2K9S A;  3Q0U A;  4XID A;  3HGG A;  4CYC B;  2ZCM A;  1TWC J;  3G1M A;  3GTL J;  3G7R A;  3V6G A;  2E2H J;  5C44 J;  3VUQ A;  3GTM J;  4L5E A;  2RAS A;  3GTP J;  4CGR A;  3CCY A;  2LK2 A;  2XGD A;  3G1L A;  2R0Q C;  5EDN A;  5EGO A;  1W0T A;  2GM4 A;  1IGN A;  2ECB A;  3JRA A;  2EZI A;  3JRB A;  2ZB9 A;  4S0H B;  5CXI A;  1PUF B;  3PM1 A;  3ZQG A;  3DCF A;  2LY9 A;  4MO7 A;  4LOC A;  1IUF A;  3GTJ J;  4ME9 A;  3RZD J;  4QTR A;  4C3J J;  1VND A;  3TP3 A;  3BR3 A;  2H8R A;  1AKH A;  2QF7 A;  1U8B A;  2FJ1 A;  3HOV J;  2XGE A;  4A3D J;  1A5J A;  3BR5 A;  4UUT A;  1UI6 A;  2UXU A;  5F0F A;  3JSJ A;  4G12 A;  2CQX A;  1IRZ A;  2E19 A;  2O7T A;  4AC0 A;  4XK4 A;  3IH3 A;  3JRD A;  4MK6 A;  2IAI A;  2YVE A;  3HOZ J;  1YRN A;  1TWG J;  4DW6 A;  5J1Y A;  1MNM C;  3SJM A;  1FIA A;  4AF5 A;  1AHD P;  3M3Y J;  3W6V A;  1ZTR A;  3O8G A;  2TCT A;  4A3J J;  2MW8 A;  3QQA A;  3NXC A;  1E3O C;  1K83 J;  2H1K A;  1ZR4 A;  4DYR A;  4MFD A;  1VFC A;  1Z0X A;  4RBO A;  1A6I A;  2NOG A;  1FEX A;  4X1E A;  1HDP A;  5E3L A;  4IHV A;  5JLW A;  3T6N A;  5IPA A;  2XGC A;  5F0C A;  2D5V A;  1ETY A;  2DA1 A;  3S5R A;  3K7A J;  2WGB A;  4KWA A;  3PAS A;  3H3V K;  2P81 A;  1LFU P;  5K7Z A;  1FTT A;  2G7G A;  1JKP C;  2ZOY A;  4M3B A;  3WHB A;  4I6Z A;  5HSZ A;  2X48 A;  4NN1 A;  5F08 A;  3BG5 A;  2HXI A;  4JP0 A;  1ZK8 A;  2JA6 J;  1F36 A;  3ZQL A;  3I4N J;  5GPC A;  1IDY A;  2NP3 A;  3ON4 A;  3G1O A;  3HTH A;  2G7S A;  4A3K J;  3UKG A;  4X6A J;  5EGO B;  3QKX A;  1VI0 A;  1JKQ C;  2TRT A;  2L7M P;  2M8G X;  3HOU J;  3HGY A;  2OF7 A;  3ZOB A;  3S15 J;  1R9T J;  2EQR A;  2NX4 A;  2WAQ N;  4QIW N;  2NS8 A;  3TW6 A;  4A3B J;  1OCP A;  3JRF A;  1RKW A;  3C2B A;  4IHY A;  3LOC A;  2HOS A;  2ID6 A;  2Y0S N;  3CMY A;  1B8I A;  9ANT A;  3QPS A;  5CXG A;  3MVP A;  3LHQ A;  2PBX A;  5EEA A;  1O4X A;  3D1N I;  4JYK A;  5IYD J;  3GTG J;  3VPR A;  3TP0 A;  3HE0 A;  2L7F P;  3CJD A;  3SDG A;  3BTI A;  5M3F J;  3G56 A;  2Y9Y A;  4BXX J;  4B1R A;  3JRC A;  1IV6 A;  4Y52 J;  1U78 A;  1B72 B;  3NRG A;  4JX4 A;  1ZR2 A;  1JGG A;  3O8H A;  2GEN A;  1H89 C;  3F0C A;  2FBQ A;  3S2H J;  3RKQ A;  2W53 A;  2R5Y B;  3BRU A;  3M4O J;  1B72 A;  1TC3 C;  5DS9 A;  3HTA A;  1UMQ A;  4QSH A;  1XS9 A;  4M6V A;  2ZCN A;  2ZCX A;  1OJL A;  3WHC A;  3RH2 A;  3K2A A;  5DAJ A;  4I76 A;  3RD3 A;  3VVZ A;  5F1J A;  1IDZ A;  5IOZ A;  1I50 J;  1RKT A;  4W97 A;  2AHQ A;  1ZGW A;  1BA5 A;  3LJL A;  4GFK A;  1G2H A;  1S7E A;  3LWJ A;  1H8A C;  3HOY J;  4BKX A;  1NK2 P;  1JT6 A;  1BL0 A;  4DYQ A;  1UI5 A;  3EGQ A;  4A3G J;  1JT0 A;  3S16 J;  4D5C A;  2YS9 A;  3ZQC A;  5BNG A;  4JNN A;  2NVX J;  1WCM J;  2DMT A;  2DA5 A;  1MH3 A;  3Q3S A;  3A03 A;  5EFY A;  2B63 J;  4JL3 A;  2ME0 A;  4J19 A;  4ACI A;  3A01 B;  2LLK A;  5FKL A;  3HOW J;  3LSR A;  3FIS A;  2ZOZ A;  2WUI A;  2XPW A;  1BW6 A;  2CUF A;  2LR8 A;  3DPJ A;  1POG A;  1MSE C;  4IEJ A;  3COL A;  4JX6 A;  4FCY A;  3S1Q J;  1IJW C;  2DTZ A;  3BR1 A;  3BTC A;  5M5X J;  2NVY J;  5CW8 A;  2CQQ A;  3ZQI A;  1U9N A;  2M2E A;  3AQT A;  1JTX A;  3MN2 A;  1Y1W J;  5DTD A;  3ON2 A;  2UXP A;  2X9D A;  1H88 C;  4DZP A;  3HDD A;  1AU7 A;  4A93 J;  2DA2 A;  1FIP A;  1IG7 A;  2FQ4 A;  1QVT A;  3HM5 A;  5FHP A;  1SGM A;  5D18 A;  1D5Y A;  4A3C J;  1ZKG A;  3IH4 A;  5C4X J;  4L62 A;  2X6O A;  5J1R A;  2QCO A;  2IU5 A;  3KKD A;  2DJN A;  4EEF G;  5IYC J;  2KDZ A;  1ETV A;  2FD5 A;  3BHQ A;  3A02 A;  2HKU A;  1RR7 A;  2XB5 A;  3LSP A;  2IBD A;  2DN0 A;  4V2F A;  2R93 J;  4GCT A;  2UXO A;  1P7I A;  2CJJ A;  2E1O A;  2AO9 A;  2K40 A;  2DMQ A;  3B6A A;  3HOX J;  1JJ6 C;  3HKZ N;  1TWH J;  3IUV A;  2NVT J;  4JKZ A;  2LVS A;  4AUX A;  1ITY A;  2Q24 A;  1GV2 A;  5AQC A;  2LP0 A;  2WV1 A;  1I3Q J;  3FK7 A;  5GPA A;  4A3I J;  2QIB A;  3ZQH A;  3C07 A;  2M34 A;  2IEK A;  3JR9 A;  3S1N J;  4ICH A;  2HYT A;  2DG8 A;  1QRY A;  1ETK A;  1JKR C;  4A3E J;  1SAN A;  1MH4 A;  5IP9 J;  2UXH A;  1OFC X;  3AQS A;  2KT0 A;  2L7Z A;  3BG3 A;  3Q0V A;  5E3O A;  5K7H A;  4NEL A;  1HOM A;  1W0U A;  3ANG A;  4A3M J;  5FKK A;  1AKH B;  4JX5 A;  1JUP A;  1T33 A;  3BG9 A;  5IP6 A;  1B8I B;  1P7J A;  3KNW A;  2OER A;  4D7M A;  4C3H J;  2F07 A;  4DZJ A;  1YRN B;  2CU7 A;  4RDU A;  3CWR A;  3VW0 A;  5M5W J;  2VPR A;  3RZO J;  3BR2 A;  5JLX A;  3B81 A;  3BNI A;  4PXI A;  2ECC A;  2CRG A;  2E2J J;  2ID3 A;  3F1B A;  5C4J J;  1WGX A;  1FJL A;  1XG1 A;  2WB1 N;  2COB A;  4FE4 A;  1RES A;  2ME6 A;  1GVD A;  2GUH A;  1BJZ A;  2EZL A;  2DMP A;  3VP5 A;  2HQ5 A;  5H9T A;  2R7Z J;  2DA6 A;  3H0G J;  3MKL A;  5FKO A;  3FRQ A;  2HYJ A;  4W1U A;  4UUS B;  3VOX A;  2HDD A;  1MBJ A;  1X58 A;  2DA7 A;  3S1M J;  5FKN A;  5HAW A;  4NDL A;  2OI8 A;  4A3L J;  5K58 A;  1TWA J;  1U9O A;  2O8K A;  3P9T A;  2W48 A;  1X2M A;  5EF6 A;  3S1R J;  1QVU A;  2R5Y A;  2JMW A;  2EZH A;  5J3L A;  3RQI A;  3MNL A;  3HBL A;  1WH5 A;  2RAE A;  3JRG A;  5F0H A;  4MIM A;  5K7F A;  1ENH A;  1WPK A;  4XRM A;  3GZI A;  1LFB A;  1Y1V J;  2LKX A;  2M9H A;  4B3A A;  1JUM A;  2LD5 A;  3LNQ A;  2LFB A;  4DYC A;  2MG4 A;  3BTL A;  4M3D A;  3L1P A;  1WI3 A;  2L9R A;  4XRS G;  3EUP A;  3OIO A;  4Y7N J;  3CQZ J;  1LE8 B;  1T56 A;  1MSF C;  2GFN A;  2EBI A; 
#chains in the Genus database with same CATH topology
 3S3N A;  1XDU A;  2D6Y A;  4HQE A;  2JK3 A;  4XRF A;  2EZK A;  5GTH C;  4GCL A;  3JAM K;  3GZ6 A;  1BIA A;  1MBE A;  2EIM H;  5IYB J;  5CVR A;  2H27 A;  3QU3 A;  4RB1 A;  1RPW A;  3VYS B;  1HCR A;  4CUG A;  1FP2 A;  5B66 C;  5ILU A;  1APL C;  3GLX A;  2MGQ A;  1FOY A;  2KDO A;  3A1Y A;  5D8L B;  2R4G A;  3H35 A;  3F21 A;  2LKS A;  3BY6 A;  3BCG A;  4D5F A;  5E17 F;  1YYV A;  2K02 A;  5JHU A;  3A01 A;  4LK1 F;  3GFJ A;  1Y6I A;  3PSF A;  3SZT A;  2ZNY A;  4E4H A;  4I98 B;  5HOO A;  3KZ9 A;  2YVX A;  2BYV E;  3HB9 A;  5D19 A;  3NAR A;  5LFA A;  3REO A;  3F9K A;  5M3M J;  3S3O A;  3VVY A;  3VW2 A;  3SEQ A;  2HTJ A;  3E7Q A;  2IA0 A;  1GT0 C;  1R36 A;  2E1N A;  1NTC A;  1WRJ A;  3OOP A;  3AL0 B;  2CQK A;  2A05 A;  2QEX I;  2ZME A;  1B6A A;  2NRA C;  4HKU A;  3OY9 A;  2HOA A;  3BZK A;  2VE9 A;  1YI2 I;  3IWF A;  2XRL A;  3HSF A;  2P5K A;  4AYB N;  5CVU A;  2G7H A;  2KIQ A;  1X19 A;  2E1M C;  3B02 A;  4PJN A;  2E2I J;  2Y48 A;  3VYR B;  2QQB A;  1ZLK A;  1W7P D;  3L7W A;  1ZN2 A;  3LA2 A;  2Q8K A;  2IGM A;  3NI7 A;  4XOR A;  4H4K C;  1G3Y A;  1JUS A;  3ZN1 A;  4ESF A;  2RVC A;  4FIS A;  5FRN A;  2VQC A;  2V1N A;  3OR1 C;  2A07 F;  3FKJ A;  2OZU A;  3W2A A;  5FMP A;  4A0Y A;  4PSW A;  3E6M A;  2V26 A;  1X2N A;  5BS6 A;  3DU6 A;  1I1G A;  3JRE A;  4BBS J;  4IRV A;  2WB1 A;  4WIB A;  3ONQ A;  3GTO J;  4PGG A;  2IS6 A;  2OCC H;  4IHX A;  3GF2 A;  4XLA A;  2IS1 A;  3HTI A;  2XC7 A;  1TW2 A;  2X4H A;  4UDS A;  1F5T A;  5JVT A;  1HKS A;  3CF2 A;  2HYF A;  3Q0W A;  3C2H A;  1X3U A;  3DTE A;  2DOD A;  1ERD A;  3I3L A;  2LYC A;  3KP6 A;  3V4G A;  3FDY A;  1Y0N A;  4EJU A;  2M7A A;  4YIF A;  4FET A;  3MZ8 A;  1WJC A;  3QOP A;  1RIO H;  2G0E A;  2M4G A;  4NNJ A;  2XAJ A;  3OYA A;  3JRH A;  1KGS A;  2PBI A;  3EUH C;  2XSD C;  3CC2 I;  4CO8 A;  1VF9 A;  2FNA A;  3DPT A;  3TOB A;  2VOO A;  2M0C A;  3BTJ A;  4ZYG A;  2DPU A;  1DGW Y;  2ICW G;  1XD7 A;  2Y9Z A;  4KMF A;  1F4K A;  1QZY A;  3FXQ A;  2W25 A;  1GVJ A;  3EUK L;  1V5G A;  3HC7 A;  2UXX A;  4P9F A;  1X1D A;  2H6B A;  4F55 A;  4U0Y A;  1N25 A;  1BOB A;  4XSX F;  5EEG A;  3ZQF A;  1AA7 A;  2E34 A;  3A4C A;  2X1D A;  2HOE A;  3CDL A;  2XAU A;  4HYE A;  2BVL A;  2ISY A;  3G2B A;  3K4K A;  4M3G A;  3WGI A;  3CLQ A;  5FJ8 J;  2Z2S B;  5JHF A;  3CUO A;  4CGZ A;  5D8K B;  1BW5 A;  5LGT A;  1WJF A;  3K70 D;  1UG2 A;  1YS6 A;  2QKO A;  3VOK A;  3IP4 B;  3MWM A;  2FNP A;  2X6W A;  4KIT B;  1Y56 A;  5F64 A;  4EVI A;  1M1E B;  3IV5 A;  3KZZ A;  1RUO A;  2JA8 J;  4FTH A;  3WTZ A;  2JA5 J;  4YZE A;  2L9S A;  1JXS A;  2YX4 A;  5EZG A;  2OPT A;  4M9X A;  1T08 B;  1CF7 A;  2HKO A;  3ULQ B;  2ZNZ A;  4XID A;  4XOP A;  3E3V A;  1GXP A;  2M8E A;  2X1E A;  2VLA A;  2ZCM A;  1IW7 F;  4E7H A;  3VUQ A;  2H8W A;  4IRH A;  5C44 J;  1I1S A;  2DCE A;  1VQ5 I;  3GTP J;  3G1L A;  3Q5F A;  5EGO A;  1HXD A;  2RQQ A;  4HF0 A;  5AIP A;  1IGN A;  3AFH A;  4AM3 A;  2ZB9 A;  2OUM A;  5CXI A;  3MZY A;  2A3S A;  1DP7 P;  1XGN A;  1W1W E;  2XAF A;  4BQQ A;  4MO7 A;  5HNF A;  1ACI A;  2M30 A;  3GTJ J;  3RZD J;  4KIB A;  1W7P B;  1BJA A;  2ELH A;  1OR7 A;  1VND A;  3H92 A;  4C3J J;  1N77 A;  3NWS A;  4TV7 A;  2H8R A;  3JSO A;  3FZV A;  1K78 A;  3HOV J;  4LB5 A;  3P5J A;  2P5V A;  1XTA A;  3E6C C;  4OIR F;  4XL9 A;  2JA2 A;  1A5J A;  3BR5 A;  2CS3 A;  1Q1H A;  1UI6 A;  5F0F A;  2UXU A;  3JSJ A;  3KEQ A;  4G12 A;  5ED4 A;  1J59 A;  4XK4 A;  2HZT A;  4JQF A;  2VQL A;  4L9N A;  2Q0O A;  3DBH B;  1TWG J;  3QOE A;  3M3Y J;  3A2K A;  3W6V A;  2DT6 A;  1ZTR A;  1U2W A;  1J5Y A;  4N0B A;  1E3O C;  1K83 J;  1ZR4 A;  4DYR A;  5IT3 A;  1U5T B;  3CO7 C;  4JBA A;  4MFD A;  2DO7 A;  5ICG A;  2NOG A;  4HZF A;  4A0X A;  1HDP A;  2F5F A;  2KIM A;  1HW1 A;  2UZK A;  1C0W A;  2V1U A;  2HKX A;  3T6N A;  4X0G A;  1UJ8 A;  2K86 A;  2J5O A;  2LY1 A;  4ZZL A;  2AXT C;  2QKM B;  5LEJ A;  3HRT A;  1ETY A;  4M6Y A;  4CCJ A;  4F7Z A;  1QNT A;  3WU0 A;  5LHG A;  3G3Z A;  3I71 A;  4RB0 A;  1LFU P;  5HVQ C;  2EIN H;  1FTT A;  2CV2 A;  5ERI A;  4AIJ A;  2R7Q A;  4M3B A;  3HXL A;  3WHB A;  3CCU I;  1OPC A;  2X48 A;  2O61 A;  3AL0 C;  3TGN A;  3RJP A;  2RQP A;  4JP0 A;  4Y33 A;  2NP3 A;  4HF1 A;  3G1O A;  4GYI A;  2GOM A;  3HTH A;  5LHI A;  4IJA A;  2JVH A;  5L3G A;  1BR4 A;  5F6F A;  1A35 A;  5CYV A;  2M45 A;  1A6Q A;  2XAQ A;  4M9Z A;  1VI0 A;  4M6X A;  2OF7 A;  1R9T J;  3L2C A;  1FP1 D;  1WI9 A;  2WAQ N;  3CJR B;  1V5E A;  1B59 A;  1YHQ I;  4RA2 A;  2O6G E;  2KLO A;  1VQ7 I;  2PFB A;  2DDA A;  3KP4 A;  1AOY A;  3AG1 H;  1QQI A;  4XLN F;  4II2 A;  1D0Y A;  1REP C;  1O4X A;  3D1N I;  1XMX A;  1XDS A;  2XDV A;  1FBS A;  3GTG J;  2O8X A;  3ZQ7 A;  3VPR A;  3TP0 A;  3K4L A;  4AIK A;  3BTI A;  4MEX F;  3G56 A;  4RM2 A;  2A5W A;  4BXX J;  1TP4 A;  1VQ8 I;  3J7A Y;  2E1M B;  2K4J A;  2YSR A;  4BDY A;  1U78 A;  1B72 B;  3D5R C;  3MQ0 A;  4ZYE A;  1HC8 A;  3HPH A;  2W4S A;  3OYI A;  2GEN A;  1Z9C A;  4ZDL A;  2OU2 A;  1I5Z A;  2VON A;  4XLF A;  2VOD A;  2W53 A;  1R1U A;  2ZBK A;  4HBL A;  4XQF A;  2DU9 A;  5FD5 A;  2DI3 A;  3M4O J;  1DP3 A;  1LDJ A;  2KPM A;  5DS9 A;  2CV0 A;  4KN7 X;  3IKT A;  3HTA A;  4QSH A;  5KK1 A;  2ZCX A;  4M6V A;  2F4I A;  2VE8 A;  4I76 A;  3SZG A;  4ON0 A;  3VVZ A;  5F1J A;  3HTS B;  5IOZ A;  3ASN H;  1BA5 A;  5HS8 A;  2JPB A;  4PJM A;  1S7E A;  3C18 A;  4DIQ A;  3HOY J;  1NK2 P;  2P7V B;  1JT6 A;  4QWQ A;  1TZL A;  4UV8 A;  4KT5 C;  2HR3 A;  1UI5 A;  4A3G J;  4D5C A;  2YS9 A;  3ZQC A;  5JR3 A;  4JNN A;  4EM1 A;  1RRJ A;  2WV0 A;  1TBX A;  2DA5 A;  4MTD A;  3Q3S A;  2FOK A;  5EFY A;  5CKT A;  3OYH A;  3ABT A;  3V42 A;  2R7F A;  1ULY A;  1S6L A;  1PP7 U;  3HOW J;  2ZOZ A;  2HYG D;  1W5S A;  2XPW A;  2QVO A;  1W36 C;  4CSW A;  4EAT A;  2BY2 A;  2BOL A;  1XMK A;  4PDK A;  2KRH A;  3OL4 A;  4FCY A;  3S1Q J;  3OR2 C;  3DKW A;  3K4J A;  3H0D A;  1P9Q C;  3DBR B;  3CCR I;  3BR1 A;  2CQQ A;  1I27 A;  3ZQI A;  1JGS A;  1MMG A;  4LGW A;  5DTD A;  1Y1W J;  3RPQ A;  3K9T A;  4WWC A;  3GZN B;  4XBF A;  4BAY A;  4HST A;  4KIF A;  5CLS A;  2FQ4 A;  1OIS A;  1SC7 A;  2W84 A;  2QA4 I;  2DW4 A;  1D5Y A;  3IH4 A;  2PMU A;  1LFP A;  2X6O A;  2H94 A;  1MNE A;  1ETV A;  5DM7 F;  2XB5 A;  4EGZ A;  4V2F A;  3P9C A;  4D9J A;  1E2X A;  1IN7 A;  1GXQ A;  4HEA 2;  1WFX A;  4BS9 A;  2ZXW H;  4B47 A;  4CDG A;  1BN5 A;  1JJ6 C;  1ZGJ A;  3IUV A;  2A6H F;  5JVG F;  2WV1 A;  1J09 A;  1I3Q J;  2QIB A;  4A3I J;  1ZEL A;  4UXN A;  2IEK A;  3JR9 A;  3SEZ A;  3HSE A;  3ERE D;  3S1N J;  1ODD A;  1K6O A;  3BLY A;  1S8N A;  3V8J A;  3PFI A;  1UZC A;  3RKY A;  2FBH A;  5IP9 J;  3F23 A;  1VQK I;  3BG3 A;  2BY1 A;  2MLK A;  3I0T A;  4PUS A;  2DFE A;  1HOM A;  2DDB A;  3ANG A;  1K78 B;  2UUZ A;  1YG2 A;  2FEZ A;  2F2E A;  3KNW A;  1PDN C;  2OTJ I;  4D7M A;  3HG9 A;  4DZJ A;  1YRN B;  2CU7 A;  2CQ7 A;  3ZMD A;  2ACJ A;  5M5W J;  2VPR A;  1TL8 A;  3VYT B;  3I59 A;  1IXR C;  3BR2 A;  5JLX A;  1BR2 A;  3KIO A;  3WU2 C;  4HV6 A;  2XAH A;  2ID3 A;  2NVU B;  1TQM A;  1MIJ A;  2BV6 A;  3ABK H;  2JUG A;  3H9J A;  3LQR A;  5GAD J;  1FJL A;  1XG1 A;  2WB1 N;  2ZO4 A;  2WAD A;  4E7L A;  2ME6 A;  1GVD A;  4NC6 A;  4IVN A;  2DT5 A;  2GZW A;  2A61 A;  4XKV A;  4XM3 A;  4BDZ A;  3KP7 A;  4N4O B;  4BYY A;  2OD5 A;  2GXB A;  4ZYH A;  1RC9 A;  2E36 A;  3MKL A;  2G9W A;  4XOT A;  4W1U A;  5FKO A;  3J7Z I;  5JI6 A;  4KIC A;  3DKY A;  3VOX A;  2HDD A;  4YII A;  1OYY A;  5FKN A;  5HAW A;  5FFZ A;  1KQ9 A;  3A0B C;  3KEY A;  1FOX A;  3L2Q A;  2J5P A;  1YX5 A;  3RQ4 A;  2BXY A;  3FXU A;  2D45 A;  3PNY A;  1KZH A;  1SD6 A;  4HPQ A;  2L4A A;  4LIT A;  3JRG A;  3FXL A;  1ENH A;  1WJ5 A;  2L3D A;  3K8P C;  3GZI A;  1LFB A;  2ESN A;  2R7T A;  2M9H A;  3LNQ A;  4MEY F;  2P4W A;  3L1P A;  3JCU C;  3EUP A;  2LF7 A;  2VB6 A;  1U3E M;  2JSC A;  3FBI B;  2EBI A;  2K9Q A;  4GFB A;  2HPI A;  2GXA A;  4G6D A;  3OL3 A;  4XRS A;  4FAS D;  2BY0 A;  1R7J A;  4V19 K;  2KIF A;  2JWT A;  1PUF A;  2LSO A;  1SFO J;  1P92 A;  4D1Q A;  3RPU D;  4P9U A;  4A6E A;  4BY7 J;  4RS8 A;  2FOW A;  1CF7 B;  4XON A;  1R22 A;  2BEO A;  2VKV A;  3CZ6 A;  1ZQ3 P;  1LDK B;  3IAM 2;  4WXD A;  3C3W A;  1E17 A;  2DFI A;  3GCM A;  1ON1 A;  3I9V 2;  2VUM J;  3F8F A;  3TMO A;  4LG0 A;  3FK6 A;  3DEW A;  1GDT A;  1OCO H;  3RYR A;  4A6D A;  2N8G A;  4CYC A;  1XSX A;  2M5W A;  2O03 A;  4NC8 A;  4ZDO A;  4KN4 X;  1KU2 A;  2HI3 A;  4G8X A;  5K5O A;  1JKO C;  2IVM A;  4NHJ A;  2DLL A;  1MBG A;  5LBQ A;  3SHF A;  1YFH A;  1BOA A;  1HW2 A;  3B6C A;  1T6S A;  2XB0 X;  5BPD A;  5D5U B;  2CFX A;  2EWN A;  3S17 J;  5FKM A;  2MSY A;  1ETW A;  3FM3 A;  5DYM A;  4RAY A;  4BBR J;  3NNR A;  3CRJ A;  5EJC A;  1HBX G;  2ZME C;  2PJP A;  2EIJ H;  3ANP A;  4ZDP A;  5F27 A;  2RRE A;  2JRM A;  2R7D A;  1HSJ A;  2DA3 A;  1OCT C;  3GBG A;  3I55 I;  2GIZ A;  3M9A A;  3GEU A;  1YJ9 I;  2CUE A;  1L3L A;  4BQA A;  2LOO A;  3J80 K;  1X1B A;  4IL6 C;  2MD5 A;  2FX0 A;  3CMA I;  1EF4 A;  3ELK A;  5HDK A;  2JA7 J;  3BRO A;  1P4A A;  2IW5 A;  3BDD A;  4M3F A;  3T8T A;  1OYW A;  4OIP F;  1WWX A;  5M5Y J;  3K6G A;  2IGK A;  2NAZ A;  4HNV A;  4CHU A;  2QBY A;  2GWR A;  4A5N A;  3BT9 A;  2W57 A;  4UV9 A;  5FLV A;  2F48 A;  5EG0 B;  5HNH A;  3G71 I;  3RIR A;  4C2U A;  3QPL A;  2C6Y A;  5KCM A;  4D0P A;  2XKO A;  1FT9 A;  3KFW X;  4YEJ A;  5GP9 A;  5HOD A;  4U7B A;  1S7O A;  1I6H J;  3JRI A;  3VEP A;  1MBK A;  1IN6 A;  2LRE A;  1VQ4 I;  3V78 A;  4V2G A;  3HL2 A;  1MND A;  2DK5 A;  2W00 A;  2R7W A;  3NPI A;  3LAJ A;  3PPB A;  1GUU A;  2EH3 A;  2QLZ A;  1QHH D;  1U5T C;  2PZ9 A;  2VI6 A;  2P6T A;  1XSD A;  2R7O A;  2KRF A;  3OSF A;  4UUV A;  1ORK A;  2G7U A;  2VC1 A;  4MXM A;  5GAG J;  3CCM I;  2VJ4 A;  3G6E I;  2XPU A;  4GCK A;  2ZME B;  3T8R A;  3OOU A;  4BY1 J;  3GXO A;  5FGL A;  1IC8 A;  2FBK A;  3PIO F;  2EA2 A;  1KA8 A;  3CDI A;  3N05 A;  2XGX A;  3FXJ A;  4EJO A;  3BQZ A;  3F72 A;  1QA6 A;  1IO2 A;  4EMS A;  3K10 A;  3PO2 J;  2YU9 J;  1NG6 A;  4YFN F;  1MDM B;  2UXI A;  1QGP A;  1NK3 P;  1Z6T A;  2QWT A;  1WZ2 A;  1K61 A;  3DV8 A;  4LK0 F;  4C3I J;  4MHG A;  1WJE A;  4M71 A;  5FLM J;  4E7K A;  5F04 A;  2M3A A;  3OYE A;  2RHA A;  4UB8 C;  4OU0 A;  3VDX A;  3HUG A;  1J7K A;  2K9S A;  4CCM A;  2CV1 A;  1JI8 A;  1UHM A;  3FMS A;  4CYC B;  3GWZ A;  3G1M A;  1W7P A;  4FX4 A;  3G7R A;  5ICE A;  2E2H J;  3GTM J;  3GFM A;  2RAS A;  2LK2 A;  3O3K A;  1H0M A;  2XGD A;  1W0T A;  1LPQ A;  3JRA A;  3U2R A;  1IUY A;  3JRB A;  1IN5 A;  2FUG 2;  1SFK A;  2KP6 A;  3R61 A;  4S0H B;  4RB3 C;  3IKV A;  3DCF A;  2NS0 A;  2LY9 A;  3CD6 I;  4P55 A;  2CMP A;  1Z3Y A;  4Z2Y A;  3BR3 A;  3M8J A;  5FB2 A;  4WXC A;  1U8B A;  2FJ1 A;  1AKH A;  1K4T A;  1BI0 A;  4A3D J;  1U6G A;  3TL4 X;  4MNU A;  3GVA A;  2CQX A;  4JK1 X;  2O7T A;  4AC0 A;  1OCC H;  3JTH A;  5B5E C;  2IAI A;  4PJJ A;  4Z6Y A;  1ZGA A;  4EM2 A;  5FLX K;  1MNM C;  4AF5 A;  1FIA A;  3WTX C;  4A3J J;  2EV5 A;  1J9I A;  3BWG A;  4DQ2 A;  4IRG A;  2IS2 A;  3UNG C;  3NXC A;  3ERM A;  2ZY9 A;  1Z0X A;  1G3W A;  4HG2 A;  3OYC A;  3H9Q A;  4RBO A;  4IQJ A;  1A6I A;  1LKX A;  1MW7 A;  1Z7L A;  3C7J A;  1FEX A;  2P5L C;  3I53 A;  2CFO A;  4RAZ A;  3WE3 A;  2R7V A;  3OV8 A;  5LRS A;  5IPA A;  2PMZ A;  3CO6 C;  5F0C A;  4HX4 A;  2DA1 A;  3HZJ A;  2QQA A;  4BNC A;  3HJE A;  2WGB A;  2VPL A;  3H3V K;  3PAS A;  1QO0 D;  2P81 A;  3OYN A;  5L3D A;  3ZMU A;  4BJT A;  1IRX A;  4ENK A;  5HSZ A;  2BE5 F;  2QSH X;  5F08 A;  4CYD A;  3BG5 A;  2MD0 A;  3O6B B;  3DBL B;  1ZK8 A;  1MJB A;  2FA5 A;  1TNS A;  2CG4 A;  1FMW A;  3M7G A;  4U9L A;  4HRI A;  1XMA A;  3QKX A;  2M8G X;  4BJ6 C;  1RUN A;  5D6E A;  3ZOB A;  2B1E A;  3LSH A;  2BZT A;  4AYB A;  2OTL I;  3M1C A;  3E6B A;  1RKW A;  2Z3Y A;  1SD5 A;  1R00 A;  5DD8 A;  5DM6 F;  1MDM A;  2HOS A;  4PK4 A;  4Q4Z F;  3CMY A;  1B8I A;  4PFP A;  3J81 K;  9ANT A;  3VSL A;  5CXG A;  4WXH A;  3L2R A;  1N78 A;  3ASO H;  3I5U A;  1Z05 A;  3PQJ A;  5IYD J;  4Y4R A;  4ZTJ A;  3HE0 A;  2L7F P;  4M73 A;  2ZC2 A;  3SDG A;  4BGD A;  2IP2 A;  5M3F J;  3KE2 A;  2V4J C;  4O6J A;  5D4S A;  1E3P A;  2MAB A;  3KEO A;  1IV6 A;  2X6X A;  2K3F A;  1O3Q A;  2R3S A;  3K4B A;  5CJ9 A;  3NRG A;  4JX4 A;  2GIV A;  4I7H A;  2UWM A;  1JGG A;  3W3C A;  3QPH A;  1JE8 A;  2W7N A;  2M87 A;  3RKQ A;  2FF4 A;  2VBX A;  3LSK A;  2R5Y B;  3BRU A;  4I0A A;  3BZC A;  4KUM A;  4HDU A;  1TC3 C;  1G59 A;  4WCG A;  1UMQ A;  1OJL A;  1IDZ A;  1FBU A;  2LF8 A;  1I50 J;  1RKT A;  1ZGW A;  3LJL A;  1TTY A;  2CSO A;  3E1S A;  3S3M A;  1B9N A;  3DPU A;  5E1Z B;  5DUI A;  4PSX A;  1O7L A;  3EGQ A;  5BQT A;  1G6N A;  3GFL A;  5DDG A;  5BNG A;  1BI2 A;  5B1B H;  1YO5 C;  1R1T A;  5GAE J;  2L54 A;  3L09 A;  1MH3 A;  3MKW B;  2DJI A;  3A03 A;  3ZRG A;  2WY8 Q;  1P6R A;  4OMY A;  4JL3 A;  2LLK A;  5FKL A;  4OMZ A;  3F22 A;  2PX9 A;  1SFX A;  1QPM A;  2LR8 A;  1Y8Q B;  3L2W A;  1POG A;  1MSE C;  1UG0 A;  2QBY B;  2A68 F;  4Y17 A;  1R58 A;  1FNN A;  2JPC A;  4BXF A;  2HQA A;  1UAA A;  1J0R A;  3BTC A;  3GLL A;  2NVY J;  2ZJQ F;  1NHA A;  4II3 A;  4B8X A;  2M2E A;  3MN2 A;  3OYJ A;  3QRF F;  3M1E A;  3DLL F;  2X9D A;  4ZYA A;  2W82 A;  4C2T A;  3W6K B;  1SFU A;  4A93 J;  2MC4 A;  1IG7 A;  4O3M A;  1XGO A;  2QQ8 A;  3SFZ A;  3L2U A;  1SGM A;  3M8F A;  1JHH A;  4A3C J;  5BMZ A;  4L62 A;  1KYZ A;  2EB7 A;  2QCO A;  4LLG F;  2CW8 A;  2IU5 A;  2DOA A;  2L9N A;  3S2W A;  4UVA A;  1ZRC A;  3EDP A;  3BHQ A;  3TDZ C;  3AG4 H;  3HIF A;  3OS1 A;  3HSR A;  4HDV A;  2V9K A;  2DN0 A;  5LHH A;  1P7I A;  2AS5 F;  2F5V A;  2LRD A;  3GYH X;  1R4M B;  2AO9 A;  2K40 A;  2ZXH A;  3HOX J;  1FYL A;  1TWH J;  3ABL H;  2NVT J;  4JKZ A;  2LVS A;  5H20 A;  2B0L A;  2LP0 A;  2QEN A;  3K70 C;  3C07 A;  1W5T A;  3EYY A;  5GPA A;  4B09 A;  2M34 A;  4CCK A;  1Z21 A;  3F8C A;  4IOC F;  1VQN I;  1Y8R B;  3HHG A;  1LUJ B;  2JTV A;  3H3Z A;  3DTK A;  3K4C A;  5E1X A;  3AQS A;  2DPD A;  2L7Z A;  2JZY A;  2HEO A;  4BHC A;  1PVE A;  3BZ6 A;  5FKK A;  1AKH B;  4EQQ A;  1T33 A;  3BG9 A;  2LKP A;  4LFU A;  5BPI A;  2OER A;  4O5V A;  3SZP A;  4PCQ A;  1AWC A;  2ZXI A;  1MMD A;  1F1Z A;  5LGN A;  3W2V A;  2I8D A;  3LA7 A;  3BNI A;  2CRG A;  2E2J J;  3F1B A;  2DYR H;  5C4J J;  3MMY B;  2MFZ A;  2ZJP F;  2COB A;  1OYI A;  1RES A;  4FE4 A;  4H0E A;  1Y39 A;  2EA4 A;  2DFF A;  1IN4 A;  2HQ5 A;  3U1K A;  1RI7 A;  4OIQ F;  3H9G A;  5H9T A;  2R7Z J;  1BI1 A;  1UB9 A;  5FFX A;  1X58 A;  4CZZ A;  4M74 A;  3KYL A;  1IXS B;  3DF8 A;  5AIQ A;  4A3L J;  1XGS A;  1D8J A;  1TWA J;  3VSK A;  3RI4 A;  2W48 A;  4CA0 A;  3LSI A;  5EEH A;  2HVR A;  1U5T A;  5HLI A;  5J3L A;  5ICC A;  3WGG A;  5FRM A;  3MNL A;  1K7A A;  1I39 A;  3WTU C;  2HVS A;  2VBY A;  3HUG B;  2H1L A;  4F3Q A;  2CO5 A;  2K85 A;  1WPK A;  4GGG A;  2D1H A;  2HNH A;  1Y1V J;  3MAJ A;  2E7X A;  5J47 A;  4B3A A;  1B4A A;  1JUM A;  2XIG A;  2LFB A;  4DYC A;  3BTL A;  3DU5 A;  3BJA A;  3GX4 X;  1T39 A;  3LMM A;  1D5V A;  2E60 A;  3V7C A;  3OIO A;  3R6S A;  3NRV A;  3K2Z A;  3E0J B;  2PG4 A;  3OIP A;  2X6Y A;  3UR3 C;  2FJI 1;  4DVY P;  1STZ A;  4A0Z A;  2NS7 A;  3SFI A;  4A69 C;  5ILV A;  4IHT A;  4KMU X;  1YTY A;  2ZFW A;  3MKY B;  1DGR M;  3VOE A;  2K7L A;  1R49 A;  3VB2 A;  1MBF A;  1UFM A;  1X1P A;  2EJR A;  4Y3O A;  1LEB A;  2W85 A;  1FYK A;  2EFN A;  2EK5 A;  1WKM A;  1YLF A;  1MMS A;  4AID A;  3TW7 A;  2ELK A;  3GTQ J;  2KFD A;  3AKZ A;  4G7O F;  2KIS A;  4HLX A;  5DCM A;  1X1A A;  3FX3 A;  3V8K A;  4XLP F;  4KT6 A;  3TQN A;  5BOX A;  1WVR A;  1DU0 A;  3HIM A;  2UV1 A;  4U9N A;  1JJ8 C;  4C2M J;  4F52 A;  4U0W A;  4AC6 A;  2ESH A;  2Z5U A;  3K1P A;  3LSJ A;  1F9N A;  1HF0 A;  1KYW A;  1V5F A;  3KP5 A;  5E3M A;  1W5C C;  1U8R A;  4Y13 A;  2HTS A;  2HXO A;  4XIC A;  1PP8 F;  2QUF A;  2EFQ A;  1HDD C;  3FHN A;  5TIS C;  3VWB A;  3HHH A;  4E7S A;  1ETQ A;  2DMN A;  2L0K A;  4BJ5 C;  3KKC A;  1B9M A;  3QPT A;  2HOT A;  3BR6 A;  2G3B A;  3COA C;  4N4N B;  1LEA A;  1MMN A;  4CCL A;  2FSW A;  4DBR A;  4OD4 A;  4LB6 B;  4F93 B;  5CPR B;  2Y69 H;  2RNJ A;  1LVK A;  3K4N A;  1RR8 C;  3I4M J;  1CQT A;  2H09 A;  2DYS H;  1J75 A;  2ADU A;  5J1U A;  1X4O A;  1R5I D;  4EV0 A;  4BAC A;  5HDG A;  4XLE A;  1B1B A;  3ZMT A;  1A31 A;  3QP5 A;  3ABU A;  3CMM A;  3QWL A;  3B73 A;  4CCO A;  1K4S A;  2OZ6 A;  1G8X A;  2HDC A;  2PJR B;  2GA1 A;  4UB6 C;  4AIH A;  2NXN B;  2Y75 A;  3LWF A;  1DU6 A;  2DQR A;  2XUB A;  1Z1D A;  2IJL A;  2YX7 A;  2OCE A;  1T2K A;  4IHW A;  3L2V A;  2HS5 A;  1ZG1 A;  2FQ3 A;  5LD2 C;  2Z99 A;  1G3S A;  1UEL B;  2JN6 A;  1O57 A;  1WH7 A;  2TDX A;  4OAY A;  4GFL A;  1IRG A;  2V1D A;  3FKI J;  4U0V A;  3KYD B;  2DG7 A;  5EZH A;  4A5M A;  2GAU A;  5D4R A;  4ESJ A;  1X1C A;  2KZG A;  4YIR X;  1SMT A;  1TWF J;  3TO9 A;  1Z3X A;  3HEF A;  2B9S A;  3PL8 A;  2VKE A;  1MBH A;  4ZH4 F;  2NP5 A;  4P96 A;  1UCR A;  4PJL A;  3QOD A;  3NAU A;  4ABZ A;  3VW1 A;  2LG4 A;  3HTJ A;  1QHG A;  4IX7 A;  1LE8 A;  3RPU A;  4G7Z F;  3WTT C;  4LD5 A;  2CYY A;  3ECH A;  3H36 A;  2L5Q A;  1OQY A;  1EV7 A;  2O3F A;  2BBY A;  1O7F A;  3S8P A;  3VVX A;  3P7N A;  3BJB A;  1QPI A;  1GV5 A;  1RET A;  1OCZ H;  2YPR A;  1DDN A;  2DA4 A;  3HRM A;  4F91 B;  3FIW A;  2VBZ A;  3E7L A;  2KHM A;  2XPV A;  2QOP A;  3K4M A;  5E79 C;  4I99 C;  2FXA A;  3PO3 J;  3BP8 A;  5CVJ A;  1A36 A;  2V1X A;  1G3T A;  2F4M B;  4YFK F;  2JJ7 A;  5HLH A;  2DBB A;  3KX2 A;  1VQM I;  4L5I A;  2LBF B;  4UY8 I;  1TWC J;  3QYB A;  4G6Q A;  4HX7 A;  2HZD A;  4B48 A;  2ISZ A;  3H1C A;  4NB5 A;  4CGR A;  2AQF A;  2R0Q C;  2ECB A;  5L3B A;  1FYM A;  3GME A;  2EZI A;  4MGR A;  3IHU A;  5D6F A;  4QLC U;  1BBY A;  3ZQG A;  4EJT A;  3ECO A;  4LOC A;  4IHS A;  1IUF A;  4HV5 A;  4QTR A;  5H6R A;  3PQK A;  1OLT A;  1WJD A;  1S72 I;  4HX8 A;  2QF7 A;  2XAG A;  1ZG5 A;  5DD4 A;  2XGE A;  4ZC3 A;  2PFV A;  4UUT A;  3ZMV A;  4CH7 A;  4IZZ A;  1IRZ A;  2KZV A;  2E19 A;  2NYX A;  4LG3 A;  5E1W A;  3I59 B;  3PUB A;  3GEZ A;  1ZH5 A;  4IF4 A;  2YVE A;  3HOZ J;  1YRN A;  4DW6 A;  5GTI C;  1UST A;  1XB4 A;  3O8G A;  1E0E A;  1ZYR F;  4RGS A;  2MA3 A;  2MW8 A;  3G4S I;  2H1K A;  3KP2 A;  2PI0 A;  2OQG A;  5FO5 A;  4RGR A;  2E35 A;  4XMY A;  3LST A;  1K6Y A;  2OQR A;  2RV8 A;  3HOT A;  3CCV I;  4X1E A;  3TDU C;  2QZ8 A;  1WSU A;  1OMI A;  3D5L A;  4U7D A;  4EJV A;  5JLW A;  1MD0 A;  6PAX A;  2XGC A;  1GHC A;  2D5V A;  2VQH A;  1XSV A;  2MH2 A;  5AON A;  3CP8 A;  3WTS C;  3S5R A;  4B3X A;  2HWV A;  4KWA A;  2QYO A;  1N75 A;  3T0Y A;  3BJO A;  2ZKZ A;  2BGC A;  4PGH A;  4E6K G;  5K7Z A;  5B3S H;  3CCL I;  2G7G A;  2VC0 A;  4ZTF A;  4I6Z A;  4NN1 A;  1FY7 A;  2MLG A;  3CJQ B;  1F36 A;  2JA6 J;  3I4N J;  4G7H F;  1IDY A;  4HSR A;  1KU9 A;  3WTW C;  2G7S A;  4L0Z B;  3VOD A;  2F5E A;  4X6A J;  5EGO B;  3C2G A;  4XLC A;  1D1B A;  2RKH A;  2TRT A;  1FLI A;  3GO5 A;  4E7I A;  4A12 A;  1Z67 A;  2Q1Z B;  4I2O A;  2EQR A;  3S15 J;  2VJI A;  2XF5 A;  4QIW N;  3CDH A;  3TW6 A;  4A3B J;  4BQN A;  1OCP A;  2QQ9 A;  3C2B A;  2HFH A;  4IHY A;  3LOC A;  4LLN A;  2Y0S N;  5CQG A;  1YJN I;  3WE2 A;  2XSJ C;  4CZC A;  2ZJR F;  2ETH A;  3OWT A;  2GQQ A;  2VOP A;  3X2Q H;  3RKX A;  5EEA A;  2QWW A;  3LSM A;  4RAF A;  2M0M A;  2Y0S A;  1BR1 A;  1GLN A;  1ZAR A;  3K69 A;  5J40 A;  1ZHF A;  3ZMZ A;  3JRC A;  3H5R A;  2KL4 A;  2R7S A;  3L00 A;  2NOJ B;  3CUQ C;  2P7C B;  3O8H A;  3F0C A;  4AWX B;  1D3Y A;  1YIT I;  1YIO A;  5K1Y A;  1MKM A;  2QGU A;  2FBI A;  1B72 A;  2XAS A;  3AAF A;  2EV0 A;  4CXF A;  3SQN A;  1XS9 A;  2ZCN A;  1T8I A;  3RH2 A;  1UHW A;  3RD3 A;  3RDI A;  3JW4 A;  4IQ4 A;  2AHQ A;  4P1W A;  1G2H A;  3LWJ A;  1H8A C;  4RMN A;  3ZCO A;  3F3X A;  1JT0 A;  4DNC A;  1D1A A;  3CLO A;  3IUO A;  3D5S C;  3KZY A;  3V8L A;  1WCM J;  4XR6 A;  5J4Y A;  2CUJ A;  2DMT A;  2DOF A;  1DPR A;  3QP6 A;  1SVO A;  3GFI A;  3HTU A;  1WHU A;  3MD2 A;  5FD6 A;  2ME0 A;  1MJA A;  4EM0 B;  3K0L A;  1SAX A;  3LSR A;  1YE9 A;  2WAF A;  2FRH A;  2CUF A;  4BH9 A;  1VQ6 I;  1IZ1 A;  3COL A;  1LDD A;  2PLY A;  4JX6 A;  2CUZ A;  3ZP5 A;  1FZP B;  3RCO A;  1IJW C;  1IN8 A;  3F6V A;  2Z33 A;  5M5X J;  1FOK A;  2PJR A;  4C2M A;  3I58 A;  1U9N A;  2JRT A;  4B43 A;  4ME9 A;  3AQT A;  1ZG3 A;  2EPF A;  3ON2 A;  2UXP A;  1H88 C;  3FXK A;  3HDD A;  1I6X A;  1X3W B;  2K9M A;  4C9Y A;  4DGW B;  5ICF A;  4XLH A;  5LLQ A;  2LDU A;  2W24 A;  3ESW B;  1FIP A;  3MEX A;  1ON2 A;  4DBQ A;  1QVT A;  2DK8 A;  1V3F A;  4KFC A;  5FHP A;  4L18 B;  5KVR A;  4CIC A;  5D18 A;  4KIS A;  1ZKG A;  1S7A A;  3DTI A;  4EEF G;  3Q9S A;  4IO9 F;  2FD5 A;  1S5L C;  4G6T B;  1H9T A;  5E18 F;  2IGO A;  2IBD A;  5LRR A;  2R93 J;  4HF2 A;  2UXO A;  3U9G A;  4S05 A;  4BQO A;  1TW3 A;  3R60 A;  3DXJ F;  5E8G A;  4KYW A;  4AUX A;  5HDN A;  2Q24 A;  1GV2 A;  3OYM A;  3FK7 A;  2L02 A;  3TKY A;  2A69 F;  2DQL A;  1Z6R A;  2GXG A;  3BCB A;  4L9J A;  4ESB A;  2HYT A;  4ICH A;  1QRY A;  1ZAO A;  4AU7 A;  4QPQ A;  2HPM A;  1SAN A;  3HPG A;  1WJA A;  2K4B A;  2KT0 A;  3IAS 2;  3Q0V A;  3OYB A;  3T5X A;  5K7H A;  4A3M J;  2B7E A;  2F6C A;  2VJ5 A;  3DLA A;  4KJZ A;  5IP6 A;  2WY7 Q;  2CW0 F;  3E5U A;  3CJT B;  1B8I B;  3OS0 A;  3EPZ A;  1SFE A;  2V9V A;  4RDU A;  5FGM A;  1ZRE A;  3TOA A;  3RZO J;  4PXI A;  3BC8 A;  4ENM A;  1K79 A;  1KQ0 A;  2ECC A;  4C30 A;  2R7X A;  4LLL A;  2V79 A;  2HVQ A;  1WGX A;  4I01 A;  1HQC A;  3U1D A;  2RN7 A;  5IT9 Z;  3KP3 A;  5D5W B;  3FHZ A;  4LG0 B;  4OD5 A;  2GUH A;  2PEX A;  2EZL A;  1EKE A;  1YW9 A;  3S93 A;  3T1B A;  2VT3 A;  3ZPL A;  4IXA A;  3FRQ A;  2DA6 A;  5DCF A;  3J80 Z;  3MKZ A;  2B3W A;  2VKH A;  1MBJ A;  3S1M J;  5A2Q K;  3RKW A;  4AD9 A;  3OYG A;  2OI8 A;  2AQE A;  2VXZ A;  4HAM A;  1FBQ A;  1U9O A;  3P9T A;  4B44 A;  4UVC A;  1X2M A;  1QVU A;  3TO6 A;  2JMW A;  3LAP A;  3KLN A;  3RQI A;  1NH3 A;  2IA2 A;  1WH5 A;  3R0A A;  5J8C A;  4MIM A;  1TQP A;  5K7F A;  4UHT A;  4OIN F;  4HNT A;  2F5C A;  5L3F A;  3IWZ A;  3FF5 A;  1SVM A;  2M4K A;  2PMH A;  2IT0 A;  2IXS A;  4BL0 B;  3ABM H;  4M9S A;  4M3D A;  2R7R A;  1WI3 A;  3QYE A;  4XRS G;  2VL8 A;  3HRS A;  1O3S A;  4E70 A;  3CQZ J;  1LE8 B;  3HKZ A;  1T56 A;  1MSF C;  1A04 A;  2V6E A;  1VQL I;  2GFN A;  1KU3 A;  2R7U A;  5A2Q Z;  1Q1V A;  1BI3 A;  3LSG A;  3N97 A;  1F43 A;  2XF6 A;  3OSG A;  1VZ0 A;  1XC5 A;  2O0Y A;  4UUS A;  4AVZ A;  1EH7 A;  4BE2 A;  2WAE A;  2REK A;  3EYI A;  2O7O A;  2YVH A;  1T38 A;  3BQY A;  2M7B A;  3DP7 A;  2OV7 A;  3KET A;  3RSN A;  3O60 A;  5CQE A;  1SMY F;  3OS2 A;  3KLO A;  1YOV B;  1PYV A;  1UHS A;  4R79 A;  3CC7 I;  4MFE A;  3Q9V A;  4R1H A;  4XSZ F;  5D5V B;  1SVL A;  5B1A H;  1P4W A;  4EGY A;  2GBY A;  2P6S A;  1E3H A;  3BR0 A;  4U87 A;  2PMZ N;  1QU3 A;  3FXM A;  1FX7 A;  3H5N A;  2KJB A;  2IA1 A;  1YQA A;  2EIK H;  3JAM Z;  2ELJ A;  1XPX A;  2XF7 A;  2K5C A;  3CJN A;  4HW0 A;  3V7R A;  4JOM A;  1ZRF A;  4I02 A;  1P2F A;  3CP2 A;  3QYF A;  1SEU A;  2V57 A;  1IF1 A;  3NS4 A;  3RYP A;  2A6E F;  2XHK A;  3BG7 A;  1LNW A;  4XN3 A;  1FTZ A;  5K5Q A;  1OCR H;  2A2F X;  2BHZ A;  1ETO A;  2QKL B;  3FMR A;  3NEU A;  3R0J A;  1W36 D;  3CTA A;  1JTY A;  2KRC A;  4BE1 A;  4D7N A;  1KON A;  4LIV A;  1R6R A;  3S14 J;  3G73 A;  1FWZ A;  2I10 A;  3P9K A;  2X51 A;  2DMU A;  2L7K A;  5C4Y A;  2FU4 A;  1SAU A;  2A6T A;  5J6X A;  2KJC A;  3IRR A;  3E97 A;  4ENJ A;  4K2E A;  1S3J A;  4A3F J;  4MLO A;  5E8I A;  2K9N A;  3VFZ A;  2E5N A;  3SWH A;  2STT A;  3ROU A;  4ETS A;  4QPO A;  1G4D A;  2QSF X;  1Z77 A;  2Y30 A;  3HYI A;  2F5D A;  2DFH A;  2G7L A;  2UXN A;  2JVG A;  3W2W A;  3ZGK A;  1BM9 A;  2QTQ A;  2Z9O A;  3CUQ B;  2Y2Z A;  4FE7 A;  2CH0 A;  5EYR A;  2LNB A;  5CVI A;  2YUS A;  3IC7 A;  1LB2 A;  3F8M A;  2XDN A;  5IP7 J;  4M72 A;  2I5U A;  2FE3 A;  2Y31 A;  2VJJ A;  4GXO A;  3SXY A;  2NVQ J;  3PSI A;  3FXO A;  3O2P E;  1LQ1 A;  5DCM B;  2R5Z B;  2R92 J;  3GTK J;  4BHB A;  3IH2 A;  2O9L A;  4XKW A;  2JQ7 A;  3TED A;  5DUK A;  1V55 H;  5HBU A;  5H2F C;  4XKB A;  4RM3 A;  3WGH A;  5EG0 A;  3HRU A;  2COM A;  1R23 A;  1HST A;  5IOY A;  3QBM A;  2WAQ A;  3LA3 A;  3VIB A;  2EIL H;  1HLV A;  4HLY A;  2GLO A;  2HGC A;  2DXI A;  3SDB A;  3CC4 I;  2FMY A;  4GO1 A;  4NUB A;  2R5Z A;  3FMQ A;  2HQR A;  2P8T A;  1FPQ A;  2PQ8 A;  2LTP A;  4LMY A;  3BCA A;  3NQO A;  2NNY A;  5C3E J;  2LMD A;  2ZSH B;  1HW5 A;  4G94 A;  4GCV A;  4A2U A;  1QBJ A;  1XGM A;  2V7F A;  4BE0 A;  4WF2 A;  3ML6 A;  5HS9 A;  3WTV C;  5D1R A;  3D0S A;  2VKD A;  5E3N A;  3DQV C;  4NBQ A;  4B4C A;  1PJR A;  3S2D J;  3CCE I;  1XN7 A;  3DKX A;  4RLQ A;  3PUF A;  1VQ9 I;  3V7S A;  2QM3 A;  3CCS I;  3EUA A;  1JHF A;  2K3P A;  3KYC B;  1VTN C;  2OAZ A;  1WJB A;  1ETX A;  1T95 A;  2D2W A;  3FXR A;  4MTE A;  5L3E A;  4M3E A;  3P9I A;  4ANJ A;  2E71 A;  2Q2E A;  3FBN B;  2MH9 A;  3PNV A;  4PFO A;  3Q0U A;  2M1B A;  2BW3 A;  4KA4 A;  2HQN A;  3HGG A;  4DOZ A;  3CUQ A;  4FHT A;  1BC8 C;  3DEE A;  3GTL J;  1SD7 A;  4I0B A;  3V6G A;  2IGN A;  3LFU A;  4L5E A;  4NQW B;  2MBF A;  3CCY A;  3FWE A;  2CWE A;  5EDN A;  2GM4 A;  4OIO F;  2YR2 A;  4BHP A;  4YG2 F;  1I3A A;  2JSP A;  1PUF B;  3PM1 A;  3OYD A;  4J00 A;  1PUE E;  3ZMS A;  2XVC A;  1FMV A;  2WC2 A;  3BJ6 A;  1R5G A;  3K1M A;  3TP3 A;  3M07 A;  2XKP A;  3WU1 B;  1VQP I;  1D1C A;  1O3R A;  1T0F A;  3BPX A;  3AG2 H;  3F8N A;  2WWY A;  1ONV A;  1QZE A;  5KAF C;  4PZJ A;  1X4P A;  4J01 A;  4YFX F;  2CW7 A;  3MFK A;  2KQR A;  2RGV A;  2CGP A;  4ZYD A;  1EA3 A;  3C1D A;  3IH3 A;  3QAH A;  4F92 B;  3JRD A;  4Q48 A;  4MK6 A;  4CCN A;  1R4N B;  4MQ9 F;  5J1Y A;  3SJM A;  1AHD P;  4HNU A;  3OYF A;  3N4M A;  2TCT A;  4L9T A;  3JTG A;  3QQA A;  1TQI A;  2EV6 A;  2X0L A;  4OOI A;  4ITV A;  4DJA A;  1VFC A;  2VQG A;  3DEU A;  2STW A;  4ENN A;  1OKR A;  3TO7 A;  5E3L A;  4IHV A;  2P0W A;  2PN6 A;  3LQQ A;  3CCJ I;  3CCQ I;  1XCV A;  2BHY A;  4RB2 C;  1IRF A;  2O5R A;  2W1O A;  1IV8 A;  3K7A J;  3IL2 A;  3ZR8 X;  2K9L A;  2VN2 A;  2VIX A;  5F1R A;  1P4X A;  4L0Y B;  1W4M A;  2VAS A;  5IY5 H;  1JKP C;  2ZOY A;  5KNL A;  5HLG A;  1EH6 A;  2IPQ X;  2IRF G;  2WTE A;  2MC3 A;  3S32 A;  2IS4 A;  2HXI A;  3EET A;  3ZQL A;  5GPC A;  3ON4 A;  1TLH B;  1Z91 A;  1CGP A;  4A3K J;  3UKG A;  3CES A;  4N9I A;  1MGT A;  1Z7U A;  4BU2 A;  4BXU A;  3VTI A;  5HS7 A;  5FLX Z;  1JKQ C;  2L7M P;  3HOU J;  4IOA F;  3HGY A;  1FC3 A;  4YRV A;  2NX4 A;  2A5Y B;  2NS8 A;  4UVB A;  1RNL A;  4BEH A;  3JRF A;  3J7A O;  2VBW A;  1ZLJ A;  4XN0 A;  3CF5 F;  5JFR A;  5CVV A;  2ID6 A;  2RNG A;  2D1V A;  5H6Q A;  4GYG A;  1R5H A;  3QPS A;  3MVP A;  3LHQ A;  5D5X B;  2PBX A;  3I56 I;  3AG3 H;  1J2X A;  1D8K A;  4JYK A;  2Z16 A;  1O3T A;  4E7J A;  3WOD F;  2BXZ A;  3WTY C;  1WQ2 A;  1NG7 A;  2DTR A;  4YEL A;  2Y0M A;  4FT8 A;  3GZ5 A;  3CJD A;  4R8H A;  1QZZ A;  3ZXS A;  1LJ9 A;  2Y9Y A;  2LBF A;  4B1R A;  5HLT A;  2WBM A;  3QU6 A;  2F4O B;  2RDP A;  2EFO A;  4WK8 F;  4Y52 J;  3GUD A;  2V9P A;  1EH8 A;  2DT7 B;  1L0O C;  1ZR2 A;  5K5R A;  1DQU A;  1H89 C;  2HDW A;  1VQO I;  3S2H J;  2FBQ A;  1XX5 A;  5E20 A;  3WG7 H;  4EJW A;  3DFG A;  5LEK A;  4PJ0 C;  2L2O A;  5TGT A;  3H5A A;  4RAG A;  1KU7 A;  3ZQQ A;  2E1C A;  3WHC A;  2LY2 A;  2OBP A;  3K2A A;  5DAJ A;  4ZJZ A;  4AVP A;  2VT2 A;  4GFK A;  4W97 A;  3W6J B;  2KKO A;  4WX9 A;  2E5Z A;  5KAI C;  4KNY A;  2Z1D A;  1TNT A;  3PJR A;  4BKX A;  3HOS A;  2ZJ2 A;  3MCZ A;  3R4K A;  4IKF A;  1BL0 A;  1YX3 A;  4P5O A;  4DYQ A;  5TJJ A;  3KPH A;  1MZB A;  3S16 J;  3E5X A;  5DEQ A;  4LIU A;  5DV5 A;  4HOB A;  3FM5 A;  3PIP F;  1V54 H;  2XRN A;  2NVX J;  3TBI A;  3I64 A;  4ASN A;  2L01 A;  4BUP A;  2B63 J;  3BOQ A;  3LFK A;  3DPL C;  4J19 A;  4ACI A;  4G9Y A;  1X3Z B;  3A01 B;  3CME I;  3FIS A;  2WUI A;  1OR7 C;  4GDF A;  1BW6 A;  3DPJ A;  2KIU A;  1RZ4 A;  2OJE D;  2JT1 A;  4IEJ A;  4MQV A;  2ZSI B;  5ILS A;  2EFP A;  3A0H C;  4L5J A;  2DTZ A;  1HKQ A;  1YW7 A;  1YW8 A;  3VYU B;  5CW8 A;  3ZN0 A;  1JTX A;  2V6C A;  1FSE A;  4DZP A;  3DWL E;  2L4M A;  2ZXJ A;  1AU7 A;  1DUX C;  2DA2 A;  2BY3 A;  2ZFU A;  3HM5 A;  4UNO A;  5KHD A;  1DPU A;  4HQM A;  4E7Z A;  3SYT A;  5C4X J;  5J1R A;  3E5Q A;  3KKD A;  3PFY A;  1TT5 B;  2DJN A;  5IYC J;  1T98 A;  3J81 Z;  2KDZ A;  4IRI A;  1YS7 A;  2FML A;  2DOE A;  2XRO A;  3A02 A;  1YIJ I;  2HKU A;  1RR7 A;  3E6D A;  3H3U A;  3LSP A;  2GOX B;  4KDP A;  3KZI C;  4GCT A;  2DAO A;  3L9F A;  2CJJ A;  2E1O A;  4Q5S F;  3F8B A;  3B6A A;  1IXC A;  2DMQ A;  2JUC A;  3HKZ N;  5J4V A;  2EFW A;  4ZZD A;  2MYS A;  1U0J A;  3J7Y J;  1ITY A;  3U21 A;  1S9H A;  5AQC A;  4Q47 A;  1KQ8 A;  3PNT A;  1H9G A;  1FSH A;  3ZQH A;  4BEH B;  1ZRD A;  2LC2 A;  4OAZ A;  2DG8 A;  1ETK A;  3K1N A;  5FRO A;  1JKR C;  4A3E J;  2LH9 A;  1MH4 A;  2UXH A;  1OFC X;  1S29 A;  2RC4 A;  3KCC A;  5E3O A;  2BVM A;  4NEL A;  4GRI A;  1W0U A;  2VXD A;  3LL7 A;  2OA4 A;  4JX5 A;  1JUP A;  2KMU A;  1D0X A;  4KIG A;  1P7J A;  1XCB A;  5J8F A;  4C3H J;  2F07 A;  5L3C A;  4I09 A;  3OYK A;  1V4R A;  2OC6 A;  3RTR A;  1SD4 A;  5LGU A;  3CWR A;  3VW0 A;  1FOW A;  2NNN A;  2X1C A;  2K27 A;  1D0Z A;  4U88 A;  3B81 A;  4OWR B;  4XKC A;  2CQN A;  3GW2 A;  2XV4 S;  1MMA A;  1IAW A;  4N9H A;  3EUH A;  2YU3 A;  3BG6 A;  1USS A;  4RGX A;  3MZH A;  1BJZ A;  4L9V A;  1EJ9 A;  2L9V A;  2DMP A;  1BIB A;  3VP5 A;  1R71 A;  2BW3 B;  4S04 A;  4IPA A;  3H0G J;  5GAH J;  2QSG X;  2HYJ A;  2Q2E B;  1HA8 A;  4UUS B;  4HA8 A;  2DA7 A;  4LJZ F;  3WG9 A;  3OIQ A;  3M8E A;  2GA2 A;  3I54 A;  4NDL A;  4XNF A;  5K58 A;  2O8K A;  4NQW A;  5IT9 K;  1LVA A;  2ZCW A;  1BC7 C;  1R1V A;  3JSP A;  5EF6 A;  2AXL A;  3S1R J;  4RGU A;  2R5Y A;  2EZH A;  3OYL A;  2HU9 A;  1T0F C;  3HBL A;  2RAE A;  3F6O A;  5F0H A;  3BPV A;  4FX0 A;  3ISP A;  2E7W A;  3I4P A;  1YJW I;  1MJ9 A;  1Y0U A;  4XRM A;  3IRQ A;  1TT0 A;  2WA0 A;  3NWT A;  2LKX A;  2LD5 A;  2H6C A;  5TRD A;  2MG4 A;  2L9R A;  4FQG A;  4NC7 A;  4Y7N J;  1HKT A;  2X85 A;  3OMY A;  3EQL F;  4RLF A;  4Y15 A; 
#chains in the Genus database with same CATH homology
 2K9Q A;  1Q1V A;  2D6Y A;  4GFB A;  3LSG A;  2JK3 A;  2NS7 A;  3SFI A;  1F43 A;  4XRS A;  4GCL A;  2EZK A;  4A69 C;  1XC5 A;  3OSG A;  4UUS A;  2REK A;  1MBE A;  2O7O A;  5IYB J;  2YVH A;  3BQY A;  2JWT A;  1RPW A;  1PUF A;  1HCR A;  3O60 A;  1SFO J;  1APL C;  1MBF A;  2MGQ A;  4BY7 J;  1UHS A;  4MFE A;  2VKV A;  1ZQ3 P;  3TW7 A;  2ELK A;  3GTQ J;  3BCG A;  4D5F A;  3A01 A;  1DU0 A;  3HIM A;  2VUM J;  2GBY A;  3BR0 A;  2PMZ N;  1JJ8 C;  3FK6 A;  4C2M J;  3DEW A;  1GDT A;  4AC6 A;  3KZ9 A;  3LSJ A;  1HF0 A;  3HB9 A;  2N8G A;  4CYC A;  5D19 A;  3NAR A;  5E3M A;  2HXO A;  5M3M J;  2HI3 A;  4XIC A;  2V57 A;  3VVY A;  3VW2 A;  1HDD C;  1JKO C;  3E7Q A;  1GT0 C;  1NTC A;  1ETQ A;  1MBG A;  2DMN A;  2L0K A;  3KKC A;  4HKU A;  1FTZ A;  2HOA A;  2HOT A;  3BR6 A;  2G3B A;  2XRL A;  3B6C A;  4AYB N;  2XB0 X;  1ETO A;  3S17 J;  5FKM A;  2MSY A;  2E2I J;  1ETW A;  1JTY A;  3NNR A;  4BBR J;  4D7N A;  3CRJ A;  3I4M J;  3NI7 A;  3S14 J;  1JUS A;  1CQT A;  2I10 A;  4FIS A;  2DMU A;  3ANP A;  5C4Y A;  5FMP A;  5F27 A;  5J1U A;  4A3F J;  4MLO A;  2DA3 A;  1X2N A;  1OCT C;  2K9N A;  3GBG A;  3JRE A;  4BBS J;  3GTO J;  3GEU A;  2CUE A;  1Z77 A;  2Y30 A;  4IHX A;  2G7L A;  2FX0 A;  3HTI A;  1EF4 A;  2JA7 J;  4M3F A;  2QTQ A;  4UDS A;  2Y2Z A;  4FE7 A;  5EYR A;  3Q0W A;  4HNV A;  5M5Y J;  1DU6 A;  2YUS A;  2XDN A;  5IP7 J;  3BT9 A;  2Y31 A;  5FLV A;  4IHW A;  5EG0 B;  2NVQ J;  2G0E A;  3QPL A;  3JRH A;  2R92 J;  2R5Z B;  3GTK J;  2O9L A;  3IH2 A;  2JN6 A;  1WH7 A;  5GP9 A;  5HOD A;  2XSD C;  3TED A;  4GFL A;  1VF9 A;  3JRI A;  1I6H J;  5HBU A;  3FKI J;  2M0C A;  1MBK A;  2DG7 A;  3BTJ A;  5EZH A;  5EG0 A;  3V78 A;  4V2G A;  5IOY A;  3QBM A;  2Y9Z A;  1TWF J;  3VIB A;  1HLV A;  3NPI A;  3HEF A;  2GLO A;  2VKE A;  1MBH A;  2R5Z A;  2NP5 A;  3PPB A;  1GUU A;  2EH3 A;  3NAU A;  4ABZ A;  2LTP A;  3VW1 A;  2PZ9 A;  3HTJ A;  2VI6 A;  5C3E J;  1LE8 A;  3ZQF A;  3OSF A;  1ORK A;  4MXM A;  5D1R A;  3CDL A;  5E3N A;  4B4C A;  2XPU A;  4GCK A;  3S2D J;  3OOU A;  4BY1 J;  4M3G A;  5FGL A;  1IC8 A;  3BQZ A;  5FJ8 J;  3VVX A;  3BJB A;  3PO2 J;  1QPI A;  1GV5 A;  1RET A;  2YU9 J;  1BW5 A;  2DA4 A;  3FIW A;  1UG2 A;  2QKO A;  3E7L A;  2UXI A;  3VOK A;  2XPV A;  2QOP A;  1NK3 P;  2QWT A;  1ETX A;  3IV5 A;  2JA8 J;  4FTH A;  1K61 A;  2JA5 J;  3PO3 J;  4YZE A;  4C3I J;  4M3E A;  5FLM J;  5F04 A;  2RHA A;  5EZG A;  2OPT A;  2JJ7 A;  2K9S A;  3Q0U A;  4XID A;  3HGG A;  4CYC B;  2ZCM A;  1TWC J;  3G1M A;  3GTL J;  3G7R A;  3V6G A;  2E2H J;  5C44 J;  3VUQ A;  3GTM J;  4L5E A;  2RAS A;  3GTP J;  4CGR A;  3CCY A;  2LK2 A;  2XGD A;  3G1L A;  2R0Q C;  5EDN A;  5EGO A;  1W0T A;  2GM4 A;  1IGN A;  2ECB A;  3JRA A;  2EZI A;  3JRB A;  2ZB9 A;  4S0H B;  5CXI A;  1PUF B;  3PM1 A;  3ZQG A;  3DCF A;  2LY9 A;  4MO7 A;  4LOC A;  1IUF A;  3GTJ J;  4ME9 A;  3RZD J;  4QTR A;  4C3J J;  1VND A;  3TP3 A;  3BR3 A;  2H8R A;  1AKH A;  2QF7 A;  1U8B A;  2FJ1 A;  3HOV J;  2XGE A;  4A3D J;  1A5J A;  3BR5 A;  4UUT A;  1UI6 A;  2UXU A;  5F0F A;  3JSJ A;  4G12 A;  2CQX A;  1IRZ A;  2E19 A;  2O7T A;  4AC0 A;  4XK4 A;  3IH3 A;  3JRD A;  4MK6 A;  2IAI A;  2YVE A;  3HOZ J;  1YRN A;  1TWG J;  4DW6 A;  5J1Y A;  1MNM C;  3SJM A;  1FIA A;  4AF5 A;  1AHD P;  3M3Y J;  3W6V A;  1ZTR A;  3O8G A;  2TCT A;  4A3J J;  2MW8 A;  3QQA A;  3NXC A;  1E3O C;  1K83 J;  2H1K A;  1ZR4 A;  4DYR A;  4MFD A;  1VFC A;  1Z0X A;  4RBO A;  1A6I A;  2NOG A;  1FEX A;  4X1E A;  1HDP A;  5E3L A;  4IHV A;  5JLW A;  3T6N A;  5IPA A;  2XGC A;  5F0C A;  2D5V A;  1ETY A;  2DA1 A;  3S5R A;  3K7A J;  2WGB A;  4KWA A;  3PAS A;  3H3V K;  2P81 A;  1LFU P;  5K7Z A;  1FTT A;  2G7G A;  1JKP C;  2ZOY A;  4M3B A;  3WHB A;  4I6Z A;  5HSZ A;  2X48 A;  4NN1 A;  5F08 A;  3BG5 A;  2HXI A;  4JP0 A;  1ZK8 A;  2JA6 J;  1F36 A;  3ZQL A;  3I4N J;  5GPC A;  1IDY A;  2NP3 A;  3ON4 A;  3G1O A;  3HTH A;  2G7S A;  4A3K J;  3UKG A;  4X6A J;  5EGO B;  3QKX A;  1VI0 A;  1JKQ C;  2TRT A;  2L7M P;  2M8G X;  3HOU J;  3HGY A;  2OF7 A;  3ZOB A;  3S15 J;  1R9T J;  2EQR A;  2NX4 A;  2WAQ N;  4QIW N;  2NS8 A;  3TW6 A;  4A3B J;  1OCP A;  3JRF A;  1RKW A;  3C2B A;  4IHY A;  3LOC A;  2HOS A;  2ID6 A;  2Y0S N;  3CMY A;  1B8I A;  9ANT A;  3QPS A;  5CXG A;  3MVP A;  3LHQ A;  2PBX A;  5EEA A;  1O4X A;  3D1N I;  4JYK A;  5IYD J;  3GTG J;  3VPR A;  3TP0 A;  3HE0 A;  2L7F P;  3CJD A;  3SDG A;  3BTI A;  5M3F J;  3G56 A;  2Y9Y A;  4BXX J;  4B1R A;  3JRC A;  1IV6 A;  4Y52 J;  1U78 A;  1B72 B;  3NRG A;  4JX4 A;  1ZR2 A;  1JGG A;  3O8H A;  2GEN A;  1H89 C;  3F0C A;  2FBQ A;  3S2H J;  3RKQ A;  2W53 A;  2R5Y B;  3BRU A;  3M4O J;  1B72 A;  1TC3 C;  5DS9 A;  3HTA A;  1UMQ A;  4QSH A;  1XS9 A;  4M6V A;  2ZCN A;  2ZCX A;  1OJL A;  3WHC A;  3RH2 A;  3K2A A;  5DAJ A;  4I76 A;  3RD3 A;  3VVZ A;  5F1J A;  1IDZ A;  5IOZ A;  1I50 J;  1RKT A;  4W97 A;  2AHQ A;  1ZGW A;  1BA5 A;  3LJL A;  4GFK A;  1G2H A;  1S7E A;  3LWJ A;  1H8A C;  3HOY J;  4BKX A;  1NK2 P;  1JT6 A;  1BL0 A;  4DYQ A;  1UI5 A;  3EGQ A;  4A3G J;  1JT0 A;  3S16 J;  4D5C A;  2YS9 A;  3ZQC A;  5BNG A;  4JNN A;  2NVX J;  1WCM J;  2DMT A;  2DA5 A;  1MH3 A;  3Q3S A;  3A03 A;  5EFY A;  2B63 J;  4JL3 A;  2ME0 A;  4J19 A;  4ACI A;  3A01 B;  2LLK A;  5FKL A;  3HOW J;  3LSR A;  3FIS A;  2ZOZ A;  2WUI A;  2XPW A;  1BW6 A;  2CUF A;  2LR8 A;  3DPJ A;  1POG A;  1MSE C;  4IEJ A;  3COL A;  4JX6 A;  4FCY A;  3S1Q J;  1IJW C;  2DTZ A;  3BR1 A;  3BTC A;  5M5X J;  2NVY J;  5CW8 A;  2CQQ A;  3ZQI A;  1U9N A;  2M2E A;  3AQT A;  1JTX A;  3MN2 A;  1Y1W J;  5DTD A;  3ON2 A;  2UXP A;  2X9D A;  1H88 C;  4DZP A;  3HDD A;  1AU7 A;  4A93 J;  2DA2 A;  1FIP A;  1IG7 A;  2FQ4 A;  1QVT A;  3HM5 A;  5FHP A;  1SGM A;  5D18 A;  1D5Y A;  4A3C J;  1ZKG A;  3IH4 A;  5C4X J;  4L62 A;  2X6O A;  5J1R A;  2QCO A;  2IU5 A;  3KKD A;  2DJN A;  4EEF G;  5IYC J;  2KDZ A;  1ETV A;  2FD5 A;  3BHQ A;  3A02 A;  2HKU A;  1RR7 A;  2XB5 A;  3LSP A;  2IBD A;  2DN0 A;  4V2F A;  2R93 J;  4GCT A;  2UXO A;  1P7I A;  2CJJ A;  2E1O A;  2AO9 A;  2K40 A;  2DMQ A;  3B6A A;  3HOX J;  1JJ6 C;  3HKZ N;  1TWH J;  3IUV A;  2NVT J;  4JKZ A;  2LVS A;  4AUX A;  1ITY A;  2Q24 A;  1GV2 A;  5AQC A;  2LP0 A;  2WV1 A;  1I3Q J;  3FK7 A;  5GPA A;  4A3I J;  2QIB A;  3ZQH A;  3C07 A;  2M34 A;  2IEK A;  3JR9 A;  3S1N J;  4ICH A;  2HYT A;  2DG8 A;  1QRY A;  1ETK A;  1JKR C;  4A3E J;  1SAN A;  1MH4 A;  5IP9 J;  2UXH A;  1OFC X;  3AQS A;  2KT0 A;  2L7Z A;  3BG3 A;  3Q0V A;  5E3O A;  5K7H A;  4NEL A;  1HOM A;  1W0U A;  3ANG A;  4A3M J;  5FKK A;  1AKH B;  4JX5 A;  1JUP A;  1T33 A;  3BG9 A;  5IP6 A;  1B8I B;  1P7J A;  3KNW A;  2OER A;  4D7M A;  4C3H J;  2F07 A;  4DZJ A;  1YRN B;  2CU7 A;  4RDU A;  3CWR A;  3VW0 A;  5M5W J;  2VPR A;  3RZO J;  3BR2 A;  5JLX A;  3B81 A;  3BNI A;  4PXI A;  2ECC A;  2CRG A;  2E2J J;  2ID3 A;  3F1B A;  5C4J J;  1WGX A;  1FJL A;  1XG1 A;  2WB1 N;  2COB A;  4FE4 A;  1RES A;  2ME6 A;  1GVD A;  2GUH A;  1BJZ A;  2EZL A;  2DMP A;  3VP5 A;  2HQ5 A;  5H9T A;  2R7Z J;  2DA6 A;  3H0G J;  3MKL A;  5FKO A;  3FRQ A;  2HYJ A;  4W1U A;  4UUS B;  3VOX A;  2HDD A;  1MBJ A;  1X58 A;  2DA7 A;  3S1M J;  5FKN A;  5HAW A;  4NDL A;  2OI8 A;  4A3L J;  5K58 A;  1TWA J;  1U9O A;  2O8K A;  3P9T A;  2W48 A;  1X2M A;  5EF6 A;  3S1R J;  1QVU A;  2R5Y A;  2JMW A;  2EZH A;  5J3L A;  3RQI A;  3MNL A;  3HBL A;  1WH5 A;  2RAE A;  3JRG A;  5F0H A;  4MIM A;  5K7F A;  1ENH A;  1WPK A;  4XRM A;  3GZI A;  1LFB A;  1Y1V J;  2LKX A;  2M9H A;  4B3A A;  1JUM A;  2LD5 A;  3LNQ A;  2LFB A;  4DYC A;  2MG4 A;  3BTL A;  4M3D A;  3L1P A;  1WI3 A;  2L9R A;  4XRS G;  3EUP A;  3OIO A;  4Y7N J;  3CQZ J;  1LE8 B;  1T56 A;  1MSF C;  2GFN A;  2EBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...