3HGYA

Crystal structure of cmer bound to taurocholic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
202
structure length
202
Chain Sequence
b'TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CmeR
molecule tags Transcription repressor, drug binding
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: crystal structures of CmeR-bile acid complexes
rcsb
total genus 75
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hgyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hgyA02
3S1RJ 2E19A 2EH3A 3MN2A 1YRNA 1POGA 2RAEA 5CXIA 2G3BA 2CUFA 1MSEC 1U8BA 2VI6A 3CDLA 1W0TA 4DZPA 2NP3A 2WUIA 2W53A 3HE0A 3COLA 1MBKA 4JP0A 2XPUA 4B3AA 3PO2J 3KZ9A 3PPBA 1WGXA 2G0EA 1QPIA 5CXGA 2GUHA 1MBJA 2QKOA 2ZCXA 2FX0A 4D7NA 1GT0C 5HBUA 2UXIA 3JRGA 3CJDA 5F1JA 1ITYA 4JNNA 4L62A 3GTKJ 5F0CA 3FISA 3GTPJ 1H89C 2FBQA 4IHVA 5M5WJ 2IAIA 2GBYA 2CQQA 2L0KA 2FJ1A 1GDTA 4A3DJ 3NNRA 5D19A 4IHWA 4W1UA 4XRSG 1UG2A 4XIDA 2E2IJ 1Y1WJ 2LR8A 2JA7J 2JA6J 4A69C 5DTDA 2DJNA 5JLXA 3PASA 1WH7A 1IV6A 1XS9A 4UUSB 5FLVA 3RQIA 3BG3A 3FIWA 4JX6A 1X2NA 1TWFJ 3GTGJ 2K9NA 3LSPA 5DS9A 4XRMA 3FKIJ 1IJWC 3RKQA 2XB0X 3L1PA 1W0UA 2KT0A 3HTHA 2HXOA 2K9SA 5IYCJ 4MXMA 1ZGWA 2ZOZA 3E7QA 3NI7A 3C2BA 5M3FJ 5C3EJ 5D18A 1MNMC 2L7MP 2YUSA 3BJBA 1AU7A 4W97A 3OIOA 2JA5J 5GPAA 3QBMA 2JWTA 1U9NA 2P81A 4CYCA 4A3GJ 2M8GX 1ETXA 2HQ5A 1LE8B 3JRAA 1U78A 4DYQA 2M9HA 3IH4A 4V2GA 4GFLA 3MNLA 3S5RA 4MFEA 2Y2ZA 2O9LA 3E7LA 1ZK8A 4M3GA 1ETVA 5J1UA 3JRHA 3GTQJ 3ON4A 3DEWA 3QPSA 5K58A 1MH4A 1Z77A 3CWRA 2F07A 1WCMJ 3OSGA 3DCFA 3LWJA 1IUFA 5F08A 4FE4A 3TP0A 5C4YA 1A6IA 2YVEA 3ANGA 3G56A 5FKKA 4MK6A 4JYKA 1XC5A 3JRBA 5M5XJ 3S14J 2Y30A 2UXOA 2UXHA 4XRSA 1ETWA 1MBHA 1JT0A 1ZR2A 3VPRA 5EZHA 5IYDJ 2DA1A 4AUXA 2G7LA 1MBEA 2REKA 2YVHA 4YZEA 1CQTA 1BW6A 2GFNA 2QWTA 2CRGA 2HOTA 4M3EA 2OI8A 2AO9A 2ZOYA 1Z0XA 4V2FA 4BY1J 3GTJJ 3QPLA 3TEDA 4Y52J 2MSYA 3AQSA 4CYCB 2E2JJ 1A5JA 3B81A 2NVYJ 1MBFA 1F36A 4A3JJ 3Q0VA 3O8GA 1JKRC 3NXCA 4HKUA 5IPAA 3BTJA 3V78A 3CCYA 2DA7A 3JRDA 3V6GA 4D7MA 3JREA 4L5EA 2QF7A 3HIMA 1HOMA 1LFBA 1NK2P 3I4MJ 1ZKGA 1TC3C 2DTZA 1FTZA 3T6NA 2DA5A 3K2AA 2L9RA 2XGCA 3S16J 1TWAJ 2Y9YA 2EBIA 2RHAA 3D1NI 1IG7A 3H0GJ 4B1RA 1I6HJ 5FKMA 3GTLJ 3VVYA 2ELKA 3NRGA 5IP7J 3HEFA 3HOXJ 1RKWA 3FK6A 2ZCMA 2EQRA 5FHPA 3HB9A 4B4CA 5C4XJ 1FJLA 2XGEA 3Q0WA 4GFKA 5FKOA 4DYCA 2DMNA 1D5YA 5IYBJ 5EGOB 3PM1A 2JJ7A 2VKVA 1JTYA 3HBLA 2R93J 3FRQA 1JUSA 5EG0A 3DPJA 2M2EA 1F43A 5HODA 3HGYA 1PUFA 3NPIA 1SFOJ 5DAJA 3EGQA 4DW6A 1K61A 4HNVA 4CGRA 2LLKA 3RZDJ 1FEXA 3HTJA 2L7ZA 4Y7NJ 3LSJA 2DMTA 2E1OA 4I6ZA 1NTCA 2IBDA 2R0QC 4NELA 3HOWJ 4D5CA 1S7EA 2NS8A 5EG0B 2R5YA 1GV2A 1Y1VJ 5AQCA 1AKHA 2R5ZA 3S1QJ 1OCPA 3BR5A 3NARA 3LNQA 2E2HJ 3KNWA 2WAQN 2WB1N 3VVZA 2ID6A 3CMYA 3S17J 2O7OA 3VW1A 3HTAA 1JT6A 1RESA 2GENA 2G7SA 2NOGA 2DA3A 3QQAA 3BQZA 5K7FA 4D5FA 3RD3A 4KWAA 1VI0A 2LK2A 4XK4A 4C3JJ 3BHQA 1HDPA 3BNIA 1AKHB 2JK3A 2MW8A 2TRTA 2HKUA 3ON2A 4GCKA 2TCTA 1ZQ3P 1BJZA 1JKPC 5BNGA 5CW8A 2PBXA 5M3MJ 3ZQHA 1DU0A 4G12A 2K40A 3WHBA 1E3OC 3GEUA 3M4OJ 3IH3A 1T56A 1T33A 4ABZA 2NVTJ 2DA6A 4AC6A 3VIBA 1RPWA 5K7HA 3A01A 2VUMJ 3CRJA 3HGGA 5EF6A 4A3CJ 1JUPA 2HOAA 3KKCA 1GVDA 2HYTA 4JL3A 3JRIA 5FKLA 3SDGA 1FTTA 1DU6A 3Q3SA 5FKNA 2NS7A 2Y0SN 2QCOA 1IC8A 2UXUA 4C2MJ 2DMQA 2ECCA 3GBGA 3G1OA 2NVXJ 5E3LA 3RZOJ 3HDDA 3VOXA 1UHSA 1VNDA 1JKOC 1U9OA 3S15J 2XPWA 3BRUA 3ZQCA 1FIPA 1TWGJ 1ZTRA 4MO7A 5IOYA 2LFBA 2B63J 1XG1A 1AHDP 5GP9A 5IOZA 5J1RA 3VW2A 1QVTA 3TP3A 4IEJA 1ZR4A 2IU5A 5FMPA 3IV5A 1ENHA 1P7JA 3LOCA 3W6VA 4X6AJ 1X58A 5M5YJ 1EF4A 1MBGA 2XPVA 2X48A 2X9DA 1MH3A 2FQ4A 2XB5A 5K7ZA 3JRCA 4FTHA 4UUTA 9ANTA 1H8AC 4RBOA 4ICHA 3O60A 4IHXA 1SGMA 4A3BJ 1OJLA 1APLC 3UKGA 4QTRA 1UI5A 1UMQA 4MLOA 2LD5A 5HAWA 3S1NJ 1G2HA 2NVQJ 5EDNA 2YU9J 1SANA 1IRZA 3NAUA 1ETYA 3KKDA 3BR6A 4I76A 4S0HB 4C3IJ 3K7AJ 3QKXA 5D1RA 2QOPA 1JUMA 2EZLA 3JRFA 3MKLA 1PUFB 4BBSJ 1BA5A 3BCGA 1QRYA 4X1EA 3TW6A 1JGGA 2MGQA 3JR9A 2Y9ZA 2R92J 3B6AA 1B8IB 1K83J 2ZB9A 4MFDA 1ETOA 5EGOA 5J1YA 4M3BA 5EYRA 4QIWN 3BR1A 1H88C 1HF0A 3A03A 2QTQA 1NK3P 2JMWA 4BBRJ 3IH2A 2KDZA 1OCTC 3H3VK 3S1MJ 3VW0A 2O7TA 2AHQA 2EZIA 3HTIA 2EZHA 3A02A 3Q0UA 3VP5A 4A93J 1VFCA 2FD5A 3ZOBA 1UI6A 3AQTA 4UUSA 2ECBA 3BR3A 5F04A 2HYJA 4FE7A 1ETKA 4IHYA 1I3QJ 3HOZJ 4C3HJ 5E3OA 4J19A 4FISA 4EEFG 1HLVA 4NN1A 1B72B 2VPRA 4PXIA 3P9TA 2HI3A 2JA8J 3OSFA 3LHQA 2M34A 3FK7A 1LE8A 1GUUA 2OPTA 3BR0A 1P7IA 5IP6A 3ZQIA 1LFUP 3GZIA 1B8IA 3HKZN 3A01B 3G1LA 2ZCNA 3PO3J 1MSFC 2ME0A 3ANPA 2CJJA 4M3DA 2LY9A 3BG9A 2DA2A 4XICA 4BXXJ 3S2HJ 1JJ8C 2LKXA 4QSHA 4A3KJ 2W48A 2D5VA 3VVXA 2H1KA 1VF9A 5JLWA 4RDUA 2H8RA 5GPCA 3B6CA 3BQYA 4JX4A 3MVPA 5EFYA 5FGLA 1IDYA 2K9QA 5EZGA 1B72A 2RASA 2N8GA 5FLMJ 5E3MA 1RKTA 1ORKA 2GLOA 2OF7A 3S2DJ 4JKZA 2DA4A 4LOCA 2CU7A 4A3IJ 4GCTA 2D6YA 2COBA 3RH2A 2CUEA 1ETQA 1WH5A 5C4JJ 4A3EJ 3VUQA 1QVUA 5E3NA 2ID3A 2R7ZJ 5C44J 1RR7A 4ME9A 3BR2A 3I4NJ 1R9TJ 2PMZN 5IP9J 2R5ZB 4MIMA 3TW7A 3ZQGA 2R5YB 1IDZA 4A3FJ 5F27A 2O8KA 4M3FA 3F0CA 2Y31A 4ACIA 4DZJA 5EEAA 2HXIA 2LP0A 3HM5A 3ZQFA 1BW5A 3HOYJ 3F1BA 2QIBA 2XRLA 1FIAA 2WV1A 4BKXA 2GM4A 3HOVJ 5H9TA 2DG7A 2X6OA 2I10A 2V57A 3BT9A 1BL0A 3JSJA 1TWHJ 4FCYA 3IUVA 5J3LA 2M0CA 2OERA 1YRNB 2LTPA 3BTIA 2IEKA 2DG8A 2DMUA 3BTLA 3LSRA 5F0FA 1Q1VA 1WI3A 2DMPA 2XSDC 1JKQC 3G1MA 1WPKA 3OOUA 2YS9A 1O4XA 1HCRA 4GCLA 2LVSA 2NP5A 2WGBA 1OFCX 2XGDA 1I50J 1TWCJ 1RETA 1X2MA 2L7FP 2VKEA 3HOUJ 3CQZJ 1IGNA 3O8HA 4AYBN 3GTMJ 1JJ6C 2HDDA 4UDSA 4NDLA 3LJLA 3VOKA 2CQXA 4JX5A 1HDDC 4AF5A 5F0HA 2Q24A 2XDNA 3G7RA 3SFIA 2PZ9A 1GV5A 2JN6A 2ME6A 4M6VA 3ZQLA 3M3YJ 3LSGA 2UXPA 2G7GA 3EUPA 4BY7J 2MG4A 4GFBA 3C07A 3WHCA 4DYRA 4A3MJ 5HSZA 2DN0A 2EZKA 2NX4A 3BTCA 1JTXA 4AC0A 3SJMA 3BG5A 4A3LJ 2HOSA 3GTOJ 5FJ8J
chains in the Genus database with same CATH superfamily
3L2VA 2HZTA 3ZMUA 1YRNA 4ANJA 5GAGJ 2LNBA 3FM5A 5CXIA 2ZNYA 2G3BA 3E5QA 4IOCF 4RA2A 4HA8A 4AM3A 4BHCA 1OR7A 2E5ZA 1W5TA 2E1CA 2WUIA 2HTJA 1MBKA 4B3AA 3PO2J 1WGXA 1USTA 4GGGA 2KIFA 5LHIA 1DDNA 2QKOA 3BLYA 2VB6A 2PX9A 2FQ3A 3IHUA 2UXIA 3ASOH 3I56I 3CJDA 5F1JA 3L2WA 4JNNA 2IA1A 1ZYRF 5ILUA 5GAEJ 4L62A 2V6CA 3FISA 1IN8A 3GFMA 5TJJA 1YW9A 5JVGF 2BEOA 3IRRA 4A3DJ 5D19A 4XRSG 1TT5B 4XIDA 3V8JA 2O61A 1IN6A 2XIGA 3FMQA 2EFWA 5JLXA 4RB3C 1JGSA 1TZLA 2L4MA 4XONA 2ZXWH 3GTGJ 2VQCA 4Z2YA 4XRFA 3LSKA 5DS9A 2BY2A 4ETSA 1TNTA 5LHHA 3RKQA 2XB0X 3HSFA 3IUOA 4NHJA 2D1VA 2K9SA 5HNHA 1K4TA 3E7QA 4KUMA 3C2BA 5M3FJ 5C3EJ 2Q2EB 3VODA 3JCUC 1OYYA 2DK8A 3PIPF 4W97A 1UAAA 2JA5J 2Z5UA 2ZO4A 2P81A 2M8GX 1ETXA 1ACIA 1A6QA 4HLYA 1UELB 1E2XA 3OR2C 4M3GA 3JRHA 3ON4A 4F7ZA 2V4JC 2FNPA 3QOEA 1D5VA 2QVOA 1FOXA 2BW3B 1X3ZB 2GXBA 1WCMJ 3OSGA 4C30A 4FE4A 2X4HA 3TP0A 1A6IA 2ZJQF 2GIVA 2YVEA 4JYKA 4EM2A 2M7BA 3S14J 1K78B 2UXOA 3F8NA 4NQWB 1ETWA 4ZYEA 1UG0A 1Z05A 1O3RA 3CJTB 2G7HA 4OAYA 2YVHA 3FDYA 4G6DA 3ULQB 2P4WA 3TGNA 2QQAA 1IF1A 2NRAC 2FBHA 2HKXA 2STTA 1ZGJA 1OCRH 2ZOYA 2AO9A 2HKOA 4BY1J 3GTJJ 1A31A 2HQAA 4RAZA 3QPLA 3AAFA 3TEDA 2R7UA 1E3PA 1SFEA 1ZG1A 4R8HA 1N25A 3REOA 3B81A 3TDUC 3VYSB 1F36A 5FB2A 4A3JJ 1IN4A 5CVJA 1Y8QB 1LEBA 1JKRC 3IP4B 4GO1A 3BTJA 1U5TB 1Y8RB 4LFUA 3IKVA 3RQ4A 1WZ2A 3CCYA 3E6MA 2DA7A 4D7MA 1QPMA 3JREA 4L5EA 2RDPA 2XAQA 2QF7A 1HKTA 3IL2A 2L9NA 3COAC 5AIQA 3J80Z 4PGHA 1WJDA 3H9GA 5HLIA 1FTZA 3GX4X 4Y33A 2XGCA 5DDGA 3GWZA 4FETA 4HF0A 1XX5A 2P5KA 2Y9YA 3W3CA 2X85A 4B1RA 3CDIA 3VVYA 3W6KB 2ELKA 4PJLA 5K5QA 2DT5A 3VFZA 2EIKH 1HKQA 5B1AH 3WTWC 3ONQA 3W6JB 2EINH 4GFKA 4DVYP 4V19K 2DMNA 1V3FA 5EGOB 1SVLA 2JJ7A 2R93J 1JTYA 4D0PA 5L3EA 4DQ2A 1JUSA 2AQEA 1Y0UA 4XNFA 1F43A 1FY7A 2KZGA 4I99C 1ZRFA 1PUFA 4GXOA 5DAJA 1HQCA 3EGQA 1QZZA 2QEXI 2LLKA 3LSHA 3CCLI 1FYLA 3AG1H 3HTJA 2FUG2 3LQRA 2E1OA 1V5EA 2DOFA 1ZAOA 3LSMA 2O5RA 2DJIA 2IXSA 1Y1VJ 2E35A 3P9CA 3CJRB 2WC2A 4KT5C 1L0OC 2WAQN 1UHMA 2BV6A 2WB1N 2X6YA 2M4GA 4G6TB 4P1WA 3CMYA 1O3SA 3RPUD 2BVLA 2PQ8A 1QQIA 3HJEA 4RMNA 2G7SA 2GENA 3U9GA 2NOGA 4HDUA 1L3LA 2E5NA 3ABMH 3QQAA 2F4IA 4PCQA 5HLGA 4D5FA 3RD3A 2KP6A 1VI0A 3DWLE 1TL8A 4C3JJ 4KMFA 3BHQA 3KEQA 3BNIA 3L00A 2AQFA 2ACJA 2TRTA 1X19A 2FJI1 2EFPA 3EYIA 3KP7A 3OYDA 2M5WA 2E36A 4RGRA 1FYMA 2GOMA 4NC8A 3R60A 1YX3A 1XDSA 3T0YA 4E7KA 2R7WA 2QSHX 3HZJA 1G3WA 3KYLA 1E3OC 3K70C 3GEUA 4LLGF 1JXSA 1T56A 1T33A 1XN7A 3E5UA 4BS9A 2JQ7A 1NG7A 1N77A 2YSRA 3V7RA 1I6XA 2DPDA 2PJRA 1RPWA 5K7HA 2VUMJ 2KFDA 2LY2A 4CCMA 3HTSB 3DTIA 4A3CJ 2BZTA 2ELHA 2MLGA 1JUPA 1JHFA 2VONA 4RLQA 1V5FA 5FKLA 1GXPA 3CLQA 1JE8A 2NS7A 3S93A 4B48A 2XF7A 1XMXA 1K79A 2QQBA 5GADJ 1QZYA 4J01A 2MC4A 4G8XA 3HDDA 5FRMA 1R7JA 2H27A 2G7UA 4Y17A 2A6TA 5E8GA 3S15J 4L9NA 1KQ9A 1FIPA 4MO7A 2B63J 1EH6A 5E17F 4U0VA 1XG1A 3KP6A 1EV7A 1AHDP 4HBLA 3BOQA 4IEJA 3BZKA 3IV5A 1ENHA 3QRFF 1WRJA 2ICWG 5BMZA 2XF6A 2V9VA 4KIBA 3JAMK 4A12A 3LFUA 2FQ4A 5K7ZA 4CCJA 4HDVA 1TQMA 2KIMA 2ZY9A 1S5LC 1XSDA 3GFJA 3QU6A 1APLC 1VQMI 3HRSA 2PBIA 1B9MA 2QKMB 3KLOA 4F52A 5D6EA 4QTRA 4MLOA 1T0FC 5A2QK 1ZRCA 3I64A 5HDNA 5EDNA 4C2TA 2VOPA 4LK1F 3OYMA 4M9ZA 3ZMDA 3KKDA 1UB9A 2MH2A 1FOKA 2QOPA 1BA5A 1N78A 4L5JA 3LSIA 2CQKA 4XR6A 1JGGA 1SAUA 3B6AA 3MAJA 1PP7U 4BE0A 2QTQA 4RGSA 2MBFA 3EYYA 5LHGA 4BBRJ 3IH2A 1OCTC 1VQ8I 3PNYA 1GVJA 2F5FA 2O7TA 2AHQA 3LSTA 3RIRA 3VP5A 1X4OA 1Y56A 1VFCA 3ZOBA 1EKEA 2XROA 1Z3XA 2R7VA 1UI6A 5F04A 2VBZA 3VB2A 2EIJH 3A4CA 4IF4A 2DK5A 2YX7A 2L01A 4PXIA 1BM9A 4UVCA 3ZMTA 1ON2A 2BHZA 2M34A 3LAPA 3ABUA 2M87A 2F2EA 5JR3A 1P7IA 1MZBA 3GW2A 5FFZA 1LFUP 2V26A 4ESFA 3CC2I 3G1LA 2FOWA 3EQLF 2ME0A 4H0EA 2LY9A 4L9VA 4XBFA 2VC1A 1WQ2A 3A1YA 3NRVA 1YIJI 4HPQA 2X51A 2JTVA 2A07F 4WXCA 4CCOA 2HYFA 4O5VA 1YS6A 1WI9A 4OAZA 2M1BA 3PJRA 3VYUB 5B3SH 1O7LA 1LEAA 3ROUA 2LKPA 4WCGA 2D6YA 2COBA 3RH2A 1Z7UA 2CUEA 4PSWA 5C4JJ 2R7ZJ 2CV0A 2K3PA 3G73A 3L9FA 3ZCOA 3I4NJ 4BACA 2PMZN 3FZVA 4MIMA 3ZQGA 3PFIA 3VEPA 1OCZH 1YI2I 1BI1A 2KRFA 3TO6A 1P4WA 4LLLA 2HYGD 1RNLA 4UY8I 4A0ZA 3KE2A 3F1BA 2QIBA 3G3ZA 3OMYA 1FIAA 1Z7LA 3GO5A 2OZ6A 3OYHA 4U7DA 3HOVJ 4DBRA 4KN4X 2X6OA 4ZYAA 3E6CC 2P0WA 2V57A 3JSJA 1TWHJ 5JFRA 2HVSA 1YJ9I 4HF2A 4AVZA 3IAM2 2B9SA 2IEKA 2H1LA 3HG9A 4E7HA 4B3XA 3CJNA 2DMUA 1Z3YA 5F0FA 2XSDC 1TW2A 4A5MA 4GCLA 2XDVA 4XOPA 4CUGA 2LVSA 4E7ZA 1ZG3A 2WGBA 2ZFWA 5H2FC 4IRIA 1RETA 4XLFA 4U0YA 2JT1A 3ESWB 3O8HA 1U0JA 4B44A 5LRRA 1BR1A 3H9QA 2R7RA 1LJ9A 3S2WA 3AL0C 4JX5A 5H6RA 3A0HC 2BY3A 2YPRA 3DTKA 1GV5A 1LVKA 2IPQX 4C9YA 1K78A 3C2HA 2DOEA 4LG0A 2LBFB 3VSKA 3LSGA 3OYLA 2UXPA 4M6YA 2PFVA 1ZGAA 5KVRA 4HQEA 3MKYB 3WHCA 1YHQI 5HSZA 2CFXA 1IO2A 5J4YA 3OYNA 2VXZA 4ZDOA 3SJMA 3S3NA 3K2ZA 1CF7B 4OU0A 2ZJRF 2QSFX 2E19A 3MN2A 3HC7A 2A68F 1POGA 3GZNB 2GA1A 2QSGX 5CPRB 3BCBA 1TLHB 1U8BA 2H8WA 1W0TA 2L3DA 4DZPA 1B59A 1JKPC 2W53A 3HE0A 4ON0A 2XPUA 3PPBA 1V55H 1YS7A 3L2UA 1QPIA 2OUMA 3S8PA 1QO0D 2JVHA 2DI3A 1I3AA 2YU3A 4RM2A 4BYYA 4AD9A 2KRHA 1AOYA 2K7LA 1IV8A 1R49A 3DPLC 1ITYA 5JHUA 4L0ZB 1EH7A 3GTKJ 2CFOA 2EIMH 4Q5SF 4IHVA 4CGZA 2L0KA 3F8BA 2B7EA 5FGMA 2Z99A 4NC7A 3SZGA 3NNRA 4W1UA 1UG2A 2E2IJ 1TP4A 2JA6J 2FMYA 3SQNA 3CCJI 5KCMA 3FKJA 3K1MA 1R5GA 1DGWY 1T6SA 2DCEA 5DTDA 2DJNA 5HOOA 1WH7A 4UUSB 5FLVA 3RQIA 3W2AA 3FIWA 2O6GE 1YFHA 2W1OA 5E1XA 3LSPA 3KZYA 3KZIC 4XRMA 1EJ9A 3FKIJ 5HS7A 3HKZA 3EDPA 1MD0A 2HXOA 3E5XA 5D4SA 2ZOZA 3NI7A 2FRHA 3CP2A 3PQJA 1HXDA 2QQ9A 1DPRA 5D18A 2ZMEC 3GMEA 4LMYA 3BJBA 1SD5A 2X6WA 3R4KA 4HOBA 4G6QA 2VOOA 4CDGA 1AU7A 4XLCA 5GPAA 3QBMA 1U9NA 2F5VA 1WJFA 3U1DA 2HQ5A 1LE8B 3JRAA 2K27A 2OC6A 5JVTA 3IH4A 5KK1A 5LGNA 4V2GA 1S6LA 3I59B 3RI4A 5JI6A 2O9LA 1ETVA 1EA3A 3GTQJ 4BEHA 4ZZLA 3K69A 3DEWA 2IW5A 3QPSA 1PVEA 2R7OA 4ZZDA 3CCVI 5D8LB 3F8CA 3CWRA 4ZTJA 2F07A 1G4DA 2EFOA 3DBLB 4Y13A 5C4YA 3G56A 2GA2A 5M5XJ 1MDMA 4A5NA 5DYMA 1DUXC 2UXHA 1U5TC 2RQPA 1XMAA 2E7WA 1ZR2A 1JT0A 3E6BA 1XGOA 3VPRA 2DA1A 4MEXF 2ISYA 1MBEA 2BW3A 5HNFA 2YX4A 4DBQA 1CQTA 2GFNA 2VQHA 4FQGA 2VC0A 4DJAA 2WY8Q 4UB6C 3OYIA 2OBPA 1OISA 1Z0XA 4HLXA 4V2FA 5B5EC 1FMWA 3AL0B 4Y52J 4RLFA 2MSYA 3OWTA 3ECOA 4ZC3A 2PMUA 1MMNA 3N97A 4CYCB 1A5JA 1E17A 3BROA 3JTGA 2PJRB 3O8GA 2EPFA 3J81Z 3NXCA 3QODA 3KX2A 3V78A 3DU5A 2I8DA 3WTTC 1QHHD 1Z6RA 3KP4A 3K6GA 3HIMA 1HOMA 2EA2A 4KICA 1PP8F 1R4NB 2DW4A 2V1NA 5DCFA 3J80K 1TC3C 2DTZA 3T6NA 3TO7A 3HYIA 3K2AA 1VQ5I 3S16J 3J7AY 5ILSA 2QQ8A 1FSHA 3HXLA 2ZXHA 5CQGA 3D1NI 1IG7A 1I6HJ 3F3XA 1W7PD 3GEZA 3GTLJ 4O3MA 2VIXA 3BPVA 3FK6A 3VOEA 4Y4RA 1H0MA 3JW4A 3M07A 4BH9A 4RB0A 4PGGA 2NNYA 3HB9A 4B4CA 2HR3A 4A6DA 1FJLA 2X1DA 2XGEA 2QUFA 4HF1A 3DFGA 3MEXA 3CCEI 2VKVA 3HBLA 3X2QH 2KHMA 4LIUA 5LFAA 2M2EA 2F6CA 3RDIA 1LDJA 1VQ6I 2BY0A 3CF5F 2Z3YA 4LK0F 1K61A 3KCCA 2Z33A 4CGRA 3LSJA 4BQAA 3TDZC 4E7LA 2XF5A 1PYVA 2MD5A 4B09A 1NH3A 2PLYA 2IBDA 2R0QC 1LDDA 2YR2A 4OOIA 3FMRA 3ASNH 5EG0B 2R5YA 4ASNA 1AKHA 3ECHA 1KA8A 3LNQA 2E2HJ 4PUSA 3VVZA 4EJWA 1RESA 2A5WA 5HDGA 3HRMA 3BQZA 2K4BA 3OIPA 1FP1D 3KIOA 5EEGA 1VTNC 4KWAA 1LKXA 2IGMA 4BHBA 2P5VA 1HDPA 2QENA 4HQMA 4Q47A 2JK3A 2MW8A 2VLAA 1TNSA 3G71I 3L7WA 1ZQ3P 1PUEE 5BNGA 1OR7C 2H6CA 2B0LA 1FYKA 3SZPA 5L3CA 3WODF 5L3GA 1UZCA 4I0BA 1XDUA 4HEA2 6PAXA 1QA6A 4B47A 3WGIA 4ABZA 2CGPA 4FT8A 2DA6A 1QNTA 4RGUA 1ZLKA 4U87A 3A01A 1R00A 3HOSA 4IZZA 2Y75A 1TTYA 4HW0A 3FBIB 2HOAA 1H9TA 1GVDA 3JRIA 4WXDA 3C1DA 3SDGA 3M8JA 4UV9A 4BQNA 1IZ1A 3TOAA 2R7DA 2ZFUA 4Y3OA 4OINF 4C2MJ 2HDWA 4ZYGA 2K85A 2NAZA 4I02A 5E3LA 3RZOJ 1SD4A 2IGOA 2LG4A 1VQKI 3CCQI 1EH8A 1UHSA 4E7JA 4U9NA 1U9OA 2K9MA 1BIBA 4HV6A 1J75A 1DP3A 4N0BA 1XMKA 2LFBA 3EUHA 4KJZA 3HUGB 5GP9A 3TO9A 1W1WE 2KISA 1T8IA 2HPMA 4IRHA 1U2WA 1R22A 1ZR4A 2K02A 2IU5A 3W6VA 4BUPA 4IO9F 1X58A 5ERIA 2XPVA 1LDKB 2CQ7A 2X48A 2XB5A 3JRCA 2W00A 2OV7A 1IXRC 2F4OB 2HVQA 4ICHA 1R5ID 1SGMA 2IA0A 2VE8A 2W4SA 3PFYA 2DFEA 5LGUA 2LD5A 4XLHA 5HAWA 1ZHFA 1SD7A 3S1NJ 1G2HA 3CMMA 2NVQJ 5BOXA 3OYCA 1IRZA 5F6FA 5L3BA 3NAUA 4HX8A 2K86A 2R7SA 3N4MA 2B1EA 2OAZA 3K7AJ 3CCSI 2OJED 2FMLA 3JRFA 4IHSA 3C7JA 1B6AA 4X0GA 1QRYA 3BP8A 5FD5A 3TW6A 3OYAA 2Q2EA 1XSXA 4EATA 1BN5A 1K83J 1ETOA 2W57A 1MNEA 1S29A 3IWFA 1HF0A 4QIWN 3WTVC 5J8CA 3P9IA 4BNCA 4I98B 2QM3A 3VW0A 2O8XA 1WWXA 1BC8C 1KU2A 2IA2A 1N75A 2CWEA 2EZIA 4XN3A 1LPQA 3HTIA 3AFHA 2EZHA 2O3FA 2VJIA 3A02A 4ESJA 1O3TA 1I5ZA 1LQ1A 2IS4A 2M0MA 3PL8A 5E20A 3AQTA 3EUKL 4FE7A 3AG4H 5J47A 2MLKA 3JSPA 4EJUA 1I3QJ 2OZUA 1V4RA 3HOZJ 4C3HJ 1HLVA 4FISA 2BXYA 2VBYA 2VPRA 4QPOA 1KYWA 4S05A 3OSFA 1MJBA 3FK7A 2LF7A 4XL9A 2QBYA 1WVRA 3ZQIA 2K4JA 3GZIA 4CXFA 1CGPA 1B8IA 3PNTA 4CICA 2MABA 2ZCNA 3PO3J 4UNOA 2D1HA 3MCZA 2CJJA 4YIFA 4YIRX 1WSUA 3BG9A 2DA2A 3GFLA 2V1DA 3BZ6A 1H9GA 3LMMA 3A0BC 1IRGA 2W48A 1WJAA 2DQLA 5DCMA 4D1QA 2D5VA 3BG7A 2H1KA 2D2WA 1G3YA 4RDUA 2CH0A 2R7FA 5GPCA 1S72I 1ZRDA 4JX4A 4XLNF 5EFYA 2F5EA 5FLXK 4DNCA 3MWMA 3NS4A 1ULYA 4WF2A 1X1PA 2DPUA 2WA0A 1ORKA 2WV0A 2GLOA 4A2UA 3CUOA 3DV8A 2V1UA 3S2DJ 2XKOA 4JKZA 3BY6A 3NWTA 5D8KB 1RR8C 2CU7A 2V1XA 4A3IJ 1X4PA 3DPTA 4L9JA 1ETQA 3HHHA 3VUQA 1IN5A 3WTYC 2HDCA 5KNLA 1VQNI 1QVUA 2UV1A 1E0EA 2ID3A 3LL7A 4NBQA 3Q9SA 4L18B 3GLLA 5C44J 4UV8A 3H5NA 1HSJA 2C6YA 1F1ZA 3EUHC 3P5JA 3ISPA 3TW7A 4WIBA 5DM6F 2JUGA 1IDZA 4A3FJ 2ESNA 1ZN2A 1HC8A 1R58A 4ACIA 1MW7A 1X1CA 2DDBA 2LP0A 3GVAA 3KPHA 4YFNF 1BW5A 4XQFA 1SVMA 4KFCA 3HOYJ 3EETA 1Y6IA 3J7AO 2VXDA 4A0XA 1P6RA 1I27A 2WV1A 2XAUA 3HIFA 1OMIA 4U7BA 2DG7A 2AXTC 2LH9A 5AONA 2DQRA 2EV5A 2P8TA 1XGNA 4ESBA 5IT3A 3IUVA 2H94A 1GLNA 3K1PA 4N4NB 2OERA 3QPTA 3R0JA 3LFKA 1RRJA 1X3WB 2ELJA 4LIVA 3DP7A 1KZHA 4B8XA 1WI3A 2DMPA 1HA8A 3J81K 2JPBA 5CYVA 2W82A 1OFCX 1X2MA 2VKEA 1YOVB 2VBWA 4XN0A 5EEHA 3HOUJ 2CUJA 3CUQB 2DOAA 1BR2A 2E1MB 4AYBN 1JJ6C 2HDDA 4UDSA 4NDLA 1YO5C 3ERED 4AF5A 2DYRH 3G2BA 2KL4A 5F0HA 5GTIC 3G6EI 2PG4A 4BJ5C 3D5RC 3SFIA 4EMSA 1QU3A 2JZYA 1Z21A 4M6VA 3ZQLA 3CC4I 3M3YJ 2AXLA 4I09A 3I58A 1XD7A 2G7GA 1Q1HA 3NQOA 1BOAA 1USSA 2R7TA 2FA5A 3ZMVA 1K7AA 4AC0A 4LITA 3S3OA 4EV0A 4YRVA 3C2GA 2EH3A 2CW7A 3H3ZA 2RAEA 2V7FA 2CUFA 3KYCB 5LLQA 4ENNA 2Z2SB 3I54A 3HPGA 5IY5H 5ICCA 1AWCA 1MSEC 4S04A 2KIUA 2VI6A 3VYRB 5FLXZ 1BI2A 3E0JB 1P2FA 2DBBA 3COLA 3HTUA 4YFXF 4JP0A 4K2EA 4PJ0C 2RVCA 5CXGA 3GXOA 1MBJA 3V8KA 4WX9A 1GT0C 1D3YA 5HBUA 4KIFA 1RUNA 5F0CA 3GYHX 4L9TA 3GTPJ 2MC3A 3DQVC 3RYRA 4HNUA 1H89C 2FBQA 5M5WJ 1KYZA 2GBYA 2CQQA 2FJ1A 4IHWA 2QLZA 2W24A 4N4OB 1WHUA 2LR8A 2JA7J 4UXNA 4A69C 2JRTA 1IRXA 4L0YB 3PASA 2CQNA 5F64A 4BE2A 2K9LA 4JX6A 2JVGA 1T2KA 2IS2A 3ML6A 2G9WA 2FSWA 1VQLI 3OIQA 3F72A 3KETA 4BJ6C 4CCLA 3L1PA 3HTHA 2EK5A 4HZFA 4MXMA 2KMUA 2VE9A 1R23A 3CP8A 3RKYA 4XKCA 1VZ0A 4OD5A 2IGKA 2FEZA 4AYBA 1MNMC 2GXGA 2L7MP 4HNTA 2OQGA 3FWEA 2LRDA 4C2MA 3NWSA 2L54A 2QWWA 3OS2A 1B1BA 1TQIA 4M9XA 3T5XA 1J9IA 3FF5A 4IQ4A 2H09A 2OU2A 1U78A 4DYQA 2M9HA 3ABKH 4XLEA 3S5RA 1T08B 1J2XA 3O2PE 2DFFA 4GYIA 4M74A 5A2QZ 1W36C 5J1UA 1ODDA 5FRNA 1D8JA 3NEUA 1MH4A 2P7CB 4KITB 3LWJA 3DCFA 2PJPA 1KGSA 1R1VA 4M73A 4CZZA 1HBXG 4XKWA 2OCCH 3ZGKA 2GAUA 3BCAA 1ZARA 4BU2A 4E4HA 3SWHA 4MK6A 3ZR8X 4DIQA 1XC5A 3HRUA 3JRBA 4F93B 3CLOA 1XCBA 4HV5A 4ZDPA 4XRSA 4PK4A 3DLAA 1MBHA 1VQ9I 2A3SA 2RNGA 5CJ9A 2VKDA 4I2OA 3G4SI 1RUOA 1D0ZA 5EZHA 5IYDJ 2RC4A 3OYEA 3RPQA 4AUXA 2XVCA 2REKA 2XSJC 4WXHA 2M7AA 2QWTA 2L5QA 3MD2A 2HOTA 3WU2C 2LOOA 4EJOA 2OI8A 4BL0B 4CYDA 1HKSA 1FLIA 2ZSIB 3FXJA 3MKWB 2E2JJ 3F22A 1R1UA 2VASA 4CH7A 1MBFA 5DCMB 4OIQF 3ELKA 1DGRM 1LB2A 4HKUA 5IPAA 5E18F 2EV0A 1XGSA 2MFZA 2ZMEA 1KU9A 2A61A 5DUIA 3IWZA 5TGTA 1FBSA 1S3JA 3OV8A 1I1SA 3CZ6A 2EV6A 2L9RA 1FSEA 3A2KA 1WJ5A 2WB1A 2RHAA 3K4LA 3H0GJ 4F91B 5J40A 1P4AA 1UHWA 5FKMA 2OQRA 4NB5A 2PN6A 3NRGA 5IP7J 1IXCA 2WBMA 2F4MB 4AIKA 3JTHA 4P96A 1P92A 2VN2A 3HOXJ 4NUBA 2BVMA 2ZCMA 1UFMA 4HSTA 4G7HF 5FHPA 3H35A 3LA7A 5C4XJ 4P9FA 3ZN0A 2KZVA 2Q0OA 1T98A 3D5LA 1SFXA 3KEOA 4RS8A 5FKOA 4DYCA 3GFIA 1Y39A 5IYBJ 1D5YA 5DM7F 2Y0MA 3FRQA 2M45A 3RKWA 3ABTA 4UVBA 3OL3A 1FNNA 4KYWA 1XTAA 5L3DA 2BYVE 2VKHA 2Z9OA 1FP2A 4L5IA 4JK1X 1SFOJ 3C3WA 3RZDJ 1SVOA 3V4GA 2L7ZA 2M4KA 4XORA 1P9QC 3U2RA 4Y7NJ 4P9UA 2B3WA 3T8RA 4I6ZA 2WTEA 3OY9A 1BR4A 3QYFA 4NELA 3GF2A 4D5CA 4CZCA 4AVPA 4YG2F 2F48A 3KFWX 4KA4A 3LA3A 5J8FA 3OYBA 2R5ZA 1OCPA 1UJ8A 3NARA 5ILVA 1B4AA 2LY1A 3CCRI 3KNWA 4IOAF 4CO8A 1V54H 5LGTA 3VW1A 5DD4A 2RREA 4IQJA 4U9LA 4ITVA 1PJRA 4U0WA 4BE1A 3HTAA 1JT6A 3R6SA 1TT0A 4AWXB 2DA3A 3K1NA 4PSXA 3SFZA 2LK2A 1VQOI 3K4KA 3HUGA 2FOKA 3CO6C 1AKHB 3FXOA 2X0LA 4JBAA 1A04A 4NC6A 2Y48A 1BJZA 2X1EA 5D5VB 1MGTA 5CW8A 2PBXA 3BJOA 1M1EB 3KZZA 2VQLA 3ZN1A 1OCOH 4G12A 2K40A 2O0YA 1D1BA 3WHBA 1X1AA 3GZ6A 2M3AA 3DBRB 3IH3A 4GCVA 5DV5A 4HX4A 1RIOH 4AC6A 4D9JA 3VIBA 1S7OA 1OYWA 3HGGA 5EF6A 1R71A 2MA3A 1NG6A 4JOMA 4OD4A 3QOPA 2HYTA 5E8IA 4JL3A 3IRQA 2EFQA 5KAFC 1FTTA 3L2RA 2DLLA 2NS0A 2KJBA 3Q3SA 1DU6A 2A05A 2E34A 2GIZA 4CCNA 3FX3A 1X1BA 2KJCA 2Y0SN 4LD5A 1IC8A 1JI8A 3OYKA 3MMYB 2JSPA 1K4SA 2DMQA 2ZXIA 4XSZF 4FASD 2ZNZA 2NVXJ 4EQQA 3PUBA 3VOXA 2XUBA 4XKBA 1JKOC 1G59A 2XPWA 3B02A 3ZQCA 3V7CA 1YQAA 1BBYA 2J5PA 4KMUX 1FWZA 4ENJA 3MKZA 5IOZA 5J1RA 5CQEA 4CA0A 3VW2A 1QVTA 1ZH5A 1J5YA 3TP3A 3WGHA 5FMPA 1FZPB 3L2CA 2L7KA 3O3KA 1O3QA 4LB6B 1P7JA 5M5YJ 1E3HA 1MBGA 1XGMA 2LF8A 3RYPA 1MH3A 3M1CA 4UUTA 3IC7A 3I53A 4M9SA 1J0RA 2BHYA 2DXIA 4RBOA 2NXNB 3O60A 1LFPA 2CG4A 3ERMA 3AKZA 3KP5A 4A3BJ 1OJLA 2VJ5A 3UKGA 1W5CC 1UI5A 1UMQA 3PNVA 3BZCA 1T39A 3W2VA 4C2UA 1SANA 4HG2A 2VL8A 4ZDLA 4E6KG 3K4BA 3B73A 1ETYA 4EM0B 3BR6A 2M8EA 4I76A 4C3IJ 3QKXA 5D1RA 2XHKA 3LAJA 2A6EF 1JUMA 2EZLA 3PSIA 4BBSJ 3BCGA 3DEEA 4XSXF 5BPIA 2MGQA 2DT6A 1KU3A 3VYTB 1B8IB 2A5YB 4M3BA 3DKYA 3ZQQA 2F5CA 4IJAA 2COMA 2XC7A 2NVUB 1ZG5A 2OTLI 2ZKZA 2LSOA 1U6GA 4FX0A 3S1MJ 3HHGA 3CCMI 3BWGA 2HZDA 2KPMA 2JPCA 1RI7A 4A93J 2PI0A 2FD5A 4M6XA 3T8TA 3OYGA 2ECBA 2GWRA 4U88A 2HYJA 5CVIA 1ETKA 3QPHA 4FX4A 4IHYA 2DU9A 4J19A 4EEFG 2PMHA 3V42A 3WGGA 5H6QA 5D4RA 3SZTA 2FF4A 1Z67A 3I9V2 2HI3A 2JA8J 3P9TA 1XB4A 2EILH 2PMZA 3LHQA 2IGNA 3DXJF 1LE8A 4OIOF 2Z16A 2HQNA 1YLFA 4YIIA 2CW8A 3UR3C 2LDUA 3A01B 1MSFC 3H0DA 3CCUI 2VODA 1YIOA 5D6FA 4BXXJ 3S2HJ 2LC2A 2UXXA 3K4JA 2CV2A 1UCRA 4QSHA 4A3KJ 2E1MC 3DBHB 2DDAA 3VVXA 1MMGA 1YX5A 2XGXA 1VF9A 1Z91A 1SMYF 4HAMA 3B6CA 3BQYA 1T0FA 1YE9A 5LEKA 5KAIC 2K9QA 3F8FA 5EZGA 4IXAA 4GRIA 4IVNA 3FXLA 3PSFA 5FLMJ 3ZRGA 4AIDA 5E3MA 1RKTA 4PFOA 3HL2A 4XM3A 3K70D 2DA4A 4N9IA 1J09A 2OD5A 2RV8A 4GCTA 2O03A 1STZA 1KU7A 3C18A 3WU1B 3BDDA 2VQGA 1RR7A 1OCCH 5TRDA 4KN7X 1YJNI 1D0YA 1R9TJ 4J00A 3BPXA 1QZEA 2R5ZB 1QBJA 1VQ4I 2UWMA 4O6JA 3WTSC 2R5YB 4PJNA 2HNHA 4M3FA 3F0CA 2Y31A 4DZJA 3FXMA 5EEAA 3HM5A 3I55I 3CMAI 3CMEI 2XRLA 4DGWB 2XRNA 4BKXA 2CV1A 4MTEA 3KP2A 2I10A 3DKXA 3BT9A 4P55A 4BXFA 3EUAA 3DEUA 1YW7A 4FCYA 2V79A 5J3LA 3OYFA 1LVAA 1REPC 1YG2A 1W7PB 1IN7A 2LTPA 5J4VA 1SEUA 4LLNA 2R4GA 4RB2C 2DG8A 2VPLA 3LSRA 3W2WA 4A6EA 3DU6A 1B9NA 2W25A 3MFKA 1HCRA 4Y15A 3HSEA 2ESHA 1FBQA 3P7NA 4G7ZF 2WAFA 3E6DA 4ZJZA 4UVAA 1FOYA 3K4CA 1Z1DA 1IGNA 3WU0A 3ZMZA 2W85A 3D0SA 3AG3H 4F55A 3FXQA 2CQXA 3VOKA 2X1CA 1HDDC 3QP5A 5ICEA 2DODA 1RZ4A 3AG2H 1FOWA 2XDNA 3G7RA 1I1GA 1MNDA 2ME6A 4MTDA 3WG7H 1WJBA 5AIPA 2E1NA 1SAXA 1F5TA 3EUPA 2MG4A 4GFBA 3C07A 2K5CA 1YJWI 3I59A 4DYRA 3ZMSA 2DN0A 4G94A 2GOXB 1JTXA 2RQQA 4EJTA 4PDKA 1WJCA 4EM1A 4A3LJ 1XCVA 1F9NA 2HOSA 3GTOJ 2E71A 5FJ8J 2ZJ2A 4MGRA 4EJVA 3S1RJ 1JHHA 1HW1A 4E7SA 4EVIA 2ADUA 4QLCU 2RKHA 2DO7A 5DUKA 2HWVA 2VJJA 2XV4S 3CDLA 3EPZA 1YYVA 2D45A 2NP3A 1T38A 1S7AA 3KZ9A 2LMDA 2G0EA 2GUHA 2ZCXA 2FX0A 4BAYA 4D7NA 3UNGC 1C0WA 3SXYA 1A35A 1TQPA 3IAS2 3DTEA 3T1BA 3JRGA 4MQ9F 2R7QA 3O6BB 2P5LC 3U21A 3N05A 4BDZA 1CF7A 4XLPF 4EGZA 2IAIA 2JA2A 2L9VA 1GDTA 1P4XA 2BBYA 4QWQA 4LG3A 4R1HA 1Y1WJ 2P6SA 4IKFA 4BXUA 1IV6A 1XS9A 1F4KA 2EWNA 3BG3A 1ZLJA 1X2NA 2HPIA 3HPHA 1TWFJ 5D5WB 2K9NA 3R61A 3BC8A 3TMOA 2V6EA 1IJWC 3MZYA 1W0UA 2XASA 2KT0A 5E79C 3RCOA 3ZP5A 1FC3A 5IYCJ 1ZGWA 1D1CA 4CCKA 3GUDA 2FE3A 4ZH4F 1Y0NA 3LA2A 3WTUC 3K9TA 2YUSA 1O7FA 5ICGA 3JSOA 3MZHA 4PFPA 5FFXA 3H5RA 3OIOA 1YTYA 2JWTA 2BXZA 4CYCA 4MHGA 4A3GJ 4Q4ZF 4OMZA 3MNLA 2Y2ZA 4MFEA 3E7LA 3RPUA 1ZK8A 4P5OA 2FBKA 4AIHA 2IVMA 3M8EA 3QYBA 5CVUA 5FO5A 3OS1A 5K58A 1RC9A 1Z77A 1IUFA 5F08A 3PQKA 2ZJPF 3M7GA 1W36D 1I39A 1KQ8A 3TBIA 2UZKA 4JQFA 3ANGA 5FKKA 1MDMB 4IHTA 4BJTA 1BJAA 1X1DA 2Y30A 3TKYA 4KIGA 2L02A 1IAWA 4IRVA 5DD8A 3DF8A 5HDKA 2G7LA 3CESA 3OYJA 4YZEA 1BW6A 2CRGA 4M3EA 4YFKF 3S32A 4ENMA 3FMSA 3I0TA 3K4NA 5LBQA 3AQSA 1BI0A 3VSLA 3F6OA 4ZTFA 2QA4I 2NVYJ 2CUZA 4KNYA 1KQ0A 1W7PA 3Q0VA 1W5SA 3QP6A 1IW7F 1BI3A 3LQQA 1KONA 1W4MA 4OIRF 1SC7A 3IKTA 3BG6A 1QGPA 2R3SA 4NQWA 2QZ8A 2DFIA 2V9KA 4GYGA 3JRDA 3V6GA 1J7KA 3GZ5A 1LFBA 3TL4X 2CS3A 1WKMA 1NK2P 4ZYDA 3I4MJ 1ZKGA 1MKMA 3FXUA 2BOLA 2DA5A 2KLOA 2W84A 3VTIA 1TWAJ 4II2A 1G3TA 2EBIA 2OTJI 1O57A 4IL6C 2ZSHB 3M9AA 3KEYA 4PJJA 4F3QA 1G6NA 2DTRA 3HEFA 3OL4A 3K10A 4F92B 2XAFA 3CUQA 3HSRA 2HU9A 1RKWA 3ZPLA 2M30A 2CMPA 1ZREA 1FX7A 4E70A 2EQRA 1OQYA 1LUJB 2QGUA 2HEOA 1IUYA 1WFXA 3Q0WA 4WWCA 4OIPF 5IT9Z 4I01A 4I0AA 2RGVA 2MD0A 3PM1A 3TOBA 4BGDA 3Q5FA 5EG0A 3DPJA 5HODA 2KQRA 3GCMA 3HGYA 3NPIA 1FMVA 3CC7I 3QWLA 1SD6A 4DW6A 2VT3A 4HNVA 4BHPA 3JAMZ 1FEXA 2LYCA 2DMTA 4GDFA 3CD6I 3CF2A 1NTCA 3SDBA 3HOWJ 3FM3A 1S7EA 5E1ZB 2NS8A 1GV2A 4DOZA 5AQCA 5BQTA 5J6XA 3S1QJ 3BR5A 2L4AA 5B1BH 5K1YA 2GZWA 2ID6A 2TDXA 2QBYB 3S17J 2O7OA 4OMYA 4UB8C 1S9HA 5HS8A 2HOEA 5H20A 3ZXSA 5GTHC 1K6OA 3LWFA 2DYSH 4EGYA 2HGCA 5K7FA 5HLTA 3F8MA 5E1WA 1U8RA 4XK4A 4BQQA 1T95A 3QAHA 2P6TA 2IS1A 3FXKA 2HKUA 4RAGA 3ON2A 4GCKA 2WAEA 1R4MB 1ON1A 2TCTA 3HOTA 2UUZA 1OPCA 1S8NA 1BIAA 3ZQ7A 2WAQA 2HFHA 4Z6YA 1HW5A 2WADA 3ZQHA 5M3MJ 2Q1ZB 3QYEA 1DU0A 3KLNA 2NYXA 3RSNA 2HQRA 3FHZA 2Y0SA 3VDXA 2OA4A 3U1KA 3M4OJ 1PDNC 2Q8KA 3FHNA 4TV7A 2NVTJ 3WG9A 2MYSA 2VBXA 2V9PA 3S3MA 2GXAA 2NNNA 3CRJA 1XSVA 2I5UA 4NNJA 1R6RA 2WWYA 1IRFA 2IRFG 5D5XB 3KKCA 3FBNB 2ETHA 2JRMA 4H4KC 4IRGA 5FKNA 5CVVA 2FBIA 4IPAA 3V7SA 3OR1C 2QCOA 2UXUA 2KRCA 3H5AA 3PIOF 2DFHA 2L2OA 5FROA 2ECCA 3GBGA 5HVQC 4HRIA 3G1OA 4E7IA 1FPQA 2IT0A 5TISC 1VNDA 3QU3A 3BRUA 2CO5A 2ZBKA 2KIQA 1TWGJ 2ZC2A 1ZELA 1ZTRA 3I3LA 3H92A 5IOYA 3J7ZI 4RAYA 5JHFA 4N9HA 1SFUA 4CSWA 1G3SA 2JUCA 3SEQA 1OLTA 1J59A 2E7XA 4A0YA 3LOCA 4X6AJ 2YVXA 4M71A 3OS0A 5D5UB 3CJQB 4KISA 2Y69H 1EF4A 2OCEA 2X9DA 4FTHA 2VJ4A 2XKPA 9ANTA 1H8AC 2UXNA 1YITI 1BC7C 5DEQA 4IHXA 2NOJB 1MMAA 3DKWA 4R79A 4WK8F 4QPQA 5HLHA 1BOBA 5BPDA 3MZ8A 2W7NA 1VQPI 1NHAA 2HTSA 5HS9A 3D5SC 5K5OA 2BY1A 2YU9J 1D0XA 3M1EA 1HW2A 3CTAA 4B43A 3DLLF 3E97A 4S0HB 1D1AA 2CW0F 1DP7P 4M72A 5CVRA 3WE2A 3MKLA 1PUFB 2QKLB 1AA7A 2BE5F 4X1EA 2ZXJA 3E3VA 3JR9A 2Y9ZA 2PFBA 4KDPA 2R92J 2KKOA 3V8LA 5EJCA 3R0AA 4HX7A 2ZB9A 3HRTA 2VT2A 4MFDA 5CKTA 5EGOA 5J1YA 3I5UA 1MMDA 5EYRA 3BR1A 1MJ9A 4HSRA 5FD6A 3A03A 1V5GA 5K5RA 1H88C 1NK3P 3PUFA 2JMWA 2KDZA 1QHGA 3H3VK 2H6BA 4UHTA 1MIJA 2CYYA 2IJLA 4II3A 1FBUA 3CUQC 4RB1A 1ERDA 2BGCA 4IX7A 3Q0UA 3F6VA 5L3FA 3H1CA 4G7OF 4UUSA 3BR3A 2FNAA 5LEJA 5B66C 3BJAA 5E3OA 3L2QA 2JSCA 4NN1A 4UUVA 1B72B 2A2FX 5ICFA 2J5OA 2CSOA 2IP2A 4LB5A 1GUUA 3BR0A 2OPTA 3M8FA 5IP6A 2XAJA 5BS6A 1G8XA 3DPUA 3OOPA 1R36A 3HKZN 4BDYA 3ANPA 4M3DA 5IT9K 4YELA 4XICA 1JJ8C 1GXQA 2PEXA 1GHCA 4G9YA 2LKXA 3CO7C 4RGXA 1ONVA 3K0LA 4RAFA 3RTRA 5JLWA 4Q48A 1LNWA 1MMSA 2H8RA 4XOTA 2E60A 3MVPA 5FGLA 1IDYA 5KHDA 1FT9A 2K3FA 1B72A 2GQQA 2RASA 2N8GA 3I71A 4MNUA 4KT6A 1OKRA 3K4MA 2OF7A 3MQ0A 5GAHJ 1D8KA 4LOCA 3SEZA 3WTZA 1R5HA 2EJRA 1VQ7I 2F5DA 1WH5A 4A3EJ 2XAHA 5LD2C 2EB7A 5E3NA 2L9SA 2XAGA 4I7HA 3RJPA 1SMTA 3BJ6A 4BQOA 4ME9A 3BR2A 2KDOA 1YW8A 2HS5A 2P7VB 3E1SA 3KYDB 3SYTA 2RNJA 2LBFA 5IP9J 3ABLH 4PJMA 4LG0B 3SHFA 5ED4A 3K8PC 2LREA 5F27A 2O8KA 4PZJA 3I4PA 2Z1DA 3WTXC 1WJEA 2HXIA 4AU7A 3ZQFA 4OWRB 3F23A 4RM3A 1DQUA 1U3EM 3F9KA 3FXRA 2DAOA 2GM4A 4BEHB 5LRSA 5H9TA 1DPUA 2ZMEB 1BL0A 4YEJA 1HSTA 4HYEA 4MQVA 2ISZA 5F1RA 2HVRA 2FXAA 2STWA 2M0CA 2MH9A 1YRNB 3BTIA 1X3UA 3P9KA 1R1TA 5CLSA 3F21A 4FHTA 3BTLA 2DT7B 1Q1VA 1JKQC 4GFLA 3G1MA 1WPKA 3OOUA 2YS9A 3TQNA 1O4XA 1SFKA 1TBXA 2EFNA 2ZCWA 3VWBA 2NP5A 3GLXA 2XGDA 1I50J 1TWCJ 4XKVA 2L7FP 1Z9CA 3CQZJ 1A36A 3GTMJ 4MEYF 2A69F 1XPXA 4CHUA 3LJLA 1MJAA 3H36A 4AIJA 3H3UA 2AS5F 3J7YJ 3Q9VA 1OYIA 2Q24A 1Z6TA 4ENKA 2IS6A 2PZ9A 2JN6A 3H9JA 4XLAA 2LKSA 4LGWA 2FU4A 4XMYA 2QYOA 4ZYHA 4BY7J 1K6YA 1TW3A 3CDHA 3KP3A 3WE3A 4A3MJ 3RKXA 1U5TA 2EZKA 2NX4A 2EA4A 3BTCA 3L09A 1IXSB 2WY7Q 3BG5A 2X6XA 4LJZF 2RN7A 2R7XA 2A6HF
chains in the Genus database with same CATH topology
3S1RJ 2E19A 2EH3A 3MN2A 1YRNA 1POGA 2RAEA 5CXIA 2G3BA 2CUFA 1MSEC 1U8BA 2VI6A 3CDLA 1W0TA 4DZPA 2NP3A 2WUIA 2W53A 3HE0A 3COLA 1MBKA 4JP0A 2XPUA 4B3AA 3PO2J 3KZ9A 3PPBA 1WGXA 2G0EA 1QPIA 5CXGA 2GUHA 1MBJA 2QKOA 2ZCXA 2FX0A 4D7NA 1GT0C 5HBUA 2UXIA 3JRGA 3CJDA 5F1JA 1ITYA 4JNNA 4L62A 3GTKJ 5F0CA 3FISA 3GTPJ 1H89C 2FBQA 4IHVA 5M5WJ 2IAIA 2GBYA 2CQQA 2L0KA 2FJ1A 1GDTA 4A3DJ 3NNRA 5D19A 4IHWA 4W1UA 4XRSG 1UG2A 4XIDA 2E2IJ 1Y1WJ 2LR8A 2JA7J 2JA6J 4A69C 5DTDA 2DJNA 5JLXA 3PASA 1WH7A 1IV6A 1XS9A 4UUSB 5FLVA 3RQIA 3BG3A 3FIWA 4JX6A 1X2NA 1TWFJ 3GTGJ 2K9NA 3LSPA 5DS9A 4XRMA 3FKIJ 1IJWC 3RKQA 2XB0X 3L1PA 1W0UA 2KT0A 3HTHA 2HXOA 2K9SA 5IYCJ 4MXMA 1ZGWA 2ZOZA 3E7QA 3NI7A 3C2BA 5M3FJ 5C3EJ 5D18A 1MNMC 2L7MP 2YUSA 3BJBA 1AU7A 4W97A 3OIOA 2JA5J 5GPAA 3QBMA 2JWTA 1U9NA 2P81A 4CYCA 4A3GJ 2M8GX 1ETXA 2HQ5A 1LE8B 3JRAA 1U78A 4DYQA 2M9HA 3IH4A 4V2GA 4GFLA 3MNLA 3S5RA 4MFEA 2Y2ZA 2O9LA 3E7LA 1ZK8A 4M3GA 1ETVA 5J1UA 3JRHA 3GTQJ 3ON4A 3DEWA 3QPSA 5K58A 1MH4A 1Z77A 3CWRA 2F07A 1WCMJ 3OSGA 3DCFA 3LWJA 1IUFA 5F08A 4FE4A 3TP0A 5C4YA 1A6IA 2YVEA 3ANGA 3G56A 5FKKA 4MK6A 4JYKA 1XC5A 3JRBA 5M5XJ 3S14J 2Y30A 2UXOA 2UXHA 4XRSA 1ETWA 1MBHA 1JT0A 1ZR2A 3VPRA 5EZHA 5IYDJ 2DA1A 4AUXA 2G7LA 1MBEA 2REKA 2YVHA 4YZEA 1CQTA 1BW6A 2GFNA 2QWTA 2CRGA 2HOTA 4M3EA 2OI8A 2AO9A 2ZOYA 1Z0XA 4V2FA 4BY1J 3GTJJ 3QPLA 3TEDA 4Y52J 2MSYA 3AQSA 4CYCB 2E2JJ 1A5JA 3B81A 2NVYJ 1MBFA 1F36A 4A3JJ 3Q0VA 3O8GA 1JKRC 3NXCA 4HKUA 5IPAA 3BTJA 3V78A 3CCYA 2DA7A 3JRDA 3V6GA 4D7MA 3JREA 4L5EA 2QF7A 3HIMA 1HOMA 1LFBA 1NK2P 3I4MJ 1ZKGA 1TC3C 2DTZA 1FTZA 3T6NA 2DA5A 3K2AA 2L9RA 2XGCA 3S16J 1TWAJ 2Y9YA 2EBIA 2RHAA 3D1NI 1IG7A 3H0GJ 4B1RA 1I6HJ 5FKMA 3GTLJ 3VVYA 2ELKA 3NRGA 5IP7J 3HEFA 3HOXJ 1RKWA 3FK6A 2ZCMA 2EQRA 5FHPA 3HB9A 4B4CA 5C4XJ 1FJLA 2XGEA 3Q0WA 4GFKA 5FKOA 4DYCA 2DMNA 1D5YA 5IYBJ 5EGOB 3PM1A 2JJ7A 2VKVA 1JTYA 3HBLA 2R93J 3FRQA 1JUSA 5EG0A 3DPJA 2M2EA 1F43A 5HODA 3HGYA 1PUFA 3NPIA 1SFOJ 5DAJA 3EGQA 4DW6A 1K61A 4HNVA 4CGRA 2LLKA 3RZDJ 1FEXA 3HTJA 2L7ZA 4Y7NJ 3LSJA 2DMTA 2E1OA 4I6ZA 1NTCA 2IBDA 2R0QC 4NELA 3HOWJ 4D5CA 1S7EA 2NS8A 5EG0B 2R5YA 1GV2A 1Y1VJ 5AQCA 1AKHA 2R5ZA 3S1QJ 1OCPA 3BR5A 3NARA 3LNQA 2E2HJ 3KNWA 2WAQN 2WB1N 3VVZA 2ID6A 3CMYA 3S17J 2O7OA 3VW1A 3HTAA 1JT6A 1RESA 2GENA 2G7SA 2NOGA 2DA3A 3QQAA 3BQZA 5K7FA 4D5FA 3RD3A 4KWAA 1VI0A 2LK2A 4XK4A 4C3JJ 3BHQA 1HDPA 3BNIA 1AKHB 2JK3A 2MW8A 2TRTA 2HKUA 3ON2A 4GCKA 2TCTA 1ZQ3P 1BJZA 1JKPC 5BNGA 5CW8A 2PBXA 5M3MJ 3ZQHA 1DU0A 4G12A 2K40A 3WHBA 1E3OC 3GEUA 3M4OJ 3IH3A 1T56A 1T33A 4ABZA 2NVTJ 2DA6A 4AC6A 3VIBA 1RPWA 5K7HA 3A01A 2VUMJ 3CRJA 3HGGA 5EF6A 4A3CJ 1JUPA 2HOAA 3KKCA 1GVDA 2HYTA 4JL3A 3JRIA 5FKLA 3SDGA 1FTTA 1DU6A 3Q3SA 5FKNA 2NS7A 2Y0SN 2QCOA 1IC8A 2UXUA 4C2MJ 2DMQA 2ECCA 3GBGA 3G1OA 2NVXJ 5E3LA 3RZOJ 3HDDA 3VOXA 1UHSA 1VNDA 1JKOC 1U9OA 3S15J 2XPWA 3BRUA 3ZQCA 1FIPA 1TWGJ 1ZTRA 4MO7A 5IOYA 2LFBA 2B63J 1XG1A 1AHDP 5GP9A 5IOZA 5J1RA 3VW2A 1QVTA 3TP3A 4IEJA 1ZR4A 2IU5A 5FMPA 3IV5A 1ENHA 1P7JA 3LOCA 3W6VA 4X6AJ 1X58A 5M5YJ 1EF4A 1MBGA 2XPVA 2X48A 2X9DA 1MH3A 2FQ4A 2XB5A 5K7ZA 3JRCA 4FTHA 4UUTA 9ANTA 1H8AC 4RBOA 4ICHA 3O60A 4IHXA 1SGMA 4A3BJ 1OJLA 1APLC 3UKGA 4QTRA 1UI5A 1UMQA 4MLOA 2LD5A 5HAWA 3S1NJ 1G2HA 2NVQJ 5EDNA 2YU9J 1SANA 1IRZA 3NAUA 1ETYA 3KKDA 3BR6A 4I76A 4S0HB 4C3IJ 3K7AJ 3QKXA 5D1RA 2QOPA 1JUMA 2EZLA 3JRFA 3MKLA 1PUFB 4BBSJ 1BA5A 3BCGA 1QRYA 4X1EA 3TW6A 1JGGA 2MGQA 3JR9A 2Y9ZA 2R92J 3B6AA 1B8IB 1K83J 2ZB9A 4MFDA 1ETOA 5EGOA 5J1YA 4M3BA 5EYRA 4QIWN 3BR1A 1H88C 1HF0A 3A03A 2QTQA 1NK3P 2JMWA 4BBRJ 3IH2A 2KDZA 1OCTC 3H3VK 3S1MJ 3VW0A 2O7TA 2AHQA 2EZIA 3HTIA 2EZHA 3A02A 3Q0UA 3VP5A 4A93J 1VFCA 2FD5A 3ZOBA 1UI6A 3AQTA 4UUSA 2ECBA 3BR3A 5F04A 2HYJA 4FE7A 1ETKA 4IHYA 1I3QJ 3HOZJ 4C3HJ 5E3OA 4J19A 4FISA 4EEFG 1HLVA 4NN1A 1B72B 2VPRA 4PXIA 3P9TA 2HI3A 2JA8J 3OSFA 3LHQA 2M34A 3FK7A 1LE8A 1GUUA 2OPTA 3BR0A 1P7IA 5IP6A 3ZQIA 1LFUP 3GZIA 1B8IA 3HKZN 3A01B 3G1LA 2ZCNA 3PO3J 1MSFC 2ME0A 3ANPA 2CJJA 4M3DA 2LY9A 3BG9A 2DA2A 4XICA 4BXXJ 3S2HJ 1JJ8C 2LKXA 4QSHA 4A3KJ 2W48A 2D5VA 3VVXA 2H1KA 1VF9A 5JLWA 4RDUA 2H8RA 5GPCA 3B6CA 3BQYA 4JX4A 3MVPA 5EFYA 5FGLA 1IDYA 2K9QA 5EZGA 1B72A 2RASA 2N8GA 5FLMJ 5E3MA 1RKTA 1ORKA 2GLOA 2OF7A 3S2DJ 4JKZA 2DA4A 4LOCA 2CU7A 4A3IJ 4GCTA 2D6YA 2COBA 3RH2A 2CUEA 1ETQA 1WH5A 5C4JJ 4A3EJ 3VUQA 1QVUA 5E3NA 2ID3A 2R7ZJ 5C44J 1RR7A 4ME9A 3BR2A 3I4NJ 1R9TJ 2PMZN 5IP9J 2R5ZB 4MIMA 3TW7A 3ZQGA 2R5YB 1IDZA 4A3FJ 5F27A 2O8KA 4M3FA 3F0CA 2Y31A 4ACIA 4DZJA 5EEAA 2HXIA 2LP0A 3HM5A 3ZQFA 1BW5A 3HOYJ 3F1BA 2QIBA 2XRLA 1FIAA 2WV1A 4BKXA 2GM4A 3HOVJ 5H9TA 2DG7A 2X6OA 2I10A 2V57A 3BT9A 1BL0A 3JSJA 1TWHJ 4FCYA 3IUVA 5J3LA 2M0CA 2OERA 1YRNB 2LTPA 3BTIA 2IEKA 2DG8A 2DMUA 3BTLA 3LSRA 5F0FA 1Q1VA 1WI3A 2DMPA 2XSDC 1JKQC 3G1MA 1WPKA 3OOUA 2YS9A 1O4XA 1HCRA 4GCLA 2LVSA 2NP5A 2WGBA 1OFCX 2XGDA 1I50J 1TWCJ 1RETA 1X2MA 2L7FP 2VKEA 3HOUJ 3CQZJ 1IGNA 3O8HA 4AYBN 3GTMJ 1JJ6C 2HDDA 4UDSA 4NDLA 3LJLA 3VOKA 2CQXA 4JX5A 1HDDC 4AF5A 5F0HA 2Q24A 2XDNA 3G7RA 3SFIA 2PZ9A 1GV5A 2JN6A 2ME6A 4M6VA 3ZQLA 3M3YJ 3LSGA 2UXPA 2G7GA 3EUPA 4BY7J 2MG4A 4GFBA 3C07A 3WHCA 4DYRA 4A3MJ 5HSZA 2DN0A 2EZKA 2NX4A 3BTCA 1JTXA 4AC0A 3SJMA 3BG5A 4A3LJ 2HOSA 3GTOJ 5FJ8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R J;  2E19 A;  2EH3 A;  3MN2 A;  1YRN A;  1POG A;  2RAE A;  5CXI A;  2G3B A;  2CUF A;  1MSE C;  1U8B A;  2VI6 A;  3CDL A;  1W0T A;  4DZP A;  2NP3 A;  2WUI A;  2W53 A;  3HE0 A;  3COL A;  1MBK A;  4JP0 A;  2XPU A;  4B3A A;  3PO2 J;  3KZ9 A;  3PPB A;  1WGX A;  2G0E A;  1QPI A;  5CXG A;  2GUH A;  1MBJ A;  2QKO A;  2ZCX A;  2FX0 A;  4D7N A;  1GT0 C;  5HBU A;  2UXI A;  3JRG A;  3CJD A;  5F1J A;  1ITY A;  4JNN A;  4L62 A;  3GTK J;  5F0C A;  3FIS A;  3GTP J;  1H89 C;  2FBQ A;  4IHV A;  5M5W J;  2IAI A;  2GBY A;  2CQQ A;  2L0K A;  2FJ1 A;  1GDT A;  4A3D J;  3NNR A;  5D19 A;  4IHW A;  4W1U A;  4XRS G;  1UG2 A;  4XID A;  2E2I J;  1Y1W J;  2LR8 A;  2JA7 J;  2JA6 J;  4A69 C;  5DTD A;  2DJN A;  5JLX A;  3PAS A;  1WH7 A;  1IV6 A;  1XS9 A;  4UUS B;  5FLV A;  3RQI A;  3BG3 A;  3FIW A;  4JX6 A;  1X2N A;  1TWF J;  3GTG J;  2K9N A;  3LSP A;  5DS9 A;  4XRM A;  3FKI J;  1IJW C;  3RKQ A;  2XB0 X;  3L1P A;  1W0U A;  2KT0 A;  3HTH A;  2HXO A;  2K9S A;  5IYC J;  4MXM A;  1ZGW A;  2ZOZ A;  3E7Q A;  3NI7 A;  3C2B A;  5M3F J;  5C3E J;  5D18 A;  1MNM C;  2L7M P;  2YUS A;  3BJB A;  1AU7 A;  4W97 A;  3OIO A;  2JA5 J;  5GPA A;  3QBM A;  2JWT A;  1U9N A;  2P81 A;  4CYC A;  4A3G J;  2M8G X;  1ETX A;  2HQ5 A;  1LE8 B;  3JRA A;  1U78 A;  4DYQ A;  2M9H A;  3IH4 A;  4V2G A;  4GFL A;  3MNL A;  3S5R A;  4MFE A;  2Y2Z A;  2O9L A;  3E7L A;  1ZK8 A;  4M3G A;  1ETV A;  5J1U A;  3JRH A;  3GTQ J;  3ON4 A;  3DEW A;  3QPS A;  5K58 A;  1MH4 A;  1Z77 A;  3CWR A;  2F07 A;  1WCM J;  3OSG A;  3DCF A;  3LWJ A;  1IUF A;  5F08 A;  4FE4 A;  3TP0 A;  5C4Y A;  1A6I A;  2YVE A;  3ANG A;  3G56 A;  5FKK A;  4MK6 A;  4JYK A;  1XC5 A;  3JRB A;  5M5X J;  3S14 J;  2Y30 A;  2UXO A;  2UXH A;  4XRS A;  1ETW A;  1MBH A;  1JT0 A;  1ZR2 A;  3VPR A;  5EZH A;  5IYD J;  2DA1 A;  4AUX A;  2G7L A;  1MBE A;  2REK A;  2YVH A;  4YZE A;  1CQT A;  1BW6 A;  2GFN A;  2QWT A;  2CRG A;  2HOT A;  4M3E A;  2OI8 A;  2AO9 A;  2ZOY A;  1Z0X A;  4V2F A;  4BY1 J;  3GTJ J;  3QPL A;  3TED A;  4Y52 J;  2MSY A;  3AQS A;  4CYC B;  2E2J J;  1A5J A;  3B81 A;  2NVY J;  1MBF A;  1F36 A;  4A3J J;  3Q0V A;  3O8G A;  1JKR C;  3NXC A;  4HKU A;  5IPA A;  3BTJ A;  3V78 A;  3CCY A;  2DA7 A;  3JRD A;  3V6G A;  4D7M A;  3JRE A;  4L5E A;  2QF7 A;  3HIM A;  1HOM A;  1LFB A;  1NK2 P;  3I4M J;  1ZKG A;  1TC3 C;  2DTZ A;  1FTZ A;  3T6N A;  2DA5 A;  3K2A A;  2L9R A;  2XGC A;  3S16 J;  1TWA J;  2Y9Y A;  2EBI A;  2RHA A;  3D1N I;  1IG7 A;  3H0G J;  4B1R A;  1I6H J;  5FKM A;  3GTL J;  3VVY A;  2ELK A;  3NRG A;  5IP7 J;  3HEF A;  3HOX J;  1RKW A;  3FK6 A;  2ZCM A;  2EQR A;  5FHP A;  3HB9 A;  4B4C A;  5C4X J;  1FJL A;  2XGE A;  3Q0W A;  4GFK A;  5FKO A;  4DYC A;  2DMN A;  1D5Y A;  5IYB J;  5EGO B;  3PM1 A;  2JJ7 A;  2VKV A;  1JTY A;  3HBL A;  2R93 J;  3FRQ A;  1JUS A;  5EG0 A;  3DPJ A;  2M2E A;  1F43 A;  5HOD A;  3HGY A;  1PUF A;  3NPI A;  1SFO J;  5DAJ A;  3EGQ A;  4DW6 A;  1K61 A;  4HNV A;  4CGR A;  2LLK A;  3RZD J;  1FEX A;  3HTJ A;  2L7Z A;  4Y7N J;  3LSJ A;  2DMT A;  2E1O A;  4I6Z A;  1NTC A;  2IBD A;  2R0Q C;  4NEL A;  3HOW J;  4D5C A;  1S7E A;  2NS8 A;  5EG0 B;  2R5Y A;  1GV2 A;  1Y1V J;  5AQC A;  1AKH A;  2R5Z A;  3S1Q J;  1OCP A;  3BR5 A;  3NAR A;  3LNQ A;  2E2H J;  3KNW A;  2WAQ N;  2WB1 N;  3VVZ A;  2ID6 A;  3CMY A;  3S17 J;  2O7O A;  3VW1 A;  3HTA A;  1JT6 A;  1RES A;  2GEN A;  2G7S A;  2NOG A;  2DA3 A;  3QQA A;  3BQZ A;  5K7F A;  4D5F A;  3RD3 A;  4KWA A;  1VI0 A;  2LK2 A;  4XK4 A;  4C3J J;  3BHQ A;  1HDP A;  3BNI A;  1AKH B;  2JK3 A;  2MW8 A;  2TRT A;  2HKU A;  3ON2 A;  4GCK A;  2TCT A;  1ZQ3 P;  1BJZ A;  1JKP C;  5BNG A;  5CW8 A;  2PBX A;  5M3M J;  3ZQH A;  1DU0 A;  4G12 A;  2K40 A;  3WHB A;  1E3O C;  3GEU A;  3M4O J;  3IH3 A;  1T56 A;  1T33 A;  4ABZ A;  2NVT J;  2DA6 A;  4AC6 A;  3VIB A;  1RPW A;  5K7H A;  3A01 A;  2VUM J;  3CRJ A;  3HGG A;  5EF6 A;  4A3C J;  1JUP A;  2HOA A;  3KKC A;  1GVD A;  2HYT A;  4JL3 A;  3JRI A;  5FKL A;  3SDG A;  1FTT A;  1DU6 A;  3Q3S A;  5FKN A;  2NS7 A;  2Y0S N;  2QCO A;  1IC8 A;  2UXU A;  4C2M J;  2DMQ A;  2ECC A;  3GBG A;  3G1O A;  2NVX J;  5E3L A;  3RZO J;  3HDD A;  3VOX A;  1UHS A;  1VND A;  1JKO C;  1U9O A;  3S15 J;  2XPW A;  3BRU A;  3ZQC A;  1FIP A;  1TWG J;  1ZTR A;  4MO7 A;  5IOY A;  2LFB A;  2B63 J;  1XG1 A;  1AHD P;  5GP9 A;  5IOZ A;  5J1R A;  3VW2 A;  1QVT A;  3TP3 A;  4IEJ A;  1ZR4 A;  2IU5 A;  5FMP A;  3IV5 A;  1ENH A;  1P7J A;  3LOC A;  3W6V A;  4X6A J;  1X58 A;  5M5Y J;  1EF4 A;  1MBG A;  2XPV A;  2X48 A;  2X9D A;  1MH3 A;  2FQ4 A;  2XB5 A;  5K7Z A;  3JRC A;  4FTH A;  4UUT A;  9ANT A;  1H8A C;  4RBO A;  4ICH A;  3O60 A;  4IHX A;  1SGM A;  4A3B J;  1OJL A;  1APL C;  3UKG A;  4QTR A;  1UI5 A;  1UMQ A;  4MLO A;  2LD5 A;  5HAW A;  3S1N J;  1G2H A;  2NVQ J;  5EDN A;  2YU9 J;  1SAN A;  1IRZ A;  3NAU A;  1ETY A;  3KKD A;  3BR6 A;  4I76 A;  4S0H B;  4C3I J;  3K7A J;  3QKX A;  5D1R A;  2QOP A;  1JUM A;  2EZL A;  3JRF A;  3MKL A;  1PUF B;  4BBS J;  1BA5 A;  3BCG A;  1QRY A;  4X1E A;  3TW6 A;  1JGG A;  2MGQ A;  3JR9 A;  2Y9Z A;  2R92 J;  3B6A A;  1B8I B;  1K83 J;  2ZB9 A;  4MFD A;  1ETO A;  5EGO A;  5J1Y A;  4M3B A;  5EYR A;  4QIW N;  3BR1 A;  1H88 C;  1HF0 A;  3A03 A;  2QTQ A;  1NK3 P;  2JMW A;  4BBR J;  3IH2 A;  2KDZ A;  1OCT C;  3H3V K;  3S1M J;  3VW0 A;  2O7T A;  2AHQ A;  2EZI A;  3HTI A;  2EZH A;  3A02 A;  3Q0U A;  3VP5 A;  4A93 J;  1VFC A;  2FD5 A;  3ZOB A;  1UI6 A;  3AQT A;  4UUS A;  2ECB A;  3BR3 A;  5F04 A;  2HYJ A;  4FE7 A;  1ETK A;  4IHY A;  1I3Q J;  3HOZ J;  4C3H J;  5E3O A;  4J19 A;  4FIS A;  4EEF G;  1HLV A;  4NN1 A;  1B72 B;  2VPR A;  4PXI A;  3P9T A;  2HI3 A;  2JA8 J;  3OSF A;  3LHQ A;  2M34 A;  3FK7 A;  1LE8 A;  1GUU A;  2OPT A;  3BR0 A;  1P7I A;  5IP6 A;  3ZQI A;  1LFU P;  3GZI A;  1B8I A;  3HKZ N;  3A01 B;  3G1L A;  2ZCN A;  3PO3 J;  1MSF C;  2ME0 A;  3ANP A;  2CJJ A;  4M3D A;  2LY9 A;  3BG9 A;  2DA2 A;  4XIC A;  4BXX J;  3S2H J;  1JJ8 C;  2LKX A;  4QSH A;  4A3K J;  2W48 A;  2D5V A;  3VVX A;  2H1K A;  1VF9 A;  5JLW A;  4RDU A;  2H8R A;  5GPC A;  3B6C A;  3BQY A;  4JX4 A;  3MVP A;  5EFY A;  5FGL A;  1IDY A;  2K9Q A;  5EZG A;  1B72 A;  2RAS A;  2N8G A;  5FLM J;  5E3M A;  1RKT A;  1ORK A;  2GLO A;  2OF7 A;  3S2D J;  4JKZ A;  2DA4 A;  4LOC A;  2CU7 A;  4A3I J;  4GCT A;  2D6Y A;  2COB A;  3RH2 A;  2CUE A;  1ETQ A;  1WH5 A;  5C4J J;  4A3E J;  3VUQ A;  1QVU A;  5E3N A;  2ID3 A;  2R7Z J;  5C44 J;  1RR7 A;  4ME9 A;  3BR2 A;  3I4N J;  1R9T J;  2PMZ N;  5IP9 J;  2R5Z B;  4MIM A;  3TW7 A;  3ZQG A;  2R5Y B;  1IDZ A;  4A3F J;  5F27 A;  2O8K A;  4M3F A;  3F0C A;  2Y31 A;  4ACI A;  4DZJ A;  5EEA A;  2HXI A;  2LP0 A;  3HM5 A;  3ZQF A;  1BW5 A;  3HOY J;  3F1B A;  2QIB A;  2XRL A;  1FIA A;  2WV1 A;  4BKX A;  2GM4 A;  3HOV J;  5H9T A;  2DG7 A;  2X6O A;  2I10 A;  2V57 A;  3BT9 A;  1BL0 A;  3JSJ A;  1TWH J;  4FCY A;  3IUV A;  5J3L A;  2M0C A;  2OER A;  1YRN B;  2LTP A;  3BTI A;  2IEK A;  2DG8 A;  2DMU A;  3BTL A;  3LSR A;  5F0F A;  1Q1V A;  1WI3 A;  2DMP A;  2XSD C;  1JKQ C;  3G1M A;  1WPK A;  3OOU A;  2YS9 A;  1O4X A;  1HCR A;  4GCL A;  2LVS A;  2NP5 A;  2WGB A;  1OFC X;  2XGD A;  1I50 J;  1TWC J;  1RET A;  1X2M A;  2L7F P;  2VKE A;  3HOU J;  3CQZ J;  1IGN A;  3O8H A;  4AYB N;  3GTM J;  1JJ6 C;  2HDD A;  4UDS A;  4NDL A;  3LJL A;  3VOK A;  2CQX A;  4JX5 A;  1HDD C;  4AF5 A;  5F0H A;  2Q24 A;  2XDN A;  3G7R A;  3SFI A;  2PZ9 A;  1GV5 A;  2JN6 A;  2ME6 A;  4M6V A;  3ZQL A;  3M3Y J;  3LSG A;  2UXP A;  2G7G A;  3EUP A;  4BY7 J;  2MG4 A;  4GFB A;  3C07 A;  3WHC A;  4DYR A;  4A3M J;  5HSZ A;  2DN0 A;  2EZK A;  2NX4 A;  3BTC A;  1JTX A;  4AC0 A;  3SJM A;  3BG5 A;  4A3L J;  2HOS A;  3GTO J;  5FJ8 J; 
#chains in the Genus database with same CATH topology
 3L2V A;  2HZT A;  3ZMU A;  1YRN A;  4ANJ A;  5GAG J;  2LNB A;  3FM5 A;  5CXI A;  2ZNY A;  2G3B A;  3E5Q A;  4IOC F;  4RA2 A;  4HA8 A;  4AM3 A;  4BHC A;  1OR7 A;  2E5Z A;  1W5T A;  2E1C A;  2WUI A;  2HTJ A;  1MBK A;  4B3A A;  3PO2 J;  1WGX A;  1UST A;  4GGG A;  2KIF A;  5LHI A;  1DDN A;  2QKO A;  3BLY A;  2VB6 A;  2PX9 A;  2FQ3 A;  3IHU A;  2UXI A;  3ASO H;  3I56 I;  3CJD A;  5F1J A;  3L2W A;  4JNN A;  2IA1 A;  1ZYR F;  5ILU A;  5GAE J;  4L62 A;  2V6C A;  3FIS A;  1IN8 A;  3GFM A;  5TJJ A;  1YW9 A;  5JVG F;  2BEO A;  3IRR A;  4A3D J;  5D19 A;  4XRS G;  1TT5 B;  4XID A;  3V8J A;  2O61 A;  1IN6 A;  2XIG A;  3FMQ A;  2EFW A;  5JLX A;  4RB3 C;  1JGS A;  1TZL A;  2L4M A;  4XON A;  2ZXW H;  3GTG J;  2VQC A;  4Z2Y A;  4XRF A;  3LSK A;  5DS9 A;  2BY2 A;  4ETS A;  1TNT A;  5LHH A;  3RKQ A;  2XB0 X;  3HSF A;  3IUO A;  4NHJ A;  2D1V A;  2K9S A;  5HNH A;  1K4T A;  3E7Q A;  4KUM A;  3C2B A;  5M3F J;  5C3E J;  2Q2E B;  3VOD A;  3JCU C;  1OYY A;  2DK8 A;  3PIP F;  4W97 A;  1UAA A;  2JA5 J;  2Z5U A;  2ZO4 A;  2P81 A;  2M8G X;  1ETX A;  1ACI A;  1A6Q A;  4HLY A;  1UEL B;  1E2X A;  3OR2 C;  4M3G A;  3JRH A;  3ON4 A;  4F7Z A;  2V4J C;  2FNP A;  3QOE A;  1D5V A;  2QVO A;  1FOX A;  2BW3 B;  1X3Z B;  2GXB A;  1WCM J;  3OSG A;  4C30 A;  4FE4 A;  2X4H A;  3TP0 A;  1A6I A;  2ZJQ F;  2GIV A;  2YVE A;  4JYK A;  4EM2 A;  2M7B A;  3S14 J;  1K78 B;  2UXO A;  3F8N A;  4NQW B;  1ETW A;  4ZYE A;  1UG0 A;  1Z05 A;  1O3R A;  3CJT B;  2G7H A;  4OAY A;  2YVH A;  3FDY A;  4G6D A;  3ULQ B;  2P4W A;  3TGN A;  2QQA A;  1IF1 A;  2NRA C;  2FBH A;  2HKX A;  2STT A;  1ZGJ A;  1OCR H;  2ZOY A;  2AO9 A;  2HKO A;  4BY1 J;  3GTJ J;  1A31 A;  2HQA A;  4RAZ A;  3QPL A;  3AAF A;  3TED A;  2R7U A;  1E3P A;  1SFE A;  1ZG1 A;  4R8H A;  1N25 A;  3REO A;  3B81 A;  3TDU C;  3VYS B;  1F36 A;  5FB2 A;  4A3J J;  1IN4 A;  5CVJ A;  1Y8Q B;  1LEB A;  1JKR C;  3IP4 B;  4GO1 A;  3BTJ A;  1U5T B;  1Y8R B;  4LFU A;  3IKV A;  3RQ4 A;  1WZ2 A;  3CCY A;  3E6M A;  2DA7 A;  4D7M A;  1QPM A;  3JRE A;  4L5E A;  2RDP A;  2XAQ A;  2QF7 A;  1HKT A;  3IL2 A;  2L9N A;  3COA C;  5AIQ A;  3J80 Z;  4PGH A;  1WJD A;  3H9G A;  5HLI A;  1FTZ A;  3GX4 X;  4Y33 A;  2XGC A;  5DDG A;  3GWZ A;  4FET A;  4HF0 A;  1XX5 A;  2P5K A;  2Y9Y A;  3W3C A;  2X85 A;  4B1R A;  3CDI A;  3VVY A;  3W6K B;  2ELK A;  4PJL A;  5K5Q A;  2DT5 A;  3VFZ A;  2EIK H;  1HKQ A;  5B1A H;  3WTW C;  3ONQ A;  3W6J B;  2EIN H;  4GFK A;  4DVY P;  4V19 K;  2DMN A;  1V3F A;  5EGO B;  1SVL A;  2JJ7 A;  2R93 J;  1JTY A;  4D0P A;  5L3E A;  4DQ2 A;  1JUS A;  2AQE A;  1Y0U A;  4XNF A;  1F43 A;  1FY7 A;  2KZG A;  4I99 C;  1ZRF A;  1PUF A;  4GXO A;  5DAJ A;  1HQC A;  3EGQ A;  1QZZ A;  2QEX I;  2LLK A;  3LSH A;  3CCL I;  1FYL A;  3AG1 H;  3HTJ A;  2FUG 2;  3LQR A;  2E1O A;  1V5E A;  2DOF A;  1ZAO A;  3LSM A;  2O5R A;  2DJI A;  2IXS A;  1Y1V J;  2E35 A;  3P9C A;  3CJR B;  2WC2 A;  4KT5 C;  1L0O C;  2WAQ N;  1UHM A;  2BV6 A;  2WB1 N;  2X6Y A;  2M4G A;  4G6T B;  4P1W A;  3CMY A;  1O3S A;  3RPU D;  2BVL A;  2PQ8 A;  1QQI A;  3HJE A;  4RMN A;  2G7S A;  2GEN A;  3U9G A;  2NOG A;  4HDU A;  1L3L A;  2E5N A;  3ABM H;  3QQA A;  2F4I A;  4PCQ A;  5HLG A;  4D5F A;  3RD3 A;  2KP6 A;  1VI0 A;  3DWL E;  1TL8 A;  4C3J J;  4KMF A;  3BHQ A;  3KEQ A;  3BNI A;  3L00 A;  2AQF A;  2ACJ A;  2TRT A;  1X19 A;  2FJI 1;  2EFP A;  3EYI A;  3KP7 A;  3OYD A;  2M5W A;  2E36 A;  4RGR A;  1FYM A;  2GOM A;  4NC8 A;  3R60 A;  1YX3 A;  1XDS A;  3T0Y A;  4E7K A;  2R7W A;  2QSH X;  3HZJ A;  1G3W A;  3KYL A;  1E3O C;  3K70 C;  3GEU A;  4LLG F;  1JXS A;  1T56 A;  1T33 A;  1XN7 A;  3E5U A;  4BS9 A;  2JQ7 A;  1NG7 A;  1N77 A;  2YSR A;  3V7R A;  1I6X A;  2DPD A;  2PJR A;  1RPW A;  5K7H A;  2VUM J;  2KFD A;  2LY2 A;  4CCM A;  3HTS B;  3DTI A;  4A3C J;  2BZT A;  2ELH A;  2MLG A;  1JUP A;  1JHF A;  2VON A;  4RLQ A;  1V5F A;  5FKL A;  1GXP A;  3CLQ A;  1JE8 A;  2NS7 A;  3S93 A;  4B48 A;  2XF7 A;  1XMX A;  1K79 A;  2QQB A;  5GAD J;  1QZY A;  4J01 A;  2MC4 A;  4G8X A;  3HDD A;  5FRM A;  1R7J A;  2H27 A;  2G7U A;  4Y17 A;  2A6T A;  5E8G A;  3S15 J;  4L9N A;  1KQ9 A;  1FIP A;  4MO7 A;  2B63 J;  1EH6 A;  5E17 F;  4U0V A;  1XG1 A;  3KP6 A;  1EV7 A;  1AHD P;  4HBL A;  3BOQ A;  4IEJ A;  3BZK A;  3IV5 A;  1ENH A;  3QRF F;  1WRJ A;  2ICW G;  5BMZ A;  2XF6 A;  2V9V A;  4KIB A;  3JAM K;  4A12 A;  3LFU A;  2FQ4 A;  5K7Z A;  4CCJ A;  4HDV A;  1TQM A;  2KIM A;  2ZY9 A;  1S5L C;  1XSD A;  3GFJ A;  3QU6 A;  1APL C;  1VQM I;  3HRS A;  2PBI A;  1B9M A;  2QKM B;  3KLO A;  4F52 A;  5D6E A;  4QTR A;  4MLO A;  1T0F C;  5A2Q K;  1ZRC A;  3I64 A;  5HDN A;  5EDN A;  4C2T A;  2VOP A;  4LK1 F;  3OYM A;  4M9Z A;  3ZMD A;  3KKD A;  1UB9 A;  2MH2 A;  1FOK A;  2QOP A;  1BA5 A;  1N78 A;  4L5J A;  3LSI A;  2CQK A;  4XR6 A;  1JGG A;  1SAU A;  3B6A A;  3MAJ A;  1PP7 U;  4BE0 A;  2QTQ A;  4RGS A;  2MBF A;  3EYY A;  5LHG A;  4BBR J;  3IH2 A;  1OCT C;  1VQ8 I;  3PNY A;  1GVJ A;  2F5F A;  2O7T A;  2AHQ A;  3LST A;  3RIR A;  3VP5 A;  1X4O A;  1Y56 A;  1VFC A;  3ZOB A;  1EKE A;  2XRO A;  1Z3X A;  2R7V A;  1UI6 A;  5F04 A;  2VBZ A;  3VB2 A;  2EIJ H;  3A4C A;  4IF4 A;  2DK5 A;  2YX7 A;  2L01 A;  4PXI A;  1BM9 A;  4UVC A;  3ZMT A;  1ON2 A;  2BHZ A;  2M34 A;  3LAP A;  3ABU A;  2M87 A;  2F2E A;  5JR3 A;  1P7I A;  1MZB A;  3GW2 A;  5FFZ A;  1LFU P;  2V26 A;  4ESF A;  3CC2 I;  3G1L A;  2FOW A;  3EQL F;  2ME0 A;  4H0E A;  2LY9 A;  4L9V A;  4XBF A;  2VC1 A;  1WQ2 A;  3A1Y A;  3NRV A;  1YIJ I;  4HPQ A;  2X51 A;  2JTV A;  2A07 F;  4WXC A;  4CCO A;  2HYF A;  4O5V A;  1YS6 A;  1WI9 A;  4OAZ A;  2M1B A;  3PJR A;  3VYU B;  5B3S H;  1O7L A;  1LEA A;  3ROU A;  2LKP A;  4WCG A;  2D6Y A;  2COB A;  3RH2 A;  1Z7U A;  2CUE A;  4PSW A;  5C4J J;  2R7Z J;  2CV0 A;  2K3P A;  3G73 A;  3L9F A;  3ZCO A;  3I4N J;  4BAC A;  2PMZ N;  3FZV A;  4MIM A;  3ZQG A;  3PFI A;  3VEP A;  1OCZ H;  1YI2 I;  1BI1 A;  2KRF A;  3TO6 A;  1P4W A;  4LLL A;  2HYG D;  1RNL A;  4UY8 I;  4A0Z A;  3KE2 A;  3F1B A;  2QIB A;  3G3Z A;  3OMY A;  1FIA A;  1Z7L A;  3GO5 A;  2OZ6 A;  3OYH A;  4U7D A;  3HOV J;  4DBR A;  4KN4 X;  2X6O A;  4ZYA A;  3E6C C;  2P0W A;  2V57 A;  3JSJ A;  1TWH J;  5JFR A;  2HVS A;  1YJ9 I;  4HF2 A;  4AVZ A;  3IAM 2;  2B9S A;  2IEK A;  2H1L A;  3HG9 A;  4E7H A;  4B3X A;  3CJN A;  2DMU A;  1Z3Y A;  5F0F A;  2XSD C;  1TW2 A;  4A5M A;  4GCL A;  2XDV A;  4XOP A;  4CUG A;  2LVS A;  4E7Z A;  1ZG3 A;  2WGB A;  2ZFW A;  5H2F C;  4IRI A;  1RET A;  4XLF A;  4U0Y A;  2JT1 A;  3ESW B;  3O8H A;  1U0J A;  4B44 A;  5LRR A;  1BR1 A;  3H9Q A;  2R7R A;  1LJ9 A;  3S2W A;  3AL0 C;  4JX5 A;  5H6R A;  3A0H C;  2BY3 A;  2YPR A;  3DTK A;  1GV5 A;  1LVK A;  2IPQ X;  4C9Y A;  1K78 A;  3C2H A;  2DOE A;  4LG0 A;  2LBF B;  3VSK A;  3LSG A;  3OYL A;  2UXP A;  4M6Y A;  2PFV A;  1ZGA A;  5KVR A;  4HQE A;  3MKY B;  3WHC A;  1YHQ I;  5HSZ A;  2CFX A;  1IO2 A;  5J4Y A;  3OYN A;  2VXZ A;  4ZDO A;  3SJM A;  3S3N A;  3K2Z A;  1CF7 B;  4OU0 A;  2ZJR F;  2QSF X;  2E19 A;  3MN2 A;  3HC7 A;  2A68 F;  1POG A;  3GZN B;  2GA1 A;  2QSG X;  5CPR B;  3BCB A;  1TLH B;  1U8B A;  2H8W A;  1W0T A;  2L3D A;  4DZP A;  1B59 A;  1JKP C;  2W53 A;  3HE0 A;  4ON0 A;  2XPU A;  3PPB A;  1V55 H;  1YS7 A;  3L2U A;  1QPI A;  2OUM A;  3S8P A;  1QO0 D;  2JVH A;  2DI3 A;  1I3A A;  2YU3 A;  4RM2 A;  4BYY A;  4AD9 A;  2KRH A;  1AOY A;  2K7L A;  1IV8 A;  1R49 A;  3DPL C;  1ITY A;  5JHU A;  4L0Z B;  1EH7 A;  3GTK J;  2CFO A;  2EIM H;  4Q5S F;  4IHV A;  4CGZ A;  2L0K A;  3F8B A;  2B7E A;  5FGM A;  2Z99 A;  4NC7 A;  3SZG A;  3NNR A;  4W1U A;  1UG2 A;  2E2I J;  1TP4 A;  2JA6 J;  2FMY A;  3SQN A;  3CCJ I;  5KCM A;  3FKJ A;  3K1M A;  1R5G A;  1DGW Y;  1T6S A;  2DCE A;  5DTD A;  2DJN A;  5HOO A;  1WH7 A;  4UUS B;  5FLV A;  3RQI A;  3W2A A;  3FIW A;  2O6G E;  1YFH A;  2W1O A;  5E1X A;  3LSP A;  3KZY A;  3KZI C;  4XRM A;  1EJ9 A;  3FKI J;  5HS7 A;  3HKZ A;  3EDP A;  1MD0 A;  2HXO A;  3E5X A;  5D4S A;  2ZOZ A;  3NI7 A;  2FRH A;  3CP2 A;  3PQJ A;  1HXD A;  2QQ9 A;  1DPR A;  5D18 A;  2ZME C;  3GME A;  4LMY A;  3BJB A;  1SD5 A;  2X6W A;  3R4K A;  4HOB A;  4G6Q A;  2VOO A;  4CDG A;  1AU7 A;  4XLC A;  5GPA A;  3QBM A;  1U9N A;  2F5V A;  1WJF A;  3U1D A;  2HQ5 A;  1LE8 B;  3JRA A;  2K27 A;  2OC6 A;  5JVT A;  3IH4 A;  5KK1 A;  5LGN A;  4V2G A;  1S6L A;  3I59 B;  3RI4 A;  5JI6 A;  2O9L A;  1ETV A;  1EA3 A;  3GTQ J;  4BEH A;  4ZZL A;  3K69 A;  3DEW A;  2IW5 A;  3QPS A;  1PVE A;  2R7O A;  4ZZD A;  3CCV I;  5D8L B;  3F8C A;  3CWR A;  4ZTJ A;  2F07 A;  1G4D A;  2EFO A;  3DBL B;  4Y13 A;  5C4Y A;  3G56 A;  2GA2 A;  5M5X J;  1MDM A;  4A5N A;  5DYM A;  1DUX C;  2UXH A;  1U5T C;  2RQP A;  1XMA A;  2E7W A;  1ZR2 A;  1JT0 A;  3E6B A;  1XGO A;  3VPR A;  2DA1 A;  4MEX F;  2ISY A;  1MBE A;  2BW3 A;  5HNF A;  2YX4 A;  4DBQ A;  1CQT A;  2GFN A;  2VQH A;  4FQG A;  2VC0 A;  4DJA A;  2WY8 Q;  4UB6 C;  3OYI A;  2OBP A;  1OIS A;  1Z0X A;  4HLX A;  4V2F A;  5B5E C;  1FMW A;  3AL0 B;  4Y52 J;  4RLF A;  2MSY A;  3OWT A;  3ECO A;  4ZC3 A;  2PMU A;  1MMN A;  3N97 A;  4CYC B;  1A5J A;  1E17 A;  3BRO A;  3JTG A;  2PJR B;  3O8G A;  2EPF A;  3J81 Z;  3NXC A;  3QOD A;  3KX2 A;  3V78 A;  3DU5 A;  2I8D A;  3WTT C;  1QHH D;  1Z6R A;  3KP4 A;  3K6G A;  3HIM A;  1HOM A;  2EA2 A;  4KIC A;  1PP8 F;  1R4N B;  2DW4 A;  2V1N A;  5DCF A;  3J80 K;  1TC3 C;  2DTZ A;  3T6N A;  3TO7 A;  3HYI A;  3K2A A;  1VQ5 I;  3S16 J;  3J7A Y;  5ILS A;  2QQ8 A;  1FSH A;  3HXL A;  2ZXH A;  5CQG A;  3D1N I;  1IG7 A;  1I6H J;  3F3X A;  1W7P D;  3GEZ A;  3GTL J;  4O3M A;  2VIX A;  3BPV A;  3FK6 A;  3VOE A;  4Y4R A;  1H0M A;  3JW4 A;  3M07 A;  4BH9 A;  4RB0 A;  4PGG A;  2NNY A;  3HB9 A;  4B4C A;  2HR3 A;  4A6D A;  1FJL A;  2X1D A;  2XGE A;  2QUF A;  4HF1 A;  3DFG A;  3MEX A;  3CCE I;  2VKV A;  3HBL A;  3X2Q H;  2KHM A;  4LIU A;  5LFA A;  2M2E A;  2F6C A;  3RDI A;  1LDJ A;  1VQ6 I;  2BY0 A;  3CF5 F;  2Z3Y A;  4LK0 F;  1K61 A;  3KCC A;  2Z33 A;  4CGR A;  3LSJ A;  4BQA A;  3TDZ C;  4E7L A;  2XF5 A;  1PYV A;  2MD5 A;  4B09 A;  1NH3 A;  2PLY A;  2IBD A;  2R0Q C;  1LDD A;  2YR2 A;  4OOI A;  3FMR A;  3ASN H;  5EG0 B;  2R5Y A;  4ASN A;  1AKH A;  3ECH A;  1KA8 A;  3LNQ A;  2E2H J;  4PUS A;  3VVZ A;  4EJW A;  1RES A;  2A5W A;  5HDG A;  3HRM A;  3BQZ A;  2K4B A;  3OIP A;  1FP1 D;  3KIO A;  5EEG A;  1VTN C;  4KWA A;  1LKX A;  2IGM A;  4BHB A;  2P5V A;  1HDP A;  2QEN A;  4HQM A;  4Q47 A;  2JK3 A;  2MW8 A;  2VLA A;  1TNS A;  3G71 I;  3L7W A;  1ZQ3 P;  1PUE E;  5BNG A;  1OR7 C;  2H6C A;  2B0L A;  1FYK A;  3SZP A;  5L3C A;  3WOD F;  5L3G A;  1UZC A;  4I0B A;  1XDU A;  4HEA 2;  6PAX A;  1QA6 A;  4B47 A;  3WGI A;  4ABZ A;  2CGP A;  4FT8 A;  2DA6 A;  1QNT A;  4RGU A;  1ZLK A;  4U87 A;  3A01 A;  1R00 A;  3HOS A;  4IZZ A;  2Y75 A;  1TTY A;  4HW0 A;  3FBI B;  2HOA A;  1H9T A;  1GVD A;  3JRI A;  4WXD A;  3C1D A;  3SDG A;  3M8J A;  4UV9 A;  4BQN A;  1IZ1 A;  3TOA A;  2R7D A;  2ZFU A;  4Y3O A;  4OIN F;  4C2M J;  2HDW A;  4ZYG A;  2K85 A;  2NAZ A;  4I02 A;  5E3L A;  3RZO J;  1SD4 A;  2IGO A;  2LG4 A;  1VQK I;  3CCQ I;  1EH8 A;  1UHS A;  4E7J A;  4U9N A;  1U9O A;  2K9M A;  1BIB A;  4HV6 A;  1J75 A;  1DP3 A;  4N0B A;  1XMK A;  2LFB A;  3EUH A;  4KJZ A;  3HUG B;  5GP9 A;  3TO9 A;  1W1W E;  2KIS A;  1T8I A;  2HPM A;  4IRH A;  1U2W A;  1R22 A;  1ZR4 A;  2K02 A;  2IU5 A;  3W6V A;  4BUP A;  4IO9 F;  1X58 A;  5ERI A;  2XPV A;  1LDK B;  2CQ7 A;  2X48 A;  2XB5 A;  3JRC A;  2W00 A;  2OV7 A;  1IXR C;  2F4O B;  2HVQ A;  4ICH A;  1R5I D;  1SGM A;  2IA0 A;  2VE8 A;  2W4S A;  3PFY A;  2DFE A;  5LGU A;  2LD5 A;  4XLH A;  5HAW A;  1ZHF A;  1SD7 A;  3S1N J;  1G2H A;  3CMM A;  2NVQ J;  5BOX A;  3OYC A;  1IRZ A;  5F6F A;  5L3B A;  3NAU A;  4HX8 A;  2K86 A;  2R7S A;  3N4M A;  2B1E A;  2OAZ A;  3K7A J;  3CCS I;  2OJE D;  2FML A;  3JRF A;  4IHS A;  3C7J A;  1B6A A;  4X0G A;  1QRY A;  3BP8 A;  5FD5 A;  3TW6 A;  3OYA A;  2Q2E A;  1XSX A;  4EAT A;  1BN5 A;  1K83 J;  1ETO A;  2W57 A;  1MNE A;  1S29 A;  3IWF A;  1HF0 A;  4QIW N;  3WTV C;  5J8C A;  3P9I A;  4BNC A;  4I98 B;  2QM3 A;  3VW0 A;  2O8X A;  1WWX A;  1BC8 C;  1KU2 A;  2IA2 A;  1N75 A;  2CWE A;  2EZI A;  4XN3 A;  1LPQ A;  3HTI A;  3AFH A;  2EZH A;  2O3F A;  2VJI A;  3A02 A;  4ESJ A;  1O3T A;  1I5Z A;  1LQ1 A;  2IS4 A;  2M0M A;  3PL8 A;  5E20 A;  3AQT A;  3EUK L;  4FE7 A;  3AG4 H;  5J47 A;  2MLK A;  3JSP A;  4EJU A;  1I3Q J;  2OZU A;  1V4R A;  3HOZ J;  4C3H J;  1HLV A;  4FIS A;  2BXY A;  2VBY A;  2VPR A;  4QPO A;  1KYW A;  4S05 A;  3OSF A;  1MJB A;  3FK7 A;  2LF7 A;  4XL9 A;  2QBY A;  1WVR A;  3ZQI A;  2K4J A;  3GZI A;  4CXF A;  1CGP A;  1B8I A;  3PNT A;  4CIC A;  2MAB A;  2ZCN A;  3PO3 J;  4UNO A;  2D1H A;  3MCZ A;  2CJJ A;  4YIF A;  4YIR X;  1WSU A;  3BG9 A;  2DA2 A;  3GFL A;  2V1D A;  3BZ6 A;  1H9G A;  3LMM A;  3A0B C;  1IRG A;  2W48 A;  1WJA A;  2DQL A;  5DCM A;  4D1Q A;  2D5V A;  3BG7 A;  2H1K A;  2D2W A;  1G3Y A;  4RDU A;  2CH0 A;  2R7F A;  5GPC A;  1S72 I;  1ZRD A;  4JX4 A;  4XLN F;  5EFY A;  2F5E A;  5FLX K;  4DNC A;  3MWM A;  3NS4 A;  1ULY A;  4WF2 A;  1X1P A;  2DPU A;  2WA0 A;  1ORK A;  2WV0 A;  2GLO A;  4A2U A;  3CUO A;  3DV8 A;  2V1U A;  3S2D J;  2XKO A;  4JKZ A;  3BY6 A;  3NWT A;  5D8K B;  1RR8 C;  2CU7 A;  2V1X A;  4A3I J;  1X4P A;  3DPT A;  4L9J A;  1ETQ A;  3HHH A;  3VUQ A;  1IN5 A;  3WTY C;  2HDC A;  5KNL A;  1VQN I;  1QVU A;  2UV1 A;  1E0E A;  2ID3 A;  3LL7 A;  4NBQ A;  3Q9S A;  4L18 B;  3GLL A;  5C44 J;  4UV8 A;  3H5N A;  1HSJ A;  2C6Y A;  1F1Z A;  3EUH C;  3P5J A;  3ISP A;  3TW7 A;  4WIB A;  5DM6 F;  2JUG A;  1IDZ A;  4A3F J;  2ESN A;  1ZN2 A;  1HC8 A;  1R58 A;  4ACI A;  1MW7 A;  1X1C A;  2DDB A;  2LP0 A;  3GVA A;  3KPH A;  4YFN F;  1BW5 A;  4XQF A;  1SVM A;  4KFC A;  3HOY J;  3EET A;  1Y6I A;  3J7A O;  2VXD A;  4A0X A;  1P6R A;  1I27 A;  2WV1 A;  2XAU A;  3HIF A;  1OMI A;  4U7B A;  2DG7 A;  2AXT C;  2LH9 A;  5AON A;  2DQR A;  2EV5 A;  2P8T A;  1XGN A;  4ESB A;  5IT3 A;  3IUV A;  2H94 A;  1GLN A;  3K1P A;  4N4N B;  2OER A;  3QPT A;  3R0J A;  3LFK A;  1RRJ A;  1X3W B;  2ELJ A;  4LIV A;  3DP7 A;  1KZH A;  4B8X A;  1WI3 A;  2DMP A;  1HA8 A;  3J81 K;  2JPB A;  5CYV A;  2W82 A;  1OFC X;  1X2M A;  2VKE A;  1YOV B;  2VBW A;  4XN0 A;  5EEH A;  3HOU J;  2CUJ A;  3CUQ B;  2DOA A;  1BR2 A;  2E1M B;  4AYB N;  1JJ6 C;  2HDD A;  4UDS A;  4NDL A;  1YO5 C;  3ERE D;  4AF5 A;  2DYR H;  3G2B A;  2KL4 A;  5F0H A;  5GTI C;  3G6E I;  2PG4 A;  4BJ5 C;  3D5R C;  3SFI A;  4EMS A;  1QU3 A;  2JZY A;  1Z21 A;  4M6V A;  3ZQL A;  3CC4 I;  3M3Y J;  2AXL A;  4I09 A;  3I58 A;  1XD7 A;  2G7G A;  1Q1H A;  3NQO A;  1BOA A;  1USS A;  2R7T A;  2FA5 A;  3ZMV A;  1K7A A;  4AC0 A;  4LIT A;  3S3O A;  4EV0 A;  4YRV A;  3C2G A;  2EH3 A;  2CW7 A;  3H3Z A;  2RAE A;  2V7F A;  2CUF A;  3KYC B;  5LLQ A;  4ENN A;  2Z2S B;  3I54 A;  3HPG A;  5IY5 H;  5ICC A;  1AWC A;  1MSE C;  4S04 A;  2KIU A;  2VI6 A;  3VYR B;  5FLX Z;  1BI2 A;  3E0J B;  1P2F A;  2DBB A;  3COL A;  3HTU A;  4YFX F;  4JP0 A;  4K2E A;  4PJ0 C;  2RVC A;  5CXG A;  3GXO A;  1MBJ A;  3V8K A;  4WX9 A;  1GT0 C;  1D3Y A;  5HBU A;  4KIF A;  1RUN A;  5F0C A;  3GYH X;  4L9T A;  3GTP J;  2MC3 A;  3DQV C;  3RYR A;  4HNU A;  1H89 C;  2FBQ A;  5M5W J;  1KYZ A;  2GBY A;  2CQQ A;  2FJ1 A;  4IHW A;  2QLZ A;  2W24 A;  4N4O B;  1WHU A;  2LR8 A;  2JA7 J;  4UXN A;  4A69 C;  2JRT A;  1IRX A;  4L0Y B;  3PAS A;  2CQN A;  5F64 A;  4BE2 A;  2K9L A;  4JX6 A;  2JVG A;  1T2K A;  2IS2 A;  3ML6 A;  2G9W A;  2FSW A;  1VQL I;  3OIQ A;  3F72 A;  3KET A;  4BJ6 C;  4CCL A;  3L1P A;  3HTH A;  2EK5 A;  4HZF A;  4MXM A;  2KMU A;  2VE9 A;  1R23 A;  3CP8 A;  3RKY A;  4XKC A;  1VZ0 A;  4OD5 A;  2IGK A;  2FEZ A;  4AYB A;  1MNM C;  2GXG A;  2L7M P;  4HNT A;  2OQG A;  3FWE A;  2LRD A;  4C2M A;  3NWS A;  2L54 A;  2QWW A;  3OS2 A;  1B1B A;  1TQI A;  4M9X A;  3T5X A;  1J9I A;  3FF5 A;  4IQ4 A;  2H09 A;  2OU2 A;  1U78 A;  4DYQ A;  2M9H A;  3ABK H;  4XLE A;  3S5R A;  1T08 B;  1J2X A;  3O2P E;  2DFF A;  4GYI A;  4M74 A;  5A2Q Z;  1W36 C;  5J1U A;  1ODD A;  5FRN A;  1D8J A;  3NEU A;  1MH4 A;  2P7C B;  4KIT B;  3LWJ A;  3DCF A;  2PJP A;  1KGS A;  1R1V A;  4M73 A;  4CZZ A;  1HBX G;  4XKW A;  2OCC H;  3ZGK A;  2GAU A;  3BCA A;  1ZAR A;  4BU2 A;  4E4H A;  3SWH A;  4MK6 A;  3ZR8 X;  4DIQ A;  1XC5 A;  3HRU A;  3JRB A;  4F93 B;  3CLO A;  1XCB A;  4HV5 A;  4ZDP A;  4XRS A;  4PK4 A;  3DLA A;  1MBH A;  1VQ9 I;  2A3S A;  2RNG A;  5CJ9 A;  2VKD A;  4I2O A;  3G4S I;  1RUO A;  1D0Z A;  5EZH A;  5IYD J;  2RC4 A;  3OYE A;  3RPQ A;  4AUX A;  2XVC A;  2REK A;  2XSJ C;  4WXH A;  2M7A A;  2QWT A;  2L5Q A;  3MD2 A;  2HOT A;  3WU2 C;  2LOO A;  4EJO A;  2OI8 A;  4BL0 B;  4CYD A;  1HKS A;  1FLI A;  2ZSI B;  3FXJ A;  3MKW B;  2E2J J;  3F22 A;  1R1U A;  2VAS A;  4CH7 A;  1MBF A;  5DCM B;  4OIQ F;  3ELK A;  1DGR M;  1LB2 A;  4HKU A;  5IPA A;  5E18 F;  2EV0 A;  1XGS A;  2MFZ A;  2ZME A;  1KU9 A;  2A61 A;  5DUI A;  3IWZ A;  5TGT A;  1FBS A;  1S3J A;  3OV8 A;  1I1S A;  3CZ6 A;  2EV6 A;  2L9R A;  1FSE A;  3A2K A;  1WJ5 A;  2WB1 A;  2RHA A;  3K4L A;  3H0G J;  4F91 B;  5J40 A;  1P4A A;  1UHW A;  5FKM A;  2OQR A;  4NB5 A;  2PN6 A;  3NRG A;  5IP7 J;  1IXC A;  2WBM A;  2F4M B;  4AIK A;  3JTH A;  4P96 A;  1P92 A;  2VN2 A;  3HOX J;  4NUB A;  2BVM A;  2ZCM A;  1UFM A;  4HST A;  4G7H F;  5FHP A;  3H35 A;  3LA7 A;  5C4X J;  4P9F A;  3ZN0 A;  2KZV A;  2Q0O A;  1T98 A;  3D5L A;  1SFX A;  3KEO A;  4RS8 A;  5FKO A;  4DYC A;  3GFI A;  1Y39 A;  5IYB J;  1D5Y A;  5DM7 F;  2Y0M A;  3FRQ A;  2M45 A;  3RKW A;  3ABT A;  4UVB A;  3OL3 A;  1FNN A;  4KYW A;  1XTA A;  5L3D A;  2BYV E;  2VKH A;  2Z9O A;  1FP2 A;  4L5I A;  4JK1 X;  1SFO J;  3C3W A;  3RZD J;  1SVO A;  3V4G A;  2L7Z A;  2M4K A;  4XOR A;  1P9Q C;  3U2R A;  4Y7N J;  4P9U A;  2B3W A;  3T8R A;  4I6Z A;  2WTE A;  3OY9 A;  1BR4 A;  3QYF A;  4NEL A;  3GF2 A;  4D5C A;  4CZC A;  4AVP A;  4YG2 F;  2F48 A;  3KFW X;  4KA4 A;  3LA3 A;  5J8F A;  3OYB A;  2R5Z A;  1OCP A;  1UJ8 A;  3NAR A;  5ILV A;  1B4A A;  2LY1 A;  3CCR I;  3KNW A;  4IOA F;  4CO8 A;  1V54 H;  5LGT A;  3VW1 A;  5DD4 A;  2RRE A;  4IQJ A;  4U9L A;  4ITV A;  1PJR A;  4U0W A;  4BE1 A;  3HTA A;  1JT6 A;  3R6S A;  1TT0 A;  4AWX B;  2DA3 A;  3K1N A;  4PSX A;  3SFZ A;  2LK2 A;  1VQO I;  3K4K A;  3HUG A;  2FOK A;  3CO6 C;  1AKH B;  3FXO A;  2X0L A;  4JBA A;  1A04 A;  4NC6 A;  2Y48 A;  1BJZ A;  2X1E A;  5D5V B;  1MGT A;  5CW8 A;  2PBX A;  3BJO A;  1M1E B;  3KZZ A;  2VQL A;  3ZN1 A;  1OCO H;  4G12 A;  2K40 A;  2O0Y A;  1D1B A;  3WHB A;  1X1A A;  3GZ6 A;  2M3A A;  3DBR B;  3IH3 A;  4GCV A;  5DV5 A;  4HX4 A;  1RIO H;  4AC6 A;  4D9J A;  3VIB A;  1S7O A;  1OYW A;  3HGG A;  5EF6 A;  1R71 A;  2MA3 A;  1NG6 A;  4JOM A;  4OD4 A;  3QOP A;  2HYT A;  5E8I A;  4JL3 A;  3IRQ A;  2EFQ A;  5KAF C;  1FTT A;  3L2R A;  2DLL A;  2NS0 A;  2KJB A;  3Q3S A;  1DU6 A;  2A05 A;  2E34 A;  2GIZ A;  4CCN A;  3FX3 A;  1X1B A;  2KJC A;  2Y0S N;  4LD5 A;  1IC8 A;  1JI8 A;  3OYK A;  3MMY B;  2JSP A;  1K4S A;  2DMQ A;  2ZXI A;  4XSZ F;  4FAS D;  2ZNZ A;  2NVX J;  4EQQ A;  3PUB A;  3VOX A;  2XUB A;  4XKB A;  1JKO C;  1G59 A;  2XPW A;  3B02 A;  3ZQC A;  3V7C A;  1YQA A;  1BBY A;  2J5P A;  4KMU X;  1FWZ A;  4ENJ A;  3MKZ A;  5IOZ A;  5J1R A;  5CQE A;  4CA0 A;  3VW2 A;  1QVT A;  1ZH5 A;  1J5Y A;  3TP3 A;  3WGH A;  5FMP A;  1FZP B;  3L2C A;  2L7K A;  3O3K A;  1O3Q A;  4LB6 B;  1P7J A;  5M5Y J;  1E3H A;  1MBG A;  1XGM A;  2LF8 A;  3RYP A;  1MH3 A;  3M1C A;  4UUT A;  3IC7 A;  3I53 A;  4M9S A;  1J0R A;  2BHY A;  2DXI A;  4RBO A;  2NXN B;  3O60 A;  1LFP A;  2CG4 A;  3ERM A;  3AKZ A;  3KP5 A;  4A3B J;  1OJL A;  2VJ5 A;  3UKG A;  1W5C C;  1UI5 A;  1UMQ A;  3PNV A;  3BZC A;  1T39 A;  3W2V A;  4C2U A;  1SAN A;  4HG2 A;  2VL8 A;  4ZDL A;  4E6K G;  3K4B A;  3B73 A;  1ETY A;  4EM0 B;  3BR6 A;  2M8E A;  4I76 A;  4C3I J;  3QKX A;  5D1R A;  2XHK A;  3LAJ A;  2A6E F;  1JUM A;  2EZL A;  3PSI A;  4BBS J;  3BCG A;  3DEE A;  4XSX F;  5BPI A;  2MGQ A;  2DT6 A;  1KU3 A;  3VYT B;  1B8I B;  2A5Y B;  4M3B A;  3DKY A;  3ZQQ A;  2F5C A;  4IJA A;  2COM A;  2XC7 A;  2NVU B;  1ZG5 A;  2OTL I;  2ZKZ A;  2LSO A;  1U6G A;  4FX0 A;  3S1M J;  3HHG A;  3CCM I;  3BWG A;  2HZD A;  2KPM A;  2JPC A;  1RI7 A;  4A93 J;  2PI0 A;  2FD5 A;  4M6X A;  3T8T A;  3OYG A;  2ECB A;  2GWR A;  4U88 A;  2HYJ A;  5CVI A;  1ETK A;  3QPH A;  4FX4 A;  4IHY A;  2DU9 A;  4J19 A;  4EEF G;  2PMH A;  3V42 A;  3WGG A;  5H6Q A;  5D4R A;  3SZT A;  2FF4 A;  1Z67 A;  3I9V 2;  2HI3 A;  2JA8 J;  3P9T A;  1XB4 A;  2EIL H;  2PMZ A;  3LHQ A;  2IGN A;  3DXJ F;  1LE8 A;  4OIO F;  2Z16 A;  2HQN A;  1YLF A;  4YII A;  2CW8 A;  3UR3 C;  2LDU A;  3A01 B;  1MSF C;  3H0D A;  3CCU I;  2VOD A;  1YIO A;  5D6F A;  4BXX J;  3S2H J;  2LC2 A;  2UXX A;  3K4J A;  2CV2 A;  1UCR A;  4QSH A;  4A3K J;  2E1M C;  3DBH B;  2DDA A;  3VVX A;  1MMG A;  1YX5 A;  2XGX A;  1VF9 A;  1Z91 A;  1SMY F;  4HAM A;  3B6C A;  3BQY A;  1T0F A;  1YE9 A;  5LEK A;  5KAI C;  2K9Q A;  3F8F A;  5EZG A;  4IXA A;  4GRI A;  4IVN A;  3FXL A;  3PSF A;  5FLM J;  3ZRG A;  4AID A;  5E3M A;  1RKT A;  4PFO A;  3HL2 A;  4XM3 A;  3K70 D;  2DA4 A;  4N9I A;  1J09 A;  2OD5 A;  2RV8 A;  4GCT A;  2O03 A;  1STZ A;  1KU7 A;  3C18 A;  3WU1 B;  3BDD A;  2VQG A;  1RR7 A;  1OCC H;  5TRD A;  4KN7 X;  1YJN I;  1D0Y A;  1R9T J;  4J00 A;  3BPX A;  1QZE A;  2R5Z B;  1QBJ A;  1VQ4 I;  2UWM A;  4O6J A;  3WTS C;  2R5Y B;  4PJN A;  2HNH A;  4M3F A;  3F0C A;  2Y31 A;  4DZJ A;  3FXM A;  5EEA A;  3HM5 A;  3I55 I;  3CMA I;  3CME I;  2XRL A;  4DGW B;  2XRN A;  4BKX A;  2CV1 A;  4MTE A;  3KP2 A;  2I10 A;  3DKX A;  3BT9 A;  4P55 A;  4BXF A;  3EUA A;  3DEU A;  1YW7 A;  4FCY A;  2V79 A;  5J3L A;  3OYF A;  1LVA A;  1REP C;  1YG2 A;  1W7P B;  1IN7 A;  2LTP A;  5J4V A;  1SEU A;  4LLN A;  2R4G A;  4RB2 C;  2DG8 A;  2VPL A;  3LSR A;  3W2W A;  4A6E A;  3DU6 A;  1B9N A;  2W25 A;  3MFK A;  1HCR A;  4Y15 A;  3HSE A;  2ESH A;  1FBQ A;  3P7N A;  4G7Z F;  2WAF A;  3E6D A;  4ZJZ A;  4UVA A;  1FOY A;  3K4C A;  1Z1D A;  1IGN A;  3WU0 A;  3ZMZ A;  2W85 A;  3D0S A;  3AG3 H;  4F55 A;  3FXQ A;  2CQX A;  3VOK A;  2X1C A;  1HDD C;  3QP5 A;  5ICE A;  2DOD A;  1RZ4 A;  3AG2 H;  1FOW A;  2XDN A;  3G7R A;  1I1G A;  1MND A;  2ME6 A;  4MTD A;  3WG7 H;  1WJB A;  5AIP A;  2E1N A;  1SAX A;  1F5T A;  3EUP A;  2MG4 A;  4GFB A;  3C07 A;  2K5C A;  1YJW I;  3I59 A;  4DYR A;  3ZMS A;  2DN0 A;  4G94 A;  2GOX B;  1JTX A;  2RQQ A;  4EJT A;  4PDK A;  1WJC A;  4EM1 A;  4A3L J;  1XCV A;  1F9N A;  2HOS A;  3GTO J;  2E71 A;  5FJ8 J;  2ZJ2 A;  4MGR A;  4EJV A;  3S1R J;  1JHH A;  1HW1 A;  4E7S A;  4EVI A;  2ADU A;  4QLC U;  2RKH A;  2DO7 A;  5DUK A;  2HWV A;  2VJJ A;  2XV4 S;  3CDL A;  3EPZ A;  1YYV A;  2D45 A;  2NP3 A;  1T38 A;  1S7A A;  3KZ9 A;  2LMD A;  2G0E A;  2GUH A;  2ZCX A;  2FX0 A;  4BAY A;  4D7N A;  3UNG C;  1C0W A;  3SXY A;  1A35 A;  1TQP A;  3IAS 2;  3DTE A;  3T1B A;  3JRG A;  4MQ9 F;  2R7Q A;  3O6B B;  2P5L C;  3U21 A;  3N05 A;  4BDZ A;  1CF7 A;  4XLP F;  4EGZ A;  2IAI A;  2JA2 A;  2L9V A;  1GDT A;  1P4X A;  2BBY A;  4QWQ A;  4LG3 A;  4R1H A;  1Y1W J;  2P6S A;  4IKF A;  4BXU A;  1IV6 A;  1XS9 A;  1F4K A;  2EWN A;  3BG3 A;  1ZLJ A;  1X2N A;  2HPI A;  3HPH A;  1TWF J;  5D5W B;  2K9N A;  3R61 A;  3BC8 A;  3TMO A;  2V6E A;  1IJW C;  3MZY A;  1W0U A;  2XAS A;  2KT0 A;  5E79 C;  3RCO A;  3ZP5 A;  1FC3 A;  5IYC J;  1ZGW A;  1D1C A;  4CCK A;  3GUD A;  2FE3 A;  4ZH4 F;  1Y0N A;  3LA2 A;  3WTU C;  3K9T A;  2YUS A;  1O7F A;  5ICG A;  3JSO A;  3MZH A;  4PFP A;  5FFX A;  3H5R A;  3OIO A;  1YTY A;  2JWT A;  2BXZ A;  4CYC A;  4MHG A;  4A3G J;  4Q4Z F;  4OMZ A;  3MNL A;  2Y2Z A;  4MFE A;  3E7L A;  3RPU A;  1ZK8 A;  4P5O A;  2FBK A;  4AIH A;  2IVM A;  3M8E A;  3QYB A;  5CVU A;  5FO5 A;  3OS1 A;  5K58 A;  1RC9 A;  1Z77 A;  1IUF A;  5F08 A;  3PQK A;  2ZJP F;  3M7G A;  1W36 D;  1I39 A;  1KQ8 A;  3TBI A;  2UZK A;  4JQF A;  3ANG A;  5FKK A;  1MDM B;  4IHT A;  4BJT A;  1BJA A;  1X1D A;  2Y30 A;  3TKY A;  4KIG A;  2L02 A;  1IAW A;  4IRV A;  5DD8 A;  3DF8 A;  5HDK A;  2G7L A;  3CES A;  3OYJ A;  4YZE A;  1BW6 A;  2CRG A;  4M3E A;  4YFK F;  3S32 A;  4ENM A;  3FMS A;  3I0T A;  3K4N A;  5LBQ A;  3AQS A;  1BI0 A;  3VSL A;  3F6O A;  4ZTF A;  2QA4 I;  2NVY J;  2CUZ A;  4KNY A;  1KQ0 A;  1W7P A;  3Q0V A;  1W5S A;  3QP6 A;  1IW7 F;  1BI3 A;  3LQQ A;  1KON A;  1W4M A;  4OIR F;  1SC7 A;  3IKT A;  3BG6 A;  1QGP A;  2R3S A;  4NQW A;  2QZ8 A;  2DFI A;  2V9K A;  4GYG A;  3JRD A;  3V6G A;  1J7K A;  3GZ5 A;  1LFB A;  3TL4 X;  2CS3 A;  1WKM A;  1NK2 P;  4ZYD A;  3I4M J;  1ZKG A;  1MKM A;  3FXU A;  2BOL A;  2DA5 A;  2KLO A;  2W84 A;  3VTI A;  1TWA J;  4II2 A;  1G3T A;  2EBI A;  2OTJ I;  1O57 A;  4IL6 C;  2ZSH B;  3M9A A;  3KEY A;  4PJJ A;  4F3Q A;  1G6N A;  2DTR A;  3HEF A;  3OL4 A;  3K10 A;  4F92 B;  2XAF A;  3CUQ A;  3HSR A;  2HU9 A;  1RKW A;  3ZPL A;  2M30 A;  2CMP A;  1ZRE A;  1FX7 A;  4E70 A;  2EQR A;  1OQY A;  1LUJ B;  2QGU A;  2HEO A;  1IUY A;  1WFX A;  3Q0W A;  4WWC A;  4OIP F;  5IT9 Z;  4I01 A;  4I0A A;  2RGV A;  2MD0 A;  3PM1 A;  3TOB A;  4BGD A;  3Q5F A;  5EG0 A;  3DPJ A;  5HOD A;  2KQR A;  3GCM A;  3HGY A;  3NPI A;  1FMV A;  3CC7 I;  3QWL A;  1SD6 A;  4DW6 A;  2VT3 A;  4HNV A;  4BHP A;  3JAM Z;  1FEX A;  2LYC A;  2DMT A;  4GDF A;  3CD6 I;  3CF2 A;  1NTC A;  3SDB A;  3HOW J;  3FM3 A;  1S7E A;  5E1Z B;  2NS8 A;  1GV2 A;  4DOZ A;  5AQC A;  5BQT A;  5J6X A;  3S1Q J;  3BR5 A;  2L4A A;  5B1B H;  5K1Y A;  2GZW A;  2ID6 A;  2TDX A;  2QBY B;  3S17 J;  2O7O A;  4OMY A;  4UB8 C;  1S9H A;  5HS8 A;  2HOE A;  5H20 A;  3ZXS A;  5GTH C;  1K6O A;  3LWF A;  2DYS H;  4EGY A;  2HGC A;  5K7F A;  5HLT A;  3F8M A;  5E1W A;  1U8R A;  4XK4 A;  4BQQ A;  1T95 A;  3QAH A;  2P6T A;  2IS1 A;  3FXK A;  2HKU A;  4RAG A;  3ON2 A;  4GCK A;  2WAE A;  1R4M B;  1ON1 A;  2TCT A;  3HOT A;  2UUZ A;  1OPC A;  1S8N A;  1BIA A;  3ZQ7 A;  2WAQ A;  2HFH A;  4Z6Y A;  1HW5 A;  2WAD A;  3ZQH A;  5M3M J;  2Q1Z B;  3QYE A;  1DU0 A;  3KLN A;  2NYX A;  3RSN A;  2HQR A;  3FHZ A;  2Y0S A;  3VDX A;  2OA4 A;  3U1K A;  3M4O J;  1PDN C;  2Q8K A;  3FHN A;  4TV7 A;  2NVT J;  3WG9 A;  2MYS A;  2VBX A;  2V9P A;  3S3M A;  2GXA A;  2NNN A;  3CRJ A;  1XSV A;  2I5U A;  4NNJ A;  1R6R A;  2WWY A;  1IRF A;  2IRF G;  5D5X B;  3KKC A;  3FBN B;  2ETH A;  2JRM A;  4H4K C;  4IRG A;  5FKN A;  5CVV A;  2FBI A;  4IPA A;  3V7S A;  3OR1 C;  2QCO A;  2UXU A;  2KRC A;  3H5A A;  3PIO F;  2DFH A;  2L2O A;  5FRO A;  2ECC A;  3GBG A;  5HVQ C;  4HRI A;  3G1O A;  4E7I A;  1FPQ A;  2IT0 A;  5TIS C;  1VND A;  3QU3 A;  3BRU A;  2CO5 A;  2ZBK A;  2KIQ A;  1TWG J;  2ZC2 A;  1ZEL A;  1ZTR A;  3I3L A;  3H92 A;  5IOY A;  3J7Z I;  4RAY A;  5JHF A;  4N9H A;  1SFU A;  4CSW A;  1G3S A;  2JUC A;  3SEQ A;  1OLT A;  1J59 A;  2E7X A;  4A0Y A;  3LOC A;  4X6A J;  2YVX A;  4M71 A;  3OS0 A;  5D5U B;  3CJQ B;  4KIS A;  2Y69 H;  1EF4 A;  2OCE A;  2X9D A;  4FTH A;  2VJ4 A;  2XKP A;  9ANT A;  1H8A C;  2UXN A;  1YIT I;  1BC7 C;  5DEQ A;  4IHX A;  2NOJ B;  1MMA A;  3DKW A;  4R79 A;  4WK8 F;  4QPQ A;  5HLH A;  1BOB A;  5BPD A;  3MZ8 A;  2W7N A;  1VQP I;  1NHA A;  2HTS A;  5HS9 A;  3D5S C;  5K5O A;  2BY1 A;  2YU9 J;  1D0X A;  3M1E A;  1HW2 A;  3CTA A;  4B43 A;  3DLL F;  3E97 A;  4S0H B;  1D1A A;  2CW0 F;  1DP7 P;  4M72 A;  5CVR A;  3WE2 A;  3MKL A;  1PUF B;  2QKL B;  1AA7 A;  2BE5 F;  4X1E A;  2ZXJ A;  3E3V A;  3JR9 A;  2Y9Z A;  2PFB A;  4KDP A;  2R92 J;  2KKO A;  3V8L A;  5EJC A;  3R0A A;  4HX7 A;  2ZB9 A;  3HRT A;  2VT2 A;  4MFD A;  5CKT A;  5EGO A;  5J1Y A;  3I5U A;  1MMD A;  5EYR A;  3BR1 A;  1MJ9 A;  4HSR A;  5FD6 A;  3A03 A;  1V5G A;  5K5R A;  1H88 C;  1NK3 P;  3PUF A;  2JMW A;  2KDZ A;  1QHG A;  3H3V K;  2H6B A;  4UHT A;  1MIJ A;  2CYY A;  2IJL A;  4II3 A;  1FBU A;  3CUQ C;  4RB1 A;  1ERD A;  2BGC A;  4IX7 A;  3Q0U A;  3F6V A;  5L3F A;  3H1C A;  4G7O F;  4UUS A;  3BR3 A;  2FNA A;  5LEJ A;  5B66 C;  3BJA A;  5E3O A;  3L2Q A;  2JSC A;  4NN1 A;  4UUV A;  1B72 B;  2A2F X;  5ICF A;  2J5O A;  2CSO A;  2IP2 A;  4LB5 A;  1GUU A;  3BR0 A;  2OPT A;  3M8F A;  5IP6 A;  2XAJ A;  5BS6 A;  1G8X A;  3DPU A;  3OOP A;  1R36 A;  3HKZ N;  4BDY A;  3ANP A;  4M3D A;  5IT9 K;  4YEL A;  4XIC A;  1JJ8 C;  1GXQ A;  2PEX A;  1GHC A;  4G9Y A;  2LKX A;  3CO7 C;  4RGX A;  1ONV A;  3K0L A;  4RAF A;  3RTR A;  5JLW A;  4Q48 A;  1LNW A;  1MMS A;  2H8R A;  4XOT A;  2E60 A;  3MVP A;  5FGL A;  1IDY A;  5KHD A;  1FT9 A;  2K3F A;  1B72 A;  2GQQ A;  2RAS A;  2N8G A;  3I71 A;  4MNU A;  4KT6 A;  1OKR A;  3K4M A;  2OF7 A;  3MQ0 A;  5GAH J;  1D8K A;  4LOC A;  3SEZ A;  3WTZ A;  1R5H A;  2EJR A;  1VQ7 I;  2F5D A;  1WH5 A;  4A3E J;  2XAH A;  5LD2 C;  2EB7 A;  5E3N A;  2L9S A;  2XAG A;  4I7H A;  3RJP A;  1SMT A;  3BJ6 A;  4BQO A;  4ME9 A;  3BR2 A;  2KDO A;  1YW8 A;  2HS5 A;  2P7V B;  3E1S A;  3KYD B;  3SYT A;  2RNJ A;  2LBF A;  5IP9 J;  3ABL H;  4PJM A;  4LG0 B;  3SHF A;  5ED4 A;  3K8P C;  2LRE A;  5F27 A;  2O8K A;  4PZJ A;  3I4P A;  2Z1D A;  3WTX C;  1WJE A;  2HXI A;  4AU7 A;  3ZQF A;  4OWR B;  3F23 A;  4RM3 A;  1DQU A;  1U3E M;  3F9K A;  3FXR A;  2DAO A;  2GM4 A;  4BEH B;  5LRS A;  5H9T A;  1DPU A;  2ZME B;  1BL0 A;  4YEJ A;  1HST A;  4HYE A;  4MQV A;  2ISZ A;  5F1R A;  2HVR A;  2FXA A;  2STW A;  2M0C A;  2MH9 A;  1YRN B;  3BTI A;  1X3U A;  3P9K A;  1R1T A;  5CLS A;  3F21 A;  4FHT A;  3BTL A;  2DT7 B;  1Q1V A;  1JKQ C;  4GFL A;  3G1M A;  1WPK A;  3OOU A;  2YS9 A;  3TQN A;  1O4X A;  1SFK A;  1TBX A;  2EFN A;  2ZCW A;  3VWB A;  2NP5 A;  3GLX A;  2XGD A;  1I50 J;  1TWC J;  4XKV A;  2L7F P;  1Z9C A;  3CQZ J;  1A36 A;  3GTM J;  4MEY F;  2A69 F;  1XPX A;  4CHU A;  3LJL A;  1MJA A;  3H36 A;  4AIJ A;  3H3U A;  2AS5 F;  3J7Y J;  3Q9V A;  1OYI A;  2Q24 A;  1Z6T A;  4ENK A;  2IS6 A;  2PZ9 A;  2JN6 A;  3H9J A;  4XLA A;  2LKS A;  4LGW A;  2FU4 A;  4XMY A;  2QYO A;  4ZYH A;  4BY7 J;  1K6Y A;  1TW3 A;  3CDH A;  3KP3 A;  3WE3 A;  4A3M J;  3RKX A;  1U5T A;  2EZK A;  2NX4 A;  2EA4 A;  3BTC A;  3L09 A;  1IXS B;  2WY7 Q;  3BG5 A;  2X6X A;  4LJZ F;  2RN7 A;  2R7X A;  2A6H F; 
#chains in the Genus database with same CATH homology
 3S1R J;  2E19 A;  2EH3 A;  3MN2 A;  1YRN A;  1POG A;  2RAE A;  5CXI A;  2G3B A;  2CUF A;  1MSE C;  1U8B A;  2VI6 A;  3CDL A;  1W0T A;  4DZP A;  2NP3 A;  2WUI A;  2W53 A;  3HE0 A;  3COL A;  1MBK A;  4JP0 A;  2XPU A;  4B3A A;  3PO2 J;  3KZ9 A;  3PPB A;  1WGX A;  2G0E A;  1QPI A;  5CXG A;  2GUH A;  1MBJ A;  2QKO A;  2ZCX A;  2FX0 A;  4D7N A;  1GT0 C;  5HBU A;  2UXI A;  3JRG A;  3CJD A;  5F1J A;  1ITY A;  4JNN A;  4L62 A;  3GTK J;  5F0C A;  3FIS A;  3GTP J;  1H89 C;  2FBQ A;  4IHV A;  5M5W J;  2IAI A;  2GBY A;  2CQQ A;  2L0K A;  2FJ1 A;  1GDT A;  4A3D J;  3NNR A;  5D19 A;  4IHW A;  4W1U A;  4XRS G;  1UG2 A;  4XID A;  2E2I J;  1Y1W J;  2LR8 A;  2JA7 J;  2JA6 J;  4A69 C;  5DTD A;  2DJN A;  5JLX A;  3PAS A;  1WH7 A;  1IV6 A;  1XS9 A;  4UUS B;  5FLV A;  3RQI A;  3BG3 A;  3FIW A;  4JX6 A;  1X2N A;  1TWF J;  3GTG J;  2K9N A;  3LSP A;  5DS9 A;  4XRM A;  3FKI J;  1IJW C;  3RKQ A;  2XB0 X;  3L1P A;  1W0U A;  2KT0 A;  3HTH A;  2HXO A;  2K9S A;  5IYC J;  4MXM A;  1ZGW A;  2ZOZ A;  3E7Q A;  3NI7 A;  3C2B A;  5M3F J;  5C3E J;  5D18 A;  1MNM C;  2L7M P;  2YUS A;  3BJB A;  1AU7 A;  4W97 A;  3OIO A;  2JA5 J;  5GPA A;  3QBM A;  2JWT A;  1U9N A;  2P81 A;  4CYC A;  4A3G J;  2M8G X;  1ETX A;  2HQ5 A;  1LE8 B;  3JRA A;  1U78 A;  4DYQ A;  2M9H A;  3IH4 A;  4V2G A;  4GFL A;  3MNL A;  3S5R A;  4MFE A;  2Y2Z A;  2O9L A;  3E7L A;  1ZK8 A;  4M3G A;  1ETV A;  5J1U A;  3JRH A;  3GTQ J;  3ON4 A;  3DEW A;  3QPS A;  5K58 A;  1MH4 A;  1Z77 A;  3CWR A;  2F07 A;  1WCM J;  3OSG A;  3DCF A;  3LWJ A;  1IUF A;  5F08 A;  4FE4 A;  3TP0 A;  5C4Y A;  1A6I A;  2YVE A;  3ANG A;  3G56 A;  5FKK A;  4MK6 A;  4JYK A;  1XC5 A;  3JRB A;  5M5X J;  3S14 J;  2Y30 A;  2UXO A;  2UXH A;  4XRS A;  1ETW A;  1MBH A;  1JT0 A;  1ZR2 A;  3VPR A;  5EZH A;  5IYD J;  2DA1 A;  4AUX A;  2G7L A;  1MBE A;  2REK A;  2YVH A;  4YZE A;  1CQT A;  1BW6 A;  2GFN A;  2QWT A;  2CRG A;  2HOT A;  4M3E A;  2OI8 A;  2AO9 A;  2ZOY A;  1Z0X A;  4V2F A;  4BY1 J;  3GTJ J;  3QPL A;  3TED A;  4Y52 J;  2MSY A;  3AQS A;  4CYC B;  2E2J J;  1A5J A;  3B81 A;  2NVY J;  1MBF A;  1F36 A;  4A3J J;  3Q0V A;  3O8G A;  1JKR C;  3NXC A;  4HKU A;  5IPA A;  3BTJ A;  3V78 A;  3CCY A;  2DA7 A;  3JRD A;  3V6G A;  4D7M A;  3JRE A;  4L5E A;  2QF7 A;  3HIM A;  1HOM A;  1LFB A;  1NK2 P;  3I4M J;  1ZKG A;  1TC3 C;  2DTZ A;  1FTZ A;  3T6N A;  2DA5 A;  3K2A A;  2L9R A;  2XGC A;  3S16 J;  1TWA J;  2Y9Y A;  2EBI A;  2RHA A;  3D1N I;  1IG7 A;  3H0G J;  4B1R A;  1I6H J;  5FKM A;  3GTL J;  3VVY A;  2ELK A;  3NRG A;  5IP7 J;  3HEF A;  3HOX J;  1RKW A;  3FK6 A;  2ZCM A;  2EQR A;  5FHP A;  3HB9 A;  4B4C A;  5C4X J;  1FJL A;  2XGE A;  3Q0W A;  4GFK A;  5FKO A;  4DYC A;  2DMN A;  1D5Y A;  5IYB J;  5EGO B;  3PM1 A;  2JJ7 A;  2VKV A;  1JTY A;  3HBL A;  2R93 J;  3FRQ A;  1JUS A;  5EG0 A;  3DPJ A;  2M2E A;  1F43 A;  5HOD A;  3HGY A;  1PUF A;  3NPI A;  1SFO J;  5DAJ A;  3EGQ A;  4DW6 A;  1K61 A;  4HNV A;  4CGR A;  2LLK A;  3RZD J;  1FEX A;  3HTJ A;  2L7Z A;  4Y7N J;  3LSJ A;  2DMT A;  2E1O A;  4I6Z A;  1NTC A;  2IBD A;  2R0Q C;  4NEL A;  3HOW J;  4D5C A;  1S7E A;  2NS8 A;  5EG0 B;  2R5Y A;  1GV2 A;  1Y1V J;  5AQC A;  1AKH A;  2R5Z A;  3S1Q J;  1OCP A;  3BR5 A;  3NAR A;  3LNQ A;  2E2H J;  3KNW A;  2WAQ N;  2WB1 N;  3VVZ A;  2ID6 A;  3CMY A;  3S17 J;  2O7O A;  3VW1 A;  3HTA A;  1JT6 A;  1RES A;  2GEN A;  2G7S A;  2NOG A;  2DA3 A;  3QQA A;  3BQZ A;  5K7F A;  4D5F A;  3RD3 A;  4KWA A;  1VI0 A;  2LK2 A;  4XK4 A;  4C3J J;  3BHQ A;  1HDP A;  3BNI A;  1AKH B;  2JK3 A;  2MW8 A;  2TRT A;  2HKU A;  3ON2 A;  4GCK A;  2TCT A;  1ZQ3 P;  1BJZ A;  1JKP C;  5BNG A;  5CW8 A;  2PBX A;  5M3M J;  3ZQH A;  1DU0 A;  4G12 A;  2K40 A;  3WHB A;  1E3O C;  3GEU A;  3M4O J;  3IH3 A;  1T56 A;  1T33 A;  4ABZ A;  2NVT J;  2DA6 A;  4AC6 A;  3VIB A;  1RPW A;  5K7H A;  3A01 A;  2VUM J;  3CRJ A;  3HGG A;  5EF6 A;  4A3C J;  1JUP A;  2HOA A;  3KKC A;  1GVD A;  2HYT A;  4JL3 A;  3JRI A;  5FKL A;  3SDG A;  1FTT A;  1DU6 A;  3Q3S A;  5FKN A;  2NS7 A;  2Y0S N;  2QCO A;  1IC8 A;  2UXU A;  4C2M J;  2DMQ A;  2ECC A;  3GBG A;  3G1O A;  2NVX J;  5E3L A;  3RZO J;  3HDD A;  3VOX A;  1UHS A;  1VND A;  1JKO C;  1U9O A;  3S15 J;  2XPW A;  3BRU A;  3ZQC A;  1FIP A;  1TWG J;  1ZTR A;  4MO7 A;  5IOY A;  2LFB A;  2B63 J;  1XG1 A;  1AHD P;  5GP9 A;  5IOZ A;  5J1R A;  3VW2 A;  1QVT A;  3TP3 A;  4IEJ A;  1ZR4 A;  2IU5 A;  5FMP A;  3IV5 A;  1ENH A;  1P7J A;  3LOC A;  3W6V A;  4X6A J;  1X58 A;  5M5Y J;  1EF4 A;  1MBG A;  2XPV A;  2X48 A;  2X9D A;  1MH3 A;  2FQ4 A;  2XB5 A;  5K7Z A;  3JRC A;  4FTH A;  4UUT A;  9ANT A;  1H8A C;  4RBO A;  4ICH A;  3O60 A;  4IHX A;  1SGM A;  4A3B J;  1OJL A;  1APL C;  3UKG A;  4QTR A;  1UI5 A;  1UMQ A;  4MLO A;  2LD5 A;  5HAW A;  3S1N J;  1G2H A;  2NVQ J;  5EDN A;  2YU9 J;  1SAN A;  1IRZ A;  3NAU A;  1ETY A;  3KKD A;  3BR6 A;  4I76 A;  4S0H B;  4C3I J;  3K7A J;  3QKX A;  5D1R A;  2QOP A;  1JUM A;  2EZL A;  3JRF A;  3MKL A;  1PUF B;  4BBS J;  1BA5 A;  3BCG A;  1QRY A;  4X1E A;  3TW6 A;  1JGG A;  2MGQ A;  3JR9 A;  2Y9Z A;  2R92 J;  3B6A A;  1B8I B;  1K83 J;  2ZB9 A;  4MFD A;  1ETO A;  5EGO A;  5J1Y A;  4M3B A;  5EYR A;  4QIW N;  3BR1 A;  1H88 C;  1HF0 A;  3A03 A;  2QTQ A;  1NK3 P;  2JMW A;  4BBR J;  3IH2 A;  2KDZ A;  1OCT C;  3H3V K;  3S1M J;  3VW0 A;  2O7T A;  2AHQ A;  2EZI A;  3HTI A;  2EZH A;  3A02 A;  3Q0U A;  3VP5 A;  4A93 J;  1VFC A;  2FD5 A;  3ZOB A;  1UI6 A;  3AQT A;  4UUS A;  2ECB A;  3BR3 A;  5F04 A;  2HYJ A;  4FE7 A;  1ETK A;  4IHY A;  1I3Q J;  3HOZ J;  4C3H J;  5E3O A;  4J19 A;  4FIS A;  4EEF G;  1HLV A;  4NN1 A;  1B72 B;  2VPR A;  4PXI A;  3P9T A;  2HI3 A;  2JA8 J;  3OSF A;  3LHQ A;  2M34 A;  3FK7 A;  1LE8 A;  1GUU A;  2OPT A;  3BR0 A;  1P7I A;  5IP6 A;  3ZQI A;  1LFU P;  3GZI A;  1B8I A;  3HKZ N;  3A01 B;  3G1L A;  2ZCN A;  3PO3 J;  1MSF C;  2ME0 A;  3ANP A;  2CJJ A;  4M3D A;  2LY9 A;  3BG9 A;  2DA2 A;  4XIC A;  4BXX J;  3S2H J;  1JJ8 C;  2LKX A;  4QSH A;  4A3K J;  2W48 A;  2D5V A;  3VVX A;  2H1K A;  1VF9 A;  5JLW A;  4RDU A;  2H8R A;  5GPC A;  3B6C A;  3BQY A;  4JX4 A;  3MVP A;  5EFY A;  5FGL A;  1IDY A;  2K9Q A;  5EZG A;  1B72 A;  2RAS A;  2N8G A;  5FLM J;  5E3M A;  1RKT A;  1ORK A;  2GLO A;  2OF7 A;  3S2D J;  4JKZ A;  2DA4 A;  4LOC A;  2CU7 A;  4A3I J;  4GCT A;  2D6Y A;  2COB A;  3RH2 A;  2CUE A;  1ETQ A;  1WH5 A;  5C4J J;  4A3E J;  3VUQ A;  1QVU A;  5E3N A;  2ID3 A;  2R7Z J;  5C44 J;  1RR7 A;  4ME9 A;  3BR2 A;  3I4N J;  1R9T J;  2PMZ N;  5IP9 J;  2R5Z B;  4MIM A;  3TW7 A;  3ZQG A;  2R5Y B;  1IDZ A;  4A3F J;  5F27 A;  2O8K A;  4M3F A;  3F0C A;  2Y31 A;  4ACI A;  4DZJ A;  5EEA A;  2HXI A;  2LP0 A;  3HM5 A;  3ZQF A;  1BW5 A;  3HOY J;  3F1B A;  2QIB A;  2XRL A;  1FIA A;  2WV1 A;  4BKX A;  2GM4 A;  3HOV J;  5H9T A;  2DG7 A;  2X6O A;  2I10 A;  2V57 A;  3BT9 A;  1BL0 A;  3JSJ A;  1TWH J;  4FCY A;  3IUV A;  5J3L A;  2M0C A;  2OER A;  1YRN B;  2LTP A;  3BTI A;  2IEK A;  2DG8 A;  2DMU A;  3BTL A;  3LSR A;  5F0F A;  1Q1V A;  1WI3 A;  2DMP A;  2XSD C;  1JKQ C;  3G1M A;  1WPK A;  3OOU A;  2YS9 A;  1O4X A;  1HCR A;  4GCL A;  2LVS A;  2NP5 A;  2WGB A;  1OFC X;  2XGD A;  1I50 J;  1TWC J;  1RET A;  1X2M A;  2L7F P;  2VKE A;  3HOU J;  3CQZ J;  1IGN A;  3O8H A;  4AYB N;  3GTM J;  1JJ6 C;  2HDD A;  4UDS A;  4NDL A;  3LJL A;  3VOK A;  2CQX A;  4JX5 A;  1HDD C;  4AF5 A;  5F0H A;  2Q24 A;  2XDN A;  3G7R A;  3SFI A;  2PZ9 A;  1GV5 A;  2JN6 A;  2ME6 A;  4M6V A;  3ZQL A;  3M3Y J;  3LSG A;  2UXP A;  2G7G A;  3EUP A;  4BY7 J;  2MG4 A;  4GFB A;  3C07 A;  3WHC A;  4DYR A;  4A3M J;  5HSZ A;  2DN0 A;  2EZK A;  2NX4 A;  3BTC A;  1JTX A;  4AC0 A;  3SJM A;  3BG5 A;  4A3L J;  2HOS A;  3GTO J;  5FJ8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...