3HGYA

Crystal structure of cmer bound to taurocholic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CmeR
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: crystal structures of CmeR-bile acid complexes
rcsb
molecule tags Transcription repressor, drug binding
total genus 75
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hgyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hgyA02
2NVXJ 3JSJA 3M3YJ 1HOMA 2XDNA 4C2MJ 3CJDA 4JX4A 3HOXJ 3I4NJ 4A3MJ 2RHAA 3G56A 4YZEA 4A3JJ 2DMQA 2G7LA 4RBOA 2HOAA 3KZ9A 1NK3P 4QSHA 3S14J 3DEWA 5HODA 4CYCA 3HOVJ 5C4YA 2EZLA 4FISA 2REKA 3TW7A 1B8IB 1B72B 2QOPA 3ZQFA 1MBEA 4XK4A 3JR9A 2ZCXA 5C3EJ 2ECCA 2OF7A 4MLOA 5EGOB 1MNMC 3JRBA 1JGGA 4NDLA 1JKOC 1NK2P 4G12A 4A3FJ 2WGBA 1GUUA 2ME6A 4XRSG 1JTYA 3ZQLA 2Y30A 2PZ9A 2WAQN 3W6VA 2DA4A 4A3GJ 3ANPA 2DA1A 1NTCA 2GENA 2M0CA 2CJJA 3JREA 1Y1WJ 1ZR4A 2FJ1A 1TWFJ 1APLC 2HXIA 4MFDA 3ON4A 4MFEA 3T6NA 4AC0A 5EEAA 1JKRC 3F1BA 2MG4A 2JMWA 2DN0A 3S1NJ 2XGCA 3Q3SA 2NS8A 1GV5A 4M3BA 3JRCA 5DAJA 2QKOA 5IOZA 3B6AA 1WH5A 2FQ4A 2E19A 2JJ7A 2Y9ZA 4AUXA 5J1RA 1W0UA 1OJLA 2LD5A 2CQQA 4UUTA 2JA7J 1RKWA 2AHQA 1ETXA 3HGGA 1IC8A 5F27A 1ETKA 2D6YA 3VUQA 3QQAA 1JKQC 1AKHB 2LFBA 1Y1VJ 3BTCA 5HSZA 1H8AC 4GFKA 4GCKA 3BTIA 2HYTA 1TWHJ 2CU7A 3BR2A 1E3OC 1JT0A 4MK6A 1T56A 2R5YA 2XSDC 5FLVA 3CRJA 3ZQGA 2I10A 5EZGA 2ID6A 4W1UA 5IOYA 1PUFB 5D19A 2HKUA 2JWTA 2R5ZB 3NNRA 1UMQA 1ZTRA 3G1LA 2CRGA 1JKPC 1WGXA 1S7EA 2XRLA 4C3JJ 2IU5A 1BA5A 3NXCA 1MBHA 4IHYA 1LFBA 5M5XJ 9ANTA 2GUHA 3LSRA 2F07A 1JJ8C 3HTAA 3NARA 5F0CA 4HKUA 2K9NA 3UKGA 3S1RJ 4CYCB 1GVDA 2OPTA 4MO7A 3HOZJ 1IV6A 4IEJA 2L7MP 3VOKA 2Q24A 3NRGA 1P7JA 5M5WJ 3HTHA 1WI3A 3S15J 3HE0A 1BW6A 2R7ZJ 1MH4A 1BW5A 3GTJJ 2WB1N 3ANGA 2ZB9A 5HBUA 2L9RA 1UI6A 3ZQCA 3GBGA 1OCTC 4JKZA 5FKMA 3A01A 5K58A 1TWCJ 4C3IJ 2NVTJ 3G7RA 3IH3A 2DTZA 5EDNA 3IUVA 5CXIA 3S2DJ 2DMTA 3Q0VA 3HOYJ 3GEUA 3S17J 4C3HJ 1OCPA 1X2NA 1IUFA 2HQ5A 3BNIA 2YVHA 1U78A 4M3FA 1ZR2A 2R93J 3HIMA 2L0KA 3IH4A 4B3AA 3A03A 2R0QC 3C2BA 1VNDA 3JRAA 2Y2ZA 2G7GA 1UHSA 3H3VK 5F0FA 5H9TA 3HB9A 3V78A 1VFCA 5E3LA 1FJLA 2VKEA 2E2JJ 2NP3A 2OI8A 3BR6A 3RQIA 4UDSA 2LTPA 3VW0A 4UUSB 2DMPA 4BXXJ 3HDDA 3E7QA 4D5CA 5FHPA 4BBRJ 5C4JJ 4A93J 3COLA 5IYDJ 2FBQA 2XGDA 2DA5A 2HI3A 3LSGA 1QVTA 2EQRA 4BBSJ 2IEKA 3AQTA 5IYBJ 3QPLA 2LY9A 2CUFA 1DU0A 3I4MJ 4XRSA 1ETOA 5EF6A 1FIPA 5JLWA 1LFUP 2DG7A 2DA6A 2NOGA 1QPIA 1GT0C 5EZHA 1XC5A 2MSYA 1MBKA 2XPVA 4I6ZA 2NP5A 2W53A 4JNNA 3BTJA 4A3CJ 2Y31A 3BR3A 3ZQIA 5IP6A 2EBIA 1JUPA 1LE8B 2VUMJ 2UXOA 1IG7A 2R92J 4ME9A 4XIDA 2WUIA 1P7IA 1UG2A 3PASA 4CGRA 1RKTA 1ETWA 3NI7A 3HBLA 3FRQA 1ZGWA 3HTJA 1U9NA 1I3QJ 2LR8A 3PM1A 3GZIA 1RPWA 3D1NI 4XRMA 1IDZA 5DS9A 4XICA 2M34A 3SFIA 2YVEA 4PXIA 3C07A 2NX4A 4S0HB 3S16J 4X1EA 1ITYA 4ACIA 3CMYA 4A3EJ 2B63J 2YUSA 1VF9A 1T33A 3FIWA 1SGMA 4L5EA 1AHDP 2G3BA 3CQZJ 3S5RA 3KNWA 3VP5A 2MGQA 1YRNB 2ME0A 1F36A 2CQXA 2G0EA 2K9SA 4X6AJ 4MXMA 2JA8J 1FIAA 2DA2A 3O8GA 2ZCNA 4BY7J 2GLOA 4ICHA 1ZK8A 2LLKA 1JUSA 3QPSA 1TWAJ 1ZKGA 5EG0B 5F08A 3O60A 4KWAA 1A5JA 3HOWJ 5DTDA 1U8BA 1MSEC 3A02A 3IV5A 3JRFA 4IHVA 2LP0A 4A69C 2XB0X 3K2AA 1MH3A 4MIMA 1JJ6C 2QWTA 3V6GA 3FK7A 3MVPA 2PMZN 5FJ8J 4A3KJ 3H0GJ 4AYBN 1I50J 2H1KA 2DMUA 3BJBA 2RAEA 4GFBA 2K40A 1B72A 4BKXA 2CUEA 3VW2A 5EGOA 2UXIA 1QRYA 5F0HA 1Z0XA 2HOSA 2QCOA 5FKKA 5FLMJ 2E2HJ 1MBFA 5IPAA 2G7SA 2UXHA 3CDLA 1WCMJ 1Z77A 2NVYJ 2KDZA 1G2HA 1WPKA 3LOCA 3KKDA 2HOTA 3BT9A 2W48A 4V2FA 3LNQA 5D18A 5EFYA 5J1UA 2O7TA 3VW1A 2HYJA 1Q1VA 2QF7A 4A3BJ 1K83J 1ENHA 1ETVA 3BRUA 1XG1A 2TRTA 3RD3A 1X58A 1GV2A 5M5YJ 1XS9A 2DMNA 3L1PA 2E2IJ 3FISA 4HNVA 2ZOYA 2O7OA 3LHQA 3PO3J 4Y7NJ 3O8HA 4DZPA 2YS9A 2X9DA 3GTOJ 2OERA 2D5VA 1IRZA 2ID3A 4D7MA 3F0CA 3NPIA 3Q0UA 4BY1J 2DA3A 3G1MA 3BCGA 2LKXA 2JN6A 3EUPA 1IDYA 5E3NA 3BR1A 3JRHA 3VPRA 3S2HJ 1OFCX 2EZIA 3GTLJ 3E7LA 2XGEA 2JA5J 1FTTA 4JL3A 2V57A 4M3GA 5FKOA 1QVUA 3S1QJ 5C4XJ 2ECBA 3OSGA 3HOUJ 3B6CA 3VIBA 2DJNA 5E3MA 3GTMJ 3IH2A 4JX5A 4LOCA 1PUFA 3P9TA 1RETA 1FTZA 3VVXA 1RR7A 2R5ZA 3RZDJ 2R5YB 4J19A 2VPRA 2UXPA 4DYQA 3ZQHA 1HDPA 3BG5A 4JP0A 2FD5A 3SDGA 2HXOA 4L62A 3EGQA 4DZJA 1JTXA 1HLVA 2XB5A 3BQYA 5D1RA 2VKVA 4JX6A 2HDDA 1IGNA 5EYRA 2Y0SN 2ZOZA 3KKCA 2X6OA 3HKZN 5IYCJ 3OSFA 2VI6A 1ORKA 3CCYA 1K61A 3GTPJ 2GBYA 3NAUA 3TP3A 1MBGA 1H89C 4FE7A 3BR5A 2O9LA 2RASA 2IAIA 2P81A 5K7ZA 1SANA 2O8KA 1MBJA 3B81A 3DPJA 2NS7A 4FE4A 3BG9A 3QKXA 3ZOBA 1HDDC 2ELKA 1R9TJ 3FK6A 3ON2A 4RDUA 1WH7A 1MSFC 4B4CA 5C44J 3SJMA 4GFLA 4D5FA 1FEXA 4EEFG 4GCTA 5F04A 1JUMA 2GFNA 3A01B 1F43A 2JK3A 1H88C 4A3IJ 4DW6A 2L7ZA 3HM5A 5FMPA 4B1RA 3LJLA 3Q0WA 4ABZA 1HCRA 3RH2A 5CW8A 3OIOA 4QIWN 4M3EA 5F1JA 2K9QA 2WV1A 3HEFA 2NVQJ 2QIBA 2ZCMA 4DYCA 2PBXA 4W97A 1BJZA 2FX0A 3JRGA 4FTHA 3VVYA 3TW6A 3DCFA 4UUSA 3CWRA 3LWJA 1I6HJ 3LSJA 3MNLA 5GP9A 1TC3C 2LK2A 3JRDA 2AO9A 5J1YA 3BG3A 2XPWA 1IJWC 5J3LA 3GTQJ 5IP9J 2YU9J 2QTQA 5AQCA 3MN2A 4D7NA 2M8GX 2IBDA 4NN1A 2Y9YA 1B8IA 3BTLA 3TEDA 2X48A 1CQTA 2TCTA 4IHXA 3JRIA 2JA6J 4M3DA 3K7AJ 4V2GA 1TWGJ 4JYKA 1A6IA 2COBA 3VOXA 2XPUA 1POGA 4Y52J 4GCLA 5M3MJ 5JLXA 3BR0A 1D5YA 5E3OA 4IHWA 1LE8A 3VVZA 5IP7J 3S1MJ 1O4XA 1ETYA 2M9HA 5HAWA 2DA7A 4QTRA 5FKNA 2N8GA 5GPCA 2H8RA 2DG8A 4A3DJ 1RESA 5BNGA 4A3LJ 1HF0A 3QBMA 1W0TA 2GM4A 4NELA 3G1OA 2EZKA 1EF4A 3BHQA 1BL0A 5FGLA 3PO2J 4I76A 1X2MA 3OOUA 2MW8A 5FKLA 1DU6A 1GDTA 2KT0A 1UI5A 1AU7A 3TP0A 1JT6A 3GTGJ 3AQSA 3LSPA 3HTIA 1VI0A 2L7FP 2LVSA 3FKIJ 5CXGA 2EH3A 4DYRA 5K7FA 2EZHA 2M2EA 4M6VA 3WHBA 3PPBA 4AF5A 1AKHA 5GPAA 3GTKJ 1YRNA 1ZQ3P 1U9OA 4FCYA 3MKLA 3M4OJ 5M3FJ 3RKQA 4AC6A 1SFOJ 2UXUA 5EG0A 3RZOJ 5K7HA 3HGYA 3BQZA 3WHCA 2E1OA 1ETQA
chains in the Genus database with same CATH superfamily
3B02A 2NVXJ 3L2WA 1D8JA 1XN7A 3CUQA 3I4NJ 4A3MJ 2FBIA 4A3JJ 1LVAA 3KZ9A 3EYYA 2WWYA 3S14J 4GO1A 4XR6A 3FHZA 3HOVJ 1W4MA 4PK4A 5HDGA 5C4YA 4CO8A 1MGTA 1C0WA 4AM3A 2DT7B 3F9KA 3ZQFA 1TT5B 1MNMC 2OF7A 3CC7I 3AL0B 4OIQF 1T39A 3JRBA 2RREA 5LGNA 2DOEA 1BR2A 1YS7A 1O3QA 2ME6A 1IN5A 4RA2A 4HDUA 1G4DA 1JTYA 3CLOA 1Z67A 1X3UA 5FFXA 3DKXA 2MH9A 1FWZA 4A3GJ 5CPRB 3V8KA 2GENA 3PNYA 2M0CA 5B1AH 5HS9A 2H1LA 2YR2A 4M71A 1YLFA 3K2ZA 2HXIA 4MFDA 1S6LA 2LY2A 1R5ID 5ILSA 2MH2A 3F1BA 4YELA 2JMWA 4ZTFA 4V19K 1GV5A 3JRCA 3L2UA 4CCOA 5IOZA 2I8DA 3SEQA 2Y9ZA 2IS6A 4AUXA 5J1RA 3A1YA 1MD0A 3ISPA 2V4JC 3OIQA 2B9SA 2Z3YA 2A6HF 1ETXA 1V3FA 2GA2A 1ETKA 3RKYA 5J8CA 1GXQA 1ZLJA 2L54A 3QQAA 1R49A 2D6YA 3VUQA 4HNTA 1AKHB 1TLHB 1WI9A 5J4VA 4RM3A 2CO5A 5IY5H 4MK6A 4HA8A 1Z3YA 4RAGA 3I9V2 5D19A 3D5SC 1PUFB 2XKPA 3CCMI 2NYXA 3NQOA 5E8IA 5ICEA 2R5ZB 2JT1A 1ZTRA 4NB5A 5TJJA 3AKZA 3BPXA 4YFXF 2RV8A 1JKPC 1ACIA 3J80K 1BA5A 3IAS2 3NXCA 2L4AA 1SD6A 3PNTA 2BGCA 1VQ8I 4IHYA 3PSFA 4LFUA 3M8JA 1JJ8C 1YS6A 2UXNA 2KFDA 4HKUA 3UKGA 5DUIA 1GVDA 1Z7UA 4D0PA 4QLCU 4U0WA 1QQIA 4MO7A 4Z6YA 1IV6A 1WQ2A 4UVAA 1YX5A 5M5WJ 2STWA 2D1VA 1WI3A 3ZQQA 3DBHB 4HDVA 3HPGA 1BW5A 3K70D 1SFKA 3ZGKA 3DWLE 3FXMA 1T0FC 5BMZA 5FKMA 1FNNA 1TZLA 5B1BH 2L9SA 4L5JA 3OR2C 4U9NA 3IH3A 3QPTA 3EUKL 1X1BA 4H4KC 5KCMA 1W36C 3L7WA 3DLAA 4HF0A 4C3HJ 4BHPA 1NH3A 3BCAA 2HTJA 3FXLA 1GXPA 3GZNB 3A4CA 3T1BA 2R0QC 2V9KA 3C2BA 2QEXI 5E79C 2E1MC 2E34A 2LDUA 1HSJA 2HNHA 5F0FA 4BQQA 4AVZA 1FJLA 4XSZF 3GXOA 3RQIA 4UDSA 2LTPA 2CYYA 2JSCA 4UUSB 4Q48A 4WK8F 2PLYA 3HDDA 4BBRJ 4ENJA 3F3XA 4TV7A 3AG2H 3KP2A 4LMYA 2P8TA 1LEAA 3H36A 1X1PA 1KU7A 2R7UA 1QHHD 1D0ZA 2HVRA 2HI3A 3LSGA 5EEGA 3DP7A 1BI3A 3MCZA 4IO9F 2D2WA 3OR1C 4G8XA 5K5OA 1DU0A 3RDIA 3PIPF 4XRSA 2E1OA 2W82A 3KEOA 3H5NA 4XM3A 3CCSI 2W85A 3ECOA 2NOGA 1QPIA 5EZHA 2NP5A 4I6ZA 3I5UA 5HLGA 3HXLA 3BDDA 4JNNA 1EJ9A 4WF2A 2Y31A 4IOCF 2MA3A 2EBIA 5IP6A 3BZKA 4RLQA 1IG7A 1SAUA 3PASA 1ETWA 3CD6I 2VBZA 4C2UA 5IT9K 5B66C 2E1MB 1BI0A 5EJCA 2HYGD 2VJ4A 2MLGA 1VQKI 3HTJA 1KU3A 2VT2A 1I3QJ 2LR8A 1XX5A 4CCKA 1ZG5A 4IZZA 1LFPA 1OYWA 5ILVA 3OYBA 3TKYA 4XKVA 4PXIA 4RGSA 1QBJA 2OZUA 4PCQA 3GLLA 4A3EJ 3H3ZA 5H2FC 2PJRA 1VF9A 3H1CA 1OCZH 4A0ZA 2BBYA 1DGWY 1R00A 1AHDP 3ZMUA 3S5RA 3WU2C 1O3TA 3KNWA 1MZBA 3VP5A 4G6TB 1YYVA 1YRNB 1F36A 2JTVA 2OBPA 4CHUA 1R4NB 3O8GA 2OUMA 3IRQA 2ZJRF 4ICHA 1ZK8A 4WXCA 1JUSA 1KQ9A 1X4PA 1XDUA 2DK5A 3AG4H 5HS7A 5DTDA 1ZHFA 1FYKA 4LGWA 1MSEC 3I4PA 1HBXG 3A02A 1H9GA 3JRFA 1VQOI 1S3JA 4IF4A 2XB0X 3K2AA 3J81Z 4HF1A 2CGPA 4G7OF 2VT3A 3V4GA 4XKBA 3J7ZI 3M8EA 1A04A 2RAEA 2RN7A 4AIHA 2QENA 3GX4X 2K40A 3IWZA 1G3SA 1B72A 4BKXA 3RIRA 1LJ9A 2DT5A 4WX9A 5EGOA 4ESJA 2UXIA 1S29A 1MMNA 2HOSA 3GVAA 4XONA 5D5VB 3GCMA 5IPAA 1ZRFA 2UXHA 1BM9A 1WCMJ 2KDZA 3EDPA 3LOCA 3I58A 3T8TA 2HOTA 4J01A 4B43A 2W48A 1B6AA 4BEHA 2ACJA 4EM1A 2VJ5A 2DYSH 2UUZA 2IXSA 1RNLA 1OCCH 1XSVA 2KZVA 3BRUA 2TRTA 3RD3A 3C7JA 2CWEA 1J09A 3CJNA 2DMNA 3VEPA 3OYJA 4J00A 2OV7A 3L1PA 4HNVA 4PDKA 4ZH4F 1VQ4I 2ZOYA 4IL6C 2BVMA 2EFWA 1MIJA 4DZPA 2YS9A 2X9DA 3GTOJ 2OERA 1D1BA 3I55I 4KJZA 4EV0A 2VONA 4BY1J 1WFXA 3RYPA 2JN6A 3EUPA 2X1CA 2LRDA 3HRUA 1I6XA 5E1WA 1OFCX 4E6KG 2EZIA 3GTLJ 2QSHX 2XGEA 1FSHA 2KMUA 4WIBA 3P7NA 4JL3A 3RPUD 2HWVA 2GQQA 1R5HA 2WADA 1QVUA 5FKOA 2PJRB 3FXOA 2ECBA 1X1CA 4O3MA 1U2WA 1IO2A 5CVJA 3GTMJ 2OTLI 3IH2A 3V7SA 1RETA 3DBRB 3R0JA 4FASD 3VVXA 2DTRA 3DTKA 2R5YB 2UXPA 3K4KA 1HDPA 4JP0A 3SDGA 2KDOA 4IQ4A 1FT9A 1K6YA 2KRHA 2XB5A 2P6SA 3MZHA 5D5XB 2HDDA 3JSOA 2ZOZA 2DBBA 3HKZN 5IYCJ 3CCYA 1K61A 3TO6A 4DNCA 2XV4S 2Q2EB 2GBYA 3JAMZ 1MBGA 5J40A 2P81A 5K7ZA 1H0MA 3HTSB 3DPJA 4OD5A 4F91B 2NS7A 4FE4A 3BG9A 3G3ZA 4ZYHA 3QKXA 3ZOBA 4OAYA 1SVLA 5EEHA 3WG7H 2J5PA 1WH7A 5LGUA 1R5GA 4B4CA 3KX2A 5C44J 4GFLA 4HEA2 4BEHB 4BE2A 2X51A 3BJ6A 2GFNA 1G3YA 1Y8QB 4JBAA 4BJ5C 3OYMA 4A3IJ 2P5VA 1XCBA 3HM5A 3HUGB 3VYRB 4B1RA 1DPRA 3K4MA 5FMPA 3O2PE 3DPUA 3V42A 2W57A 5CW8A 3QP5A 2O8XA 4I01A 1UG0A 2R7FA 3K69A 3WTWC 4IVNA 1T8IA 1U5TA 3CF5F 5FD6A 4IX7A 2ZBKA 2F4OB 1XDSA 2A61A 5DEQA 2DPDA 2CQ7A 4B09A 3CWRA 3LSJA 1N78A 2P7VB 1TC3C 2AO9A 5J1YA 1KGSA 1F1ZA 3OYGA 5J3LA 4R1HA 3GTQJ 2YU9J 1RI7A 5AQCA 1H9TA 3CCUI 5AIQA 5LFAA 3OYDA 2LH9A 1J9IA 3FDYA 3U1KA 3A0HC 2Y9YA 3HOSA 1VTNC 4NN1A 1SFXA 2X48A 1W5SA 1YJNI 4IOAF 2PMUA 4R79A 4IHXA 1OPCA 3GLXA 1TNSA 2RQPA 4M3DA 1J2XA 3SQNA 4C2TA 2XPUA 1NG6A 1POGA 5J47A 5HOOA 1D5YA 1VQNI 5HNHA 1E17A 1LE8A 3FM3A 1U5TC 2FMLA 5ICFA 1JI8A 2R4GA 5IP7J 4UUVA 4NUBA 2PJPA 5BPIA 3CP8A 2LYCA 1TNTA 4QTRA 5FKNA 2N8GA 1ZELA 4ESFA 5GPCA 2H8RA 2O6GE 5BNGA 2F5DA 2KHMA 1EF4A 4CCNA 2GXGA 3LSIA 5DD4A 3OOUA 3K8PC 4G7ZF 3FM5A 2KJBA 5CVUA 2XF6A 1MMGA 3PIOF 3TP0A 1KYZA 4KICA 4RB1A 1VQPI 4UV8A 1UHMA 2XIGA 5K7FA 1DQUA 1OMIA 2CFOA 2EZHA 5H6QA 3PPBA 4HSRA 2BVLA 4E4HA 2W00A 3VDXA 2K86A 1ZQ3P 1U9OA 2DW4A 1W5CC 1PJRA 3G2BA 1T2KA 2Z9OA 5M3FJ 3RKQA 4AC6A 3B73A 2UXUA 2GXAA 5K7HA 2W1OA 2E36A 1U5TB 4EGYA 3WHCA 4BQAA 4P1WA 1BOAA 1JGSA 3CMMA 4WCGA 4XKCA 3M3YJ 2W25A 1HOMA 2RHAA 1G3TA 3G56A 2DO7A 2DFFA 2V7FA 4YZEA 2G9WA 4Q4ZF 4QSHA 2ZKZA 5LHHA 1P4XA 1KQ8A 5AONA 2R7TA 3BG7A 2O61A 2IGKA 5DV5A 2W4SA 1MNEA 2QOPA 3CTAA 4S04A 1MBEA 2R7DA 3JR9A 4MLOA 4A5NA 3LSKA 3PL8A 2ZNYA 3WTVC 3ECHA 4MGRA 2R7WA 4PJMA 3X2QH 4NDLA 4GCVA 4G12A 4A3FJ 3TDUC 3FXKA 1Z3XA 4M9ZA 2R7VA 2LKPA 2WAQN 4CDGA 2ZSIB 3W6VA 1DPUA 3DPLC 4HAMA 4BXUA 3J81K 3ANPA 4HF2A 2VJJA 3K4BA 2BEOA 1Y1WJ 1R58A 3AG3H 3ON4A 3W2VA 4E7ZA 3T6NA 4AC0A 2WAEA 4CZCA 1R36A 1LQ1A 3ERED 2M45A 1W7PB 2XGCA 1GVJA 5L3DA 5TISC 2E7XA 5DAJA 1WVRA 2QKOA 1WH5A 2FQ4A 2JJ7A 1MJBA 2VKHA 3NWTA 1IF1A 1W0UA 2YVXA 3R61A 1OJLA 1Y6IA 2V1UA 2BE5F 2LD5A 2CQQA 4I09A 2DLLA 2AHQA 2NRAC 3HGGA 1I27A 5F27A 1LDDA 1BR4A 4RGRA 5BOXA 2P5LC 1JKQC 3OYCA 2LFBA 2VL8A 1Y1VJ 2CSOA 4WWCA 2HYTA 5HLIA 3U2RA 4GDFA 1T56A 3CRJA 2NAZA 2VQHA 3DEEA 3IAM2 4N4NB 4E70A 2XROA 4U7BA 1SD4A 5EZGA 4W1UA 1RUNA 2FF4A 3KP7A 2Q8KA 2V1NA 2HKUA 2KRFA 1QNTA 2HDCA 3E0JB 3G1LA 4PFOA 3RQ4A 2XAUA 1WHUA 2IU5A 4BHCA 1MBHA 4E7KA 2F07A 3DU5A 1YHQI 3HTAA 1TT0A 2K9NA 3C2HA 2DT6A 3HYIA 1OR7C 3HOZJ 3FKJA 3Q5FA 4NBQA 5A2QZ 2KLOA 2L7KA 3S15J 2M87A 3HZJA 3FBIB 2R7ZJ 4LB6B 4P55A 2W84A 2WB1N 3GTJJ 2JPCA 1UI6A 4JKZA 3GBGA 5LEKA 3LA2A 5K58A 2NVTJ 1OQYA 1E2XA 2VKDA 5LEJA 2E71A 1CF7A 5EDNA 2STTA 3V8LA 4OOIA 3Q0VA 4EATA 3CCRI 2A5YB 2H27A 3S17J 4NHJA 4HLXA 1MNDA 3JAMK 2IVMA 1FOWA 3WE2A 2DODA 1WJCA 2IT0A 2L01A 1ZR2A 1Z21A 2R93J 3HIMA 2L0KA 3A03A 2Y2ZA 3H3VK 2Z16A 3O3KA 2EK5A 2EINH 3SHFA 3DEUA 5DYMA 1VFCA 3I56I 1MMAA 2VKEA 2JSPA 3CCLI 2NP3A 2OI8A 4FETA 3FXRA 4XKWA 4IXAA 3KEQA 5FHPA 2DXIA 1B9NA 2HQRA 2VIXA 5GAEJ 2HQNA 3ZMVA 2UV1A 2EQRA 1X3WB 3GFJA 5IYBJ 4PJJA 1XGOA 1RR8C 2CUFA 3I4MJ 2IS2A 1YOVB 1ETOA 5EF6A 4RB0A 5JLWA 2IJLA 4HX4A 2Y75A 1QHGA 1TP4A 1LFUP 3L2CA 1YFHA 2HS5A 3KLOA 4CGZA 2W53A 1TTYA 1XC5A 1LVKA 1QO0D 5ERIA 4EVIA 3WTXC 1S8NA 3FMRA 1JUPA 3HC7A 2R92J 4I98B 1P7IA 1UG2A 1DUXC 4CGRA 2H6BA 1K6OA 1DP7P 4BHBA 3NI7A 3CUQC 3FMQA 1X1DA 2Q1ZB 3SEZA 1U9NA 2FQ3A 3GZIA 1RPWA 2OD5A 3CDHA 1IDZA 2EA2A 4XICA 2K85A 1IXCA 4I0BA 2M34A 2OZ6A 3W6JB 2YVEA 4FQGA 2PBIA 1S9HA 5KVRA 3CESA 2ZSHB 3C07A 1QGPA 1W7PD 1Z05A 2PG4A 3SYTA 1LB2A 1D0XA 5JFRA 1ITYA 1I1SA 3CMYA 4ON0A 1CF7B 2OAZA 1IZ1A 2VBWA 2YUSA 4PFPA 2FBKA 1T33A 1J5YA 3FIWA 2ZNZA 2M4GA 1SGMA 4OU0A 4PJLA 2G3BA 1GLNA 2K5CA 2QKMB 3F21A 4YIIA 4X6AJ 2CQXA 2K9SA 5D8KB 3G71I 4IJAA 2AQEA 4E7LA 4KMFA 1FIAA 2QVOA 4UB6C 2FMYA 2IGOA 1MMSA 4YEJA 3K4NA 1HXDA 3PUBA 1U8RA 1RRJA 5E1ZB 2IRFG 3QPSA 1MDMA 2VASA 4JQFA 3O60A 1QZZA 1A5JA 2OQRA 3IV5A 4PZJA 2Z99A 4IHVA 3CJTB 3V6GA 1MH3A 3BOQA 1SC7A 2L2OA 1DDNA 1NHAA 4UB8C 3K0LA 3MVPA 3CUQB 5FJ8J 1WJEA 3H0GJ 4AYBN 2M4KA 2H1KA 3GF2A 3GZ6A 1ZRCA 4GFBA 2X85A 4GXOA 2JVGA 2KL4A 3EQLF 2ELHA 2GAUA 2RNJA 3ZMZA 3IC7A 2PI0A 5CQGA 2QCOA 3ERMA 1MBFA 3Q9VA 2BXZA 3MQ0A 3DXJF 3KKDA 3KIOA 5ICGA 4KN7X 4IRGA 2D45A 4L9NA 5E17F 4PJNA 5D18A 4CCJA 2HU9A 5EFYA 4XN3A 5J1UA 5DD8A 2O7TA 3ABLH 1ON2A 4HG2A 3BZ6A 3ONQA 4Q5SF 1W1WE 1WKMA 1K83J 2MABA 5L3BA 1X58A 3P9CA 3VOEA 2RQQA 3LSMA 1YTYA 1KYWA 1XS9A 2M7AA 3OYLA 3PSIA 3H5RA 3WODF 2F2EA 1JXSA 2KQRA 2VE8A 2XAHA 3PO3J 4ZDLA 4XMYA 1VQ9I 4EJTA 1GHCA 3F0CA 3QU6A 3RKXA 1IW7F 4C2MA 3JRHA 2AQFA 2VODA 2JUCA 2LSOA 2QLZA 2B3WA 5F64A 4UHTA 2JA5J 1FTTA 2QBYA 1STZA 2HZTA 2P5KA 2V57A 2HQAA 3OYFA 3QOEA 3QRFF 4YIRX 1BI1A 3HOUJ 3P9IA 2VBXA 1K7AA 3QP6A 3MZYA 2BHYA 4PSXA 4DYQA 1OCRH 4U0VA 2FD5A 2L02A 3RI4A 3CP2A 4L62A 2V9PA 3KETA 1MDMB 3DLLF 5FD5A 5JI6A 2K02A 2LF8A 1UZCA 1FMWA 3F6VA 4JX6A 4HX7A 3WGHA 4G6QA 5EYRA 2R7OA 2Y0SN 2ZXHA 2X6OA 3KKCA 2X6WA 2VI6A 3TP3A 4BH9A 1H89C 2ISZA 4KIGA 1XGSA 3BR5A 4Z2YA 4RGXA 1SFEA 2WAFA 4KNYA 1WRJA 2V1DA 1MBJA 1N75A 1WJDA 2BYVE 4XLAA 1D1AA 3ZMTA 3M8FA 1LEBA 4OIPF 1O7FA 2ZXWH 2IA1A 2ELKA 1R9TJ 1V55H 3FK6A 1TL8A 1USSA 1IN7A 4HQMA 1LNWA 3IKVA 1FEXA 4EEFG 1WJ5A 2E1NA 5DM6F 1LUJB 2JK3A 4M74A 1H88C 3LMMA 2LMDA 1FX7A 2L7ZA 1ON1A 3OYNA 2XHKA 3GO5A 4CYDA 3QYEA 2K27A 4IRVA 3KYDB 4ITVA 2E5NA 4OMYA 1IRFA 1IXSB 4ZZLA 1I1GA 3ZQ7A 1R7JA 3KLNA 1EH7A 3TQNA 5JVTA 2WY7Q 3WTSC 3H9JA 3OWTA 5A2QK 2UXXA 3WTUC 3E6BA 4W97A 1BJZA 3JRGA 3F22A 4FTHA 3NS4A 4RB3C 3WGIA 4XLCA 3LWJA 2QYOA 1BJAA 2EIKH 4AVPA 4GYIA 2LK2A 3S8PA 3BG3A 2XPWA 3TOAA 3KZZA 5IP9J 3U21A 1D0YA 1WZ2A 4RLFA 2QTQA 2QBYB 4Y13A 2JZYA 3AG1H 2M8GX 2IBDA 2ZJ2A 3HSEA 1B8IA 2HKXA 2IGNA 1CQTA 3E6CC 1A35A 2YX7A 2VQCA 2JQ7A 3K7AJ 1TWGJ 1QPMA 2ELJA 1A6IA 4JYKA 4F3QA 2COBA 3O6BB 3GW2A 5H20A 2A05A 4A6EA 5M3MJ 4E7SA 3BR0A 2CUZA 2M8EA 4IHWA 2IW5A 3KE2A 4A12A 2NVUB 1O4XA 4L0ZB 1WJBA 3PQKA 2DFHA 3F6OA 4RB2C 4F7ZA 2DA7A 2AS5F 5FO5A 3HRTA 4G9YA 4KT5C 3COAC 4KIBA 2GM4A 1YW8A 4XLFA 4I76A 1X2MA 4II2A 1PP7U 4S05A 3K4CA 2Z1DA 1DU6A 4XORA 3J7YJ 1JT6A 4FT8A 1XTAA 3E5QA 3HOTA 2LVSA 2EH3A 4F52A 3CCEI 4M9SA 1AWCA 3VTIA 2V6CA 4AF5A 3SXYA 3AAFA 3I71A 1A31A 5J8FA 3ZR8X 2DK8A 3ZXSA 4A0YA 2GOMA 4FCYA 1ZG3A 1RIOH 3MKLA 3FWEA 3M4OJ 4DOZA 4DJAA 4L0YB 1SFOJ 4CZZA 5D5UB 5EG0A 1D5VA 3RZOJ 3HGYA 3BQZA 1VQMI 2EFNA 4LB5A 2QSGX 1KONA 1FMVA 3PQJA 3KYCB 1OCOH 1WJFA 4PGHA 3MEXA 4C2MJ 3HOXJ 4LIVA 3QAHA 1AA7A 3S93A 4B3XA 3JTGA 2G7LA 3HSFA 2HOAA 4RBOA 1NK3P 5HODA 4CYCA 1QZYA 2FUG2 2RGVA 1W36D 4M6XA 4FISA 3K1MA 2REKA 4LG0A 1B8IB 1B72B 3IUOA 4XK4A 3M07A 3N05A 5C3EJ 2ECCA 2IA0A 4GGGA 1ZGJA 3I3LA 5EGOB 2EFOA 2VOPA 1JGGA 2BW3A 1Y0UA 2H09A 2WBMA 2A5WA 1NK2P 2WGBA 2EV5A 2QKLB 1GUUA 4KUMA 5K5RA 2WAQA 2Y30A 3K1NA 2PZ9A 4JOMA 4U9LA 3G73A 3RTRA 3OV8A 2RVCA 3KP6A 2DA1A 2A6TA 5KAIC 3RPQA 3VYSB 2KIMA 4G6DA 4PJ0C 4BDZA 4ENNA 1X19A 2HEOA 5BS6A 5LRRA 3JREA 4HV6A 1BOBA 2EWNA 2FJ1A 1APLC 4QPOA 2A68F 2XAFA 2YX4A 3BG6A 2HVSA 1VZ0A 2MG4A 3BJAA 5J6XA 3PNVA 2DAOA 2E35A 2K3FA 3E3VA 3S1NJ 2QM3A 4MHGA 4O6JA 2F4IA 2ETHA 3C2GA 4LLLA 4RS8A 1EV7A 2E19A 1VQ5I 4BE1A 3TOBA 4KN4X 1RKWA 2R7XA 4RMNA 1I3AA 3MKZA 1IC8A 1SD7A 2F5EA 5B3SH 2RC4A 3NRVA 2HGCA 2FOKA 1N25A 2KISA 2V79A 3EUHA 2EB7A 3PUFA 4LD5A 3RYRA 2DOFA 4GFKA 2EFQA 4KIFA 2CU7A 3BR2A 2EIMH 1JT0A 4L9VA 1K78A 5FLVA 3TO7A 2I10A 3L9FA 3ZQGA 4BE0A 2BV6A 2HDWA 1FBSA 5IOYA 4ZYDA 2JWTA 3NNRA 1UMQA 5HDKA 3HRMA 2CRGA 3OY9A 3OYHA 1WGXA 4KMUX 2XRLA 3E97A 4F92B 3OIPA 4EM0B 1Z6TA 1MJ9A 5F1RA 2MD0A 5GADJ 3JTHA 1U6GA 9ANTA 2GUHA 3K4LA 3ROUA 3CLQA 2HOEA 3C1DA 2WA0A 4XLHA 4CYCB 1J0RA 2Z33A 1OYYA 1OKRA 1XD7A 2A3SA 3V7RA 2L7MP 5CQEA 3E6MA 4LG0B 4BXFA 4YG2F 3TGNA 4BQOA 3HTHA 2WB1A 3L2VA 4ZZDA 3EUHC 3CJRB 1EH6A 3V8JA 3H9QA 3ANGA 2BW3B 5HBUA 4CXFA 2ZMEA 1OCTC 3A01A 2DOAA 1TWCJ 2GA1A 4C3IJ 1IRGA 2AXLA 3G7RA 1OISA 4ZJZA 5HVQC 3IUVA 1XGMA 5CXIA 3ZPLA 4YIFA 5GTHC 2DMTA 1B4AA 4OAZA 3DPTA 1YQAA 3GEUA 1R71A 3P9KA 3T5XA 1X2NA 2HQ5A 2CV0A 3FXUA 4M3FA 4B3AA 4CUGA 1ODDA 1PYVA 3DTIA 3JRAA 2A07F 1UHSA 5ILUA 4ESBA 4I02A 3VYUB 3HB9A 3V78A 4Q47A 5E3LA 4UNOA 2E2JJ 2BHZA 4HX8A 5ICCA 3BR6A 1LPQA 3WTYC 1IV8A 3CJQB 3E7QA 2DMPA 2ZFWA 4BQNA 2TDXA 4A93J 3COLA 1BN5A 2B7EA 4ZYGA 2W7NA 2L9NA 5IYDJ 2YPRA 4B47A 1UCRA 2FBQA 1RUOA 2A2FX 4N0BA 5LHIA 1QVTA 1F4KA 2NS0A 2R3SA 2MFZA 3BWGA 3RKWA 4G7HF 2IEKA 3ABTA 3AQTA 4OMZA 2BOLA 3I54A 5DCMA 4BU2A 3LQRA 5AIPA 4DIQA 1K78B 3CCJI 2DG7A 3FHNA 2LREA 5FGMA 1GT0C 2XPVA 1X4OA 1V4RA 4ETSA 2DI3A 4MEYF 4A3CJ 4QWQA 1IN8A 1LE8B 2DFIA 2EJRA 2UXOA 3JSPA 3UNGC 2LOOA 4ME9A 4XIDA 2JVHA 1Z6RA 1KZHA 2NNYA 2LY1A 3SZTA 3W2WA 4CCLA 3GUDA 2MD5A 3FRQA 3PM1A 2DQLA 5E18F 4XRMA 3QYFA 2VE9A 5DS9A 1OYIA 3JCUC 1YIOA 2E60A 4I7HA 2O0YA 2A69F 4KITB 2PFVA 4ZDPA 3VODA 1LKXA 2CQKA 3LAPA 3T8RA 5FLXZ 2M30A 4L5IA 1KU2A 2M5WA 2OU2A 2X4HA 2ME0A 2G0EA 4BACA 3I64A 1FSEA 2DA2A 4EMSA 1V5GA 5FB2A 2YSRA 2ZCNA 4BY7J 2GLOA 2M1BA 3CMEI 2LLKA 2E5ZA 3OS1A 1ZKGA 4E7HA 2E7WA 3REOA 4CH7A 1R4MB 3HOWJ 1U8BA 1BIAA 3HHGA 4MIMA 1JJ6C 3FK7A 3LFUA 1FYMA 4AYBA 2PMZN 4A0XA 4Y15A 3KP3A 4BJ6C 2DMUA 3SFZA 3BJBA 2BY3A 3M1EA 4LJZF 5D6EA 2P4WA 5CVVA 1HSTA 3BY6A 4EJOA 1Z0XA 4ANJA 3R4KA 2IP2A 2G7SA 2CH0A 3CDLA 1Z77A 2NVYJ 1WPKA 4AD9A 4V2FA 3CCQI 3F23A 1IRXA 1M1EB 2DQRA 2H6CA 1FBQA 3EYIA 1USTA 3VW1A 2HYJA 5LRSA 3ZN1A 2QF7A 5DM7F 4A3BJ 2CG4A 3VB2A 3IHUA 1ETVA 3GMEA 4LG3A 2FNAA 3ZMSA 3MKWB 3F8MA 1ZH5A 3AFHA 3ESWB 3CMAI 3S3OA 3FISA 5CJ9A 1SMYF 2O7OA 3MAJA 4Y7NJ 5K5QA 4UVCA 4EJWA 1R1VA 4CA0A 3KCCA 4B8XA 5E8GA 2DA3A 3RSNA 3BCGA 2LKXA 3BCBA 1TQMA 5E3NA 1U0JA 3BR1A 3S2HJ 2AXTC 1Y0NA 3E7LA 2OJED 1Y39A 4F55A 2EPFA 4WXDA 1PUEE 4G94A 2VPLA 3RJPA 3SWHA 2I5UA 1VQ6I 2KIFA 1NG7A 2ESNA 1FY7A 1KQ0A 3QOPA 3S1QJ 4OD4A 4KA4A 3VIBA 1HW5A 1I39A 4M73A 2PEXA 2PMHA 4N9IA 2XDVA 1VQLI 1YW9A 2FU4A 2EA4A 1PUFA 2KRCA 3S3MA 2XKOA 2R5ZA 3RZDJ 3A2KA 1X1AA 5LBQA 1OLTA 1JTXA 2L3DA 2MBFA 1HLVA 1Y8RB 2BY0A 2F6CA 2Y0SA 2F4MB 2XAGA 4XNFA 1O3RA 5JVGF 3CCVI 2DJIA 4XLNF 1RC9A 4ENKA 3OSFA 3KFWX 3MKYB 2XAQA 2O9LA 2RASA 3F8CA 2FOWA 2R7SA 2HVQA 1FLIA 2O5RA 2ZJPF 1VQ7I 4BNCA 3LA7A 2GIZA 3CDIA 1HDDC 4R8HA 3HL2A 5KAFC 1ZG1A 1QU3A 4EJVA 1WWXA 3ON2A 1SMTA 1BC8C 4YFKF 1R22A 4RDUA 5CYVA 1MSFC 2WC2A 4D5FA 1CGPA 4GCTA 1D3YA 3FMSA 2F48A 3E5UA 3IRRA 1PDNC 2HPMA 2FJI1 2C6YA 4DVYP 5H6RA 1FYLA 3H9GA 3V7CA 2UWMA 1HQCA 1KA8A 2QQ9A 4MTEA 2CW7A 2F5FA 3LJLA 1B59A 4ABZA 3SZPA 2COMA 3RH2A 1FP2A 1HKQA 4AU7A 2OCCH 5HDNA 3WU1B 2B1EA 4QIWN 4M3EA 4EJUA 1P4WA 5F1JA 1L3LA 2GXBA 2K9QA 2QWWA 2ZCMA 2PBXA 3RPUA 1TW3A 2HTSA 3TW6A 3DCFA 4IHTA 4UUSA 4U0YA 4HRIA 1YIJI 3J7AY 1G59A 5GP9A 1XMXA 2KIQA 1HW2A 3UR3C 3JRDA 1IJWC 2XRNA 3FXJA 3CZ6A 3MN2A 2X1DA 1JHFA 4XN0A 4XBFA 2V26A 4D7NA 3EPZA 3VWBA 1TW2A 3ZMDA 1T0FA 4L18B 2G7UA 4Y3OA 4B48A 3JRIA 2JA6J 4V2GA 1B9MA 3FX3A 1F9NA 3MWMA 1O57A 3U9GA 2Y48A 4IPAA 5BQTA 4Y52J 2V9VA 1PP8F 1R1UA 5JLXA 1ZRDA 5E3OA 3QWLA 3W2AA 2KPMA 4OIRF 2DYRH 4M6YA 5CVIA 4QPQA 3S1MJ 1IXRC 2PQ8A 2IPQX 1ETYA 4P9UA 2QUFA 4UXNA 2VB6A 2M9HA 5HAWA 3OOPA 3DQVC 1T95A 3OS2A 3KEYA 2DG8A 3D5RC 1RESA 4HPQA 4A3LJ 1I5ZA 1HF0A 2X0LA 3H3UA 3LFKA 1W0TA 4MQVA 1FPQA 1Z91A 1P4AA 3G1OA 3S2WA 3OS0A 3BHQA 3PO2J 5FGLA 4C30A 2FE3A 2OA4A 4EM2A 1SVMA 4P5OA 2MW8A 5FKLA 1UHWA 4OINF 1GDTA 1V5FA 1AU7A 4BL0B 3GTGJ 4JK1X 3AQSA 1VI0A 1YJ9I 3LQQA 4ASNA 3FKIJ 5CXGA 2Z5UA 4DYRA 2O3FA 2W24A 4M6VA 4XQFA 5GPAA 2FRHA 3GTKJ 3A0BC 3ABKH 5D5WB 1YRNA 1P2FA 2ZFUA 3ZRGA 2LKSA 5LGTA 3DV8A 1R1TA 2HPIA 3QU3A 2VBYA 4K2EA 3D5LA 4IQJA 5IT3A 1ETQA 2JUGA 2DCEA 3NEUA 3JSJA 1ZLKA 4I2OA 4C9YA 2KZGA 4AIKA 5L3EA 2XDNA 2VN2A 2VXDA 3CJDA 4JX4A 2VOOA 2K4BA 4HQEA 3HKZA 5LHGA 2DMQA 4HV5A 3DEWA 1YX3A 1SVOA 3OYIA 2EZLA 2ISYA 1WSUA 5FLXK 3TW7A 2ZCXA 1S72I 2RDPA 4KYWA 1KU9A 3GYHX 5LD2C 1UJ8A 4Y33A 2CV1A 2XASA 4LITA 2KP6A 2QQAA 1JKOC 1PVEA 3DBLB 4CCMA 1G6NA 4XRSG 3ZQLA 2X6YA 2EFPA 3DFGA 2VLAA 2DA4A 2EV6A 2P6TA 1NTCA 4CSWA 3L2RA 1T38A 3TL4X 3FF5A 2CJJA 4Y4RA 4PUSA 1ZR4A 3GFMA 1TWFJ 3FXQA 4MFEA 1FOYA 5EEAA 3MFKA 2LBFA 1JKRC 4IHSA 5GAHJ 3ML6A 1Z1DA 2DN0A 3Q3SA 2NS8A 2CFXA 4M3BA 3T0YA 3B6AA 3E1SA 1A6QA 2XGXA 1P92A 4M72A 5E20A 2FXAA 2KJCA 3N97A 1T08B 5D6FA 2XF5A 4UUTA 3TO9A 2JA7J 3KP4A 3VYTB 2MLKA 1L0OC 4I0AA 3IWFA 2IS1A 1UB9A 1K4SA 3PFIA 3WTZA 3BTCA 5HSZA 4DGWB 1H8AC 4GCKA 3BTIA 1TWHJ 1E3OC 2UZKA 3NWSA 2R5YA 2XSDC 1HW1A 3OL3A 4X0GA 4U7DA 4ZDOA 1MW7A 2ID6A 2QSFX 4U88A 3F72A 4AIJA 1FOXA 2QGUA 3DTEA 4C3JJ 1S7EA 2MC4A 3HRSA 3VSLA 3I59A 3HSRA 1Z9CA 1J75A 2M3AA 3LAJA 1BBYA 2F5VA 2Q2EA 3ABMH 1LFBA 2ZXIA 5M5XJ 4FHTA 3LSRA 3NARA 4XOTA 5F0CA 4ZYEA 1ULYA 3BROA 3E5XA 3S1RJ 2BXYA 4RAYA 2OPTA 1UELB 1Z7LA 4WXHA 3I0TA 4YFNF 2JRMA 4IEJA 1S5LC 3VOKA 2LG4A 1HKTA 2Q24A 3NRGA 1P7JA 4DBQA 3HE0A 2FEZA 1BW6A 2ZJQF 3S32A 1MH4A 2QQ8A 2F5CA 2VC0A 1U3EM 5KHDA 2ZB9A 2L9RA 3ZQCA 3ABUA 4GYGA 2KKOA 2M7BA 1BR1A 4E7IA 3HHHA 1YITI 1D1CA 2DTZA 2NNNA 3HUGA 3S2DJ 3C3WA 3J7AO 3TDZC 3HOYJ 1A36A 3CO7C 5JR3A 1K4TA 1ZN2A 1OCPA 2XVCA 1IUFA 1G8XA 3BNIA 3OYKA 5FROA 3IKTA 1U78A 2YVHA 1YO5C 1EA3A 4P9FA 3IH4A 1VNDA 2G7GA 2LBFB 4E7JA 4YRVA 5DDGA 1XSXA 4B44A 2H8WA 5GAGJ 3KYLA 5H9TA 4EQQA 3MD2A 1QA6A 4KT6A 3L2QA 1UAAA 1SAXA 1LDJA 3M1CA 1JE8A 3I53A 2P7CB 2WY8Q 2GWRA 3VW0A 4M9XA 2BY2A 1P6RA 4BXXJ 3F8NA 4D5CA 5C4JJ 2MYSA 4XOPA 1YI2I 2HZDA 4OWRB 2XGDA 1EKEA 4XL9A 2DA5A 3OL4A 4BBSJ 4D1QA 3N4MA 1N77A 2NXNB 3QPLA 2LY9A 1SFUA 2K7LA 5GTIC 1REPC 1FIPA 4I99C 5CVRA 3DF8A 3W3CA 2XSJC 3SZGA 2K9MA 5D4RA 3Q9SA 3EUAA 5L3FA 2DA6A 1Q1HA 4XLPF 2PN6A 1E0EA 2MSYA 1MBKA 1E3HA 2JRTA 2LC2A 2HFHA 3BTJA 3BR3A 3DU6A 3ZQIA 3I59B 2VUMJ 1ZGAA 1UFMA 1RZ4A 3F8BA 2ADUA 1DP3A 5CKTA 4PGGA 1BIBA 2WUIA 3ASOH 3GEZA 3GFIA 1ZAOA 1RKTA 3MZ8A 5F6FA 3HG9A 4PSWA 3U1DA 4DBRA 3HBLA 4HBLA 3W6KB 2RKHA 3C18A 4MQ9F 2VXZA 1ZGWA 1IAWA 2IGMA 3GFLA 1FC3A 3D1NI 1YJWI 1AOYA 2WV0A 2IA2A 2JPBA 4RM2A 2CS3A 3G6EI 3SFIA 1F5TA 3H92A 1BI2A 1R23A 1XCVA 2VQLA 2NX4A 1J59A 3LL7A 3GZ5A 4S0HB 4X1EA 3S16J 4NC6A 4H0EA 4ACIA 1R6RA 4NNJA 4HLYA 3ULQB 2B63J 2E1CA 2PFBA 5D8LB 4MTDA 1ZREA 1XPXA 2CV2A 4L5EA 3CQZJ 4HW0A 4RAZA 4Y17A 1ONVA 1T6SA 2MGQA 4MXMA 2CQNA 5J4YA 2JA8J 1SD5A 2ESHA 3ELKA 3K9TA 3BP8A 3HIFA 4IRHA 4BGDA 3BZCA 1TWAJ 4AIDA 5EG0B 5F08A 3BLYA 3FZVA 4KWAA 4NC7A 1TBXA 1V54H 2VJIA 4UV9A 2LP0A 4A69C 2V6EA 2PMZA 4KISA 2QWTA 1WJAA 1S7AA 2GOXB 3L09A 3OMYA 2XAJA 4A3KJ 3LSHA 4BJTA 1I50J 1DGRM 3KP5A 3M9AA 4LK1F 2CUEA 3RCOA 2DPUA 3VW2A 1IN6A 1ZARA 1XGNA 1QRYA 2K9LA 5F0HA 5FRMA 3BPVA 3QPHA 5FKKA 5FLMJ 2E2HJ 4A5MA 2XUBA 1G2HA 3BT9A 4OIOF 2OTJI 2DFEA 3LNQA 1D8KA 3HPHA 2LF7A 3TMOA 2ICWG 4FX4A 2DDAA 5DUKA 3E6DA 4LLNA 1EH8A 1JHHA 4HYEA 3K10A 4HSTA 4HZFA 1Q1VA 3D0SA 4GRIA 1ENHA 4ENMA 1XG1A 2D1HA 1GV2A 4KFCA 5M5YJ 3IP4B 3ZN0A 1XSDA 5L3CA 4NC8A 4BDYA 3R0AA 2ZC2A 2QA4I 1IN4A 4ZYAA 2E2IJ 1W7PA 2BY1A 1LDKB 3LHQA 3O8HA 3WG9A 3DKWA 2D5VA 1IRZA 2ID3A 4D7MA 3NPIA 1FOKA 4O5VA 3Q0UA 3S3NA 3G1MA 3J80Z 3H5AA 5HLHA 1IDYA 3JW4A 4IKFA 2L5QA 3VPRA 2YU3A 2Y0MA 3KZIC 3R6SA 3M7GA 2ZMEC 1MKMA 1TQIA 2CUJA 2HR3A 2X6XA 4M3GA 5C4XJ 1HKSA 3OSGA 3B6CA 2DJNA 4FX0A 3K4JA 5E3MA 4LIUA 4BYYA 3PFYA 1FZPB 1G3WA 4IRIA 4U87A 1QZEA 4JX5A 4LOCA 2B0LA 4HNUA 3P9TA 1FTZA 4NQWA 3VSKA 1RR7A 4J19A 2VPRA 3K6GA 3ZQHA 3BG5A 2GIVA 2HXOA 2K3PA 3EGQA 4N4OB 4DZJA 4ZC3A 1P9QC 3CF2A 3BQYA 3WE3A 3LSTA 5TRDA 2VKVA 5D1RA 2FBHA 4BUPA 1IGNA 1IUYA 3CUOA 2IS4A 1ORKA 3GTPJ 4A2UA 2O03A 3NAUA 2RNGA 3K1PA 2ZO4A 2EILH 4RAFA 4FE7A 5LLQA 5ED4A 2Q0OA 2R7RA 2L4MA 2IAIA 2OQGA 4P96A 1SANA 3EETA 2O8KA 3B81A 3P5JA 5L3GA 2KIUA 3L00A 3BJOA 4XSXF 2A6EF 2JA2A 1S7OA 3H0DA 3CC2I 2FSWA 3SJMA 4F93B 5K1YA 2V1XA 3FBNB 2VC1A 2ZMEB 5F04A 1JUMA 3A01B 1F43A 4DW6A 2PX9A 1T98A 4II3A 3WGGA 5HS8A 2QZ8A 1MMDA 2ZXJA 2L9VA 3Q0WA 2HYFA 1HCRA 3PJRA 2R7QA 4BAYA 2HKOA 3OIOA 1HC8A 1HA8A 2GZWA 1SEUA 2P0WA 2WV1A 3HEFA 2NVQJ 3K70C 2QIBA 2CMPA 2ZY9A 3VVYA 4DYCA 2EIJH 1J7KA 1X3ZB 2FX0A 1Y56A 3MMYB 5B5EC 3WTTC 1XMAA 1I6HJ 3MNLA 2WTEA 1ZYRF 1OR7A 1YE9A 5JHUA 5IT9Z 1W5TA 2OCEA 2QQBA 2BZTA 1FBUA 3BTLA 3TEDA 5BPDA 1XMKA 3CC4I 5JHFA 1V5EA 2TCTA 2K4JA 3SDBA 6PAXA 3F8FA 3KPHA 1ERDA 2EV0A 3VOXA 4NQWB 4ZTJA 5DCMB 4MEXF 1XB4A 3H35A 3IL2A 4GCLA 3CO6C 1TQPA 5KNLA 3VVZA 2G7HA 3DKYA 3GWZA 3OYAA 2DDBA 4UVBA 2X1EA 1MJAA 1FP1D 2ZCWA 2FA5A 3R60A 4N9HA 4XRFA 4A3DJ 2Y69H 3OYEA 4A6DA 4DQ2A 5FFZA 5KK1A 3QBMA 3G4SI 4NELA 4XLEA 2CW8A 3KZYA 2EZKA 2M0MA 2Z2SB 3HTUA 1O7LA 3QODA 4HOBA 4LLGF 5DCFA 2H94A 2J5OA 1BL0A 1E3PA 5CLSA 4D9JA 3ASNH 3HJEA 5FRNA 4RGUA 3AL0C 1UI5A 2KT0A 4L9JA 5D4SA 2FNPA 2XF7A 2DU9A 3LSPA 2OC6A 3HTIA 2L7FP 4UY8I 4BS9A 3QYBA 1YG2A 2NOJB 2M2EA 3LA3A 3WHBA 5E1XA 3ZP5A 1B1BA 1AKHA 5TGTA 2XC7A 4AWXB 4KDPA 3ZCOA 4CICA 5HLTA 3VFZA 2MC3A 4MNUA 3BC8A 3WU0A 4EGZA 3TBIA 1YW7A 2CW0F 1BC7C 5HNFA 4L9TA 4LK0F 1K79A 3LWFA 1O3SA 2VQGA 2LNBA
chains in the Genus database with same CATH topology
2NVXJ 3JSJA 3M3YJ 1HOMA 2XDNA 4C2MJ 3CJDA 4JX4A 3HOXJ 3I4NJ 4A3MJ 2RHAA 3G56A 4YZEA 4A3JJ 2DMQA 2G7LA 4RBOA 2HOAA 3KZ9A 1NK3P 4QSHA 3S14J 3DEWA 5HODA 4CYCA 3HOVJ 5C4YA 2EZLA 4FISA 2REKA 3TW7A 1B8IB 1B72B 2QOPA 3ZQFA 1MBEA 4XK4A 3JR9A 2ZCXA 5C3EJ 2ECCA 2OF7A 4MLOA 5EGOB 1MNMC 3JRBA 1JGGA 4NDLA 1JKOC 1NK2P 4G12A 4A3FJ 2WGBA 1GUUA 2ME6A 4XRSG 1JTYA 3ZQLA 2Y30A 2PZ9A 2WAQN 3W6VA 2DA4A 4A3GJ 3ANPA 2DA1A 1NTCA 2GENA 2M0CA 2CJJA 3JREA 1Y1WJ 1ZR4A 2FJ1A 1TWFJ 1APLC 2HXIA 4MFDA 3ON4A 4MFEA 3T6NA 4AC0A 5EEAA 1JKRC 3F1BA 2MG4A 2JMWA 2DN0A 3S1NJ 2XGCA 3Q3SA 2NS8A 1GV5A 4M3BA 3JRCA 5DAJA 2QKOA 5IOZA 3B6AA 1WH5A 2FQ4A 2E19A 2JJ7A 2Y9ZA 4AUXA 5J1RA 1W0UA 1OJLA 2LD5A 2CQQA 4UUTA 2JA7J 1RKWA 2AHQA 1ETXA 3HGGA 1IC8A 5F27A 1ETKA 2D6YA 3VUQA 3QQAA 1JKQC 1AKHB 2LFBA 1Y1VJ 3BTCA 5HSZA 1H8AC 4GFKA 4GCKA 3BTIA 2HYTA 1TWHJ 2CU7A 3BR2A 1E3OC 1JT0A 4MK6A 1T56A 2R5YA 2XSDC 5FLVA 3CRJA 3ZQGA 2I10A 5EZGA 2ID6A 4W1UA 5IOYA 1PUFB 5D19A 2HKUA 2JWTA 2R5ZB 3NNRA 1UMQA 1ZTRA 3G1LA 2CRGA 1JKPC 1WGXA 1S7EA 2XRLA 4C3JJ 2IU5A 1BA5A 3NXCA 1MBHA 4IHYA 1LFBA 5M5XJ 9ANTA 2GUHA 3LSRA 2F07A 1JJ8C 3HTAA 3NARA 5F0CA 4HKUA 2K9NA 3UKGA 3S1RJ 4CYCB 1GVDA 2OPTA 4MO7A 3HOZJ 1IV6A 4IEJA 2L7MP 3VOKA 2Q24A 3NRGA 1P7JA 5M5WJ 3HTHA 1WI3A 3S15J 3HE0A 1BW6A 2R7ZJ 1MH4A 1BW5A 3GTJJ 2WB1N 3ANGA 2ZB9A 5HBUA 2L9RA 1UI6A 3ZQCA 3GBGA 1OCTC 4JKZA 5FKMA 3A01A 5K58A 1TWCJ 4C3IJ 2NVTJ 3G7RA 3IH3A 2DTZA 5EDNA 3IUVA 5CXIA 3S2DJ 2DMTA 3Q0VA 3HOYJ 3GEUA 3S17J 4C3HJ 1OCPA 1X2NA 1IUFA 2HQ5A 3BNIA 2YVHA 1U78A 4M3FA 1ZR2A 2R93J 3HIMA 2L0KA 3IH4A 4B3AA 3A03A 2R0QC 3C2BA 1VNDA 3JRAA 2Y2ZA 2G7GA 1UHSA 3H3VK 5F0FA 5H9TA 3HB9A 3V78A 1VFCA 5E3LA 1FJLA 2VKEA 2E2JJ 2NP3A 2OI8A 3BR6A 3RQIA 4UDSA 2LTPA 3VW0A 4UUSB 2DMPA 4BXXJ 3HDDA 3E7QA 4D5CA 5FHPA 4BBRJ 5C4JJ 4A93J 3COLA 5IYDJ 2FBQA 2XGDA 2DA5A 2HI3A 3LSGA 1QVTA 2EQRA 4BBSJ 2IEKA 3AQTA 5IYBJ 3QPLA 2LY9A 2CUFA 1DU0A 3I4MJ 4XRSA 1ETOA 5EF6A 1FIPA 5JLWA 1LFUP 2DG7A 2DA6A 2NOGA 1QPIA 1GT0C 5EZHA 1XC5A 2MSYA 1MBKA 2XPVA 4I6ZA 2NP5A 2W53A 4JNNA 3BTJA 4A3CJ 2Y31A 3BR3A 3ZQIA 5IP6A 2EBIA 1JUPA 1LE8B 2VUMJ 2UXOA 1IG7A 2R92J 4ME9A 4XIDA 2WUIA 1P7IA 1UG2A 3PASA 4CGRA 1RKTA 1ETWA 3NI7A 3HBLA 3FRQA 1ZGWA 3HTJA 1U9NA 1I3QJ 2LR8A 3PM1A 3GZIA 1RPWA 3D1NI 4XRMA 1IDZA 5DS9A 4XICA 2M34A 3SFIA 2YVEA 4PXIA 3C07A 2NX4A 4S0HB 3S16J 4X1EA 1ITYA 4ACIA 3CMYA 4A3EJ 2B63J 2YUSA 1VF9A 1T33A 3FIWA 1SGMA 4L5EA 1AHDP 2G3BA 3CQZJ 3S5RA 3KNWA 3VP5A 2MGQA 1YRNB 2ME0A 1F36A 2CQXA 2G0EA 2K9SA 4X6AJ 4MXMA 2JA8J 1FIAA 2DA2A 3O8GA 2ZCNA 4BY7J 2GLOA 4ICHA 1ZK8A 2LLKA 1JUSA 3QPSA 1TWAJ 1ZKGA 5EG0B 5F08A 3O60A 4KWAA 1A5JA 3HOWJ 5DTDA 1U8BA 1MSEC 3A02A 3IV5A 3JRFA 4IHVA 2LP0A 4A69C 2XB0X 3K2AA 1MH3A 4MIMA 1JJ6C 2QWTA 3V6GA 3FK7A 3MVPA 2PMZN 5FJ8J 4A3KJ 3H0GJ 4AYBN 1I50J 2H1KA 2DMUA 3BJBA 2RAEA 4GFBA 2K40A 1B72A 4BKXA 2CUEA 3VW2A 5EGOA 2UXIA 1QRYA 5F0HA 1Z0XA 2HOSA 2QCOA 5FKKA 5FLMJ 2E2HJ 1MBFA 5IPAA 2G7SA 2UXHA 3CDLA 1WCMJ 1Z77A 2NVYJ 2KDZA 1G2HA 1WPKA 3LOCA 3KKDA 2HOTA 3BT9A 2W48A 4V2FA 3LNQA 5D18A 5EFYA 5J1UA 2O7TA 3VW1A 2HYJA 1Q1VA 2QF7A 4A3BJ 1K83J 1ENHA 1ETVA 3BRUA 1XG1A 2TRTA 3RD3A 1X58A 1GV2A 5M5YJ 1XS9A 2DMNA 3L1PA 2E2IJ 3FISA 4HNVA 2ZOYA 2O7OA 3LHQA 3PO3J 4Y7NJ 3O8HA 4DZPA 2YS9A 2X9DA 3GTOJ 2OERA 2D5VA 1IRZA 2ID3A 4D7MA 3F0CA 3NPIA 3Q0UA 4BY1J 2DA3A 3G1MA 3BCGA 2LKXA 2JN6A 3EUPA 1IDYA 5E3NA 3BR1A 3JRHA 3VPRA 3S2HJ 1OFCX 2EZIA 3GTLJ 3E7LA 2XGEA 2JA5J 1FTTA 4JL3A 2V57A 4M3GA 5FKOA 1QVUA 3S1QJ 5C4XJ 2ECBA 3OSGA 3HOUJ 3B6CA 3VIBA 2DJNA 5E3MA 3GTMJ 3IH2A 4JX5A 4LOCA 1PUFA 3P9TA 1RETA 1FTZA 3VVXA 1RR7A 2R5ZA 3RZDJ 2R5YB 4J19A 2VPRA 2UXPA 4DYQA 3ZQHA 1HDPA 3BG5A 4JP0A 2FD5A 3SDGA 2HXOA 4L62A 3EGQA 4DZJA 1JTXA 1HLVA 2XB5A 3BQYA 5D1RA 2VKVA 4JX6A 2HDDA 1IGNA 5EYRA 2Y0SN 2ZOZA 3KKCA 2X6OA 3HKZN 5IYCJ 3OSFA 2VI6A 1ORKA 3CCYA 1K61A 3GTPJ 2GBYA 3NAUA 3TP3A 1MBGA 1H89C 4FE7A 3BR5A 2O9LA 2RASA 2IAIA 2P81A 5K7ZA 1SANA 2O8KA 1MBJA 3B81A 3DPJA 2NS7A 4FE4A 3BG9A 3QKXA 3ZOBA 1HDDC 2ELKA 1R9TJ 3FK6A 3ON2A 4RDUA 1WH7A 1MSFC 4B4CA 5C44J 3SJMA 4GFLA 4D5FA 1FEXA 4EEFG 4GCTA 5F04A 1JUMA 2GFNA 3A01B 1F43A 2JK3A 1H88C 4A3IJ 4DW6A 2L7ZA 3HM5A 5FMPA 4B1RA 3LJLA 3Q0WA 4ABZA 1HCRA 3RH2A 5CW8A 3OIOA 4QIWN 4M3EA 5F1JA 2K9QA 2WV1A 3HEFA 2NVQJ 2QIBA 2ZCMA 4DYCA 2PBXA 4W97A 1BJZA 2FX0A 3JRGA 4FTHA 3VVYA 3TW6A 3DCFA 4UUSA 3CWRA 3LWJA 1I6HJ 3LSJA 3MNLA 5GP9A 1TC3C 2LK2A 3JRDA 2AO9A 5J1YA 3BG3A 2XPWA 1IJWC 5J3LA 3GTQJ 5IP9J 2YU9J 2QTQA 5AQCA 3MN2A 4D7NA 2M8GX 2IBDA 4NN1A 2Y9YA 1B8IA 3BTLA 3TEDA 2X48A 1CQTA 2TCTA 4IHXA 3JRIA 2JA6J 4M3DA 3K7AJ 4V2GA 1TWGJ 4JYKA 1A6IA 2COBA 3VOXA 2XPUA 1POGA 4Y52J 4GCLA 5M3MJ 5JLXA 3BR0A 1D5YA 5E3OA 4IHWA 1LE8A 3VVZA 5IP7J 3S1MJ 1O4XA 1ETYA 2M9HA 5HAWA 2DA7A 4QTRA 5FKNA 2N8GA 5GPCA 2H8RA 2DG8A 4A3DJ 1RESA 5BNGA 4A3LJ 1HF0A 3QBMA 1W0TA 2GM4A 4NELA 3G1OA 2EZKA 1EF4A 3BHQA 1BL0A 5FGLA 3PO2J 4I76A 1X2MA 3OOUA 2MW8A 5FKLA 1DU6A 1GDTA 2KT0A 1UI5A 1AU7A 3TP0A 1JT6A 3GTGJ 3AQSA 3LSPA 3HTIA 1VI0A 2L7FP 2LVSA 3FKIJ 5CXGA 2EH3A 4DYRA 5K7FA 2EZHA 2M2EA 4M6VA 3WHBA 3PPBA 4AF5A 1AKHA 5GPAA 3GTKJ 1YRNA 1ZQ3P 1U9OA 4FCYA 3MKLA 3M4OJ 5M3FJ 3RKQA 4AC6A 1SFOJ 2UXUA 5EG0A 3RZOJ 5K7HA 3HGYA 3BQZA 3WHCA 2E1OA 1ETQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX J;  3JSJ A;  3M3Y J;  1HOM A;  2XDN A;  4C2M J;  3CJD A;  4JX4 A;  3HOX J;  3I4N J;  4A3M J;  2RHA A;  3G56 A;  4YZE A;  4A3J J;  2DMQ A;  2G7L A;  4RBO A;  2HOA A;  3KZ9 A;  1NK3 P;  4QSH A;  3S14 J;  3DEW A;  5HOD A;  4CYC A;  3HOV J;  5C4Y A;  2EZL A;  4FIS A;  2REK A;  3TW7 A;  1B8I B;  1B72 B;  2QOP A;  3ZQF A;  1MBE A;  4XK4 A;  3JR9 A;  2ZCX A;  5C3E J;  2ECC A;  2OF7 A;  4MLO A;  5EGO B;  1MNM C;  3JRB A;  1JGG A;  4NDL A;  1JKO C;  1NK2 P;  4G12 A;  4A3F J;  2WGB A;  1GUU A;  2ME6 A;  4XRS G;  1JTY A;  3ZQL A;  2Y30 A;  2PZ9 A;  2WAQ N;  3W6V A;  2DA4 A;  4A3G J;  3ANP A;  2DA1 A;  1NTC A;  2GEN A;  2M0C A;  2CJJ A;  3JRE A;  1Y1W J;  1ZR4 A;  2FJ1 A;  1TWF J;  1APL C;  2HXI A;  4MFD A;  3ON4 A;  4MFE A;  3T6N A;  4AC0 A;  5EEA A;  1JKR C;  3F1B A;  2MG4 A;  2JMW A;  2DN0 A;  3S1N J;  2XGC A;  3Q3S A;  2NS8 A;  1GV5 A;  4M3B A;  3JRC A;  5DAJ A;  2QKO A;  5IOZ A;  3B6A A;  1WH5 A;  2FQ4 A;  2E19 A;  2JJ7 A;  2Y9Z A;  4AUX A;  5J1R A;  1W0U A;  1OJL A;  2LD5 A;  2CQQ A;  4UUT A;  2JA7 J;  1RKW A;  2AHQ A;  1ETX A;  3HGG A;  1IC8 A;  5F27 A;  1ETK A;  2D6Y A;  3VUQ A;  3QQA A;  1JKQ C;  1AKH B;  2LFB A;  1Y1V J;  3BTC A;  5HSZ A;  1H8A C;  4GFK A;  4GCK A;  3BTI A;  2HYT A;  1TWH J;  2CU7 A;  3BR2 A;  1E3O C;  1JT0 A;  4MK6 A;  1T56 A;  2R5Y A;  2XSD C;  5FLV A;  3CRJ A;  3ZQG A;  2I10 A;  5EZG A;  2ID6 A;  4W1U A;  5IOY A;  1PUF B;  5D19 A;  2HKU A;  2JWT A;  2R5Z B;  3NNR A;  1UMQ A;  1ZTR A;  3G1L A;  2CRG A;  1JKP C;  1WGX A;  1S7E A;  2XRL A;  4C3J J;  2IU5 A;  1BA5 A;  3NXC A;  1MBH A;  4IHY A;  1LFB A;  5M5X J;  9ANT A;  2GUH A;  3LSR A;  2F07 A;  1JJ8 C;  3HTA A;  3NAR A;  5F0C A;  4HKU A;  2K9N A;  3UKG A;  3S1R J;  4CYC B;  1GVD A;  2OPT A;  4MO7 A;  3HOZ J;  1IV6 A;  4IEJ A;  2L7M P;  3VOK A;  2Q24 A;  3NRG A;  1P7J A;  5M5W J;  3HTH A;  1WI3 A;  3S15 J;  3HE0 A;  1BW6 A;  2R7Z J;  1MH4 A;  1BW5 A;  3GTJ J;  2WB1 N;  3ANG A;  2ZB9 A;  5HBU A;  2L9R A;  1UI6 A;  3ZQC A;  3GBG A;  1OCT C;  4JKZ A;  5FKM A;  3A01 A;  5K58 A;  1TWC J;  4C3I J;  2NVT J;  3G7R A;  3IH3 A;  2DTZ A;  5EDN A;  3IUV A;  5CXI A;  3S2D J;  2DMT A;  3Q0V A;  3HOY J;  3GEU A;  3S17 J;  4C3H J;  1OCP A;  1X2N A;  1IUF A;  2HQ5 A;  3BNI A;  2YVH A;  1U78 A;  4M3F A;  1ZR2 A;  2R93 J;  3HIM A;  2L0K A;  3IH4 A;  4B3A A;  3A03 A;  2R0Q C;  3C2B A;  1VND A;  3JRA A;  2Y2Z A;  2G7G A;  1UHS A;  3H3V K;  5F0F A;  5H9T A;  3HB9 A;  3V78 A;  1VFC A;  5E3L A;  1FJL A;  2VKE A;  2E2J J;  2NP3 A;  2OI8 A;  3BR6 A;  3RQI A;  4UDS A;  2LTP A;  3VW0 A;  4UUS B;  2DMP A;  4BXX J;  3HDD A;  3E7Q A;  4D5C A;  5FHP A;  4BBR J;  5C4J J;  4A93 J;  3COL A;  5IYD J;  2FBQ A;  2XGD A;  2DA5 A;  2HI3 A;  3LSG A;  1QVT A;  2EQR A;  4BBS J;  2IEK A;  3AQT A;  5IYB J;  3QPL A;  2LY9 A;  2CUF A;  1DU0 A;  3I4M J;  4XRS A;  1ETO A;  5EF6 A;  1FIP A;  5JLW A;  1LFU P;  2DG7 A;  2DA6 A;  2NOG A;  1QPI A;  1GT0 C;  5EZH A;  1XC5 A;  2MSY A;  1MBK A;  2XPV A;  4I6Z A;  2NP5 A;  2W53 A;  4JNN A;  3BTJ A;  4A3C J;  2Y31 A;  3BR3 A;  3ZQI A;  5IP6 A;  2EBI A;  1JUP A;  1LE8 B;  2VUM J;  2UXO A;  1IG7 A;  2R92 J;  4ME9 A;  4XID A;  2WUI A;  1P7I A;  1UG2 A;  3PAS A;  4CGR A;  1RKT A;  1ETW A;  3NI7 A;  3HBL A;  3FRQ A;  1ZGW A;  3HTJ A;  1U9N A;  1I3Q J;  2LR8 A;  3PM1 A;  3GZI A;  1RPW A;  3D1N I;  4XRM A;  1IDZ A;  5DS9 A;  4XIC A;  2M34 A;  3SFI A;  2YVE A;  4PXI A;  3C07 A;  2NX4 A;  4S0H B;  3S16 J;  4X1E A;  1ITY A;  4ACI A;  3CMY A;  4A3E J;  2B63 J;  2YUS A;  1VF9 A;  1T33 A;  3FIW A;  1SGM A;  4L5E A;  1AHD P;  2G3B A;  3CQZ J;  3S5R A;  3KNW A;  3VP5 A;  2MGQ A;  1YRN B;  2ME0 A;  1F36 A;  2CQX A;  2G0E A;  2K9S A;  4X6A J;  4MXM A;  2JA8 J;  1FIA A;  2DA2 A;  3O8G A;  2ZCN A;  4BY7 J;  2GLO A;  4ICH A;  1ZK8 A;  2LLK A;  1JUS A;  3QPS A;  1TWA J;  1ZKG A;  5EG0 B;  5F08 A;  3O60 A;  4KWA A;  1A5J A;  3HOW J;  5DTD A;  1U8B A;  1MSE C;  3A02 A;  3IV5 A;  3JRF A;  4IHV A;  2LP0 A;  4A69 C;  2XB0 X;  3K2A A;  1MH3 A;  4MIM A;  1JJ6 C;  2QWT A;  3V6G A;  3FK7 A;  3MVP A;  2PMZ N;  5FJ8 J;  4A3K J;  3H0G J;  4AYB N;  1I50 J;  2H1K A;  2DMU A;  3BJB A;  2RAE A;  4GFB A;  2K40 A;  1B72 A;  4BKX A;  2CUE A;  3VW2 A;  5EGO A;  2UXI A;  1QRY A;  5F0H A;  1Z0X A;  2HOS A;  2QCO A;  5FKK A;  5FLM J;  2E2H J;  1MBF A;  5IPA A;  2G7S A;  2UXH A;  3CDL A;  1WCM J;  1Z77 A;  2NVY J;  2KDZ A;  1G2H A;  1WPK A;  3LOC A;  3KKD A;  2HOT A;  3BT9 A;  2W48 A;  4V2F A;  3LNQ A;  5D18 A;  5EFY A;  5J1U A;  2O7T A;  3VW1 A;  2HYJ A;  1Q1V A;  2QF7 A;  4A3B J;  1K83 J;  1ENH A;  1ETV A;  3BRU A;  1XG1 A;  2TRT A;  3RD3 A;  1X58 A;  1GV2 A;  5M5Y J;  1XS9 A;  2DMN A;  3L1P A;  2E2I J;  3FIS A;  4HNV A;  2ZOY A;  2O7O A;  3LHQ A;  3PO3 J;  4Y7N J;  3O8H A;  4DZP A;  2YS9 A;  2X9D A;  3GTO J;  2OER A;  2D5V A;  1IRZ A;  2ID3 A;  4D7M A;  3F0C A;  3NPI A;  3Q0U A;  4BY1 J;  2DA3 A;  3G1M A;  3BCG A;  2LKX A;  2JN6 A;  3EUP A;  1IDY A;  5E3N A;  3BR1 A;  3JRH A;  3VPR A;  3S2H J;  1OFC X;  2EZI A;  3GTL J;  3E7L A;  2XGE A;  2JA5 J;  1FTT A;  4JL3 A;  2V57 A;  4M3G A;  5FKO A;  1QVU A;  3S1Q J;  5C4X J;  2ECB A;  3OSG A;  3HOU J;  3B6C A;  3VIB A;  2DJN A;  5E3M A;  3GTM J;  3IH2 A;  4JX5 A;  4LOC A;  1PUF A;  3P9T A;  1RET A;  1FTZ A;  3VVX A;  1RR7 A;  2R5Z A;  3RZD J;  2R5Y B;  4J19 A;  2VPR A;  2UXP A;  4DYQ A;  3ZQH A;  1HDP A;  3BG5 A;  4JP0 A;  2FD5 A;  3SDG A;  2HXO A;  4L62 A;  3EGQ A;  4DZJ A;  1JTX A;  1HLV A;  2XB5 A;  3BQY A;  5D1R A;  2VKV A;  4JX6 A;  2HDD A;  1IGN A;  5EYR A;  2Y0S N;  2ZOZ A;  3KKC A;  2X6O A;  3HKZ N;  5IYC J;  3OSF A;  2VI6 A;  1ORK A;  3CCY A;  1K61 A;  3GTP J;  2GBY A;  3NAU A;  3TP3 A;  1MBG A;  1H89 C;  4FE7 A;  3BR5 A;  2O9L A;  2RAS A;  2IAI A;  2P81 A;  5K7Z A;  1SAN A;  2O8K A;  1MBJ A;  3B81 A;  3DPJ A;  2NS7 A;  4FE4 A;  3BG9 A;  3QKX A;  3ZOB A;  1HDD C;  2ELK A;  1R9T J;  3FK6 A;  3ON2 A;  4RDU A;  1WH7 A;  1MSF C;  4B4C A;  5C44 J;  3SJM A;  4GFL A;  4D5F A;  1FEX A;  4EEF G;  4GCT A;  5F04 A;  1JUM A;  2GFN A;  3A01 B;  1F43 A;  2JK3 A;  1H88 C;  4A3I J;  4DW6 A;  2L7Z A;  3HM5 A;  5FMP A;  4B1R A;  3LJL A;  3Q0W A;  4ABZ A;  1HCR A;  3RH2 A;  5CW8 A;  3OIO A;  4QIW N;  4M3E A;  5F1J A;  2K9Q A;  2WV1 A;  3HEF A;  2NVQ J;  2QIB A;  2ZCM A;  4DYC A;  2PBX A;  4W97 A;  1BJZ A;  2FX0 A;  3JRG A;  4FTH A;  3VVY A;  3TW6 A;  3DCF A;  4UUS A;  3CWR A;  3LWJ A;  1I6H J;  3LSJ A;  3MNL A;  5GP9 A;  1TC3 C;  2LK2 A;  3JRD A;  2AO9 A;  5J1Y A;  3BG3 A;  2XPW A;  1IJW C;  5J3L A;  3GTQ J;  5IP9 J;  2YU9 J;  2QTQ A;  5AQC A;  3MN2 A;  4D7N A;  2M8G X;  2IBD A;  4NN1 A;  2Y9Y A;  1B8I A;  3BTL A;  3TED A;  2X48 A;  1CQT A;  2TCT A;  4IHX A;  3JRI A;  2JA6 J;  4M3D A;  3K7A J;  4V2G A;  1TWG J;  4JYK A;  1A6I A;  2COB A;  3VOX A;  2XPU A;  1POG A;  4Y52 J;  4GCL A;  5M3M J;  5JLX A;  3BR0 A;  1D5Y A;  5E3O A;  4IHW A;  1LE8 A;  3VVZ A;  5IP7 J;  3S1M J;  1O4X A;  1ETY A;  2M9H A;  5HAW A;  2DA7 A;  4QTR A;  5FKN A;  2N8G A;  5GPC A;  2H8R A;  2DG8 A;  4A3D J;  1RES A;  5BNG A;  4A3L J;  1HF0 A;  3QBM A;  1W0T A;  2GM4 A;  4NEL A;  3G1O A;  2EZK A;  1EF4 A;  3BHQ A;  1BL0 A;  5FGL A;  3PO2 J;  4I76 A;  1X2M A;  3OOU A;  2MW8 A;  5FKL A;  1DU6 A;  1GDT A;  2KT0 A;  1UI5 A;  1AU7 A;  3TP0 A;  1JT6 A;  3GTG J;  3AQS A;  3LSP A;  3HTI A;  1VI0 A;  2L7F P;  2LVS A;  3FKI J;  5CXG A;  2EH3 A;  4DYR A;  5K7F A;  2EZH A;  2M2E A;  4M6V A;  3WHB A;  3PPB A;  4AF5 A;  1AKH A;  5GPA A;  3GTK J;  1YRN A;  1ZQ3 P;  1U9O A;  4FCY A;  3MKL A;  3M4O J;  5M3F J;  3RKQ A;  4AC6 A;  1SFO J;  2UXU A;  5EG0 A;  3RZO J;  5K7H A;  3HGY A;  3BQZ A;  3WHC A;  2E1O A;  1ETQ A; 
#chains in the Genus database with same CATH topology
 3B02 A;  2NVX J;  3L2W A;  1D8J A;  1XN7 A;  3CUQ A;  3I4N J;  4A3M J;  2FBI A;  4A3J J;  1LVA A;  3KZ9 A;  3EYY A;  2WWY A;  3S14 J;  4GO1 A;  4XR6 A;  3FHZ A;  3HOV J;  1W4M A;  4PK4 A;  5HDG A;  5C4Y A;  4CO8 A;  1MGT A;  1C0W A;  4AM3 A;  2DT7 B;  3F9K A;  3ZQF A;  1TT5 B;  1MNM C;  2OF7 A;  3CC7 I;  3AL0 B;  4OIQ F;  1T39 A;  3JRB A;  2RRE A;  5LGN A;  2DOE A;  1BR2 A;  1YS7 A;  1O3Q A;  2ME6 A;  1IN5 A;  4RA2 A;  4HDU A;  1G4D A;  1JTY A;  3CLO A;  1Z67 A;  1X3U A;  5FFX A;  3DKX A;  2MH9 A;  1FWZ A;  4A3G J;  5CPR B;  3V8K A;  2GEN A;  3PNY A;  2M0C A;  5B1A H;  5HS9 A;  2H1L A;  2YR2 A;  4M71 A;  1YLF A;  3K2Z A;  2HXI A;  4MFD A;  1S6L A;  2LY2 A;  1R5I D;  5ILS A;  2MH2 A;  3F1B A;  4YEL A;  2JMW A;  4ZTF A;  4V19 K;  1GV5 A;  3JRC A;  3L2U A;  4CCO A;  5IOZ A;  2I8D A;  3SEQ A;  2Y9Z A;  2IS6 A;  4AUX A;  5J1R A;  3A1Y A;  1MD0 A;  3ISP A;  2V4J C;  3OIQ A;  2B9S A;  2Z3Y A;  2A6H F;  1ETX A;  1V3F A;  2GA2 A;  1ETK A;  3RKY A;  5J8C A;  1GXQ A;  1ZLJ A;  2L54 A;  3QQA A;  1R49 A;  2D6Y A;  3VUQ A;  4HNT A;  1AKH B;  1TLH B;  1WI9 A;  5J4V A;  4RM3 A;  2CO5 A;  5IY5 H;  4MK6 A;  4HA8 A;  1Z3Y A;  4RAG A;  3I9V 2;  5D19 A;  3D5S C;  1PUF B;  2XKP A;  3CCM I;  2NYX A;  3NQO A;  5E8I A;  5ICE A;  2R5Z B;  2JT1 A;  1ZTR A;  4NB5 A;  5TJJ A;  3AKZ A;  3BPX A;  4YFX F;  2RV8 A;  1JKP C;  1ACI A;  3J80 K;  1BA5 A;  3IAS 2;  3NXC A;  2L4A A;  1SD6 A;  3PNT A;  2BGC A;  1VQ8 I;  4IHY A;  3PSF A;  4LFU A;  3M8J A;  1JJ8 C;  1YS6 A;  2UXN A;  2KFD A;  4HKU A;  3UKG A;  5DUI A;  1GVD A;  1Z7U A;  4D0P A;  4QLC U;  4U0W A;  1QQI A;  4MO7 A;  4Z6Y A;  1IV6 A;  1WQ2 A;  4UVA A;  1YX5 A;  5M5W J;  2STW A;  2D1V A;  1WI3 A;  3ZQQ A;  3DBH B;  4HDV A;  3HPG A;  1BW5 A;  3K70 D;  1SFK A;  3ZGK A;  3DWL E;  3FXM A;  1T0F C;  5BMZ A;  5FKM A;  1FNN A;  1TZL A;  5B1B H;  2L9S A;  4L5J A;  3OR2 C;  4U9N A;  3IH3 A;  3QPT A;  3EUK L;  1X1B A;  4H4K C;  5KCM A;  1W36 C;  3L7W A;  3DLA A;  4HF0 A;  4C3H J;  4BHP A;  1NH3 A;  3BCA A;  2HTJ A;  3FXL A;  1GXP A;  3GZN B;  3A4C A;  3T1B A;  2R0Q C;  2V9K A;  3C2B A;  2QEX I;  5E79 C;  2E1M C;  2E34 A;  2LDU A;  1HSJ A;  2HNH A;  5F0F A;  4BQQ A;  4AVZ A;  1FJL A;  4XSZ F;  3GXO A;  3RQI A;  4UDS A;  2LTP A;  2CYY A;  2JSC A;  4UUS B;  4Q48 A;  4WK8 F;  2PLY A;  3HDD A;  4BBR J;  4ENJ A;  3F3X A;  4TV7 A;  3AG2 H;  3KP2 A;  4LMY A;  2P8T A;  1LEA A;  3H36 A;  1X1P A;  1KU7 A;  2R7U A;  1QHH D;  1D0Z A;  2HVR A;  2HI3 A;  3LSG A;  5EEG A;  3DP7 A;  1BI3 A;  3MCZ A;  4IO9 F;  2D2W A;  3OR1 C;  4G8X A;  5K5O A;  1DU0 A;  3RDI A;  3PIP F;  4XRS A;  2E1O A;  2W82 A;  3KEO A;  3H5N A;  4XM3 A;  3CCS I;  2W85 A;  3ECO A;  2NOG A;  1QPI A;  5EZH A;  2NP5 A;  4I6Z A;  3I5U A;  5HLG A;  3HXL A;  3BDD A;  4JNN A;  1EJ9 A;  4WF2 A;  2Y31 A;  4IOC F;  2MA3 A;  2EBI A;  5IP6 A;  3BZK A;  4RLQ A;  1IG7 A;  1SAU A;  3PAS A;  1ETW A;  3CD6 I;  2VBZ A;  4C2U A;  5IT9 K;  5B66 C;  2E1M B;  1BI0 A;  5EJC A;  2HYG D;  2VJ4 A;  2MLG A;  1VQK I;  3HTJ A;  1KU3 A;  2VT2 A;  1I3Q J;  2LR8 A;  1XX5 A;  4CCK A;  1ZG5 A;  4IZZ A;  1LFP A;  1OYW A;  5ILV A;  3OYB A;  3TKY A;  4XKV A;  4PXI A;  4RGS A;  1QBJ A;  2OZU A;  4PCQ A;  3GLL A;  4A3E J;  3H3Z A;  5H2F C;  2PJR A;  1VF9 A;  3H1C A;  1OCZ H;  4A0Z A;  2BBY A;  1DGW Y;  1R00 A;  1AHD P;  3ZMU A;  3S5R A;  3WU2 C;  1O3T A;  3KNW A;  1MZB A;  3VP5 A;  4G6T B;  1YYV A;  1YRN B;  1F36 A;  2JTV A;  2OBP A;  4CHU A;  1R4N B;  3O8G A;  2OUM A;  3IRQ A;  2ZJR F;  4ICH A;  1ZK8 A;  4WXC A;  1JUS A;  1KQ9 A;  1X4P A;  1XDU A;  2DK5 A;  3AG4 H;  5HS7 A;  5DTD A;  1ZHF A;  1FYK A;  4LGW A;  1MSE C;  3I4P A;  1HBX G;  3A02 A;  1H9G A;  3JRF A;  1VQO I;  1S3J A;  4IF4 A;  2XB0 X;  3K2A A;  3J81 Z;  4HF1 A;  2CGP A;  4G7O F;  2VT3 A;  3V4G A;  4XKB A;  3J7Z I;  3M8E A;  1A04 A;  2RAE A;  2RN7 A;  4AIH A;  2QEN A;  3GX4 X;  2K40 A;  3IWZ A;  1G3S A;  1B72 A;  4BKX A;  3RIR A;  1LJ9 A;  2DT5 A;  4WX9 A;  5EGO A;  4ESJ A;  2UXI A;  1S29 A;  1MMN A;  2HOS A;  3GVA A;  4XON A;  5D5V B;  3GCM A;  5IPA A;  1ZRF A;  2UXH A;  1BM9 A;  1WCM J;  2KDZ A;  3EDP A;  3LOC A;  3I58 A;  3T8T A;  2HOT A;  4J01 A;  4B43 A;  2W48 A;  1B6A A;  4BEH A;  2ACJ A;  4EM1 A;  2VJ5 A;  2DYS H;  2UUZ A;  2IXS A;  1RNL A;  1OCC H;  1XSV A;  2KZV A;  3BRU A;  2TRT A;  3RD3 A;  3C7J A;  2CWE A;  1J09 A;  3CJN A;  2DMN A;  3VEP A;  3OYJ A;  4J00 A;  2OV7 A;  3L1P A;  4HNV A;  4PDK A;  4ZH4 F;  1VQ4 I;  2ZOY A;  4IL6 C;  2BVM A;  2EFW A;  1MIJ A;  4DZP A;  2YS9 A;  2X9D A;  3GTO J;  2OER A;  1D1B A;  3I55 I;  4KJZ A;  4EV0 A;  2VON A;  4BY1 J;  1WFX A;  3RYP A;  2JN6 A;  3EUP A;  2X1C A;  2LRD A;  3HRU A;  1I6X A;  5E1W A;  1OFC X;  4E6K G;  2EZI A;  3GTL J;  2QSH X;  2XGE A;  1FSH A;  2KMU A;  4WIB A;  3P7N A;  4JL3 A;  3RPU D;  2HWV A;  2GQQ A;  1R5H A;  2WAD A;  1QVU A;  5FKO A;  2PJR B;  3FXO A;  2ECB A;  1X1C A;  4O3M A;  1U2W A;  1IO2 A;  5CVJ A;  3GTM J;  2OTL I;  3IH2 A;  3V7S A;  1RET A;  3DBR B;  3R0J A;  4FAS D;  3VVX A;  2DTR A;  3DTK A;  2R5Y B;  2UXP A;  3K4K A;  1HDP A;  4JP0 A;  3SDG A;  2KDO A;  4IQ4 A;  1FT9 A;  1K6Y A;  2KRH A;  2XB5 A;  2P6S A;  3MZH A;  5D5X B;  2HDD A;  3JSO A;  2ZOZ A;  2DBB A;  3HKZ N;  5IYC J;  3CCY A;  1K61 A;  3TO6 A;  4DNC A;  2XV4 S;  2Q2E B;  2GBY A;  3JAM Z;  1MBG A;  5J40 A;  2P81 A;  5K7Z A;  1H0M A;  3HTS B;  3DPJ A;  4OD5 A;  4F91 B;  2NS7 A;  4FE4 A;  3BG9 A;  3G3Z A;  4ZYH A;  3QKX A;  3ZOB A;  4OAY A;  1SVL A;  5EEH A;  3WG7 H;  2J5P A;  1WH7 A;  5LGU A;  1R5G A;  4B4C A;  3KX2 A;  5C44 J;  4GFL A;  4HEA 2;  4BEH B;  4BE2 A;  2X51 A;  3BJ6 A;  2GFN A;  1G3Y A;  1Y8Q B;  4JBA A;  4BJ5 C;  3OYM A;  4A3I J;  2P5V A;  1XCB A;  3HM5 A;  3HUG B;  3VYR B;  4B1R A;  1DPR A;  3K4M A;  5FMP A;  3O2P E;  3DPU A;  3V42 A;  2W57 A;  5CW8 A;  3QP5 A;  2O8X A;  4I01 A;  1UG0 A;  2R7F A;  3K69 A;  3WTW C;  4IVN A;  1T8I A;  1U5T A;  3CF5 F;  5FD6 A;  4IX7 A;  2ZBK A;  2F4O B;  1XDS A;  2A61 A;  5DEQ A;  2DPD A;  2CQ7 A;  4B09 A;  3CWR A;  3LSJ A;  1N78 A;  2P7V B;  1TC3 C;  2AO9 A;  5J1Y A;  1KGS A;  1F1Z A;  3OYG A;  5J3L A;  4R1H A;  3GTQ J;  2YU9 J;  1RI7 A;  5AQC A;  1H9T A;  3CCU I;  5AIQ A;  5LFA A;  3OYD A;  2LH9 A;  1J9I A;  3FDY A;  3U1K A;  3A0H C;  2Y9Y A;  3HOS A;  1VTN C;  4NN1 A;  1SFX A;  2X48 A;  1W5S A;  1YJN I;  4IOA F;  2PMU A;  4R79 A;  4IHX A;  1OPC A;  3GLX A;  1TNS A;  2RQP A;  4M3D A;  1J2X A;  3SQN A;  4C2T A;  2XPU A;  1NG6 A;  1POG A;  5J47 A;  5HOO A;  1D5Y A;  1VQN I;  5HNH A;  1E17 A;  1LE8 A;  3FM3 A;  1U5T C;  2FML A;  5ICF A;  1JI8 A;  2R4G A;  5IP7 J;  4UUV A;  4NUB A;  2PJP A;  5BPI A;  3CP8 A;  2LYC A;  1TNT A;  4QTR A;  5FKN A;  2N8G A;  1ZEL A;  4ESF A;  5GPC A;  2H8R A;  2O6G E;  5BNG A;  2F5D A;  2KHM A;  1EF4 A;  4CCN A;  2GXG A;  3LSI A;  5DD4 A;  3OOU A;  3K8P C;  4G7Z F;  3FM5 A;  2KJB A;  5CVU A;  2XF6 A;  1MMG A;  3PIO F;  3TP0 A;  1KYZ A;  4KIC A;  4RB1 A;  1VQP I;  4UV8 A;  1UHM A;  2XIG A;  5K7F A;  1DQU A;  1OMI A;  2CFO A;  2EZH A;  5H6Q A;  3PPB A;  4HSR A;  2BVL A;  4E4H A;  2W00 A;  3VDX A;  2K86 A;  1ZQ3 P;  1U9O A;  2DW4 A;  1W5C C;  1PJR A;  3G2B A;  1T2K A;  2Z9O A;  5M3F J;  3RKQ A;  4AC6 A;  3B73 A;  2UXU A;  2GXA A;  5K7H A;  2W1O A;  2E36 A;  1U5T B;  4EGY A;  3WHC A;  4BQA A;  4P1W A;  1BOA A;  1JGS A;  3CMM A;  4WCG A;  4XKC A;  3M3Y J;  2W25 A;  1HOM A;  2RHA A;  1G3T A;  3G56 A;  2DO7 A;  2DFF A;  2V7F A;  4YZE A;  2G9W A;  4Q4Z F;  4QSH A;  2ZKZ A;  5LHH A;  1P4X A;  1KQ8 A;  5AON A;  2R7T A;  3BG7 A;  2O61 A;  2IGK A;  5DV5 A;  2W4S A;  1MNE A;  2QOP A;  3CTA A;  4S04 A;  1MBE A;  2R7D A;  3JR9 A;  4MLO A;  4A5N A;  3LSK A;  3PL8 A;  2ZNY A;  3WTV C;  3ECH A;  4MGR A;  2R7W A;  4PJM A;  3X2Q H;  4NDL A;  4GCV A;  4G12 A;  4A3F J;  3TDU C;  3FXK A;  1Z3X A;  4M9Z A;  2R7V A;  2LKP A;  2WAQ N;  4CDG A;  2ZSI B;  3W6V A;  1DPU A;  3DPL C;  4HAM A;  4BXU A;  3J81 K;  3ANP A;  4HF2 A;  2VJJ A;  3K4B A;  2BEO A;  1Y1W J;  1R58 A;  3AG3 H;  3ON4 A;  3W2V A;  4E7Z A;  3T6N A;  4AC0 A;  2WAE A;  4CZC A;  1R36 A;  1LQ1 A;  3ERE D;  2M45 A;  1W7P B;  2XGC A;  1GVJ A;  5L3D A;  5TIS C;  2E7X A;  5DAJ A;  1WVR A;  2QKO A;  1WH5 A;  2FQ4 A;  2JJ7 A;  1MJB A;  2VKH A;  3NWT A;  1IF1 A;  1W0U A;  2YVX A;  3R61 A;  1OJL A;  1Y6I A;  2V1U A;  2BE5 F;  2LD5 A;  2CQQ A;  4I09 A;  2DLL A;  2AHQ A;  2NRA C;  3HGG A;  1I27 A;  5F27 A;  1LDD A;  1BR4 A;  4RGR A;  5BOX A;  2P5L C;  1JKQ C;  3OYC A;  2LFB A;  2VL8 A;  1Y1V J;  2CSO A;  4WWC A;  2HYT A;  5HLI A;  3U2R A;  4GDF A;  1T56 A;  3CRJ A;  2NAZ A;  2VQH A;  3DEE A;  3IAM 2;  4N4N B;  4E70 A;  2XRO A;  4U7B A;  1SD4 A;  5EZG A;  4W1U A;  1RUN A;  2FF4 A;  3KP7 A;  2Q8K A;  2V1N A;  2HKU A;  2KRF A;  1QNT A;  2HDC A;  3E0J B;  3G1L A;  4PFO A;  3RQ4 A;  2XAU A;  1WHU A;  2IU5 A;  4BHC A;  1MBH A;  4E7K A;  2F07 A;  3DU5 A;  1YHQ I;  3HTA A;  1TT0 A;  2K9N A;  3C2H A;  2DT6 A;  3HYI A;  1OR7 C;  3HOZ J;  3FKJ A;  3Q5F A;  4NBQ A;  5A2Q Z;  2KLO A;  2L7K A;  3S15 J;  2M87 A;  3HZJ A;  3FBI B;  2R7Z J;  4LB6 B;  4P55 A;  2W84 A;  2WB1 N;  3GTJ J;  2JPC A;  1UI6 A;  4JKZ A;  3GBG A;  5LEK A;  3LA2 A;  5K58 A;  2NVT J;  1OQY A;  1E2X A;  2VKD A;  5LEJ A;  2E71 A;  1CF7 A;  5EDN A;  2STT A;  3V8L A;  4OOI A;  3Q0V A;  4EAT A;  3CCR I;  2A5Y B;  2H27 A;  3S17 J;  4NHJ A;  4HLX A;  1MND A;  3JAM K;  2IVM A;  1FOW A;  3WE2 A;  2DOD A;  1WJC A;  2IT0 A;  2L01 A;  1ZR2 A;  1Z21 A;  2R93 J;  3HIM A;  2L0K A;  3A03 A;  2Y2Z A;  3H3V K;  2Z16 A;  3O3K A;  2EK5 A;  2EIN H;  3SHF A;  3DEU A;  5DYM A;  1VFC A;  3I56 I;  1MMA A;  2VKE A;  2JSP A;  3CCL I;  2NP3 A;  2OI8 A;  4FET A;  3FXR A;  4XKW A;  4IXA A;  3KEQ A;  5FHP A;  2DXI A;  1B9N A;  2HQR A;  2VIX A;  5GAE J;  2HQN A;  3ZMV A;  2UV1 A;  2EQR A;  1X3W B;  3GFJ A;  5IYB J;  4PJJ A;  1XGO A;  1RR8 C;  2CUF A;  3I4M J;  2IS2 A;  1YOV B;  1ETO A;  5EF6 A;  4RB0 A;  5JLW A;  2IJL A;  4HX4 A;  2Y75 A;  1QHG A;  1TP4 A;  1LFU P;  3L2C A;  1YFH A;  2HS5 A;  3KLO A;  4CGZ A;  2W53 A;  1TTY A;  1XC5 A;  1LVK A;  1QO0 D;  5ERI A;  4EVI A;  3WTX C;  1S8N A;  3FMR A;  1JUP A;  3HC7 A;  2R92 J;  4I98 B;  1P7I A;  1UG2 A;  1DUX C;  4CGR A;  2H6B A;  1K6O A;  1DP7 P;  4BHB A;  3NI7 A;  3CUQ C;  3FMQ A;  1X1D A;  2Q1Z B;  3SEZ A;  1U9N A;  2FQ3 A;  3GZI A;  1RPW A;  2OD5 A;  3CDH A;  1IDZ A;  2EA2 A;  4XIC A;  2K85 A;  1IXC A;  4I0B A;  2M34 A;  2OZ6 A;  3W6J B;  2YVE A;  4FQG A;  2PBI A;  1S9H A;  5KVR A;  3CES A;  2ZSH B;  3C07 A;  1QGP A;  1W7P D;  1Z05 A;  2PG4 A;  3SYT A;  1LB2 A;  1D0X A;  5JFR A;  1ITY A;  1I1S A;  3CMY A;  4ON0 A;  1CF7 B;  2OAZ A;  1IZ1 A;  2VBW A;  2YUS A;  4PFP A;  2FBK A;  1T33 A;  1J5Y A;  3FIW A;  2ZNZ A;  2M4G A;  1SGM A;  4OU0 A;  4PJL A;  2G3B A;  1GLN A;  2K5C A;  2QKM B;  3F21 A;  4YII A;  4X6A J;  2CQX A;  2K9S A;  5D8K B;  3G71 I;  4IJA A;  2AQE A;  4E7L A;  4KMF A;  1FIA A;  2QVO A;  4UB6 C;  2FMY A;  2IGO A;  1MMS A;  4YEJ A;  3K4N A;  1HXD A;  3PUB A;  1U8R A;  1RRJ A;  5E1Z B;  2IRF G;  3QPS A;  1MDM A;  2VAS A;  4JQF A;  3O60 A;  1QZZ A;  1A5J A;  2OQR A;  3IV5 A;  4PZJ A;  2Z99 A;  4IHV A;  3CJT B;  3V6G A;  1MH3 A;  3BOQ A;  1SC7 A;  2L2O A;  1DDN A;  1NHA A;  4UB8 C;  3K0L A;  3MVP A;  3CUQ B;  5FJ8 J;  1WJE A;  3H0G J;  4AYB N;  2M4K A;  2H1K A;  3GF2 A;  3GZ6 A;  1ZRC A;  4GFB A;  2X85 A;  4GXO A;  2JVG A;  2KL4 A;  3EQL F;  2ELH A;  2GAU A;  2RNJ A;  3ZMZ A;  3IC7 A;  2PI0 A;  5CQG A;  2QCO A;  3ERM A;  1MBF A;  3Q9V A;  2BXZ A;  3MQ0 A;  3DXJ F;  3KKD A;  3KIO A;  5ICG A;  4KN7 X;  4IRG A;  2D45 A;  4L9N A;  5E17 F;  4PJN A;  5D18 A;  4CCJ A;  2HU9 A;  5EFY A;  4XN3 A;  5J1U A;  5DD8 A;  2O7T A;  3ABL H;  1ON2 A;  4HG2 A;  3BZ6 A;  3ONQ A;  4Q5S F;  1W1W E;  1WKM A;  1K83 J;  2MAB A;  5L3B A;  1X58 A;  3P9C A;  3VOE A;  2RQQ A;  3LSM A;  1YTY A;  1KYW A;  1XS9 A;  2M7A A;  3OYL A;  3PSI A;  3H5R A;  3WOD F;  2F2E A;  1JXS A;  2KQR A;  2VE8 A;  2XAH A;  3PO3 J;  4ZDL A;  4XMY A;  1VQ9 I;  4EJT A;  1GHC A;  3F0C A;  3QU6 A;  3RKX A;  1IW7 F;  4C2M A;  3JRH A;  2AQF A;  2VOD A;  2JUC A;  2LSO A;  2QLZ A;  2B3W A;  5F64 A;  4UHT A;  2JA5 J;  1FTT A;  2QBY A;  1STZ A;  2HZT A;  2P5K A;  2V57 A;  2HQA A;  3OYF A;  3QOE A;  3QRF F;  4YIR X;  1BI1 A;  3HOU J;  3P9I A;  2VBX A;  1K7A A;  3QP6 A;  3MZY A;  2BHY A;  4PSX A;  4DYQ A;  1OCR H;  4U0V A;  2FD5 A;  2L02 A;  3RI4 A;  3CP2 A;  4L62 A;  2V9P A;  3KET A;  1MDM B;  3DLL F;  5FD5 A;  5JI6 A;  2K02 A;  2LF8 A;  1UZC A;  1FMW A;  3F6V A;  4JX6 A;  4HX7 A;  3WGH A;  4G6Q A;  5EYR A;  2R7O A;  2Y0S N;  2ZXH A;  2X6O A;  3KKC A;  2X6W A;  2VI6 A;  3TP3 A;  4BH9 A;  1H89 C;  2ISZ A;  4KIG A;  1XGS A;  3BR5 A;  4Z2Y A;  4RGX A;  1SFE A;  2WAF A;  4KNY A;  1WRJ A;  2V1D A;  1MBJ A;  1N75 A;  1WJD A;  2BYV E;  4XLA A;  1D1A A;  3ZMT A;  3M8F A;  1LEB A;  4OIP F;  1O7F A;  2ZXW H;  2IA1 A;  2ELK A;  1R9T J;  1V55 H;  3FK6 A;  1TL8 A;  1USS A;  1IN7 A;  4HQM A;  1LNW A;  3IKV A;  1FEX A;  4EEF G;  1WJ5 A;  2E1N A;  5DM6 F;  1LUJ B;  2JK3 A;  4M74 A;  1H88 C;  3LMM A;  2LMD A;  1FX7 A;  2L7Z A;  1ON1 A;  3OYN A;  2XHK A;  3GO5 A;  4CYD A;  3QYE A;  2K27 A;  4IRV A;  3KYD B;  4ITV A;  2E5N A;  4OMY A;  1IRF A;  1IXS B;  4ZZL A;  1I1G A;  3ZQ7 A;  1R7J A;  3KLN A;  1EH7 A;  3TQN A;  5JVT A;  2WY7 Q;  3WTS C;  3H9J A;  3OWT A;  5A2Q K;  2UXX A;  3WTU C;  3E6B A;  4W97 A;  1BJZ A;  3JRG A;  3F22 A;  4FTH A;  3NS4 A;  4RB3 C;  3WGI A;  4XLC A;  3LWJ A;  2QYO A;  1BJA A;  2EIK H;  4AVP A;  4GYI A;  2LK2 A;  3S8P A;  3BG3 A;  2XPW A;  3TOA A;  3KZZ A;  5IP9 J;  3U21 A;  1D0Y A;  1WZ2 A;  4RLF A;  2QTQ A;  2QBY B;  4Y13 A;  2JZY A;  3AG1 H;  2M8G X;  2IBD A;  2ZJ2 A;  3HSE A;  1B8I A;  2HKX A;  2IGN A;  1CQT A;  3E6C C;  1A35 A;  2YX7 A;  2VQC A;  2JQ7 A;  3K7A J;  1TWG J;  1QPM A;  2ELJ A;  1A6I A;  4JYK A;  4F3Q A;  2COB A;  3O6B B;  3GW2 A;  5H20 A;  2A05 A;  4A6E A;  5M3M J;  4E7S A;  3BR0 A;  2CUZ A;  2M8E A;  4IHW A;  2IW5 A;  3KE2 A;  4A12 A;  2NVU B;  1O4X A;  4L0Z B;  1WJB A;  3PQK A;  2DFH A;  3F6O A;  4RB2 C;  4F7Z A;  2DA7 A;  2AS5 F;  5FO5 A;  3HRT A;  4G9Y A;  4KT5 C;  3COA C;  4KIB A;  2GM4 A;  1YW8 A;  4XLF A;  4I76 A;  1X2M A;  4II2 A;  1PP7 U;  4S05 A;  3K4C A;  2Z1D A;  1DU6 A;  4XOR A;  3J7Y J;  1JT6 A;  4FT8 A;  1XTA A;  3E5Q A;  3HOT A;  2LVS A;  2EH3 A;  4F52 A;  3CCE I;  4M9S A;  1AWC A;  3VTI A;  2V6C A;  4AF5 A;  3SXY A;  3AAF A;  3I71 A;  1A31 A;  5J8F A;  3ZR8 X;  2DK8 A;  3ZXS A;  4A0Y A;  2GOM A;  4FCY A;  1ZG3 A;  1RIO H;  3MKL A;  3FWE A;  3M4O J;  4DOZ A;  4DJA A;  4L0Y B;  1SFO J;  4CZZ A;  5D5U B;  5EG0 A;  1D5V A;  3RZO J;  3HGY A;  3BQZ A;  1VQM I;  2EFN A;  4LB5 A;  2QSG X;  1KON A;  1FMV A;  3PQJ A;  3KYC B;  1OCO H;  1WJF A;  4PGH A;  3MEX A;  4C2M J;  3HOX J;  4LIV A;  3QAH A;  1AA7 A;  3S93 A;  4B3X A;  3JTG A;  2G7L A;  3HSF A;  2HOA A;  4RBO A;  1NK3 P;  5HOD A;  4CYC A;  1QZY A;  2FUG 2;  2RGV A;  1W36 D;  4M6X A;  4FIS A;  3K1M A;  2REK A;  4LG0 A;  1B8I B;  1B72 B;  3IUO A;  4XK4 A;  3M07 A;  3N05 A;  5C3E J;  2ECC A;  2IA0 A;  4GGG A;  1ZGJ A;  3I3L A;  5EGO B;  2EFO A;  2VOP A;  1JGG A;  2BW3 A;  1Y0U A;  2H09 A;  2WBM A;  2A5W A;  1NK2 P;  2WGB A;  2EV5 A;  2QKL B;  1GUU A;  4KUM A;  5K5R A;  2WAQ A;  2Y30 A;  3K1N A;  2PZ9 A;  4JOM A;  4U9L A;  3G73 A;  3RTR A;  3OV8 A;  2RVC A;  3KP6 A;  2DA1 A;  2A6T A;  5KAI C;  3RPQ A;  3VYS B;  2KIM A;  4G6D A;  4PJ0 C;  4BDZ A;  4ENN A;  1X19 A;  2HEO A;  5BS6 A;  5LRR A;  3JRE A;  4HV6 A;  1BOB A;  2EWN A;  2FJ1 A;  1APL C;  4QPO A;  2A68 F;  2XAF A;  2YX4 A;  3BG6 A;  2HVS A;  1VZ0 A;  2MG4 A;  3BJA A;  5J6X A;  3PNV A;  2DAO A;  2E35 A;  2K3F A;  3E3V A;  3S1N J;  2QM3 A;  4MHG A;  4O6J A;  2F4I A;  2ETH A;  3C2G A;  4LLL A;  4RS8 A;  1EV7 A;  2E19 A;  1VQ5 I;  4BE1 A;  3TOB A;  4KN4 X;  1RKW A;  2R7X A;  4RMN A;  1I3A A;  3MKZ A;  1IC8 A;  1SD7 A;  2F5E A;  5B3S H;  2RC4 A;  3NRV A;  2HGC A;  2FOK A;  1N25 A;  2KIS A;  2V79 A;  3EUH A;  2EB7 A;  3PUF A;  4LD5 A;  3RYR A;  2DOF A;  4GFK A;  2EFQ A;  4KIF A;  2CU7 A;  3BR2 A;  2EIM H;  1JT0 A;  4L9V A;  1K78 A;  5FLV A;  3TO7 A;  2I10 A;  3L9F A;  3ZQG A;  4BE0 A;  2BV6 A;  2HDW A;  1FBS A;  5IOY A;  4ZYD A;  2JWT A;  3NNR A;  1UMQ A;  5HDK A;  3HRM A;  2CRG A;  3OY9 A;  3OYH A;  1WGX A;  4KMU X;  2XRL A;  3E97 A;  4F92 B;  3OIP A;  4EM0 B;  1Z6T A;  1MJ9 A;  5F1R A;  2MD0 A;  5GAD J;  3JTH A;  1U6G A;  9ANT A;  2GUH A;  3K4L A;  3ROU A;  3CLQ A;  2HOE A;  3C1D A;  2WA0 A;  4XLH A;  4CYC B;  1J0R A;  2Z33 A;  1OYY A;  1OKR A;  1XD7 A;  2A3S A;  3V7R A;  2L7M P;  5CQE A;  3E6M A;  4LG0 B;  4BXF A;  4YG2 F;  3TGN A;  4BQO A;  3HTH A;  2WB1 A;  3L2V A;  4ZZD A;  3EUH C;  3CJR B;  1EH6 A;  3V8J A;  3H9Q A;  3ANG A;  2BW3 B;  5HBU A;  4CXF A;  2ZME A;  1OCT C;  3A01 A;  2DOA A;  1TWC J;  2GA1 A;  4C3I J;  1IRG A;  2AXL A;  3G7R A;  1OIS A;  4ZJZ A;  5HVQ C;  3IUV A;  1XGM A;  5CXI A;  3ZPL A;  4YIF A;  5GTH C;  2DMT A;  1B4A A;  4OAZ A;  3DPT A;  1YQA A;  3GEU A;  1R71 A;  3P9K A;  3T5X A;  1X2N A;  2HQ5 A;  2CV0 A;  3FXU A;  4M3F A;  4B3A A;  4CUG A;  1ODD A;  1PYV A;  3DTI A;  3JRA A;  2A07 F;  1UHS A;  5ILU A;  4ESB A;  4I02 A;  3VYU B;  3HB9 A;  3V78 A;  4Q47 A;  5E3L A;  4UNO A;  2E2J J;  2BHZ A;  4HX8 A;  5ICC A;  3BR6 A;  1LPQ A;  3WTY C;  1IV8 A;  3CJQ B;  3E7Q A;  2DMP A;  2ZFW A;  4BQN A;  2TDX A;  4A93 J;  3COL A;  1BN5 A;  2B7E A;  4ZYG A;  2W7N A;  2L9N A;  5IYD J;  2YPR A;  4B47 A;  1UCR A;  2FBQ A;  1RUO A;  2A2F X;  4N0B A;  5LHI A;  1QVT A;  1F4K A;  2NS0 A;  2R3S A;  2MFZ A;  3BWG A;  3RKW A;  4G7H F;  2IEK A;  3ABT A;  3AQT A;  4OMZ A;  2BOL A;  3I54 A;  5DCM A;  4BU2 A;  3LQR A;  5AIP A;  4DIQ A;  1K78 B;  3CCJ I;  2DG7 A;  3FHN A;  2LRE A;  5FGM A;  1GT0 C;  2XPV A;  1X4O A;  1V4R A;  4ETS A;  2DI3 A;  4MEY F;  4A3C J;  4QWQ A;  1IN8 A;  1LE8 B;  2DFI A;  2EJR A;  2UXO A;  3JSP A;  3UNG C;  2LOO A;  4ME9 A;  4XID A;  2JVH A;  1Z6R A;  1KZH A;  2NNY A;  2LY1 A;  3SZT A;  3W2W A;  4CCL A;  3GUD A;  2MD5 A;  3FRQ A;  3PM1 A;  2DQL A;  5E18 F;  4XRM A;  3QYF A;  2VE9 A;  5DS9 A;  1OYI A;  3JCU C;  1YIO A;  2E60 A;  4I7H A;  2O0Y A;  2A69 F;  4KIT B;  2PFV A;  4ZDP A;  3VOD A;  1LKX A;  2CQK A;  3LAP A;  3T8R A;  5FLX Z;  2M30 A;  4L5I A;  1KU2 A;  2M5W A;  2OU2 A;  2X4H A;  2ME0 A;  2G0E A;  4BAC A;  3I64 A;  1FSE A;  2DA2 A;  4EMS A;  1V5G A;  5FB2 A;  2YSR A;  2ZCN A;  4BY7 J;  2GLO A;  2M1B A;  3CME I;  2LLK A;  2E5Z A;  3OS1 A;  1ZKG A;  4E7H A;  2E7W A;  3REO A;  4CH7 A;  1R4M B;  3HOW J;  1U8B A;  1BIA A;  3HHG A;  4MIM A;  1JJ6 C;  3FK7 A;  3LFU A;  1FYM A;  4AYB A;  2PMZ N;  4A0X A;  4Y15 A;  3KP3 A;  4BJ6 C;  2DMU A;  3SFZ A;  3BJB A;  2BY3 A;  3M1E A;  4LJZ F;  5D6E A;  2P4W A;  5CVV A;  1HST A;  3BY6 A;  4EJO A;  1Z0X A;  4ANJ A;  3R4K A;  2IP2 A;  2G7S A;  2CH0 A;  3CDL A;  1Z77 A;  2NVY J;  1WPK A;  4AD9 A;  4V2F A;  3CCQ I;  3F23 A;  1IRX A;  1M1E B;  2DQR A;  2H6C A;  1FBQ A;  3EYI A;  1UST A;  3VW1 A;  2HYJ A;  5LRS A;  3ZN1 A;  2QF7 A;  5DM7 F;  4A3B J;  2CG4 A;  3VB2 A;  3IHU A;  1ETV A;  3GME A;  4LG3 A;  2FNA A;  3ZMS A;  3MKW B;  3F8M A;  1ZH5 A;  3AFH A;  3ESW B;  3CMA I;  3S3O A;  3FIS A;  5CJ9 A;  1SMY F;  2O7O A;  3MAJ A;  4Y7N J;  5K5Q A;  4UVC A;  4EJW A;  1R1V A;  4CA0 A;  3KCC A;  4B8X A;  5E8G A;  2DA3 A;  3RSN A;  3BCG A;  2LKX A;  3BCB A;  1TQM A;  5E3N A;  1U0J A;  3BR1 A;  3S2H J;  2AXT C;  1Y0N A;  3E7L A;  2OJE D;  1Y39 A;  4F55 A;  2EPF A;  4WXD A;  1PUE E;  4G94 A;  2VPL A;  3RJP A;  3SWH A;  2I5U A;  1VQ6 I;  2KIF A;  1NG7 A;  2ESN A;  1FY7 A;  1KQ0 A;  3QOP A;  3S1Q J;  4OD4 A;  4KA4 A;  3VIB A;  1HW5 A;  1I39 A;  4M73 A;  2PEX A;  2PMH A;  4N9I A;  2XDV A;  1VQL I;  1YW9 A;  2FU4 A;  2EA4 A;  1PUF A;  2KRC A;  3S3M A;  2XKO A;  2R5Z A;  3RZD J;  3A2K A;  1X1A A;  5LBQ A;  1OLT A;  1JTX A;  2L3D A;  2MBF A;  1HLV A;  1Y8R B;  2BY0 A;  2F6C A;  2Y0S A;  2F4M B;  2XAG A;  4XNF A;  1O3R A;  5JVG F;  3CCV I;  2DJI A;  4XLN F;  1RC9 A;  4ENK A;  3OSF A;  3KFW X;  3MKY B;  2XAQ A;  2O9L A;  2RAS A;  3F8C A;  2FOW A;  2R7S A;  2HVQ A;  1FLI A;  2O5R A;  2ZJP F;  1VQ7 I;  4BNC A;  3LA7 A;  2GIZ A;  3CDI A;  1HDD C;  4R8H A;  3HL2 A;  5KAF C;  1ZG1 A;  1QU3 A;  4EJV A;  1WWX A;  3ON2 A;  1SMT A;  1BC8 C;  4YFK F;  1R22 A;  4RDU A;  5CYV A;  1MSF C;  2WC2 A;  4D5F A;  1CGP A;  4GCT A;  1D3Y A;  3FMS A;  2F48 A;  3E5U A;  3IRR A;  1PDN C;  2HPM A;  2FJI 1;  2C6Y A;  4DVY P;  5H6R A;  1FYL A;  3H9G A;  3V7C A;  2UWM A;  1HQC A;  1KA8 A;  2QQ9 A;  4MTE A;  2CW7 A;  2F5F A;  3LJL A;  1B59 A;  4ABZ A;  3SZP A;  2COM A;  3RH2 A;  1FP2 A;  1HKQ A;  4AU7 A;  2OCC H;  5HDN A;  3WU1 B;  2B1E A;  4QIW N;  4M3E A;  4EJU A;  1P4W A;  5F1J A;  1L3L A;  2GXB A;  2K9Q A;  2QWW A;  2ZCM A;  2PBX A;  3RPU A;  1TW3 A;  2HTS A;  3TW6 A;  3DCF A;  4IHT A;  4UUS A;  4U0Y A;  4HRI A;  1YIJ I;  3J7A Y;  1G59 A;  5GP9 A;  1XMX A;  2KIQ A;  1HW2 A;  3UR3 C;  3JRD A;  1IJW C;  2XRN A;  3FXJ A;  3CZ6 A;  3MN2 A;  2X1D A;  1JHF A;  4XN0 A;  4XBF A;  2V26 A;  4D7N A;  3EPZ A;  3VWB A;  1TW2 A;  3ZMD A;  1T0F A;  4L18 B;  2G7U A;  4Y3O A;  4B48 A;  3JRI A;  2JA6 J;  4V2G A;  1B9M A;  3FX3 A;  1F9N A;  3MWM A;  1O57 A;  3U9G A;  2Y48 A;  4IPA A;  5BQT A;  4Y52 J;  2V9V A;  1PP8 F;  1R1U A;  5JLX A;  1ZRD A;  5E3O A;  3QWL A;  3W2A A;  2KPM A;  4OIR F;  2DYR H;  4M6Y A;  5CVI A;  4QPQ A;  3S1M J;  1IXR C;  2PQ8 A;  2IPQ X;  1ETY A;  4P9U A;  2QUF A;  4UXN A;  2VB6 A;  2M9H A;  5HAW A;  3OOP A;  3DQV C;  1T95 A;  3OS2 A;  3KEY A;  2DG8 A;  3D5R C;  1RES A;  4HPQ A;  4A3L J;  1I5Z A;  1HF0 A;  2X0L A;  3H3U A;  3LFK A;  1W0T A;  4MQV A;  1FPQ A;  1Z91 A;  1P4A A;  3G1O A;  3S2W A;  3OS0 A;  3BHQ A;  3PO2 J;  5FGL A;  4C30 A;  2FE3 A;  2OA4 A;  4EM2 A;  1SVM A;  4P5O A;  2MW8 A;  5FKL A;  1UHW A;  4OIN F;  1GDT A;  1V5F A;  1AU7 A;  4BL0 B;  3GTG J;  4JK1 X;  3AQS A;  1VI0 A;  1YJ9 I;  3LQQ A;  4ASN A;  3FKI J;  5CXG A;  2Z5U A;  4DYR A;  2O3F A;  2W24 A;  4M6V A;  4XQF A;  5GPA A;  2FRH A;  3GTK J;  3A0B C;  3ABK H;  5D5W B;  1YRN A;  1P2F A;  2ZFU A;  3ZRG A;  2LKS A;  5LGT A;  3DV8 A;  1R1T A;  2HPI A;  3QU3 A;  2VBY A;  4K2E A;  3D5L A;  4IQJ A;  5IT3 A;  1ETQ A;  2JUG A;  2DCE A;  3NEU A;  3JSJ A;  1ZLK A;  4I2O A;  4C9Y A;  2KZG A;  4AIK A;  5L3E A;  2XDN A;  2VN2 A;  2VXD A;  3CJD A;  4JX4 A;  2VOO A;  2K4B A;  4HQE A;  3HKZ A;  5LHG A;  2DMQ A;  4HV5 A;  3DEW A;  1YX3 A;  1SVO A;  3OYI A;  2EZL A;  2ISY A;  1WSU A;  5FLX K;  3TW7 A;  2ZCX A;  1S72 I;  2RDP A;  4KYW A;  1KU9 A;  3GYH X;  5LD2 C;  1UJ8 A;  4Y33 A;  2CV1 A;  2XAS A;  4LIT A;  2KP6 A;  2QQA A;  1JKO C;  1PVE A;  3DBL B;  4CCM A;  1G6N A;  4XRS G;  3ZQL A;  2X6Y A;  2EFP A;  3DFG A;  2VLA A;  2DA4 A;  2EV6 A;  2P6T A;  1NTC A;  4CSW A;  3L2R A;  1T38 A;  3TL4 X;  3FF5 A;  2CJJ A;  4Y4R A;  4PUS A;  1ZR4 A;  3GFM A;  1TWF J;  3FXQ A;  4MFE A;  1FOY A;  5EEA A;  3MFK A;  2LBF A;  1JKR C;  4IHS A;  5GAH J;  3ML6 A;  1Z1D A;  2DN0 A;  3Q3S A;  2NS8 A;  2CFX A;  4M3B A;  3T0Y A;  3B6A A;  3E1S A;  1A6Q A;  2XGX A;  1P92 A;  4M72 A;  5E20 A;  2FXA A;  2KJC A;  3N97 A;  1T08 B;  5D6F A;  2XF5 A;  4UUT A;  3TO9 A;  2JA7 J;  3KP4 A;  3VYT B;  2MLK A;  1L0O C;  4I0A A;  3IWF A;  2IS1 A;  1UB9 A;  1K4S A;  3PFI A;  3WTZ A;  3BTC A;  5HSZ A;  4DGW B;  1H8A C;  4GCK A;  3BTI A;  1TWH J;  1E3O C;  2UZK A;  3NWS A;  2R5Y A;  2XSD C;  1HW1 A;  3OL3 A;  4X0G A;  4U7D A;  4ZDO A;  1MW7 A;  2ID6 A;  2QSF X;  4U88 A;  3F72 A;  4AIJ A;  1FOX A;  2QGU A;  3DTE A;  4C3J J;  1S7E A;  2MC4 A;  3HRS A;  3VSL A;  3I59 A;  3HSR A;  1Z9C A;  1J75 A;  2M3A A;  3LAJ A;  1BBY A;  2F5V A;  2Q2E A;  3ABM H;  1LFB A;  2ZXI A;  5M5X J;  4FHT A;  3LSR A;  3NAR A;  4XOT A;  5F0C A;  4ZYE A;  1ULY A;  3BRO A;  3E5X A;  3S1R J;  2BXY A;  4RAY A;  2OPT A;  1UEL B;  1Z7L A;  4WXH A;  3I0T A;  4YFN F;  2JRM A;  4IEJ A;  1S5L C;  3VOK A;  2LG4 A;  1HKT A;  2Q24 A;  3NRG A;  1P7J A;  4DBQ A;  3HE0 A;  2FEZ A;  1BW6 A;  2ZJQ F;  3S32 A;  1MH4 A;  2QQ8 A;  2F5C A;  2VC0 A;  1U3E M;  5KHD A;  2ZB9 A;  2L9R A;  3ZQC A;  3ABU A;  4GYG A;  2KKO A;  2M7B A;  1BR1 A;  4E7I A;  3HHH A;  1YIT I;  1D1C A;  2DTZ A;  2NNN A;  3HUG A;  3S2D J;  3C3W A;  3J7A O;  3TDZ C;  3HOY J;  1A36 A;  3CO7 C;  5JR3 A;  1K4T A;  1ZN2 A;  1OCP A;  2XVC A;  1IUF A;  1G8X A;  3BNI A;  3OYK A;  5FRO A;  3IKT A;  1U78 A;  2YVH A;  1YO5 C;  1EA3 A;  4P9F A;  3IH4 A;  1VND A;  2G7G A;  2LBF B;  4E7J A;  4YRV A;  5DDG A;  1XSX A;  4B44 A;  2H8W A;  5GAG J;  3KYL A;  5H9T A;  4EQQ A;  3MD2 A;  1QA6 A;  4KT6 A;  3L2Q A;  1UAA A;  1SAX A;  1LDJ A;  3M1C A;  1JE8 A;  3I53 A;  2P7C B;  2WY8 Q;  2GWR A;  3VW0 A;  4M9X A;  2BY2 A;  1P6R A;  4BXX J;  3F8N A;  4D5C A;  5C4J J;  2MYS A;  4XOP A;  1YI2 I;  2HZD A;  4OWR B;  2XGD A;  1EKE A;  4XL9 A;  2DA5 A;  3OL4 A;  4BBS J;  4D1Q A;  3N4M A;  1N77 A;  2NXN B;  3QPL A;  2LY9 A;  1SFU A;  2K7L A;  5GTI C;  1REP C;  1FIP A;  4I99 C;  5CVR A;  3DF8 A;  3W3C A;  2XSJ C;  3SZG A;  2K9M A;  5D4R A;  3Q9S A;  3EUA A;  5L3F A;  2DA6 A;  1Q1H A;  4XLP F;  2PN6 A;  1E0E A;  2MSY A;  1MBK A;  1E3H A;  2JRT A;  2LC2 A;  2HFH A;  3BTJ A;  3BR3 A;  3DU6 A;  3ZQI A;  3I59 B;  2VUM J;  1ZGA A;  1UFM A;  1RZ4 A;  3F8B A;  2ADU A;  1DP3 A;  5CKT A;  4PGG A;  1BIB A;  2WUI A;  3ASO H;  3GEZ A;  3GFI A;  1ZAO A;  1RKT A;  3MZ8 A;  5F6F A;  3HG9 A;  4PSW A;  3U1D A;  4DBR A;  3HBL A;  4HBL A;  3W6K B;  2RKH A;  3C18 A;  4MQ9 F;  2VXZ A;  1ZGW A;  1IAW A;  2IGM A;  3GFL A;  1FC3 A;  3D1N I;  1YJW I;  1AOY A;  2WV0 A;  2IA2 A;  2JPB A;  4RM2 A;  2CS3 A;  3G6E I;  3SFI A;  1F5T A;  3H92 A;  1BI2 A;  1R23 A;  1XCV A;  2VQL A;  2NX4 A;  1J59 A;  3LL7 A;  3GZ5 A;  4S0H B;  4X1E A;  3S16 J;  4NC6 A;  4H0E A;  4ACI A;  1R6R A;  4NNJ A;  4HLY A;  3ULQ B;  2B63 J;  2E1C A;  2PFB A;  5D8L B;  4MTD A;  1ZRE A;  1XPX A;  2CV2 A;  4L5E A;  3CQZ J;  4HW0 A;  4RAZ A;  4Y17 A;  1ONV A;  1T6S A;  2MGQ A;  4MXM A;  2CQN A;  5J4Y A;  2JA8 J;  1SD5 A;  2ESH A;  3ELK A;  3K9T A;  3BP8 A;  3HIF A;  4IRH A;  4BGD A;  3BZC A;  1TWA J;  4AID A;  5EG0 B;  5F08 A;  3BLY A;  3FZV A;  4KWA A;  4NC7 A;  1TBX A;  1V54 H;  2VJI A;  4UV9 A;  2LP0 A;  4A69 C;  2V6E A;  2PMZ A;  4KIS A;  2QWT A;  1WJA A;  1S7A A;  2GOX B;  3L09 A;  3OMY A;  2XAJ A;  4A3K J;  3LSH A;  4BJT A;  1I50 J;  1DGR M;  3KP5 A;  3M9A A;  4LK1 F;  2CUE A;  3RCO A;  2DPU A;  3VW2 A;  1IN6 A;  1ZAR A;  1XGN A;  1QRY A;  2K9L A;  5F0H A;  5FRM A;  3BPV A;  3QPH A;  5FKK A;  5FLM J;  2E2H J;  4A5M A;  2XUB A;  1G2H A;  3BT9 A;  4OIO F;  2OTJ I;  2DFE A;  3LNQ A;  1D8K A;  3HPH A;  2LF7 A;  3TMO A;  2ICW G;  4FX4 A;  2DDA A;  5DUK A;  3E6D A;  4LLN A;  1EH8 A;  1JHH A;  4HYE A;  3K10 A;  4HST A;  4HZF A;  1Q1V A;  3D0S A;  4GRI A;  1ENH A;  4ENM A;  1XG1 A;  2D1H A;  1GV2 A;  4KFC A;  5M5Y J;  3IP4 B;  3ZN0 A;  1XSD A;  5L3C A;  4NC8 A;  4BDY A;  3R0A A;  2ZC2 A;  2QA4 I;  1IN4 A;  4ZYA A;  2E2I J;  1W7P A;  2BY1 A;  1LDK B;  3LHQ A;  3O8H A;  3WG9 A;  3DKW A;  2D5V A;  1IRZ A;  2ID3 A;  4D7M A;  3NPI A;  1FOK A;  4O5V A;  3Q0U A;  3S3N A;  3G1M A;  3J80 Z;  3H5A A;  5HLH A;  1IDY A;  3JW4 A;  4IKF A;  2L5Q A;  3VPR A;  2YU3 A;  2Y0M A;  3KZI C;  3R6S A;  3M7G A;  2ZME C;  1MKM A;  1TQI A;  2CUJ A;  2HR3 A;  2X6X A;  4M3G A;  5C4X J;  1HKS A;  3OSG A;  3B6C A;  2DJN A;  4FX0 A;  3K4J A;  5E3M A;  4LIU A;  4BYY A;  3PFY A;  1FZP B;  1G3W A;  4IRI A;  4U87 A;  1QZE A;  4JX5 A;  4LOC A;  2B0L A;  4HNU A;  3P9T A;  1FTZ A;  4NQW A;  3VSK A;  1RR7 A;  4J19 A;  2VPR A;  3K6G A;  3ZQH A;  3BG5 A;  2GIV A;  2HXO A;  2K3P A;  3EGQ A;  4N4O B;  4DZJ A;  4ZC3 A;  1P9Q C;  3CF2 A;  3BQY A;  3WE3 A;  3LST A;  5TRD A;  2VKV A;  5D1R A;  2FBH A;  4BUP A;  1IGN A;  1IUY A;  3CUO A;  2IS4 A;  1ORK A;  3GTP J;  4A2U A;  2O03 A;  3NAU A;  2RNG A;  3K1P A;  2ZO4 A;  2EIL H;  4RAF A;  4FE7 A;  5LLQ A;  5ED4 A;  2Q0O A;  2R7R A;  2L4M A;  2IAI A;  2OQG A;  4P96 A;  1SAN A;  3EET A;  2O8K A;  3B81 A;  3P5J A;  5L3G A;  2KIU A;  3L00 A;  3BJO A;  4XSX F;  2A6E F;  2JA2 A;  1S7O A;  3H0D A;  3CC2 I;  2FSW A;  3SJM A;  4F93 B;  5K1Y A;  2V1X A;  3FBN B;  2VC1 A;  2ZME B;  5F04 A;  1JUM A;  3A01 B;  1F43 A;  4DW6 A;  2PX9 A;  1T98 A;  4II3 A;  3WGG A;  5HS8 A;  2QZ8 A;  1MMD A;  2ZXJ A;  2L9V A;  3Q0W A;  2HYF A;  1HCR A;  3PJR A;  2R7Q A;  4BAY A;  2HKO A;  3OIO A;  1HC8 A;  1HA8 A;  2GZW A;  1SEU A;  2P0W A;  2WV1 A;  3HEF A;  2NVQ J;  3K70 C;  2QIB A;  2CMP A;  2ZY9 A;  3VVY A;  4DYC A;  2EIJ H;  1J7K A;  1X3Z B;  2FX0 A;  1Y56 A;  3MMY B;  5B5E C;  3WTT C;  1XMA A;  1I6H J;  3MNL A;  2WTE A;  1ZYR F;  1OR7 A;  1YE9 A;  5JHU A;  5IT9 Z;  1W5T A;  2OCE A;  2QQB A;  2BZT A;  1FBU A;  3BTL A;  3TED A;  5BPD A;  1XMK A;  3CC4 I;  5JHF A;  1V5E A;  2TCT A;  2K4J A;  3SDB A;  6PAX A;  3F8F A;  3KPH A;  1ERD A;  2EV0 A;  3VOX A;  4NQW B;  4ZTJ A;  5DCM B;  4MEX F;  1XB4 A;  3H35 A;  3IL2 A;  4GCL A;  3CO6 C;  1TQP A;  5KNL A;  3VVZ A;  2G7H A;  3DKY A;  3GWZ A;  3OYA A;  2DDB A;  4UVB A;  2X1E A;  1MJA A;  1FP1 D;  2ZCW A;  2FA5 A;  3R60 A;  4N9H A;  4XRF A;  4A3D J;  2Y69 H;  3OYE A;  4A6D A;  4DQ2 A;  5FFZ A;  5KK1 A;  3QBM A;  3G4S I;  4NEL A;  4XLE A;  2CW8 A;  3KZY A;  2EZK A;  2M0M A;  2Z2S B;  3HTU A;  1O7L A;  3QOD A;  4HOB A;  4LLG F;  5DCF A;  2H94 A;  2J5O A;  1BL0 A;  1E3P A;  5CLS A;  4D9J A;  3ASN H;  3HJE A;  5FRN A;  4RGU A;  3AL0 C;  1UI5 A;  2KT0 A;  4L9J A;  5D4S A;  2FNP A;  2XF7 A;  2DU9 A;  3LSP A;  2OC6 A;  3HTI A;  2L7F P;  4UY8 I;  4BS9 A;  3QYB A;  1YG2 A;  2NOJ B;  2M2E A;  3LA3 A;  3WHB A;  5E1X A;  3ZP5 A;  1B1B A;  1AKH A;  5TGT A;  2XC7 A;  4AWX B;  4KDP A;  3ZCO A;  4CIC A;  5HLT A;  3VFZ A;  2MC3 A;  4MNU A;  3BC8 A;  3WU0 A;  4EGZ A;  3TBI A;  1YW7 A;  2CW0 F;  1BC7 C;  5HNF A;  4L9T A;  4LK0 F;  1K79 A;  3LWF A;  1O3S A;  2VQG A;  2LNB A; 
#chains in the Genus database with same CATH homology
 2NVX J;  3JSJ A;  3M3Y J;  1HOM A;  2XDN A;  4C2M J;  3CJD A;  4JX4 A;  3HOX J;  3I4N J;  4A3M J;  2RHA A;  3G56 A;  4YZE A;  4A3J J;  2DMQ A;  2G7L A;  4RBO A;  2HOA A;  3KZ9 A;  1NK3 P;  4QSH A;  3S14 J;  3DEW A;  5HOD A;  4CYC A;  3HOV J;  5C4Y A;  2EZL A;  4FIS A;  2REK A;  3TW7 A;  1B8I B;  1B72 B;  2QOP A;  3ZQF A;  1MBE A;  4XK4 A;  3JR9 A;  2ZCX A;  5C3E J;  2ECC A;  2OF7 A;  4MLO A;  5EGO B;  1MNM C;  3JRB A;  1JGG A;  4NDL A;  1JKO C;  1NK2 P;  4G12 A;  4A3F J;  2WGB A;  1GUU A;  2ME6 A;  4XRS G;  1JTY A;  3ZQL A;  2Y30 A;  2PZ9 A;  2WAQ N;  3W6V A;  2DA4 A;  4A3G J;  3ANP A;  2DA1 A;  1NTC A;  2GEN A;  2M0C A;  2CJJ A;  3JRE A;  1Y1W J;  1ZR4 A;  2FJ1 A;  1TWF J;  1APL C;  2HXI A;  4MFD A;  3ON4 A;  4MFE A;  3T6N A;  4AC0 A;  5EEA A;  1JKR C;  3F1B A;  2MG4 A;  2JMW A;  2DN0 A;  3S1N J;  2XGC A;  3Q3S A;  2NS8 A;  1GV5 A;  4M3B A;  3JRC A;  5DAJ A;  2QKO A;  5IOZ A;  3B6A A;  1WH5 A;  2FQ4 A;  2E19 A;  2JJ7 A;  2Y9Z A;  4AUX A;  5J1R A;  1W0U A;  1OJL A;  2LD5 A;  2CQQ A;  4UUT A;  2JA7 J;  1RKW A;  2AHQ A;  1ETX A;  3HGG A;  1IC8 A;  5F27 A;  1ETK A;  2D6Y A;  3VUQ A;  3QQA A;  1JKQ C;  1AKH B;  2LFB A;  1Y1V J;  3BTC A;  5HSZ A;  1H8A C;  4GFK A;  4GCK A;  3BTI A;  2HYT A;  1TWH J;  2CU7 A;  3BR2 A;  1E3O C;  1JT0 A;  4MK6 A;  1T56 A;  2R5Y A;  2XSD C;  5FLV A;  3CRJ A;  3ZQG A;  2I10 A;  5EZG A;  2ID6 A;  4W1U A;  5IOY A;  1PUF B;  5D19 A;  2HKU A;  2JWT A;  2R5Z B;  3NNR A;  1UMQ A;  1ZTR A;  3G1L A;  2CRG A;  1JKP C;  1WGX A;  1S7E A;  2XRL A;  4C3J J;  2IU5 A;  1BA5 A;  3NXC A;  1MBH A;  4IHY A;  1LFB A;  5M5X J;  9ANT A;  2GUH A;  3LSR A;  2F07 A;  1JJ8 C;  3HTA A;  3NAR A;  5F0C A;  4HKU A;  2K9N A;  3UKG A;  3S1R J;  4CYC B;  1GVD A;  2OPT A;  4MO7 A;  3HOZ J;  1IV6 A;  4IEJ A;  2L7M P;  3VOK A;  2Q24 A;  3NRG A;  1P7J A;  5M5W J;  3HTH A;  1WI3 A;  3S15 J;  3HE0 A;  1BW6 A;  2R7Z J;  1MH4 A;  1BW5 A;  3GTJ J;  2WB1 N;  3ANG A;  2ZB9 A;  5HBU A;  2L9R A;  1UI6 A;  3ZQC A;  3GBG A;  1OCT C;  4JKZ A;  5FKM A;  3A01 A;  5K58 A;  1TWC J;  4C3I J;  2NVT J;  3G7R A;  3IH3 A;  2DTZ A;  5EDN A;  3IUV A;  5CXI A;  3S2D J;  2DMT A;  3Q0V A;  3HOY J;  3GEU A;  3S17 J;  4C3H J;  1OCP A;  1X2N A;  1IUF A;  2HQ5 A;  3BNI A;  2YVH A;  1U78 A;  4M3F A;  1ZR2 A;  2R93 J;  3HIM A;  2L0K A;  3IH4 A;  4B3A A;  3A03 A;  2R0Q C;  3C2B A;  1VND A;  3JRA A;  2Y2Z A;  2G7G A;  1UHS A;  3H3V K;  5F0F A;  5H9T A;  3HB9 A;  3V78 A;  1VFC A;  5E3L A;  1FJL A;  2VKE A;  2E2J J;  2NP3 A;  2OI8 A;  3BR6 A;  3RQI A;  4UDS A;  2LTP A;  3VW0 A;  4UUS B;  2DMP A;  4BXX J;  3HDD A;  3E7Q A;  4D5C A;  5FHP A;  4BBR J;  5C4J J;  4A93 J;  3COL A;  5IYD J;  2FBQ A;  2XGD A;  2DA5 A;  2HI3 A;  3LSG A;  1QVT A;  2EQR A;  4BBS J;  2IEK A;  3AQT A;  5IYB J;  3QPL A;  2LY9 A;  2CUF A;  1DU0 A;  3I4M J;  4XRS A;  1ETO A;  5EF6 A;  1FIP A;  5JLW A;  1LFU P;  2DG7 A;  2DA6 A;  2NOG A;  1QPI A;  1GT0 C;  5EZH A;  1XC5 A;  2MSY A;  1MBK A;  2XPV A;  4I6Z A;  2NP5 A;  2W53 A;  4JNN A;  3BTJ A;  4A3C J;  2Y31 A;  3BR3 A;  3ZQI A;  5IP6 A;  2EBI A;  1JUP A;  1LE8 B;  2VUM J;  2UXO A;  1IG7 A;  2R92 J;  4ME9 A;  4XID A;  2WUI A;  1P7I A;  1UG2 A;  3PAS A;  4CGR A;  1RKT A;  1ETW A;  3NI7 A;  3HBL A;  3FRQ A;  1ZGW A;  3HTJ A;  1U9N A;  1I3Q J;  2LR8 A;  3PM1 A;  3GZI A;  1RPW A;  3D1N I;  4XRM A;  1IDZ A;  5DS9 A;  4XIC A;  2M34 A;  3SFI A;  2YVE A;  4PXI A;  3C07 A;  2NX4 A;  4S0H B;  3S16 J;  4X1E A;  1ITY A;  4ACI A;  3CMY A;  4A3E J;  2B63 J;  2YUS A;  1VF9 A;  1T33 A;  3FIW A;  1SGM A;  4L5E A;  1AHD P;  2G3B A;  3CQZ J;  3S5R A;  3KNW A;  3VP5 A;  2MGQ A;  1YRN B;  2ME0 A;  1F36 A;  2CQX A;  2G0E A;  2K9S A;  4X6A J;  4MXM A;  2JA8 J;  1FIA A;  2DA2 A;  3O8G A;  2ZCN A;  4BY7 J;  2GLO A;  4ICH A;  1ZK8 A;  2LLK A;  1JUS A;  3QPS A;  1TWA J;  1ZKG A;  5EG0 B;  5F08 A;  3O60 A;  4KWA A;  1A5J A;  3HOW J;  5DTD A;  1U8B A;  1MSE C;  3A02 A;  3IV5 A;  3JRF A;  4IHV A;  2LP0 A;  4A69 C;  2XB0 X;  3K2A A;  1MH3 A;  4MIM A;  1JJ6 C;  2QWT A;  3V6G A;  3FK7 A;  3MVP A;  2PMZ N;  5FJ8 J;  4A3K J;  3H0G J;  4AYB N;  1I50 J;  2H1K A;  2DMU A;  3BJB A;  2RAE A;  4GFB A;  2K40 A;  1B72 A;  4BKX A;  2CUE A;  3VW2 A;  5EGO A;  2UXI A;  1QRY A;  5F0H A;  1Z0X A;  2HOS A;  2QCO A;  5FKK A;  5FLM J;  2E2H J;  1MBF A;  5IPA A;  2G7S A;  2UXH A;  3CDL A;  1WCM J;  1Z77 A;  2NVY J;  2KDZ A;  1G2H A;  1WPK A;  3LOC A;  3KKD A;  2HOT A;  3BT9 A;  2W48 A;  4V2F A;  3LNQ A;  5D18 A;  5EFY A;  5J1U A;  2O7T A;  3VW1 A;  2HYJ A;  1Q1V A;  2QF7 A;  4A3B J;  1K83 J;  1ENH A;  1ETV A;  3BRU A;  1XG1 A;  2TRT A;  3RD3 A;  1X58 A;  1GV2 A;  5M5Y J;  1XS9 A;  2DMN A;  3L1P A;  2E2I J;  3FIS A;  4HNV A;  2ZOY A;  2O7O A;  3LHQ A;  3PO3 J;  4Y7N J;  3O8H A;  4DZP A;  2YS9 A;  2X9D A;  3GTO J;  2OER A;  2D5V A;  1IRZ A;  2ID3 A;  4D7M A;  3F0C A;  3NPI A;  3Q0U A;  4BY1 J;  2DA3 A;  3G1M A;  3BCG A;  2LKX A;  2JN6 A;  3EUP A;  1IDY A;  5E3N A;  3BR1 A;  3JRH A;  3VPR A;  3S2H J;  1OFC X;  2EZI A;  3GTL J;  3E7L A;  2XGE A;  2JA5 J;  1FTT A;  4JL3 A;  2V57 A;  4M3G A;  5FKO A;  1QVU A;  3S1Q J;  5C4X J;  2ECB A;  3OSG A;  3HOU J;  3B6C A;  3VIB A;  2DJN A;  5E3M A;  3GTM J;  3IH2 A;  4JX5 A;  4LOC A;  1PUF A;  3P9T A;  1RET A;  1FTZ A;  3VVX A;  1RR7 A;  2R5Z A;  3RZD J;  2R5Y B;  4J19 A;  2VPR A;  2UXP A;  4DYQ A;  3ZQH A;  1HDP A;  3BG5 A;  4JP0 A;  2FD5 A;  3SDG A;  2HXO A;  4L62 A;  3EGQ A;  4DZJ A;  1JTX A;  1HLV A;  2XB5 A;  3BQY A;  5D1R A;  2VKV A;  4JX6 A;  2HDD A;  1IGN A;  5EYR A;  2Y0S N;  2ZOZ A;  3KKC A;  2X6O A;  3HKZ N;  5IYC J;  3OSF A;  2VI6 A;  1ORK A;  3CCY A;  1K61 A;  3GTP J;  2GBY A;  3NAU A;  3TP3 A;  1MBG A;  1H89 C;  4FE7 A;  3BR5 A;  2O9L A;  2RAS A;  2IAI A;  2P81 A;  5K7Z A;  1SAN A;  2O8K A;  1MBJ A;  3B81 A;  3DPJ A;  2NS7 A;  4FE4 A;  3BG9 A;  3QKX A;  3ZOB A;  1HDD C;  2ELK A;  1R9T J;  3FK6 A;  3ON2 A;  4RDU A;  1WH7 A;  1MSF C;  4B4C A;  5C44 J;  3SJM A;  4GFL A;  4D5F A;  1FEX A;  4EEF G;  4GCT A;  5F04 A;  1JUM A;  2GFN A;  3A01 B;  1F43 A;  2JK3 A;  1H88 C;  4A3I J;  4DW6 A;  2L7Z A;  3HM5 A;  5FMP A;  4B1R A;  3LJL A;  3Q0W A;  4ABZ A;  1HCR A;  3RH2 A;  5CW8 A;  3OIO A;  4QIW N;  4M3E A;  5F1J A;  2K9Q A;  2WV1 A;  3HEF A;  2NVQ J;  2QIB A;  2ZCM A;  4DYC A;  2PBX A;  4W97 A;  1BJZ A;  2FX0 A;  3JRG A;  4FTH A;  3VVY A;  3TW6 A;  3DCF A;  4UUS A;  3CWR A;  3LWJ A;  1I6H J;  3LSJ A;  3MNL A;  5GP9 A;  1TC3 C;  2LK2 A;  3JRD A;  2AO9 A;  5J1Y A;  3BG3 A;  2XPW A;  1IJW C;  5J3L A;  3GTQ J;  5IP9 J;  2YU9 J;  2QTQ A;  5AQC A;  3MN2 A;  4D7N A;  2M8G X;  2IBD A;  4NN1 A;  2Y9Y A;  1B8I A;  3BTL A;  3TED A;  2X48 A;  1CQT A;  2TCT A;  4IHX A;  3JRI A;  2JA6 J;  4M3D A;  3K7A J;  4V2G A;  1TWG J;  4JYK A;  1A6I A;  2COB A;  3VOX A;  2XPU A;  1POG A;  4Y52 J;  4GCL A;  5M3M J;  5JLX A;  3BR0 A;  1D5Y A;  5E3O A;  4IHW A;  1LE8 A;  3VVZ A;  5IP7 J;  3S1M J;  1O4X A;  1ETY A;  2M9H A;  5HAW A;  2DA7 A;  4QTR A;  5FKN A;  2N8G A;  5GPC A;  2H8R A;  2DG8 A;  4A3D J;  1RES A;  5BNG A;  4A3L J;  1HF0 A;  3QBM A;  1W0T A;  2GM4 A;  4NEL A;  3G1O A;  2EZK A;  1EF4 A;  3BHQ A;  1BL0 A;  5FGL A;  3PO2 J;  4I76 A;  1X2M A;  3OOU A;  2MW8 A;  5FKL A;  1DU6 A;  1GDT A;  2KT0 A;  1UI5 A;  1AU7 A;  3TP0 A;  1JT6 A;  3GTG J;  3AQS A;  3LSP A;  3HTI A;  1VI0 A;  2L7F P;  2LVS A;  3FKI J;  5CXG A;  2EH3 A;  4DYR A;  5K7F A;  2EZH A;  2M2E A;  4M6V A;  3WHB A;  3PPB A;  4AF5 A;  1AKH A;  5GPA A;  3GTK J;  1YRN A;  1ZQ3 P;  1U9O A;  4FCY A;  3MKL A;  3M4O J;  5M3F J;  3RKQ A;  4AC6 A;  1SFO J;  2UXU A;  5EG0 A;  3RZO J;  5K7H A;  3HGY A;  3BQZ A;  3WHC A;  2E1O A;  1ETQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...