3HGYA

Crystal structure of cmer bound to taurocholic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor, drug binding
molecule keywords CmeR
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: crystal structures of CmeR-bile acid complexes
rcsb
total genus 75
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hgyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hgyA02
2PZ9A 3BQYA 4V2GA 5DS9A 2W53A 2YU9J 1JT6A 3S1MJ 1H89C 2OERA 3DCFA 5EZHA 4QSHA 3HTAA 3RH2A 2NP5A 3JREA 1FTTA 2ID6A 2VI6A 3KKDA 1S7EA 2DMPA 2M34A 1RKTA 3JRAA 1JTXA 4GFKA 4JKZA 4QTRA 2UXHA 3LJLA 5CXIA 4GCTA 4JL3A 3HKZN 2R5ZB 3SDGA 5JLWA 3BTJA 4JX5A 2ELKA 1LE8A 2NVQJ 4W97A 1FEXA 3AQTA 5F0CA 4A3EJ 3HIMA 5C44J 3NXCA 2LP0A 2ME6A 2CU7A 5GPAA 3OSGA 4JX6A 5FHPA 5F1JA 3BTIA 3QKXA 4Y7NJ 2EZIA 4JYKA 2IEKA 3LSJA 5IYCJ 2HI3A 1JJ8C 2DG7A 3FK7A 2ZOYA 4GCKA 2DA7A 2HOTA 4J19A 3JRGA 2CUEA 5E3NA 4S0HB 2G7SA 2M0CA 2MG4A 3Q0UA 2DA2A 3ON2A 1LE8B 2K9SA 5C3EJ 3DPJA 2R93J 1VI0A 4RDUA 3JSJA 3S2DJ 2EQRA 4B4CA 3L1PA 4A69C 2O7TA 5H9TA 1X58A 3ZOBA 5J1RA 4MIMA 5M5YJ 3UKGA 2MGQA 3ZQLA 4A3DJ 3KKCA 2WUIA 1I50J 3Q3SA 5HBUA 2ZCMA 1RPWA 5HAWA 2WAQN 4IHVA 2DJNA 2GUHA 3SJMA 4L5EA 2E2HJ 1BL0A 2HDDA 2Y31A 2EZHA 1MH4A 2GLOA 4JNNA 3HTHA 3BG9A 2CUFA 2ZOZA 4DYCA 1SANA 2Y2ZA 3HM5A 2XPUA 4D5CA 4ICHA 2M8GX 3PPBA 2G7GA 1WPKA 4AUXA 2GFNA 4MFDA 1IJWC 1P7JA 1VF9A 3QQAA 3S15J 1JKQC 3E7QA 3ON4A 3FIWA 2LVSA 1WH7A 1UI6A 1JTYA 3RZDJ 3BHQA 1U8BA 3O8HA 3NI7A 4A3JJ 5IP9J 1A5JA 4IHYA 2UXUA 2XGDA 2FJ1A 1TWAJ 3HTIA 3O60A 5FKMA 2X48A 1AHDP 1ENHA 2DA1A 3C2BA 3HGGA 2XPVA 3CDLA 4DYRA 2Y9ZA 3QPSA 5K7HA 2I10A 1IV6A 2PMZN 4A3FJ 3CRJA 3PASA 2IAIA 2QIBA 3CQZJ 4DW6A 5FKKA 3A02A 2K40A 1JUPA 4FE4A 2CQXA 5F08A 3GTKJ 3BJBA 3BCGA 3GZIA 1MBGA 1XC5A 3ZQHA 2LLKA 4EEFG 1X2MA 1F36A 2ECBA 4L62A 1QVTA 4A3IJ 3EGQA 3BG5A 4LOCA 1IDZA 2K9QA 1QVUA 3EUPA 4M3FA 2XPWA 1VFCA 2EZKA 3GTQJ 3VOXA 3HE0A 1NK2P 3KZ9A 3HDDA 4BY7J 2H8RA 5EZGA 4I6ZA 2L7MP 3MKLA 3NPIA 1NK3P 5FKOA 1GV2A 1TC3C 2ME0A 3IUVA 1XG1A 4Y52J 4PXIA 1IUFA 4IEJA 2DA4A 3WHCA 5K7ZA 4DYQA 3S5RA 5EEAA 4NELA 1IC8A 1SFOJ 3HBLA 5FMPA 5E3MA 2OF7A 2JA6J 1APLC 1JGGA 4XRSG 1HCRA 3HOZJ 3CJDA 3HTJA 5M5XJ 1JT0A 2HXIA 3JRCA 4RBOA 5J1UA 1EF4A 2UXOA 1WCMJ 3VW2A 3Q0WA 5K58A 5D19A 1IDYA 3FISA 4KWAA 4BXXJ 1JJ6C 5F0HA 2NVTJ 1WI3A 2VKEA 3JRDA 1JUMA 1UHSA 2OI8A 5EGOA 3BR2A 2KDZA 5K7FA 2XRLA 4A3BJ 5EG0A 2Y0SN 2OPTA 3WHBA 2LD5A 1IGNA 4X6AJ 3VVXA 3GTLJ 2L7FP 4D5FA 1UG2A 2QKOA 1H8AC 2VPRA 4M3BA 3BR5A 1YRNA 2GM4A 1ZQ3P 3HEFA 3HOYJ 1MBEA 5M5WJ 4FTHA 1MBKA 3BT9A 3CCYA 3JRIA 2WV1A 3I4MJ 2XGCA 2L9RA 2V57A 3G1OA 1R9TJ 4QIWN 5HODA 3V6GA 2DN0A 3NARA 1F43A 3F0CA 5EGOB 5IPAA 3BTCA 4NDLA 3HOWJ 5FKNA 4C3JJ 3S1NJ 3ANPA 3A01A 5EG0B 4D7NA 3ZQFA 1IG7A 3PO2J 3O8GA 1VNDA 3FKIJ 4FE7A 4HKUA 3IV5A 5IP6A 1IRZA 1WGXA 3B6AA 2REKA 2WGBA 3VVYA 1DU6A 3S1RJ 1YRNB 1SGMA 3BTLA 1RETA 3M3YJ 3TW6A 3IH4A 5M3FJ 4ABZA 2RASA 5CW8A 5IOYA 1TWCJ 2R92J 3B81A 3TW7A 3HOVJ 2B63J 5DAJA 4B3AA 1ETOA 3QPLA 4M6VA 3LHQA 2YS9A 3LSGA 3GTGJ 4A93J 1T56A 1PUFA 1ETXA 1LFBA 1XS9A 3A01B 1MNMC 2WB1N 2D5VA 3RZOJ 2M9HA 2E2JJ 2DG8A 1ZR4A 3B6CA 2JJ7A 3RKQA 2NVXJ 3BRUA 5J1YA 3E7LA 4CYCA 3G56A 2DA3A 1FIAA 4MFEA 2MSYA 1W0TA 4BBRJ 1U78A 3BQZA 1AU7A 2O9LA 1HLVA 4BY1J 2P81A 5IOZA 3TEDA 3RD3A 2CRGA 3BR3A 2MW8A 2JA5J 2GBYA 3GTOJ 3NAUA 2YUSA 5E3OA 2FBQA 2G3BA 2LKXA 1GDTA 5AQCA 3OOUA 2DMQA 1PUFB 2ZCXA 1ETYA 2G0EA 3H0GJ 4A3GJ 1Q1VA 3HB9A 1ITYA 3W6VA 3S17J 2E2IJ 4YZEA 3LOCA 2N8GA 2XB0X 2NX4A 4A3CJ 3AQSA 1T33A 4AC6A 4XRMA 4CYCB 1ZR2A 5EF6A 1ETVA 4B1RA 3S1QJ 3GEUA 4JX4A 3P9TA 3VIBA 2XB5A 3MN2A 1ZGWA 1ETKA 2X6OA 3SFIA 5HSZA 1QPIA 1B72A 1E3OC 1UMQA 1Z77A 4BKXA 2TRTA 4M3GA 3ZQIA 2JA7J 3GTJJ 9ANTA 2IU5A 2UXIA 4IHXA 5EYRA 2NS8A 3D1NI 1TWGJ 2AO9A 3VOKA 5C4JJ 3HOXJ 5EFYA 4HNVA 1JKRC 2Q24A 1X2NA 1AKHA 2DMUA 3T6NA 3Q0VA 3LSPA 3S16J 2XSDC 5M3MJ 3NNRA 2NP3A 1LFUP 4I76A 1RKWA 3BG3A 1B72B 1D5YA 3QBMA 3IH3A 1UI5A 5C4YA 3H3VK 2ECCA 2DMNA 1K61A 2R5YB 3LSRA 2W48A 3PM1A 1P7IA 2D6YA 1FTZA 1ZKGA 1ZTRA 3RQIA 5GPCA 3GTMJ 1BW5A 5C4XJ 2DA5A 4UDSA 5F0FA 4A3KJ 1B8IA 4UUSB 1AKHB 1U9NA 5JLXA 1RESA 1MBHA 3S14J 4MK6A 1MBFA 4M3DA 3TP0A 2HQ5A 1CQTA 4A3LJ 4JP0A 2EZLA 3FRQA 4XICA 5IP7J 5DTDA 3VVZA 4A3MJ 4FCYA 5F27A 2XDNA 2HOAA 3OIOA 3NRGA 3VUQA 2LY9A 3IH2A 2JA8J 3G7RA 5E3LA 4IHWA 3V78A 2E1OA 2O7OA 1GV5A 5GP9A 3BR6A 1H88C 2H1KA 1G2HA 2FD5A 3TP3A 3K7AJ 3JR9A 3I4NJ 1B8IB 1POGA 2K9NA 3LNQA 3GTPJ 4FISA 2ZB9A 2G7LA 1Z0XA 1JKPC 2HYTA 4XRSA 4XK4A 4C3HJ 2LK2A 1MBJA 2RHAA 3DEWA 5D18A 1GVDA 1I6HJ 3COLA 2R0QC 3G1MA 2JK3A 3K2AA 3ZQCA 2GENA 1OCTC 4MXMA 2XGEA 1ETQA 3JRBA 5FLVA 2JMWA 1MSFC 1BA5A 3BR1A 5FGLA 4GFLA 2HKUA 3VW1A 2Y9YA 1OFCX 2YVHA 2VKVA 2RAEA 2EH3A 1U9OA 5IYDJ 1K83J 4DZPA 1W0UA 1BJZA 2HOSA 1FJLA 3VPRA 3CWRA 1NTCA 5EDNA 2DMTA 4XIDA 2FQ4A 4BBSJ 2X9DA 3JRFA 3G1LA 3MNLA 1MH3A 2CQQA 5FLMJ 1WH5A 4X1EA 4C2MJ 4GCLA 5BNGA 1TWFJ 1FIPA 1I3QJ 1OCPA 2LTPA 1JUSA 1DU0A 2EBIA 4M3EA 2UXPA 2O8KA 3M4OJ 2HYJA 4ME9A 2CJJA 1GT0C 5FJ8J 3BNIA 2PBXA 3ANGA 4CGRA 2F07A 3VP5A 4AC0A 1ORKA 1Y1WJ 1JKOC 4ACIA 2QTQA 2QF7A 3BR0A 2DA6A 2NVYJ 1BW6A 2ZCNA 3F1BA 1QRYA 1HF0A 4NN1A 2JWTA 5D1RA 1O4XA 2QWTA 3S2HJ 1RR7A 3CMYA 2IBDA 3HOUJ 2DTZA 1HOMA 3FK6A 2E19A 1GUUA 3PO3J 4AYBN 3JRHA 5J3LA 2QCOA 4DZJA 2ID3A 2NS7A 2VUMJ 3HGYA 2LR8A 3GBGA 3MVPA 2NOGA 3ZQGA 2YVEA 1TWHJ 1ETWA 1HDDC 1A6IA 2AHQA 5CXGA 3OSFA 4W1UA 2R5YA 1ZK8A 5F04A 4G12A 3KNWA 2FX0A 3LWJA 2L7ZA 4AF5A 1OJLA 4MO7A 4V2FA 4GFBA 1Y1VJ 2TCTA 5IYBJ 4UUSA 2LFBA 2KT0A 1HDPA 2L0KA 2QOPA 2M2EA 2JN6A 2R5ZA 2R7ZJ 2COBA 4UUTA 2HXOA 4C3IJ 3C07A 1MSEC 2Y30A 3VW0A 3A03A 5FKLA 4MLOA 4D7MA
chains in the Genus database with same CATH superfamily
3H3ZA 2L01A 2PZ9A 5BS6A 2Y75A 1X1CA 2YU9J 2XAGA 3DF8A 2W1OA 3HOSA 4A0XA 1B6AA 1OMIA 3RPQA 3TO6A 1XGMA 2IGKA 5EZHA 1G6NA 4QSHA 1T2KA 3HTAA 2LBFA 3SZTA 2ID6A 4JKZA 3DLAA 2M34A 3JRAA 1IUYA 4NHJA 4JL3A 2IP2A 2R5ZB 1QBJA 3S3MA 4RS8A 2FE3A 2K3PA 3BTJA 2VC0A 2KLOA 1HBXG 2D1VA 2EIJH 4W97A 5JI6A 3QP6A 3HIMA 3ZQ7A 3NXCA 1OCOH 3LFUA 3ML6A 3N97A 4XLPF 1OCCH 2FQ3A 4I02A 4PFOA 5F1JA 1YTYA 2W57A 3BY6A 4U0YA 2IEKA 4A5NA 4II3A 2HI3A 4PGHA 3IUOA 2W7NA 5HLGA 3HJEA 4GCKA 2HOTA 2G7HA 3M8EA 4C2TA 3ECOA 2H8WA 1T0FA 5JHFA 5E3NA 3EYYA 4S0HB 2G7SA 2M0CA 2P5KA 3Q0UA 2DA2A 3AG3H 3ZMTA 3ON2A 1LE8B 1X3UA 5ICGA 4KYWA 4RAGA 2R93J 1OYYA 4P55A 5DD4A 2KHMA 4B4CA 3L1PA 2O7TA 1SAXA 3KP3A 3FF5A 2QGUA 2W00A 3ZQLA 5FFZA 4KICA 1V5FA 4A3DJ 2FA5A 4FQGA 2H6CA 1VTNC 4LK1F 1SFEA 1I50J 5HBUA 4ZYEA 2ZJ2A 5HAWA 3A0BC 3MD2A 4IHVA 2K7LA 3FXQA 2OD5A 3GW2A 4Z6YA 3AFHA 2E2HJ 1KQ8A 3UR3C 3WE2A 1SANA 2Y2ZA 3ZP5A 1IZ1A 1XCVA 3W2WA 2K4JA 1VQ6I 3K69A 2FXAA 1WPKA 3BG6A 2GFNA 1ONVA 2DJIA 3JTHA 4MFDA 4IHTA 1P7JA 3S15J 2MLKA 3VTIA 3ON4A 4KUMA 4DIQA 4YIFA 2CS3A 3HRUA 3BHQA 1O7FA 1A5JA 3CCLI 4RB2C 1KU3A 2FJ1A 3O60A 1FC3A 4CICA 2O8XA 1WJAA 4IQJA 2DA1A 3HGGA 2V1DA 3C2BA 2KJCA 2HPIA 4XKWA 2XPVA 3CDLA 3I55I 4H4KC 2OQGA 4A5MA 3CZ6A 4A3FJ 3M1EA 2MC3A 3CDIA 3CQZJ 4PK4A 4HDUA 3RIRA 1JUPA 2QQ9A 4KIBA 5F08A 3TOBA 3GTKJ 3VDXA 2DPUA 3A0HC 1CGPA 3E6DA 4E6KG 1YS7A 1X3WB 1IDZA 3OYGA 1I1GA 4ZYHA 3H36A 1YX3A 2F6CA 3GTQJ 3KYLA 3VOXA 1Y0UA 4HV5A 4EGZA 4XOTA 1KU7A 5EZGA 3OYEA 4I6ZA 2L7MP 3H9GA 2BVLA 4RGXA 5D4RA 2EPFA 3FXMA 4RA2A 4FT8A 3SYTA 3HUGA 3BOQA 2MH2A 4Y52J 1ODDA 4IEJA 5K7ZA 1YO5C 3S5RA 2JA2A 2VBWA 1BBYA 5EEAA 2GA1A 1HXDA 2D45A 2CW0F 3BROA 4RGRA 1VQ4I 4BE2A 3DEEA 3IAS2 5E3MA 5K5RA 1IF1A 2JUGA 2P7CB 2LY2A 4ZYGA 1PVEA 4XRSG 2M8EA 2DQRA 4LGWA 1HCRA 2OTLI 1ZELA 5B3SH 3G6EI 1D8JA 3BLYA 2QKMB 5J1UA 2VOPA 1EF4A 2XAHA 1DUXC 3FXJA 2PLYA 2V9VA 1X4PA 1DQUA 4P5OA 3FISA 4XL9A 3KP5A 2A6TA 2NVTJ 1WI3A 2VIXA 3BR2A 3J81K 3WTVC 4XLNF 4AIHA 4BHCA 3E1SA 4A3BJ 5EG0A 4X6AJ 1QU3A 2W85A 3GTLJ 1EH7A 2XKOA 1UG2A 3HPGA 2QKOA 3WTZA 3LSKA 2RNGA 1IV8A 4M3BA 1I1SA 4BJTA 1ZHFA 3SDBA 4M6XA 3HEFA 5M5WJ 2MBFA 1QHHD 2R7DA 3BT9A 3CCYA 5H6RA 1E3HA 1UJ8A 3MCZA 3GFIA 4UNOA 2V57A 4YELA 4UV9A 4EJWA 5B66C 3C2HA 3H0DA 2HOEA 4KIFA 4CHUA 1H9TA 2CGPA 5E1XA 3NRVA 2HYGD 1B9NA 2I8DA 2RN7A 3H9QA 2YVXA 2VQCA 3IV5A 1Y8RB 3LAPA 5IP6A 2REKA 3B6AA 1XMKA 2XSJC 1T98A 3BTLA 1YOVB 4ENJA 5M3FJ 5HS9A 1ULYA 5CW8A 4IVNA 1TWCJ 5CVUA 3D5RC 3TW7A 1XGOA 2B0LA 2NAZA 2XAJA 2BY3A 3QPLA 4IPAA 4LB6B 4N9IA 2BXYA 2YS9A 3LSGA 5KCMA 4F91B 3LHQA 2ISZA 2X1CA 4HRIA 4HYEA 1T56A 4A93J 2QSHX 3U9GA 1LFBA 1XS9A 3A01B 4B3XA 1MNMC 1G3YA 2WB1N 3S32A 2D5VA 4BHBA 1YYVA 3GLXA 4WF2A 2BY0A 2KIFA 2E1CA 2DG8A 3WU2C 3RKQA 2H6BA 2VKHA 3M8FA 4E7SA 3ZMVA 2PG4A 3VFZA 3DQVC 1U8RA 1VQMI 4XLCA 3BQZA 2LG4A 4F55A 1HLVA 1DPUA 2A68F 3TEDA 3DTIA 5BMZA 2BVMA 3H3UA 2FBQA 2YUSA 2OQRA 5AQCA 2M87A 4YG2F 4K2EA 1SVMA 3RPUD 1A35A 2L9SA 4H0EA 1TZLA 4DVYP 2M4KA 3H0GJ 1R58A 3RKWA 1J59A 3FDYA 2CUJA 3PJRA 4BQAA 4YZEA 4WK8F 1VQ8I 2OC6A 3MKYB 2XB0X 2JPCA 1YJWI 3HTUA 2OCEA 3LWFA 1ZR2A 4AVZA 1U0JA 3J7YJ 3ELKA 2DW4A 4LLGF 1ERDA 5DM7F 3Q5FA 1TQMA 1W7PA 2E1NA 3OMYA 1R23A 2DLLA 2XB5A 3J7AO 3K4LA 1K7AA 1D1CA 3SFIA 2XC7A 2M45A 1MDMA 2PBIA 1KQ9A 1FNNA 2KFDA 1X4OA 4ZDOA 3P7NA 1YW8A 3M07A 3FHNA 1E3OC 1UMQA 3QPTA 4KIGA 2DDBA 3OR2C 5LLQA 1UCRA 3TDZC 2L7KA 4M3GA 4UVBA 3GTJJ 1TW3A 3C2GA 9ANTA 1XMXA 4GXOA 5L3DA 4BJ6C 4E7LA 2IU5A 4IHXA 3D1NI 2NS8A 5ICCA 3VOKA 1N77A 3CCMI 1M1EB 3HOXJ 2M3AA 4HNVA 3QOEA 5EFYA 1UELB 3PNTA 1WKMA 1JKRC 4IF4A 1X2NA 3T6NA 3LSPA 2R7UA 2OZ6A 1B72B 2P0WA 4I76A 3BG3A 3GLLA 1D5YA 3QBMA 4HQEA 3E6BA 4HQMA 1DDNA 3H3VK 1X1DA 2DMNA 2IGOA 4L9NA 2R5YB 5F6FA 4BL0B 2K85A 2D6YA 4E7IA 1FTZA 2GXBA 1ZTRA 3RQIA 3L2CA 4BYYA 5C4XJ 2DA5A 1B4AA 2OBPA 3WE3A 3DKWA 1LKXA 1JGSA 1RESA 2E1MC 2O3FA 2HFHA 3FZVA 3MZHA 3TP0A 4TV7A 2K86A 4C2MA 4JP0A 1VQ9I 4XICA 3FM3A 4HAMA 4CGZA 4G9YA 1K79A 1FZPB 4I2OA 2KRCA 2XDNA 2HOAA 3OIOA 1MJBA 2QBYB 3J81Z 1Z1DA 2ZMEB 3IH2A 3K70C 4LB5A 2DT5A 4G7HF 2K4BA 4YRVA 2K02A 3V78A 4QWQA 1C0WA 1W5TA 1GV5A 2HDWA 5GP9A 3BR6A 2JT1A 1H0MA 4UY8I 3KZIC 1FWZA 5EJCA 2H1KA 2FD5A 1B8IB 1E17A 1BOBA 3W6KB 4F93B 3ULQB 4XRSA 4XK4A 2ESHA 4ZDPA 4E7KA 2RHAA 3DEWA 4IZZA 2IS6A 1HA8A 3CF2A 3ZN1A 3COLA 4BJ5C 1UHMA 3G1MA 4LIVA 2JK3A 2B9SA 1SVLA 1ETQA 3JRBA 2PX9A 2A69F 5FLVA 1MSFC 5FGLA 1SVOA 3VW1A 1H9GA 2MC4A 1OFCX 2YVHA 4PJ0C 4Q47A 1REPC 1B1BA 2RAEA 3VYUB 1O3SA 5IYDJ 1QHGA 5TRDA 4DZPA 3R61A 1BJZA 3ERED 1FJLA 2Y69H 1R00A 2JUCA 3EDPA 4P96A 3RKYA 4FX4A 3V8JA 3I53A 1JE8A 5ICFA 3ERMA 3MMYB 3GZ6A 1HKQA 2MD5A 2VPLA 3SWHA 1D1BA 2F48A 1W5CC 4C2MJ 2GAUA 2HKXA 2X1DA 5BNGA 3VYSB 5L3GA 2JQ7A 2BZTA 1FIPA 2E34A 3FXRA 1O3TA 2V9KA 4IOCF 3OYCA 2KISA 1XMAA 2JRMA 3HSEA 1PJRA 1BI3A 1GT0C 3BNIA 2EIMH 2PBXA 2A6HF 3BWGA 2OZUA 4CGRA 3ZMUA 4B48A 3KP4A 3HYIA 2RDPA 4YFNF 4I7HA 4G7ZF 1FYKA 4JBAA 1K78B 2QTQA 3BR0A 1D1AA 2V6EA 5ICEA 1R36A 2VOOA 1O4XA 3S2HJ 1YW9A 4N0BA 4OMYA 4C9YA 3PUFA 3PO3J 3JRHA 2QCOA 4YIIA 4DZJA 3OS1A 1ZN2A 4KFCA 3GBGA 4KN7X 3ZQGA 1FPQA 1WJEA 1ZG5A 4ZYDA 2WAEA 1A6IA 3K70D 4HSRA 5LD2C 1J75A 3WG9A 1R4NB 1UB9A 3GMEA 1ZRDA 3KNWA 4MTDA 1OYIA 1EA3A 1S29A 3OR1C 3CTAA 3JAMK 2QM3A 2L7ZA 4AF5A 1WJBA 2XV4S 1QZYA 2TCTA 3ZQQA 4UUSA 1T0FC 2E35A 5LGTA 3KZZA 5EEGA 5HNFA 1X19A 4WWCA 4IOAF 1KZHA 5J47A 2VB6A 2L4MA 3TMOA 4ASNA 2R5ZA 3LQRA 4UUTA 4C3IJ 1R1VA 3OYMA 3CMEI 3ABTA 4BUPA 3HSRA 2VJIA 2BE5F 5HOOA 3IRRA 2M4GA 4IL6C 4V2GA 5DS9A 2W53A 1JT6A 3AL0B 1K4SA 1Q1HA 3GZ5A 3DCFA 1BR2A 2XAFA 3P9IA 4LD5A 4O6JA 3JREA 4EM2A 3Q9SA 1JTXA 5E8GA 2PQ8A 1IW7F 5CXIA 2V7FA 3NWTA 1IN5A 2RQPA 5E79C 3LQQA 4JX5A 3CO6C 2ELKA 5HDKA 1LE8A 3DFGA 5F0CA 4A3EJ 4KISA 3AQTA 3BPXA 1P92A 4ZC3A 2LC2A 3OSGA 4XLFA 2FMLA 2KKOA 1MD0A 4I09A 4Y7NJ 2ZFUA 4XRFA 1XD7A 3LSJA 1BJAA 3DPUA 4Y3OA 2VASA 1JJ8C 5CVIA 5IT3A 5KAFC 1YIOA 4J19A 3JRGA 1HQCA 2CUEA 2JSCA 3F6VA 2V26A 2XF7A 3F8NA 5D5WB 1XGSA 4GRIA 2MG4A 3R60A 3C3WA 1HSJA 4OU0A 3DU6A 2XASA 2UXNA 2K9SA 5C3EJ 4E7JA 3DPJA 4NB5A 4RDUA 1TL8A 5FLXK 4A69C 1X58A 3ZOBA 5J1RA 4Q5SF 2XF6A 3TQNA 1JHHA 2Q2EA 4LLNA 3E97A 1ZYRF 3HPHA 2HQNA 3DBLB 5H2FC 4JQFA 3G4SI 3KYCB 3U1DA 5ILUA 2RC4A 4L5EA 3W6JB 4XLAA 1BL0A 1MH4A 4JNNA 3PNVA 3BG9A 1LB2A 1O57A 3HM5A 2HPMA 2XPUA 2M8GX 1R7JA 3J7AY 1V55H 3PPBA 2G7GA 1RI7A 2KIQA 2RQQA 3QQAA 4N4OB 1JKQC 2UXXA 4UXNA 1WH7A 5FGMA 4IX7A 1UI6A 3RZDJ 3O8HA 2LY1A 5IP9J 4IHYA 2VN2A 2XGDA 3I58A 2QQBA 4CUGA 3HTIA 1EV7A 1ENHA 2EFOA 4QPOA 4RLFA 2KP6A 1TQIA 2VXDA 2Y9ZA 2DBBA 3NWSA 4M71A 3E5UA 3MWMA 1W4MA 2PMZN 3D5LA 3CLOA 4RB1A 4P9FA 1LEAA 4OMZA 3CRJA 3FMSA 3I4PA 3AAFA 3UNGC 3CCVI 4Y13A 5FKKA 3A02A 4V19K 2CQXA 3BJBA 3ZQHA 1WFXA 5LBQA 1F36A 4KT5C 2HEOA 3ABUA 1YITI 4L0ZB 2VONA 2EA4A 2O03A 3CD6I 2EB7A 3BG5A 2X1EA 2K9QA 1MKMA 2XPWA 4HDVA 1VFCA 3IRQA 1NK2P 4IXAA 2E71A 3GFLA 3HDDA 4J01A 1FLIA 4BY7J 3VUQA 5FKOA 3W3CA 3IL2A 1LJ9A 4DNCA 5LHGA 1TC3C 2ME0A 2AXLA 5BPDA 3KFWX 3JAMZ 2DOEA 2GOMA 2BBYA 1ON2A 2X4HA 2ZJPF 2E7WA 1SFUA 1SFOJ 1IC8A 3P9KA 1APLC 2ZXJA 3CC2I 1JGGA 4C2UA 3T5XA 2BV6A 3HOZJ 2EJRA 1VZ0A 4UB6C 3HTJA 1JT0A 1SD7A 3IAM2 1ZARA 2G7UA 1I5ZA 1WCMJ 4EGYA 1QZZA 2XGXA 4XLEA 5D19A 1IDYA 3N4MA 5ILVA 2E60A 2W84A 2DYSH 1JJ6C 5F0HA 2XAQA 4NNJA 2VKEA 1UHSA 2KDZA 1VQKI 1DP7P 3WTXC 1KU9A 2UUZA 1D0YA 2DQLA 3HL2A 2LD5A 1IGNA 3VVXA 5GAEJ 2L7FP 1RIOH 1H8AC 2VJJA 5JVGF 1ZLJA 2Z1DA 3MEXA 3AG2H 5KVRA 3K4CA 3FKJA 1ZQ3P 3FWEA 2P8TA 4FTHA 5AIPA 3OV8A 4EMSA 1TLHB 4NQWB 3MKZA 2L9RA 2Q1ZB 4QIWN 3I64A 4J00A 3QP5A 4G7OF 3F0CA 1GLNA 2CFXA 5EGOB 1SEUA 4NDLA 1OR7A 2DI3A 2WC2A 3L2VA 4I01A 1NG7A 3K1PA 3WTSC 4D1QA 3A01A 2COMA 4D7NA 1IG7A 4X0GA 1VNDA 3FKIJ 4FE7A 1R49A 4OIRF 1IRZA 4AU7A 4IRHA 2AQEA 3S1RJ 2HR3A 2IA0A 1SGMA 2PEXA 2HWVA 3BDDA 1D0XA 3HIFA 1MNEA 3IH4A 3I9V2 3WG7H 3ISPA 4I98B 2VQLA 3K1MA 2F4MB 5IOYA 3OIQA 5FLXZ 5DAJA 5LGUA 4FX0A 3CUOA 5CYVA 1K6YA 4B43A 4Y15A 2IRFG 1ETXA 4IKFA 3RYPA 2MH9A 2FMYA 1J09A 2VE8A 2IJLA 3RZOJ 4L9JA 4YFKF 2JJ7A 4XN3A 3BRUA 5J4VA 1A31A 1S8NA 3E7LA 2DA3A 3M1CA 4BBRJ 5FD5A 1RZ4A 2QQAA 5D6EA 2DFHA 4LG0B 1P9QC 4ZZDA 5HDNA 2O9LA 4BY1J 1TNSA 2QQ8A 3LFKA 2K3FA 1YS6A 2JA5J 3GTOJ 5E3OA 2LKXA 4A0ZA 4HG2A 1PUFB 3K9TA 4GCVA 1R6RA 2Y0MA 2G0EA 3HB9A 3W6VA 3S17J 2E2IJ 2KL4A 2NX4A 2X85A 1RNLA 2IS2A 4BQOA 3JSPA 1YI2I 4A3CJ 2V4JC 4AC6A 1BR1A 2DT7B 4EV0A 4ZTFA 3T8RA 1P4XA 1ETVA 5CVRA 1JXSA 2VL8A 4EJOA 2KZGA 3GEUA 3IWZA 4JX4A 3K2ZA 1G4DA 3P9TA 3R6SA 2IPQX 1ETKA 1FY7A 3CJNA 1RR8C 3M9AA 1QPIA 2KPMA 1B72A 1TT0A 2ZXWH 4BHPA 4ENMA 2A07F 2ZKZA 1Z77A 2CYYA 4PUSA 3GF2A 3KIOA 2JA7J 1HC8A 1W5SA 2A05A 2VC1A 4G6TB 3FMQA 3NS4A 3HOTA 2UXIA 1XTAA 1WJ5A 3FXUA 2DDAA 4BXFA 1TWGJ 2AO9A 3MAJA 1USTA 3F3XA 1FX7A 1XSDA 3CJRB 4A0YA 2Q24A 4WIBA 2BW3B 3VOEA 5DCFA 5CVVA 2XSDC 2HQAA 1YFHA 3NNRA 2NP3A 2LF8A 1FBSA 1LFUP 4I99C 2YX4A 1W7PD 1UI5A 5CKTA 4D0PA 2ECCA 4XKBA 2ZMEA 3IKTA 1K61A 2ICWG 4KDPA 2QENA 5J8CA 3CUQB 3AKZA 3ABMH 1WZ2A 1ZKGA 2L02A 5GPCA 5LHIA 2ZY9A 5DCMB 2VLAA 4OIQF 5D8LB 1B8IA 3WGIA 1AKHB 1U9NA 4N4NB 3BJ6A 4M3DA 3FRQA 2EZLA 1IRXA 4HA8A 3FHZA 2KIUA 3QU6A 5AIQA 2R7QA 4NC7A 1N78A 2VBZA 2A6EF 4HX7A 1N75A 3KEQA 2EV6A 2LY9A 3SXYA 1OCZH 5J8FA 1ZAOA 5E3LA 3KP6A 2R7RA 2A5YB 4HW0A 3KYDB 4BNCA 2IS1A 1BR4A 2VT3A 1G2HA 3VSLA 4GGGA 3ZXSA 3I4NJ 2DTRA 4BE0A 3LNQA 1SD6A 4FISA 1JKPC 4I0BA 2HYTA 2QZ8A 5DD8A 4D9JA 4C3HJ 5JR3A 5BOXA 1A6QA 2LK2A 3FXLA 4M72A 4UVAA 3OS0A 2Z3YA 5J4YA 2QVOA 1TTYA 5CJ9A 4RLQA 4E7ZA 4Q48A 4MXMA 2IS4A 2RGVA 2JMWA 4ANJA 3DWLE 1Z05A 1WSUA 2M30A 1JI8A 2DK8A 2CV0A 4F3QA 4HSTA 1U9OA 1U3EM 3BJAA 3JSOA 5KAIC 1Y0NA 2HOSA 4RAYA 3VPRA 4HLXA 3WTWC 5EDNA 2DMTA 2F5CA 1IRFA 3BC8A 1K78A 4IO9F 2X9DA 5KHDA 3S2WA 2MD0A 5KNLA 4X1EA 4GCLA 2A5WA 1K4TA 4WXCA 4HF2A 1OCPA 4XLHA 2LTPA 1RUOA 2EBIA 2VODA 1Z67A 2O8KA 1O7LA 3BPVA 3PFIA 3M4OJ 4ME9A 3EUHA 2CJJA 5FJ8J 3I5UA 3IHUA 1MMAA 4HEA2 3VP5A 3H5RA 3OYHA 1Y1WJ 4LK0F 5J40A 2QF7A 4CCNA 1YLFA 5HDGA 1TNTA 2UZKA 1Y8QB 2C6YA 4ESBA 3KPHA 1MGTA 1R1TA 2BHYA 2QWTA 1RR7A 2M1BA 4RM3A 3K10A 4U0VA 4BQNA 4LG3A 3HOUJ 4A2UA 2EFWA 3ZN0A 3KX2A 5F64A 3QAHA 4AYBN 1WRJA 3CF5F 4DJAA 4A6DA 3HGYA 2LR8A 2FEZA 4MQ9F 2NOGA 1TWHJ 2LDUA 2OUMA 3L7WA 3HRMA 3VODA 4W1UA 4G12A 1YIJI 3H35A 1SFKA 2FBHA 1X1AA 1SFXA 2FX0A 1OJLA 4MO7A 1AA7A 2KT0A 3B02A 2ETHA 3PL8A 4PDKA 2R7SA 2HVSA 2WB1A 2PFBA 2R7FA 3TO7A 3QU3A 2JN6A 4KA4A 1HSTA 2WAFA 4KJZA 3OYLA 2AXTC 3C07A 3G2BA 1MSEC 2ZBKA 1KYWA 3VW0A 4EJUA 4UVCA 5D5XB 3TBIA 5LRSA 5CQGA 3PSFA 5FFXA 3DBRB 4HNTA 1H89C 1G3WA 4XMYA 3RH2A 2NP5A 3IC7A 2VI6A 2VKDA 3KKDA 1S7EA 2RKHA 1VQ5I 2W24A 3OY9A 5LRRA 3RCOA 3HKZN 2E7XA 1ZGAA 3E6MA 3SDGA 2R7TA 2FF4A 1S7OA 4OWRB 1IN8A 1WJFA 2NVQJ 4EM0B 3OYAA 5C44J 2LP0A 1SC7A 2ME6A 5GPAA 4BAYA 4JX6A 1YW7A 4RB3C 5FHPA 1KQ0A 3F22A 3BTIA 4FASD 3QKXA 2XIGA 2I5UA 3MZ8A 2EZIA 3DXJF 4JYKA 3VWBA 2ZFWA 1R5GA 4Y33A 2ZOYA 4DBRA 5HVQC 2DA7A 4BQQA 4XN0A 1MJAA 2OA4A 3E5XA 4RGSA 2QKLB 3GFJA 4RAFA 4R8HA 4PJMA 3V8KA 2CW7A 3BZ6A 2F5EA 2STTA 3ZCOA 2HTJA 1U6GA 3CCRI 3JSJA 1IN7A 3S2DJ 3O6BB 1ZRCA 2MGQA 2DK5A 3PFYA 3G71I 1T08B 3WU1B 3OYDA 2WUIA 2WBMA 3Q3SA 4F7ZA 2NNNA 2FU4A 3IP4B 2EFPA 1U5TB 2DJNA 1BC7C 2GUHA 2FNPA 2HDDA 1Z9CA 4BGDA 4L5IA 4II2A 4DBQA 2VJ4A 2STWA 1IAWA 2CUFA 4DYCA 1V54H 2NOJB 4U9NA 1IJWC 3KLNA 1VF9A 1VQ7I 2LVSA 3Q9VA 4LMYA 2MLGA 1JTYA 5A2QK 1TT5B 4M9ZA 3DPLC 4EM1A 4BDYA 2UXUA 1TWAJ 3QYEA 5FKMA 4G6QA 5E17F 4AIKA 2EV0A 2P4WA 2YPRA 4DYRA 1WJDA 2I10A 1IV6A 2PN6A 2IAIA 5E20A 3LSIA 3OYBA 1FP1D 5K5OA 3ZRGA 2VXZA 4DW6A 3K4MA 3CO7C 4FE4A 4OAYA 2IGNA 4IRVA 3BCGA 1OISA 2LLKA 4EEFG 1X2MA 2W4SA 2ECBA 3A2KA 3DPTA 3DEUA 3E0JB 4XNFA 4A3IJ 2GWRA 2Z33A 1XGNA 2CFOA 3CDHA 3RQ4A 1KGSA 4LOCA 1F5TA 2ADUA 1LDDA 1LDKB 2FJI1 5DV5A 2CQKA 4E4HA 1UG0A 2EZKA 1YJNI 1G8XA 3KZ9A 2ZXIA 2H8RA 4HV6A 1BI1A 4BU2A 2G9WA 1GV2A 1V3FA 4L0YB 3CP8A 2LNBA 5FRNA 1OR7C 2DAOA 2YU3A 4PXIA 1IUFA 2R7VA 3T0YA 2DA4A 2H94A 2DFIA 3WHCA 1J5YA 1WVRA 2XKPA 4ZDLA 4BACA 2EA2A 2K9LA 2V1XA 3CCSI 2OF7A 2DU9A 2NNYA 1YJ9I 5FMPA 2L54A 5ED4A 3FBNB 1GXPA 2DT6A 5GADJ 2QEXI 3CJDA 1X1BA 3L00A 2HXIA 3IKVA 3JRCA 2UXOA 2P7VB 4MEYF 4CXFA 3VW2A 3Q0WA 4NQWA 5K58A 1L0OC 2JSPA 2X6XA 2O6GE 4NBQA 1MZBA 2HQRA 2IXSA 4KWAA 2RNJA 1JUMA 3S93A 2DOFA 5EGOA 2XRLA 2LOOA 5ERIA 1FSEA 4P1WA 4LITA 3SZPA 3ZR8X 2Y0SN 2OPTA 3WHBA 2CO5A 1YHQI 1HW2A 2L5QA 4EJVA 2VPRA 3ASNH 4PJLA 1BIAA 4PGGA 1MBEA 4GO1A 3H9JA 3JRIA 2ZCWA 2WV1A 4EJTA 3G1OA 1R9TJ 5HODA 4LIUA 4OAZA 3J7ZI 4XM3A 3V6GA 3NARA 5GTIC 2WTEA 4U7BA 2ELJA 2F5VA 5FKNA 3ANPA 3S1NJ 2WV0A 3EQLF 3DKXA 3I59B 5CQEA 4XBFA 3O8GA 1E2XA 1X3ZB 3ABLH 4PSWA 3PO2J 3OYKA 2OV7A 1I6XA 1R5ID 1DU6A 1I27A 1YQAA 1YRNB 4QPQA 3BG7A 2QYOA 5DUKA 4O5VA 3TW6A 1KONA 4C30A 2RASA 2Q0OA 4LG0A 2R92J 3C7JA 3B81A 2MYSA 4XORA 3HTSB 4B3AA 2GIVA 1ETOA 4M6VA 2H1LA 3K4KA 1VQLI 4G94A 2FBKA 5LEJA 1XDSA 1PUFA 1P4WA 1R5HA 4PSXA 1QNTA 2ELHA 2DCEA 3MFKA 4ESJA 2ZJRF 2M9HA 3LSMA 3VB2A 1D3YA 2Y48A 3B6CA 1ZR4A 2NVXJ 3WTTC 3G56A 3COAC 1XSVA 3GUDA 1FIAA 2XVCA 4MFEA 1GHCA 1PP7U 1OKRA 2YSRA 4Y4RA 3K8PC 2MSYA 1W0TA 1U78A 1K6OA 2IA1A 3W2AA 4I0AA 1AU7A 1E0EA 2NRAC 3RD3A 3S8PA 2CRGA 2EINH 3OL3A 3BR3A 4E7HA 2G3BA 2GBYA 3QOPA 4P9UA 2HGCA 1R4MB 1SAUA 2Z2SB 2DMQA 2XDVA 2D1HA 2GA2A 2ZMEC 1SD5A 4A12A 4IJAA 3PQKA 5A2QZ 1FMWA 4ZYAA 2K9MA 4MGRA 2JTVA 2FSWA 2UWMA 4CYCB 5K5QA 1WHUA 2X51A 2OTJI 5BQTA 2FOKA 2MFZA 2DFFA 4XQFA 3G73A 2P5LC 4XR6A 3VIBA 2X6OA 4FHTA 3R0AA 4CCMA 5HSZA 1SD4A 1IXSB 4KITB 2LKSA 1TQPA 2CQNA 3HZJA 4DGWB 5IT9K 4CCJA 5TJJA 2VBYA 1KU2A 4ENNA 2M5WA 1FBQA 3R4KA 5HS8A 3LA2A 5FD6A 1Y56A 2IVMA 4B8XA 1S3JA 3LMMA 1KA8A 4HBLA 4WXDA 2HKOA 2YX7A 3CUQA 3LA3A 4HX4A 4S05A 3SQNA 5EYRA 3EUKL 2ZSIB 5C4JJ 4F52A 3GFMA 4M74A 3O3KA 2M0MA 5DCMA 4ETSA 2R7WA 3EYIA 2DO7A 2DMUA 3J80K 3Q0VA 1AKHA 3S16J 3DKYA 2PJRB 1RKWA 3F72A 4PCQA 4LLLA 1ACIA 2VE9A 3TOAA 1CF7B 3JCUC 3H92A 1PDNC 3L09A 2PFVA 2BY2A 3H5NA 2A3SA 2ZNYA 1P6RA 3QWLA 3WU0A 1W36C 4OD5A 2L3DA 1N25A 4IRIA 5H20A 4MQVA 4OIOF 4BE1A 2JPBA 1TP4A 2QSFX 2ZXHA 5F0FA 2B7EA 4A3KJ 3NEUA 4UUSB 3I56I 5JLXA 1EKEA 1MBFA 2RREA 3S3NA 1CQTA 2HQ5A 2PMZA 2XF5A 2P5VA 2VBXA 4EATA 5FROA 3CJTB 5DTDA 2RV8A 1DP3A 1Z21A 3VVZA 5F1RA 4A3MJ 3CP2A 4FCYA 5D6FA 5F27A 5KK1A 3W2VA 3C1DA 3G7RA 4DOZA 2JA8J 1AWCA 1LVAA 3RKXA 4IHWA 5K1YA 1UFMA 1W1WE 2E1OA 2O7OA 3EUHC 1DGRM 1BI2A 2ZJQF 4Z2YA 2H27A 2V1UA 3TP3A 3JR9A 3BZCA 3L2QA 1POGA 1U2WA 2K9NA 3BP8A 1XPXA 2WADA 2ZB9A 1Z0XA 3HXLA 2G7LA 4MNUA 2CMPA 1STZA 3SEZA 2E36A 1GVDA 3HC7A 1I6HJ 2NS0A 4KT6A 4PJNA 3F23A 2VQHA 5LFAA 2QA4I 4CO8A 3QRFF 2V6CA 2EFNA 3K2AA 3ZQCA 2GENA 3X2QH 4L18B 2HNHA 1QZEA 2FBIA 1GXQA 3GVAA 1V4RA 4L9TA 5ILSA 2Y9YA 4U7DA 1OCRH 1OYWA 2VKVA 3EETA 2EH3A 2QUFA 1Z7UA 1LVKA 2BHZA 5JFRA 4KNYA 3CMAI 3CWRA 2V1NA 1NTCA 3OIPA 4CZCA 2EWNA 3AL0C 2DFEA 4EQQA 4BEHB 2FQ4A 1NH3A 2CWEA 2KIMA 2LSOA 3S3OA 3F6OA 2LF7A 3GO5A 1G3SA 3FXOA 1I3QJ 1XB4A 3F21A 2HDCA 1DU0A 2Z9OA 5FO5A 4HLYA 2UXPA 2W82A 4GDFA 3WTYC 3ASOH 3BCBA 3GEZA 2Q2EB 3ANGA 1ZRFA 2F07A 4AC0A 1HW5A 4U87A 3EUAA 2DPDA 2E1MB 1W36D 3QPHA 2DA6A 2NVYJ 4GYIA 2ZCNA 3KEYA 1ZH5A 3F1BA 1Z3YA 2JWTA 3SZGA 3KETA 1ZREA 1FOXA 2DODA 2IBDA 2DTZA 4ENKA 3FK6A 1HOMA 1GUUA 2JVHA 2F4IA 3DTKA 5E1ZB 5J3LA 2OCCH 3CJQB 1NHAA 2VUMJ 4B44A 3MVPA 4WXHA 2YVEA 1ETWA 2HS5A 2B3WA 5CXGA 3OSFA 1S7AA 2DOAA 2R5YA 1ZK8A 5F04A 1MNDA 5D8KB 1UAAA 2E5ZA 3OYIA 2KRFA 1F1ZA 4ITVA 3LWJA 1S6LA 5IT9Z 4V2FA 2LH9A 4GFBA 4RB0A 5LGNA 5IYBJ 3OS2A 2ZNZA 4RMNA 3PSIA 1HDPA 2BOLA 2BY1A 1YG2A 2L0KA 3BJOA 4ZH4F 2QOPA 3PIOF 1T95A 1Z6TA 4M73A 3DLLF 2R7ZJ 1LEBA 3KP2A 4L9VA 1IN4A 2QBYA 2Y30A 1S5LC 4NC6A 5FKLA 1B59A 4MLOA 4CCOA 3OYFA 3BQYA 5E1WA 2KZVA 3RSNA 3J80Z 2E5NA 4CDGA 3S1MJ 4B47A 2DYRH 5JVTA 3OL4A 2OERA 2KJBA 2LMDA 4R1HA 2PI0A 1FTTA 4GFKA 2DMPA 4G6DA 1RKTA 2VQGA 3U1KA 4QTRA 2X0LA 2UXHA 3LJLA 4GCTA 1A04A 2GXGA 5JLWA 4NUBA 4XKCA 3GWZA 5L3BA 1FEXA 3BCAA 2GOXB 5JHUA 2X6WA 2CU7A 2H09A 3QYFA 3CC7I 2PMHA 5EEHA 5HLHA 3VSKA 1MMNA 4WX9A 5IYCJ 2LBFB 1ZG1A 2DG7A 3O2PE 2NYXA 2R4GA 3FK7A 4MEXF 1U5TA 1Y6IA 3OYJA 3HSFA 2HZDA 2K27A 3EPZA 1FT9A 5DYMA 3CC4I 3M7GA 1TBXA 1VI0A 1E3PA 4KMUX 2EQRA 5H9TA 3OYNA 3U2RA 1G3TA 5GAHJ 4MIMA 2O0YA 5M5YJ 3UKGA 2EK5A 3TGNA 2BYVE 3RJPA 1BIBA 4BS9A 3KKCA 2K5CA 2ZO4A 2A61A 3OOPA 2ZCMA 1RPWA 2WAQN 1L3LA 3SJMA 1RUNA 2FUG2 3QODA 3DU5A 1YE9A 2Y31A 2EZHA 2GLOA 3HTHA 2ZOZA 2IT0A 4ICHA 4D5CA 5DEQA 1Y39A 4AUXA 1D8KA 2FNAA 1Z91A 2HU9A 2IA2A 5J6XA 6PAXA 4M9SA 3GX4X 3E7QA 3FIWA 2Z5UA 3A4CA 2RVCA 2XROA 3D0SA 3HRSA 1U8BA 3V4GA 2QWWA 3NI7A 4OD4A 4A3JJ 4LFUA 2WY7Q 3A1YA 4AIDA 1O3RA 3PIPF 2X48A 3E6CC 1AHDP 3LA7A 3K1NA 1MW7A 3FX3A 4L5JA 1B9MA 2BEOA 3ABKH 4ON0A 3WODF 1Z3XA 3QPSA 5K7HA 1EH6A 1HKSA 1FSHA 5L3CA 3ESWB 3PASA 4LJZF 3SHFA 1MMDA 2QIBA 2Z99A 3VYRB 1I39A 2K40A 3GZIA 1MBGA 1XC5A 4ZZLA 1LPQA 1T8IA 3ZPLA 1QVTA 3FM5A 5DDGA 5HNHA 3EGQA 4L62A 1OQYA 4UV8A 4CYDA 1QVUA 2Z16A 1WQ2A 2L4AA 3CCJI 3EUPA 2ACJA 4M3FA 2EIKH 1ZGJA 2J5OA 3CCUI 3HE0A 1XN7A 1FOYA 4GYGA 1FYLA 2FRHA 4Q4ZF 1YX5A 3MKLA 4A6EA 1NK3P 3NPIA 1O3QA 5HS7A 1T6SA 1WI9A 4BH9A 2P6SA 3AG4H 4M6YA 3IUVA 1XG1A 2WAQA 2AS5F 4FETA 4DYQA 4NELA 3L2RA 4AVPA 3HBLA 4HX8A 2JA6J 5BPIA 1BM9A 1OPCA 1PP8F 2LREA 4BDZA 3VYTB 5M5XJ 4RBOA 2GQQA 3T1BA 1FOWA 2TDXA 3G3ZA 3F8MA 2HZTA 4CCLA 4NC8A 3HUGB 4BXXJ 1BI0A 4U9LA 3HG9A 3JRDA 2KDOA 3ONQA 2OI8A 1P4AA 2A2FX 5K7FA 2NXNB 1UHWA 2OAZA 4MHGA 3RI4A 5E18F 1BC8C 3I59A 3P5JA 5CVJA 4D5FA 4AYBA 2QSGX 4JOMA 1IRGA 4ESFA 1G59A 3DTEA 3BR5A 1YRNA 4OIPF 4G8XA 2CV2A 2GM4A 4ZJZA 3HOYJ 4HPQA 1MBKA 1RC9A 2AQFA 5L3FA 2CQ7A 3I4MJ 1S9HA 2XGCA 3DBHB 2BGCA 4XONA 2DN0A 4ZTJA 1F43A 2EFQA 3F8BA 1TW2A 5IPAA 3BTCA 3E3VA 5GTHC 2LKPA 1ZG3A 2XHKA 3HOWJ 4C3JJ 3MKWB 4XSZF 4YEJA 5EG0B 3ZQFA 3CCQI 4HZFA 1D0ZA 1VQNI 3MQ0A 4HKUA 2WGBA 1WGXA 2CUZA 3VVYA 1QQIA 1RETA 2HVQA 2FOWA 4RM2A 3M3YJ 1EJ9A 3DP7A 3RPUA 4ABZA 1RRJA 1J9IA 5E8IA 2VJ5A 3HOVJ 2B63J 1J0RA 1FYMA 1OLTA 4IHSA 3JW4A 1PYVA 1HKTA 3GTGJ 3HRTA 2OU2A 3REOA 3E5QA 1IXCA 2F4OB 3ZMDA 4WCGA 2OJED 2E2JJ 1P2FA 3CUQC 3F8CA 5J1YA 3FMRA 4CYCA 2ISYA 3HKZA 3U21A 3V7SA 2XRNA 2HTSA 3CCEI 3I54A 2D2WA 3SFZA 3ROUA 2JVGA 3V7CA 4CH7A 2P81A 5IOZA 2HVRA 3RTRA 4DQ2A 4CSWA 2WY8Q 2KMUA 2MW8A 4Y17A 3NAUA 3K4JA 2P6TA 4RAZA 1GDTA 3OOUA 2ZCXA 2J5PA 2WWYA 4UB8C 2NVUB 3B73A 1ETYA 2F5FA 2IGMA 1Q1VA 4EVIA 4A3GJ 4YIRX 3V7RA 1ITYA 1FP2A 1Z7LA 4UHTA 3L2WA 3LOCA 2N8GA 2PMUA 4AWXB 3AQSA 1T33A 4XRMA 1KYZA 5EF6A 1V5EA 4KN4X 3V8LA 5HLTA 1XDUA 3K4BA 4B1RA 1BOAA 4PZJA 1QGPA 3S1QJ 4XKVA 2EV5A 3P9CA 4B09A 1FOKA 3MN2A 3WGGA 1ZGWA 1F9NA 1J7KA 4PFPA 2PJRA 1EH8A 1LFPA 2KRHA 4BXUA 4U0WA 4BKXA 1CF7A 2PJPA 1WWXA 2TRTA 5LEKA 5B5EC 3ZQIA 3LAJA 1I3AA 4U88A 1FBUA 3GYHX 3H1CA 5B1BH 1T39A 3AG1H 1MMSA 4XSXF 3WGHA 3K6GA 2GIZA 3TDUC 1SMTA 2JZYA 3PQJA 1VQPI 5D4SA 1W7PB 1AOYA 3I71A 2DXIA 3C18A 1MMGA 2BXZA 2GZWA 1ZLKA 1MDMB 2M7BA 4AD9A 5M3MJ 3KCCA 2MA3A 1F4KA 4R79A 2L9NA 1MIJA 5D5UB 3GZNB 3N05A 5HLIA 3IH3A 5LHHA 4HOBA 2O61A 5C4YA 1Z6RA 2JRTA 3TKYA 3CLQA 1DPRA 4XOPA 2LRDA 3R0JA 3LSRA 4AM3A 1LUJB 3MZYA 2W48A 3PM1A 2UV1A 1P7IA 2R7OA 1XSXA 3GTMJ 1BW5A 4UDSA 2WA0A 1MBHA 3KZYA 3S14J 4MK6A 4A3LJ 3RDIA 4OINF 3DV8A 5IP7J 5FB2A 4S04A 1UZCA 2V79A 3HHHA 1FMVA 2CSOA 3KP7A 4PJJA 4CA0A 2QLZA 5IY5H 2CW8A 3RYRA 5DUIA 3JTGA 2X6YA 3PNYA 3I3LA 1H88C 1PUEE 3WTUC 3BZKA 3VEPA 3K7AJ 3PUBA 2LYCA 3GTPJ 4QLCU 3D5SC 1BN5A 3TL4X 4JK1X 5CPRB 3NQOA 1MBJA 3K0LA 5D18A 3QYBA 4BEHA 2XAUA 3ZGKA 2R0QC 1IN6A 4UUVA 1D5VA 1V5GA 2ZC2A 3IWFA 3F9KA 1LNWA 3NRGA 1OCTC 5B1AH 2XGEA 3CMMA 1MJ9A 1BA5A 5H6QA 3BR1A 3V42A 2YR2A 4GFLA 2HKUA 1XCBA 1LQ1A 3KLOA 4CZZA 1K83J 1VQOI 1W0UA 4CCKA 2ESNA 1JHFA 2ZSHB 1QO0D 4XIDA 1A36A 2MABA 2O5RA 3LSTA 4BBSJ 1QPMA 4E70A 3JRFA 3G1LA 3MNLA 1MH3A 2CQQA 1R1UA 5FLMJ 1WH5A 3F8FA 3L9FA 3M8JA 1XX5A 3GXOA 2Q8KA 1TWFJ 1GVJA 2F2EA 2VT2A 3HHGA 4IRGA 4HNUA 2CV1A 1JUSA 3FBIB 5GAGJ 1X1PA 3KE2A 2CG4A 3I0TA 2Y0SA 4M3EA 4HF0A 3TO9A 2HYJA 3GCMA 2KQRA 4F92B 4AIJA 3OWTA 3K4NA 2R3SA 5FRMA 3FXKA 4HF1A 2W25A 3LSHA 3SEQA 1ORKA 1JKOC 4ACIA 3ECHA 1ON1A 2XUBA 5CLSA 1IO2A 1BW6A 4O3MA 1QRYA 1HF0A 5AONA 4NN1A 5D1RA 1DGWY 1S72I 3CMYA 5TISC 2E19A 4KMFA 2BW3A 3T8TA 5DM6F 4MTEA 1USSA 2R7XA 1J2XA 2ID3A 3L2UA 2NS7A 4N9HA 2F5DA 4YFXF 4IQ4A 4OOIA 3CESA 4RGUA 2AHQA 1HDDC 1HW1A 1QA6A 5L3EA 1R71A 1SMYF 2V9PA 1T38A 1LDJA 2EILH 5TGTA 2CH0A 2IW5A 1Y1VJ 1IXRC 3KEOA 2GXAA 1NG6A 2LFBA 3ZMZA 1U5TC 1WJCA 3H5AA 2M2EA 2L9VA 2B1EA 3ZMSA 3LL7A 2COBA 1R22A 2HYFA 2L2OA 2HXOA 2M7AA 5D5VB 4M9XA 3A03A 4D7MA
chains in the Genus database with same CATH topology
2PZ9A 3BQYA 4V2GA 5DS9A 2W53A 2YU9J 1JT6A 3S1MJ 1H89C 2OERA 3DCFA 5EZHA 4QSHA 3HTAA 3RH2A 2NP5A 3JREA 1FTTA 2ID6A 2VI6A 3KKDA 1S7EA 2DMPA 2M34A 1RKTA 3JRAA 1JTXA 4GFKA 4JKZA 4QTRA 2UXHA 3LJLA 5CXIA 4GCTA 4JL3A 3HKZN 2R5ZB 3SDGA 5JLWA 3BTJA 4JX5A 2ELKA 1LE8A 2NVQJ 4W97A 1FEXA 3AQTA 5F0CA 4A3EJ 3HIMA 5C44J 3NXCA 2LP0A 2ME6A 2CU7A 5GPAA 3OSGA 4JX6A 5FHPA 5F1JA 3BTIA 3QKXA 4Y7NJ 2EZIA 4JYKA 2IEKA 3LSJA 5IYCJ 2HI3A 1JJ8C 2DG7A 3FK7A 2ZOYA 4GCKA 2DA7A 2HOTA 4J19A 3JRGA 2CUEA 5E3NA 4S0HB 2G7SA 2M0CA 2MG4A 3Q0UA 2DA2A 3ON2A 1LE8B 2K9SA 5C3EJ 3DPJA 2R93J 1VI0A 4RDUA 3JSJA 3S2DJ 2EQRA 4B4CA 3L1PA 4A69C 2O7TA 5H9TA 1X58A 3ZOBA 5J1RA 4MIMA 5M5YJ 3UKGA 2MGQA 3ZQLA 4A3DJ 3KKCA 2WUIA 1I50J 3Q3SA 5HBUA 2ZCMA 1RPWA 5HAWA 2WAQN 4IHVA 2DJNA 2GUHA 3SJMA 4L5EA 2E2HJ 1BL0A 2HDDA 2Y31A 2EZHA 1MH4A 2GLOA 4JNNA 3HTHA 3BG9A 2CUFA 2ZOZA 4DYCA 1SANA 2Y2ZA 3HM5A 2XPUA 4D5CA 4ICHA 2M8GX 3PPBA 2G7GA 1WPKA 4AUXA 2GFNA 4MFDA 1IJWC 1P7JA 1VF9A 3QQAA 3S15J 1JKQC 3E7QA 3ON4A 3FIWA 2LVSA 1WH7A 1UI6A 1JTYA 3RZDJ 3BHQA 1U8BA 3O8HA 3NI7A 4A3JJ 5IP9J 1A5JA 4IHYA 2UXUA 2XGDA 2FJ1A 1TWAJ 3HTIA 3O60A 5FKMA 2X48A 1AHDP 1ENHA 2DA1A 3C2BA 3HGGA 2XPVA 3CDLA 4DYRA 2Y9ZA 3QPSA 5K7HA 2I10A 1IV6A 2PMZN 4A3FJ 3CRJA 3PASA 2IAIA 2QIBA 3CQZJ 4DW6A 5FKKA 3A02A 2K40A 1JUPA 4FE4A 2CQXA 5F08A 3GTKJ 3BJBA 3BCGA 3GZIA 1MBGA 1XC5A 3ZQHA 2LLKA 4EEFG 1X2MA 1F36A 2ECBA 4L62A 1QVTA 4A3IJ 3EGQA 3BG5A 4LOCA 1IDZA 2K9QA 1QVUA 3EUPA 4M3FA 2XPWA 1VFCA 2EZKA 3GTQJ 3VOXA 3HE0A 1NK2P 3KZ9A 3HDDA 4BY7J 2H8RA 5EZGA 4I6ZA 2L7MP 3MKLA 3NPIA 1NK3P 5FKOA 1GV2A 1TC3C 2ME0A 3IUVA 1XG1A 4Y52J 4PXIA 1IUFA 4IEJA 2DA4A 3WHCA 5K7ZA 4DYQA 3S5RA 5EEAA 4NELA 1IC8A 1SFOJ 3HBLA 5FMPA 5E3MA 2OF7A 2JA6J 1APLC 1JGGA 4XRSG 1HCRA 3HOZJ 3CJDA 3HTJA 5M5XJ 1JT0A 2HXIA 3JRCA 4RBOA 5J1UA 1EF4A 2UXOA 1WCMJ 3VW2A 3Q0WA 5K58A 5D19A 1IDYA 3FISA 4KWAA 4BXXJ 1JJ6C 5F0HA 2NVTJ 1WI3A 2VKEA 3JRDA 1JUMA 1UHSA 2OI8A 5EGOA 3BR2A 2KDZA 5K7FA 2XRLA 4A3BJ 5EG0A 2Y0SN 2OPTA 3WHBA 2LD5A 1IGNA 4X6AJ 3VVXA 3GTLJ 2L7FP 4D5FA 1UG2A 2QKOA 1H8AC 2VPRA 4M3BA 3BR5A 1YRNA 2GM4A 1ZQ3P 3HEFA 3HOYJ 1MBEA 5M5WJ 4FTHA 1MBKA 3BT9A 3CCYA 3JRIA 2WV1A 3I4MJ 2XGCA 2L9RA 2V57A 3G1OA 1R9TJ 4QIWN 5HODA 3V6GA 2DN0A 3NARA 1F43A 3F0CA 5EGOB 5IPAA 3BTCA 4NDLA 3HOWJ 5FKNA 4C3JJ 3S1NJ 3ANPA 3A01A 5EG0B 4D7NA 3ZQFA 1IG7A 3PO2J 3O8GA 1VNDA 3FKIJ 4FE7A 4HKUA 3IV5A 5IP6A 1IRZA 1WGXA 3B6AA 2REKA 2WGBA 3VVYA 1DU6A 3S1RJ 1YRNB 1SGMA 3BTLA 1RETA 3M3YJ 3TW6A 3IH4A 5M3FJ 4ABZA 2RASA 5CW8A 5IOYA 1TWCJ 2R92J 3B81A 3TW7A 3HOVJ 2B63J 5DAJA 4B3AA 1ETOA 3QPLA 4M6VA 3LHQA 2YS9A 3LSGA 3GTGJ 4A93J 1T56A 1PUFA 1ETXA 1LFBA 1XS9A 3A01B 1MNMC 2WB1N 2D5VA 3RZOJ 2M9HA 2E2JJ 2DG8A 1ZR4A 3B6CA 2JJ7A 3RKQA 2NVXJ 3BRUA 5J1YA 3E7LA 4CYCA 3G56A 2DA3A 1FIAA 4MFEA 2MSYA 1W0TA 4BBRJ 1U78A 3BQZA 1AU7A 2O9LA 1HLVA 4BY1J 2P81A 5IOZA 3TEDA 3RD3A 2CRGA 3BR3A 2MW8A 2JA5J 2GBYA 3GTOJ 3NAUA 2YUSA 5E3OA 2FBQA 2G3BA 2LKXA 1GDTA 5AQCA 3OOUA 2DMQA 1PUFB 2ZCXA 1ETYA 2G0EA 3H0GJ 4A3GJ 1Q1VA 3HB9A 1ITYA 3W6VA 3S17J 2E2IJ 4YZEA 3LOCA 2N8GA 2XB0X 2NX4A 4A3CJ 3AQSA 1T33A 4AC6A 4XRMA 4CYCB 1ZR2A 5EF6A 1ETVA 4B1RA 3S1QJ 3GEUA 4JX4A 3P9TA 3VIBA 2XB5A 3MN2A 1ZGWA 1ETKA 2X6OA 3SFIA 5HSZA 1QPIA 1B72A 1E3OC 1UMQA 1Z77A 4BKXA 2TRTA 4M3GA 3ZQIA 2JA7J 3GTJJ 9ANTA 2IU5A 2UXIA 4IHXA 5EYRA 2NS8A 3D1NI 1TWGJ 2AO9A 3VOKA 5C4JJ 3HOXJ 5EFYA 4HNVA 1JKRC 2Q24A 1X2NA 1AKHA 2DMUA 3T6NA 3Q0VA 3LSPA 3S16J 2XSDC 5M3MJ 3NNRA 2NP3A 1LFUP 4I76A 1RKWA 3BG3A 1B72B 1D5YA 3QBMA 3IH3A 1UI5A 5C4YA 3H3VK 2ECCA 2DMNA 1K61A 2R5YB 3LSRA 2W48A 3PM1A 1P7IA 2D6YA 1FTZA 1ZKGA 1ZTRA 3RQIA 5GPCA 3GTMJ 1BW5A 5C4XJ 2DA5A 4UDSA 5F0FA 4A3KJ 1B8IA 4UUSB 1AKHB 1U9NA 5JLXA 1RESA 1MBHA 3S14J 4MK6A 1MBFA 4M3DA 3TP0A 2HQ5A 1CQTA 4A3LJ 4JP0A 2EZLA 3FRQA 4XICA 5IP7J 5DTDA 3VVZA 4A3MJ 4FCYA 5F27A 2XDNA 2HOAA 3OIOA 3NRGA 3VUQA 2LY9A 3IH2A 2JA8J 3G7RA 5E3LA 4IHWA 3V78A 2E1OA 2O7OA 1GV5A 5GP9A 3BR6A 1H88C 2H1KA 1G2HA 2FD5A 3TP3A 3K7AJ 3JR9A 3I4NJ 1B8IB 1POGA 2K9NA 3LNQA 3GTPJ 4FISA 2ZB9A 2G7LA 1Z0XA 1JKPC 2HYTA 4XRSA 4XK4A 4C3HJ 2LK2A 1MBJA 2RHAA 3DEWA 5D18A 1GVDA 1I6HJ 3COLA 2R0QC 3G1MA 2JK3A 3K2AA 3ZQCA 2GENA 1OCTC 4MXMA 2XGEA 1ETQA 3JRBA 5FLVA 2JMWA 1MSFC 1BA5A 3BR1A 5FGLA 4GFLA 2HKUA 3VW1A 2Y9YA 1OFCX 2YVHA 2VKVA 2RAEA 2EH3A 1U9OA 5IYDJ 1K83J 4DZPA 1W0UA 1BJZA 2HOSA 1FJLA 3VPRA 3CWRA 1NTCA 5EDNA 2DMTA 4XIDA 2FQ4A 4BBSJ 2X9DA 3JRFA 3G1LA 3MNLA 1MH3A 2CQQA 5FLMJ 1WH5A 4X1EA 4C2MJ 4GCLA 5BNGA 1TWFJ 1FIPA 1I3QJ 1OCPA 2LTPA 1JUSA 1DU0A 2EBIA 4M3EA 2UXPA 2O8KA 3M4OJ 2HYJA 4ME9A 2CJJA 1GT0C 5FJ8J 3BNIA 2PBXA 3ANGA 4CGRA 2F07A 3VP5A 4AC0A 1ORKA 1Y1WJ 1JKOC 4ACIA 2QTQA 2QF7A 3BR0A 2DA6A 2NVYJ 1BW6A 2ZCNA 3F1BA 1QRYA 1HF0A 4NN1A 2JWTA 5D1RA 1O4XA 2QWTA 3S2HJ 1RR7A 3CMYA 2IBDA 3HOUJ 2DTZA 1HOMA 3FK6A 2E19A 1GUUA 3PO3J 4AYBN 3JRHA 5J3LA 2QCOA 4DZJA 2ID3A 2NS7A 2VUMJ 3HGYA 2LR8A 3GBGA 3MVPA 2NOGA 3ZQGA 2YVEA 1TWHJ 1ETWA 1HDDC 1A6IA 2AHQA 5CXGA 3OSFA 4W1UA 2R5YA 1ZK8A 5F04A 4G12A 3KNWA 2FX0A 3LWJA 2L7ZA 4AF5A 1OJLA 4MO7A 4V2FA 4GFBA 1Y1VJ 2TCTA 5IYBJ 4UUSA 2LFBA 2KT0A 1HDPA 2L0KA 2QOPA 2M2EA 2JN6A 2R5ZA 2R7ZJ 2COBA 4UUTA 2HXOA 4C3IJ 3C07A 1MSEC 2Y30A 3VW0A 3A03A 5FKLA 4MLOA 4D7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ9 A;  3BQY A;  4V2G A;  5DS9 A;  2W53 A;  2YU9 J;  1JT6 A;  3S1M J;  1H89 C;  2OER A;  3DCF A;  5EZH A;  4QSH A;  3HTA A;  3RH2 A;  2NP5 A;  3JRE A;  1FTT A;  2ID6 A;  2VI6 A;  3KKD A;  1S7E A;  2DMP A;  2M34 A;  1RKT A;  3JRA A;  1JTX A;  4GFK A;  4JKZ A;  4QTR A;  2UXH A;  3LJL A;  5CXI A;  4GCT A;  4JL3 A;  3HKZ N;  2R5Z B;  3SDG A;  5JLW A;  3BTJ A;  4JX5 A;  2ELK A;  1LE8 A;  2NVQ J;  4W97 A;  1FEX A;  3AQT A;  5F0C A;  4A3E J;  3HIM A;  5C44 J;  3NXC A;  2LP0 A;  2ME6 A;  2CU7 A;  5GPA A;  3OSG A;  4JX6 A;  5FHP A;  5F1J A;  3BTI A;  3QKX A;  4Y7N J;  2EZI A;  4JYK A;  2IEK A;  3LSJ A;  5IYC J;  2HI3 A;  1JJ8 C;  2DG7 A;  3FK7 A;  2ZOY A;  4GCK A;  2DA7 A;  2HOT A;  4J19 A;  3JRG A;  2CUE A;  5E3N A;  4S0H B;  2G7S A;  2M0C A;  2MG4 A;  3Q0U A;  2DA2 A;  3ON2 A;  1LE8 B;  2K9S A;  5C3E J;  3DPJ A;  2R93 J;  1VI0 A;  4RDU A;  3JSJ A;  3S2D J;  2EQR A;  4B4C A;  3L1P A;  4A69 C;  2O7T A;  5H9T A;  1X58 A;  3ZOB A;  5J1R A;  4MIM A;  5M5Y J;  3UKG A;  2MGQ A;  3ZQL A;  4A3D J;  3KKC A;  2WUI A;  1I50 J;  3Q3S A;  5HBU A;  2ZCM A;  1RPW A;  5HAW A;  2WAQ N;  4IHV A;  2DJN A;  2GUH A;  3SJM A;  4L5E A;  2E2H J;  1BL0 A;  2HDD A;  2Y31 A;  2EZH A;  1MH4 A;  2GLO A;  4JNN A;  3HTH A;  3BG9 A;  2CUF A;  2ZOZ A;  4DYC A;  1SAN A;  2Y2Z A;  3HM5 A;  2XPU A;  4D5C A;  4ICH A;  2M8G X;  3PPB A;  2G7G A;  1WPK A;  4AUX A;  2GFN A;  4MFD A;  1IJW C;  1P7J A;  1VF9 A;  3QQA A;  3S15 J;  1JKQ C;  3E7Q A;  3ON4 A;  3FIW A;  2LVS A;  1WH7 A;  1UI6 A;  1JTY A;  3RZD J;  3BHQ A;  1U8B A;  3O8H A;  3NI7 A;  4A3J J;  5IP9 J;  1A5J A;  4IHY A;  2UXU A;  2XGD A;  2FJ1 A;  1TWA J;  3HTI A;  3O60 A;  5FKM A;  2X48 A;  1AHD P;  1ENH A;  2DA1 A;  3C2B A;  3HGG A;  2XPV A;  3CDL A;  4DYR A;  2Y9Z A;  3QPS A;  5K7H A;  2I10 A;  1IV6 A;  2PMZ N;  4A3F J;  3CRJ A;  3PAS A;  2IAI A;  2QIB A;  3CQZ J;  4DW6 A;  5FKK A;  3A02 A;  2K40 A;  1JUP A;  4FE4 A;  2CQX A;  5F08 A;  3GTK J;  3BJB A;  3BCG A;  3GZI A;  1MBG A;  1XC5 A;  3ZQH A;  2LLK A;  4EEF G;  1X2M A;  1F36 A;  2ECB A;  4L62 A;  1QVT A;  4A3I J;  3EGQ A;  3BG5 A;  4LOC A;  1IDZ A;  2K9Q A;  1QVU A;  3EUP A;  4M3F A;  2XPW A;  1VFC A;  2EZK A;  3GTQ J;  3VOX A;  3HE0 A;  1NK2 P;  3KZ9 A;  3HDD A;  4BY7 J;  2H8R A;  5EZG A;  4I6Z A;  2L7M P;  3MKL A;  3NPI A;  1NK3 P;  5FKO A;  1GV2 A;  1TC3 C;  2ME0 A;  3IUV A;  1XG1 A;  4Y52 J;  4PXI A;  1IUF A;  4IEJ A;  2DA4 A;  3WHC A;  5K7Z A;  4DYQ A;  3S5R A;  5EEA A;  4NEL A;  1IC8 A;  1SFO J;  3HBL A;  5FMP A;  5E3M A;  2OF7 A;  2JA6 J;  1APL C;  1JGG A;  4XRS G;  1HCR A;  3HOZ J;  3CJD A;  3HTJ A;  5M5X J;  1JT0 A;  2HXI A;  3JRC A;  4RBO A;  5J1U A;  1EF4 A;  2UXO A;  1WCM J;  3VW2 A;  3Q0W A;  5K58 A;  5D19 A;  1IDY A;  3FIS A;  4KWA A;  4BXX J;  1JJ6 C;  5F0H A;  2NVT J;  1WI3 A;  2VKE A;  3JRD A;  1JUM A;  1UHS A;  2OI8 A;  5EGO A;  3BR2 A;  2KDZ A;  5K7F A;  2XRL A;  4A3B J;  5EG0 A;  2Y0S N;  2OPT A;  3WHB A;  2LD5 A;  1IGN A;  4X6A J;  3VVX A;  3GTL J;  2L7F P;  4D5F A;  1UG2 A;  2QKO A;  1H8A C;  2VPR A;  4M3B A;  3BR5 A;  1YRN A;  2GM4 A;  1ZQ3 P;  3HEF A;  3HOY J;  1MBE A;  5M5W J;  4FTH A;  1MBK A;  3BT9 A;  3CCY A;  3JRI A;  2WV1 A;  3I4M J;  2XGC A;  2L9R A;  2V57 A;  3G1O A;  1R9T J;  4QIW N;  5HOD A;  3V6G A;  2DN0 A;  3NAR A;  1F43 A;  3F0C A;  5EGO B;  5IPA A;  3BTC A;  4NDL A;  3HOW J;  5FKN A;  4C3J J;  3S1N J;  3ANP A;  3A01 A;  5EG0 B;  4D7N A;  3ZQF A;  1IG7 A;  3PO2 J;  3O8G A;  1VND A;  3FKI J;  4FE7 A;  4HKU A;  3IV5 A;  5IP6 A;  1IRZ A;  1WGX A;  3B6A A;  2REK A;  2WGB A;  3VVY A;  1DU6 A;  3S1R J;  1YRN B;  1SGM A;  3BTL A;  1RET A;  3M3Y J;  3TW6 A;  3IH4 A;  5M3F J;  4ABZ A;  2RAS A;  5CW8 A;  5IOY A;  1TWC J;  2R92 J;  3B81 A;  3TW7 A;  3HOV J;  2B63 J;  5DAJ A;  4B3A A;  1ETO A;  3QPL A;  4M6V A;  3LHQ A;  2YS9 A;  3LSG A;  3GTG J;  4A93 J;  1T56 A;  1PUF A;  1ETX A;  1LFB A;  1XS9 A;  3A01 B;  1MNM C;  2WB1 N;  2D5V A;  3RZO J;  2M9H A;  2E2J J;  2DG8 A;  1ZR4 A;  3B6C A;  2JJ7 A;  3RKQ A;  2NVX J;  3BRU A;  5J1Y A;  3E7L A;  4CYC A;  3G56 A;  2DA3 A;  1FIA A;  4MFE A;  2MSY A;  1W0T A;  4BBR J;  1U78 A;  3BQZ A;  1AU7 A;  2O9L A;  1HLV A;  4BY1 J;  2P81 A;  5IOZ A;  3TED A;  3RD3 A;  2CRG A;  3BR3 A;  2MW8 A;  2JA5 J;  2GBY A;  3GTO J;  3NAU A;  2YUS A;  5E3O A;  2FBQ A;  2G3B A;  2LKX A;  1GDT A;  5AQC A;  3OOU A;  2DMQ A;  1PUF B;  2ZCX A;  1ETY A;  2G0E A;  3H0G J;  4A3G J;  1Q1V A;  3HB9 A;  1ITY A;  3W6V A;  3S17 J;  2E2I J;  4YZE A;  3LOC A;  2N8G A;  2XB0 X;  2NX4 A;  4A3C J;  3AQS A;  1T33 A;  4AC6 A;  4XRM A;  4CYC B;  1ZR2 A;  5EF6 A;  1ETV A;  4B1R A;  3S1Q J;  3GEU A;  4JX4 A;  3P9T A;  3VIB A;  2XB5 A;  3MN2 A;  1ZGW A;  1ETK A;  2X6O A;  3SFI A;  5HSZ A;  1QPI A;  1B72 A;  1E3O C;  1UMQ A;  1Z77 A;  4BKX A;  2TRT A;  4M3G A;  3ZQI A;  2JA7 J;  3GTJ J;  9ANT A;  2IU5 A;  2UXI A;  4IHX A;  5EYR A;  2NS8 A;  3D1N I;  1TWG J;  2AO9 A;  3VOK A;  5C4J J;  3HOX J;  5EFY A;  4HNV A;  1JKR C;  2Q24 A;  1X2N A;  1AKH A;  2DMU A;  3T6N A;  3Q0V A;  3LSP A;  3S16 J;  2XSD C;  5M3M J;  3NNR A;  2NP3 A;  1LFU P;  4I76 A;  1RKW A;  3BG3 A;  1B72 B;  1D5Y A;  3QBM A;  3IH3 A;  1UI5 A;  5C4Y A;  3H3V K;  2ECC A;  2DMN A;  1K61 A;  2R5Y B;  3LSR A;  2W48 A;  3PM1 A;  1P7I A;  2D6Y A;  1FTZ A;  1ZKG A;  1ZTR A;  3RQI A;  5GPC A;  3GTM J;  1BW5 A;  5C4X J;  2DA5 A;  4UDS A;  5F0F A;  4A3K J;  1B8I A;  4UUS B;  1AKH B;  1U9N A;  5JLX A;  1RES A;  1MBH A;  3S14 J;  4MK6 A;  1MBF A;  4M3D A;  3TP0 A;  2HQ5 A;  1CQT A;  4A3L J;  4JP0 A;  2EZL A;  3FRQ A;  4XIC A;  5IP7 J;  5DTD A;  3VVZ A;  4A3M J;  4FCY A;  5F27 A;  2XDN A;  2HOA A;  3OIO A;  3NRG A;  3VUQ A;  2LY9 A;  3IH2 A;  2JA8 J;  3G7R A;  5E3L A;  4IHW A;  3V78 A;  2E1O A;  2O7O A;  1GV5 A;  5GP9 A;  3BR6 A;  1H88 C;  2H1K A;  1G2H A;  2FD5 A;  3TP3 A;  3K7A J;  3JR9 A;  3I4N J;  1B8I B;  1POG A;  2K9N A;  3LNQ A;  3GTP J;  4FIS A;  2ZB9 A;  2G7L A;  1Z0X A;  1JKP C;  2HYT A;  4XRS A;  4XK4 A;  4C3H J;  2LK2 A;  1MBJ A;  2RHA A;  3DEW A;  5D18 A;  1GVD A;  1I6H J;  3COL A;  2R0Q C;  3G1M A;  2JK3 A;  3K2A A;  3ZQC A;  2GEN A;  1OCT C;  4MXM A;  2XGE A;  1ETQ A;  3JRB A;  5FLV A;  2JMW A;  1MSF C;  1BA5 A;  3BR1 A;  5FGL A;  4GFL A;  2HKU A;  3VW1 A;  2Y9Y A;  1OFC X;  2YVH A;  2VKV A;  2RAE A;  2EH3 A;  1U9O A;  5IYD J;  1K83 J;  4DZP A;  1W0U A;  1BJZ A;  2HOS A;  1FJL A;  3VPR A;  3CWR A;  1NTC A;  5EDN A;  2DMT A;  4XID A;  2FQ4 A;  4BBS J;  2X9D A;  3JRF A;  3G1L A;  3MNL A;  1MH3 A;  2CQQ A;  5FLM J;  1WH5 A;  4X1E A;  4C2M J;  4GCL A;  5BNG A;  1TWF J;  1FIP A;  1I3Q J;  1OCP A;  2LTP A;  1JUS A;  1DU0 A;  2EBI A;  4M3E A;  2UXP A;  2O8K A;  3M4O J;  2HYJ A;  4ME9 A;  2CJJ A;  1GT0 C;  5FJ8 J;  3BNI A;  2PBX A;  3ANG A;  4CGR A;  2F07 A;  3VP5 A;  4AC0 A;  1ORK A;  1Y1W J;  1JKO C;  4ACI A;  2QTQ A;  2QF7 A;  3BR0 A;  2DA6 A;  2NVY J;  1BW6 A;  2ZCN A;  3F1B A;  1QRY A;  1HF0 A;  4NN1 A;  2JWT A;  5D1R A;  1O4X A;  2QWT A;  3S2H J;  1RR7 A;  3CMY A;  2IBD A;  3HOU J;  2DTZ A;  1HOM A;  3FK6 A;  2E19 A;  1GUU A;  3PO3 J;  4AYB N;  3JRH A;  5J3L A;  2QCO A;  4DZJ A;  2ID3 A;  2NS7 A;  2VUM J;  3HGY A;  2LR8 A;  3GBG A;  3MVP A;  2NOG A;  3ZQG A;  2YVE A;  1TWH J;  1ETW A;  1HDD C;  1A6I A;  2AHQ A;  5CXG A;  3OSF A;  4W1U A;  2R5Y A;  1ZK8 A;  5F04 A;  4G12 A;  3KNW A;  2FX0 A;  3LWJ A;  2L7Z A;  4AF5 A;  1OJL A;  4MO7 A;  4V2F A;  4GFB A;  1Y1V J;  2TCT A;  5IYB J;  4UUS A;  2LFB A;  2KT0 A;  1HDP A;  2L0K A;  2QOP A;  2M2E A;  2JN6 A;  2R5Z A;  2R7Z J;  2COB A;  4UUT A;  2HXO A;  4C3I J;  3C07 A;  1MSE C;  2Y30 A;  3VW0 A;  3A03 A;  5FKL A;  4MLO A;  4D7M A; 
#chains in the Genus database with same CATH topology
 3H3Z A;  2L01 A;  2PZ9 A;  5BS6 A;  2Y75 A;  1X1C A;  2YU9 J;  2XAG A;  3DF8 A;  2W1O A;  3HOS A;  4A0X A;  1B6A A;  1OMI A;  3RPQ A;  3TO6 A;  1XGM A;  2IGK A;  5EZH A;  1G6N A;  4QSH A;  1T2K A;  3HTA A;  2LBF A;  3SZT A;  2ID6 A;  4JKZ A;  3DLA A;  2M34 A;  3JRA A;  1IUY A;  4NHJ A;  4JL3 A;  2IP2 A;  2R5Z B;  1QBJ A;  3S3M A;  4RS8 A;  2FE3 A;  2K3P A;  3BTJ A;  2VC0 A;  2KLO A;  1HBX G;  2D1V A;  2EIJ H;  4W97 A;  5JI6 A;  3QP6 A;  3HIM A;  3ZQ7 A;  3NXC A;  1OCO H;  3LFU A;  3ML6 A;  3N97 A;  4XLP F;  1OCC H;  2FQ3 A;  4I02 A;  4PFO A;  5F1J A;  1YTY A;  2W57 A;  3BY6 A;  4U0Y A;  2IEK A;  4A5N A;  4II3 A;  2HI3 A;  4PGH A;  3IUO A;  2W7N A;  5HLG A;  3HJE A;  4GCK A;  2HOT A;  2G7H A;  3M8E A;  4C2T A;  3ECO A;  2H8W A;  1T0F A;  5JHF A;  5E3N A;  3EYY A;  4S0H B;  2G7S A;  2M0C A;  2P5K A;  3Q0U A;  2DA2 A;  3AG3 H;  3ZMT A;  3ON2 A;  1LE8 B;  1X3U A;  5ICG A;  4KYW A;  4RAG A;  2R93 J;  1OYY A;  4P55 A;  5DD4 A;  2KHM A;  4B4C A;  3L1P A;  2O7T A;  1SAX A;  3KP3 A;  3FF5 A;  2QGU A;  2W00 A;  3ZQL A;  5FFZ A;  4KIC A;  1V5F A;  4A3D J;  2FA5 A;  4FQG A;  2H6C A;  1VTN C;  4LK1 F;  1SFE A;  1I50 J;  5HBU A;  4ZYE A;  2ZJ2 A;  5HAW A;  3A0B C;  3MD2 A;  4IHV A;  2K7L A;  3FXQ A;  2OD5 A;  3GW2 A;  4Z6Y A;  3AFH A;  2E2H J;  1KQ8 A;  3UR3 C;  3WE2 A;  1SAN A;  2Y2Z A;  3ZP5 A;  1IZ1 A;  1XCV A;  3W2W A;  2K4J A;  1VQ6 I;  3K69 A;  2FXA A;  1WPK A;  3BG6 A;  2GFN A;  1ONV A;  2DJI A;  3JTH A;  4MFD A;  4IHT A;  1P7J A;  3S15 J;  2MLK A;  3VTI A;  3ON4 A;  4KUM A;  4DIQ A;  4YIF A;  2CS3 A;  3HRU A;  3BHQ A;  1O7F A;  1A5J A;  3CCL I;  4RB2 C;  1KU3 A;  2FJ1 A;  3O60 A;  1FC3 A;  4CIC A;  2O8X A;  1WJA A;  4IQJ A;  2DA1 A;  3HGG A;  2V1D A;  3C2B A;  2KJC A;  2HPI A;  4XKW A;  2XPV A;  3CDL A;  3I55 I;  4H4K C;  2OQG A;  4A5M A;  3CZ6 A;  4A3F J;  3M1E A;  2MC3 A;  3CDI A;  3CQZ J;  4PK4 A;  4HDU A;  3RIR A;  1JUP A;  2QQ9 A;  4KIB A;  5F08 A;  3TOB A;  3GTK J;  3VDX A;  2DPU A;  3A0H C;  1CGP A;  3E6D A;  4E6K G;  1YS7 A;  1X3W B;  1IDZ A;  3OYG A;  1I1G A;  4ZYH A;  3H36 A;  1YX3 A;  2F6C A;  3GTQ J;  3KYL A;  3VOX A;  1Y0U A;  4HV5 A;  4EGZ A;  4XOT A;  1KU7 A;  5EZG A;  3OYE A;  4I6Z A;  2L7M P;  3H9G A;  2BVL A;  4RGX A;  5D4R A;  2EPF A;  3FXM A;  4RA2 A;  4FT8 A;  3SYT A;  3HUG A;  3BOQ A;  2MH2 A;  4Y52 J;  1ODD A;  4IEJ A;  5K7Z A;  1YO5 C;  3S5R A;  2JA2 A;  2VBW A;  1BBY A;  5EEA A;  2GA1 A;  1HXD A;  2D45 A;  2CW0 F;  3BRO A;  4RGR A;  1VQ4 I;  4BE2 A;  3DEE A;  3IAS 2;  5E3M A;  5K5R A;  1IF1 A;  2JUG A;  2P7C B;  2LY2 A;  4ZYG A;  1PVE A;  4XRS G;  2M8E A;  2DQR A;  4LGW A;  1HCR A;  2OTL I;  1ZEL A;  5B3S H;  3G6E I;  1D8J A;  3BLY A;  2QKM B;  5J1U A;  2VOP A;  1EF4 A;  2XAH A;  1DUX C;  3FXJ A;  2PLY A;  2V9V A;  1X4P A;  1DQU A;  4P5O A;  3FIS A;  4XL9 A;  3KP5 A;  2A6T A;  2NVT J;  1WI3 A;  2VIX A;  3BR2 A;  3J81 K;  3WTV C;  4XLN F;  4AIH A;  4BHC A;  3E1S A;  4A3B J;  5EG0 A;  4X6A J;  1QU3 A;  2W85 A;  3GTL J;  1EH7 A;  2XKO A;  1UG2 A;  3HPG A;  2QKO A;  3WTZ A;  3LSK A;  2RNG A;  1IV8 A;  4M3B A;  1I1S A;  4BJT A;  1ZHF A;  3SDB A;  4M6X A;  3HEF A;  5M5W J;  2MBF A;  1QHH D;  2R7D A;  3BT9 A;  3CCY A;  5H6R A;  1E3H A;  1UJ8 A;  3MCZ A;  3GFI A;  4UNO A;  2V57 A;  4YEL A;  4UV9 A;  4EJW A;  5B66 C;  3C2H A;  3H0D A;  2HOE A;  4KIF A;  4CHU A;  1H9T A;  2CGP A;  5E1X A;  3NRV A;  2HYG D;  1B9N A;  2I8D A;  2RN7 A;  3H9Q A;  2YVX A;  2VQC A;  3IV5 A;  1Y8R B;  3LAP A;  5IP6 A;  2REK A;  3B6A A;  1XMK A;  2XSJ C;  1T98 A;  3BTL A;  1YOV B;  4ENJ A;  5M3F J;  5HS9 A;  1ULY A;  5CW8 A;  4IVN A;  1TWC J;  5CVU A;  3D5R C;  3TW7 A;  1XGO A;  2B0L A;  2NAZ A;  2XAJ A;  2BY3 A;  3QPL A;  4IPA A;  4LB6 B;  4N9I A;  2BXY A;  2YS9 A;  3LSG A;  5KCM A;  4F91 B;  3LHQ A;  2ISZ A;  2X1C A;  4HRI A;  4HYE A;  1T56 A;  4A93 J;  2QSH X;  3U9G A;  1LFB A;  1XS9 A;  3A01 B;  4B3X A;  1MNM C;  1G3Y A;  2WB1 N;  3S32 A;  2D5V A;  4BHB A;  1YYV A;  3GLX A;  4WF2 A;  2BY0 A;  2KIF A;  2E1C A;  2DG8 A;  3WU2 C;  3RKQ A;  2H6B A;  2VKH A;  3M8F A;  4E7S A;  3ZMV A;  2PG4 A;  3VFZ A;  3DQV C;  1U8R A;  1VQM I;  4XLC A;  3BQZ A;  2LG4 A;  4F55 A;  1HLV A;  1DPU A;  2A68 F;  3TED A;  3DTI A;  5BMZ A;  2BVM A;  3H3U A;  2FBQ A;  2YUS A;  2OQR A;  5AQC A;  2M87 A;  4YG2 F;  4K2E A;  1SVM A;  3RPU D;  1A35 A;  2L9S A;  4H0E A;  1TZL A;  4DVY P;  2M4K A;  3H0G J;  1R58 A;  3RKW A;  1J59 A;  3FDY A;  2CUJ A;  3PJR A;  4BQA A;  4YZE A;  4WK8 F;  1VQ8 I;  2OC6 A;  3MKY B;  2XB0 X;  2JPC A;  1YJW I;  3HTU A;  2OCE A;  3LWF A;  1ZR2 A;  4AVZ A;  1U0J A;  3J7Y J;  3ELK A;  2DW4 A;  4LLG F;  1ERD A;  5DM7 F;  3Q5F A;  1TQM A;  1W7P A;  2E1N A;  3OMY A;  1R23 A;  2DLL A;  2XB5 A;  3J7A O;  3K4L A;  1K7A A;  1D1C A;  3SFI A;  2XC7 A;  2M45 A;  1MDM A;  2PBI A;  1KQ9 A;  1FNN A;  2KFD A;  1X4O A;  4ZDO A;  3P7N A;  1YW8 A;  3M07 A;  3FHN A;  1E3O C;  1UMQ A;  3QPT A;  4KIG A;  2DDB A;  3OR2 C;  5LLQ A;  1UCR A;  3TDZ C;  2L7K A;  4M3G A;  4UVB A;  3GTJ J;  1TW3 A;  3C2G A;  9ANT A;  1XMX A;  4GXO A;  5L3D A;  4BJ6 C;  4E7L A;  2IU5 A;  4IHX A;  3D1N I;  2NS8 A;  5ICC A;  3VOK A;  1N77 A;  3CCM I;  1M1E B;  3HOX J;  2M3A A;  4HNV A;  3QOE A;  5EFY A;  1UEL B;  3PNT A;  1WKM A;  1JKR C;  4IF4 A;  1X2N A;  3T6N A;  3LSP A;  2R7U A;  2OZ6 A;  1B72 B;  2P0W A;  4I76 A;  3BG3 A;  3GLL A;  1D5Y A;  3QBM A;  4HQE A;  3E6B A;  4HQM A;  1DDN A;  3H3V K;  1X1D A;  2DMN A;  2IGO A;  4L9N A;  2R5Y B;  5F6F A;  4BL0 B;  2K85 A;  2D6Y A;  4E7I A;  1FTZ A;  2GXB A;  1ZTR A;  3RQI A;  3L2C A;  4BYY A;  5C4X J;  2DA5 A;  1B4A A;  2OBP A;  3WE3 A;  3DKW A;  1LKX A;  1JGS A;  1RES A;  2E1M C;  2O3F A;  2HFH A;  3FZV A;  3MZH A;  3TP0 A;  4TV7 A;  2K86 A;  4C2M A;  4JP0 A;  1VQ9 I;  4XIC A;  3FM3 A;  4HAM A;  4CGZ A;  4G9Y A;  1K79 A;  1FZP B;  4I2O A;  2KRC A;  2XDN A;  2HOA A;  3OIO A;  1MJB A;  2QBY B;  3J81 Z;  1Z1D A;  2ZME B;  3IH2 A;  3K70 C;  4LB5 A;  2DT5 A;  4G7H F;  2K4B A;  4YRV A;  2K02 A;  3V78 A;  4QWQ A;  1C0W A;  1W5T A;  1GV5 A;  2HDW A;  5GP9 A;  3BR6 A;  2JT1 A;  1H0M A;  4UY8 I;  3KZI C;  1FWZ A;  5EJC A;  2H1K A;  2FD5 A;  1B8I B;  1E17 A;  1BOB A;  3W6K B;  4F93 B;  3ULQ B;  4XRS A;  4XK4 A;  2ESH A;  4ZDP A;  4E7K A;  2RHA A;  3DEW A;  4IZZ A;  2IS6 A;  1HA8 A;  3CF2 A;  3ZN1 A;  3COL A;  4BJ5 C;  1UHM A;  3G1M A;  4LIV A;  2JK3 A;  2B9S A;  1SVL A;  1ETQ A;  3JRB A;  2PX9 A;  2A69 F;  5FLV A;  1MSF C;  5FGL A;  1SVO A;  3VW1 A;  1H9G A;  2MC4 A;  1OFC X;  2YVH A;  4PJ0 C;  4Q47 A;  1REP C;  1B1B A;  2RAE A;  3VYU B;  1O3S A;  5IYD J;  1QHG A;  5TRD A;  4DZP A;  3R61 A;  1BJZ A;  3ERE D;  1FJL A;  2Y69 H;  1R00 A;  2JUC A;  3EDP A;  4P96 A;  3RKY A;  4FX4 A;  3V8J A;  3I53 A;  1JE8 A;  5ICF A;  3ERM A;  3MMY B;  3GZ6 A;  1HKQ A;  2MD5 A;  2VPL A;  3SWH A;  1D1B A;  2F48 A;  1W5C C;  4C2M J;  2GAU A;  2HKX A;  2X1D A;  5BNG A;  3VYS B;  5L3G A;  2JQ7 A;  2BZT A;  1FIP A;  2E34 A;  3FXR A;  1O3T A;  2V9K A;  4IOC F;  3OYC A;  2KIS A;  1XMA A;  2JRM A;  3HSE A;  1PJR A;  1BI3 A;  1GT0 C;  3BNI A;  2EIM H;  2PBX A;  2A6H F;  3BWG A;  2OZU A;  4CGR A;  3ZMU A;  4B48 A;  3KP4 A;  3HYI A;  2RDP A;  4YFN F;  4I7H A;  4G7Z F;  1FYK A;  4JBA A;  1K78 B;  2QTQ A;  3BR0 A;  1D1A A;  2V6E A;  5ICE A;  1R36 A;  2VOO A;  1O4X A;  3S2H J;  1YW9 A;  4N0B A;  4OMY A;  4C9Y A;  3PUF A;  3PO3 J;  3JRH A;  2QCO A;  4YII A;  4DZJ A;  3OS1 A;  1ZN2 A;  4KFC A;  3GBG A;  4KN7 X;  3ZQG A;  1FPQ A;  1WJE A;  1ZG5 A;  4ZYD A;  2WAE A;  1A6I A;  3K70 D;  4HSR A;  5LD2 C;  1J75 A;  3WG9 A;  1R4N B;  1UB9 A;  3GME A;  1ZRD A;  3KNW A;  4MTD A;  1OYI A;  1EA3 A;  1S29 A;  3OR1 C;  3CTA A;  3JAM K;  2QM3 A;  2L7Z A;  4AF5 A;  1WJB A;  2XV4 S;  1QZY A;  2TCT A;  3ZQQ A;  4UUS A;  1T0F C;  2E35 A;  5LGT A;  3KZZ A;  5EEG A;  5HNF A;  1X19 A;  4WWC A;  4IOA F;  1KZH A;  5J47 A;  2VB6 A;  2L4M A;  3TMO A;  4ASN A;  2R5Z A;  3LQR A;  4UUT A;  4C3I J;  1R1V A;  3OYM A;  3CME I;  3ABT A;  4BUP A;  3HSR A;  2VJI A;  2BE5 F;  5HOO A;  3IRR A;  2M4G A;  4IL6 C;  4V2G A;  5DS9 A;  2W53 A;  1JT6 A;  3AL0 B;  1K4S A;  1Q1H A;  3GZ5 A;  3DCF A;  1BR2 A;  2XAF A;  3P9I A;  4LD5 A;  4O6J A;  3JRE A;  4EM2 A;  3Q9S A;  1JTX A;  5E8G A;  2PQ8 A;  1IW7 F;  5CXI A;  2V7F A;  3NWT A;  1IN5 A;  2RQP A;  5E79 C;  3LQQ A;  4JX5 A;  3CO6 C;  2ELK A;  5HDK A;  1LE8 A;  3DFG A;  5F0C A;  4A3E J;  4KIS A;  3AQT A;  3BPX A;  1P92 A;  4ZC3 A;  2LC2 A;  3OSG A;  4XLF A;  2FML A;  2KKO A;  1MD0 A;  4I09 A;  4Y7N J;  2ZFU A;  4XRF A;  1XD7 A;  3LSJ A;  1BJA A;  3DPU A;  4Y3O A;  2VAS A;  1JJ8 C;  5CVI A;  5IT3 A;  5KAF C;  1YIO A;  4J19 A;  3JRG A;  1HQC A;  2CUE A;  2JSC A;  3F6V A;  2V26 A;  2XF7 A;  3F8N A;  5D5W B;  1XGS A;  4GRI A;  2MG4 A;  3R60 A;  3C3W A;  1HSJ A;  4OU0 A;  3DU6 A;  2XAS A;  2UXN A;  2K9S A;  5C3E J;  4E7J A;  3DPJ A;  4NB5 A;  4RDU A;  1TL8 A;  5FLX K;  4A69 C;  1X58 A;  3ZOB A;  5J1R A;  4Q5S F;  2XF6 A;  3TQN A;  1JHH A;  2Q2E A;  4LLN A;  3E97 A;  1ZYR F;  3HPH A;  2HQN A;  3DBL B;  5H2F C;  4JQF A;  3G4S I;  3KYC B;  3U1D A;  5ILU A;  2RC4 A;  4L5E A;  3W6J B;  4XLA A;  1BL0 A;  1MH4 A;  4JNN A;  3PNV A;  3BG9 A;  1LB2 A;  1O57 A;  3HM5 A;  2HPM A;  2XPU A;  2M8G X;  1R7J A;  3J7A Y;  1V55 H;  3PPB A;  2G7G A;  1RI7 A;  2KIQ A;  2RQQ A;  3QQA A;  4N4O B;  1JKQ C;  2UXX A;  4UXN A;  1WH7 A;  5FGM A;  4IX7 A;  1UI6 A;  3RZD J;  3O8H A;  2LY1 A;  5IP9 J;  4IHY A;  2VN2 A;  2XGD A;  3I58 A;  2QQB A;  4CUG A;  3HTI A;  1EV7 A;  1ENH A;  2EFO A;  4QPO A;  4RLF A;  2KP6 A;  1TQI A;  2VXD A;  2Y9Z A;  2DBB A;  3NWS A;  4M71 A;  3E5U A;  3MWM A;  1W4M A;  2PMZ N;  3D5L A;  3CLO A;  4RB1 A;  4P9F A;  1LEA A;  4OMZ A;  3CRJ A;  3FMS A;  3I4P A;  3AAF A;  3UNG C;  3CCV I;  4Y13 A;  5FKK A;  3A02 A;  4V19 K;  2CQX A;  3BJB A;  3ZQH A;  1WFX A;  5LBQ A;  1F36 A;  4KT5 C;  2HEO A;  3ABU A;  1YIT I;  4L0Z B;  2VON A;  2EA4 A;  2O03 A;  3CD6 I;  2EB7 A;  3BG5 A;  2X1E A;  2K9Q A;  1MKM A;  2XPW A;  4HDV A;  1VFC A;  3IRQ A;  1NK2 P;  4IXA A;  2E71 A;  3GFL A;  3HDD A;  4J01 A;  1FLI A;  4BY7 J;  3VUQ A;  5FKO A;  3W3C A;  3IL2 A;  1LJ9 A;  4DNC A;  5LHG A;  1TC3 C;  2ME0 A;  2AXL A;  5BPD A;  3KFW X;  3JAM Z;  2DOE A;  2GOM A;  2BBY A;  1ON2 A;  2X4H A;  2ZJP F;  2E7W A;  1SFU A;  1SFO J;  1IC8 A;  3P9K A;  1APL C;  2ZXJ A;  3CC2 I;  1JGG A;  4C2U A;  3T5X A;  2BV6 A;  3HOZ J;  2EJR A;  1VZ0 A;  4UB6 C;  3HTJ A;  1JT0 A;  1SD7 A;  3IAM 2;  1ZAR A;  2G7U A;  1I5Z A;  1WCM J;  4EGY A;  1QZZ A;  2XGX A;  4XLE A;  5D19 A;  1IDY A;  3N4M A;  5ILV A;  2E60 A;  2W84 A;  2DYS H;  1JJ6 C;  5F0H A;  2XAQ A;  4NNJ A;  2VKE A;  1UHS A;  2KDZ A;  1VQK I;  1DP7 P;  3WTX C;  1KU9 A;  2UUZ A;  1D0Y A;  2DQL A;  3HL2 A;  2LD5 A;  1IGN A;  3VVX A;  5GAE J;  2L7F P;  1RIO H;  1H8A C;  2VJJ A;  5JVG F;  1ZLJ A;  2Z1D A;  3MEX A;  3AG2 H;  5KVR A;  3K4C A;  3FKJ A;  1ZQ3 P;  3FWE A;  2P8T A;  4FTH A;  5AIP A;  3OV8 A;  4EMS A;  1TLH B;  4NQW B;  3MKZ A;  2L9R A;  2Q1Z B;  4QIW N;  3I64 A;  4J00 A;  3QP5 A;  4G7O F;  3F0C A;  1GLN A;  2CFX A;  5EGO B;  1SEU A;  4NDL A;  1OR7 A;  2DI3 A;  2WC2 A;  3L2V A;  4I01 A;  1NG7 A;  3K1P A;  3WTS C;  4D1Q A;  3A01 A;  2COM A;  4D7N A;  1IG7 A;  4X0G A;  1VND A;  3FKI J;  4FE7 A;  1R49 A;  4OIR F;  1IRZ A;  4AU7 A;  4IRH A;  2AQE A;  3S1R J;  2HR3 A;  2IA0 A;  1SGM A;  2PEX A;  2HWV A;  3BDD A;  1D0X A;  3HIF A;  1MNE A;  3IH4 A;  3I9V 2;  3WG7 H;  3ISP A;  4I98 B;  2VQL A;  3K1M A;  2F4M B;  5IOY A;  3OIQ A;  5FLX Z;  5DAJ A;  5LGU A;  4FX0 A;  3CUO A;  5CYV A;  1K6Y A;  4B43 A;  4Y15 A;  2IRF G;  1ETX A;  4IKF A;  3RYP A;  2MH9 A;  2FMY A;  1J09 A;  2VE8 A;  2IJL A;  3RZO J;  4L9J A;  4YFK F;  2JJ7 A;  4XN3 A;  3BRU A;  5J4V A;  1A31 A;  1S8N A;  3E7L A;  2DA3 A;  3M1C A;  4BBR J;  5FD5 A;  1RZ4 A;  2QQA A;  5D6E A;  2DFH A;  4LG0 B;  1P9Q C;  4ZZD A;  5HDN A;  2O9L A;  4BY1 J;  1TNS A;  2QQ8 A;  3LFK A;  2K3F A;  1YS6 A;  2JA5 J;  3GTO J;  5E3O A;  2LKX A;  4A0Z A;  4HG2 A;  1PUF B;  3K9T A;  4GCV A;  1R6R A;  2Y0M A;  2G0E A;  3HB9 A;  3W6V A;  3S17 J;  2E2I J;  2KL4 A;  2NX4 A;  2X85 A;  1RNL A;  2IS2 A;  4BQO A;  3JSP A;  1YI2 I;  4A3C J;  2V4J C;  4AC6 A;  1BR1 A;  2DT7 B;  4EV0 A;  4ZTF A;  3T8R A;  1P4X A;  1ETV A;  5CVR A;  1JXS A;  2VL8 A;  4EJO A;  2KZG A;  3GEU A;  3IWZ A;  4JX4 A;  3K2Z A;  1G4D A;  3P9T A;  3R6S A;  2IPQ X;  1ETK A;  1FY7 A;  3CJN A;  1RR8 C;  3M9A A;  1QPI A;  2KPM A;  1B72 A;  1TT0 A;  2ZXW H;  4BHP A;  4ENM A;  2A07 F;  2ZKZ A;  1Z77 A;  2CYY A;  4PUS A;  3GF2 A;  3KIO A;  2JA7 J;  1HC8 A;  1W5S A;  2A05 A;  2VC1 A;  4G6T B;  3FMQ A;  3NS4 A;  3HOT A;  2UXI A;  1XTA A;  1WJ5 A;  3FXU A;  2DDA A;  4BXF A;  1TWG J;  2AO9 A;  3MAJ A;  1UST A;  3F3X A;  1FX7 A;  1XSD A;  3CJR B;  4A0Y A;  2Q24 A;  4WIB A;  2BW3 B;  3VOE A;  5DCF A;  5CVV A;  2XSD C;  2HQA A;  1YFH A;  3NNR A;  2NP3 A;  2LF8 A;  1FBS A;  1LFU P;  4I99 C;  2YX4 A;  1W7P D;  1UI5 A;  5CKT A;  4D0P A;  2ECC A;  4XKB A;  2ZME A;  3IKT A;  1K61 A;  2ICW G;  4KDP A;  2QEN A;  5J8C A;  3CUQ B;  3AKZ A;  3ABM H;  1WZ2 A;  1ZKG A;  2L02 A;  5GPC A;  5LHI A;  2ZY9 A;  5DCM B;  2VLA A;  4OIQ F;  5D8L B;  1B8I A;  3WGI A;  1AKH B;  1U9N A;  4N4N B;  3BJ6 A;  4M3D A;  3FRQ A;  2EZL A;  1IRX A;  4HA8 A;  3FHZ A;  2KIU A;  3QU6 A;  5AIQ A;  2R7Q A;  4NC7 A;  1N78 A;  2VBZ A;  2A6E F;  4HX7 A;  1N75 A;  3KEQ A;  2EV6 A;  2LY9 A;  3SXY A;  1OCZ H;  5J8F A;  1ZAO A;  5E3L A;  3KP6 A;  2R7R A;  2A5Y B;  4HW0 A;  3KYD B;  4BNC A;  2IS1 A;  1BR4 A;  2VT3 A;  1G2H A;  3VSL A;  4GGG A;  3ZXS A;  3I4N J;  2DTR A;  4BE0 A;  3LNQ A;  1SD6 A;  4FIS A;  1JKP C;  4I0B A;  2HYT A;  2QZ8 A;  5DD8 A;  4D9J A;  4C3H J;  5JR3 A;  5BOX A;  1A6Q A;  2LK2 A;  3FXL A;  4M72 A;  4UVA A;  3OS0 A;  2Z3Y A;  5J4Y A;  2QVO A;  1TTY A;  5CJ9 A;  4RLQ A;  4E7Z A;  4Q48 A;  4MXM A;  2IS4 A;  2RGV A;  2JMW A;  4ANJ A;  3DWL E;  1Z05 A;  1WSU A;  2M30 A;  1JI8 A;  2DK8 A;  2CV0 A;  4F3Q A;  4HST A;  1U9O A;  1U3E M;  3BJA A;  3JSO A;  5KAI C;  1Y0N A;  2HOS A;  4RAY A;  3VPR A;  4HLX A;  3WTW C;  5EDN A;  2DMT A;  2F5C A;  1IRF A;  3BC8 A;  1K78 A;  4IO9 F;  2X9D A;  5KHD A;  3S2W A;  2MD0 A;  5KNL A;  4X1E A;  4GCL A;  2A5W A;  1K4T A;  4WXC A;  4HF2 A;  1OCP A;  4XLH A;  2LTP A;  1RUO A;  2EBI A;  2VOD A;  1Z67 A;  2O8K A;  1O7L A;  3BPV A;  3PFI A;  3M4O J;  4ME9 A;  3EUH A;  2CJJ A;  5FJ8 J;  3I5U A;  3IHU A;  1MMA A;  4HEA 2;  3VP5 A;  3H5R A;  3OYH A;  1Y1W J;  4LK0 F;  5J40 A;  2QF7 A;  4CCN A;  1YLF A;  5HDG A;  1TNT A;  2UZK A;  1Y8Q B;  2C6Y A;  4ESB A;  3KPH A;  1MGT A;  1R1T A;  2BHY A;  2QWT A;  1RR7 A;  2M1B A;  4RM3 A;  3K10 A;  4U0V A;  4BQN A;  4LG3 A;  3HOU J;  4A2U A;  2EFW A;  3ZN0 A;  3KX2 A;  5F64 A;  3QAH A;  4AYB N;  1WRJ A;  3CF5 F;  4DJA A;  4A6D A;  3HGY A;  2LR8 A;  2FEZ A;  4MQ9 F;  2NOG A;  1TWH J;  2LDU A;  2OUM A;  3L7W A;  3HRM A;  3VOD A;  4W1U A;  4G12 A;  1YIJ I;  3H35 A;  1SFK A;  2FBH A;  1X1A A;  1SFX A;  2FX0 A;  1OJL A;  4MO7 A;  1AA7 A;  2KT0 A;  3B02 A;  2ETH A;  3PL8 A;  4PDK A;  2R7S A;  2HVS A;  2WB1 A;  2PFB A;  2R7F A;  3TO7 A;  3QU3 A;  2JN6 A;  4KA4 A;  1HST A;  2WAF A;  4KJZ A;  3OYL A;  2AXT C;  3C07 A;  3G2B A;  1MSE C;  2ZBK A;  1KYW A;  3VW0 A;  4EJU A;  4UVC A;  5D5X B;  3TBI A;  5LRS A;  5CQG A;  3PSF A;  5FFX A;  3DBR B;  4HNT A;  1H89 C;  1G3W A;  4XMY A;  3RH2 A;  2NP5 A;  3IC7 A;  2VI6 A;  2VKD A;  3KKD A;  1S7E A;  2RKH A;  1VQ5 I;  2W24 A;  3OY9 A;  5LRR A;  3RCO A;  3HKZ N;  2E7X A;  1ZGA A;  3E6M A;  3SDG A;  2R7T A;  2FF4 A;  1S7O A;  4OWR B;  1IN8 A;  1WJF A;  2NVQ J;  4EM0 B;  3OYA A;  5C44 J;  2LP0 A;  1SC7 A;  2ME6 A;  5GPA A;  4BAY A;  4JX6 A;  1YW7 A;  4RB3 C;  5FHP A;  1KQ0 A;  3F22 A;  3BTI A;  4FAS D;  3QKX A;  2XIG A;  2I5U A;  3MZ8 A;  2EZI A;  3DXJ F;  4JYK A;  3VWB A;  2ZFW A;  1R5G A;  4Y33 A;  2ZOY A;  4DBR A;  5HVQ C;  2DA7 A;  4BQQ A;  4XN0 A;  1MJA A;  2OA4 A;  3E5X A;  4RGS A;  2QKL B;  3GFJ A;  4RAF A;  4R8H A;  4PJM A;  3V8K A;  2CW7 A;  3BZ6 A;  2F5E A;  2STT A;  3ZCO A;  2HTJ A;  1U6G A;  3CCR I;  3JSJ A;  1IN7 A;  3S2D J;  3O6B B;  1ZRC A;  2MGQ A;  2DK5 A;  3PFY A;  3G71 I;  1T08 B;  3WU1 B;  3OYD A;  2WUI A;  2WBM A;  3Q3S A;  4F7Z A;  2NNN A;  2FU4 A;  3IP4 B;  2EFP A;  1U5T B;  2DJN A;  1BC7 C;  2GUH A;  2FNP A;  2HDD A;  1Z9C A;  4BGD A;  4L5I A;  4II2 A;  4DBQ A;  2VJ4 A;  2STW A;  1IAW A;  2CUF A;  4DYC A;  1V54 H;  2NOJ B;  4U9N A;  1IJW C;  3KLN A;  1VF9 A;  1VQ7 I;  2LVS A;  3Q9V A;  4LMY A;  2MLG A;  1JTY A;  5A2Q K;  1TT5 B;  4M9Z A;  3DPL C;  4EM1 A;  4BDY A;  2UXU A;  1TWA J;  3QYE A;  5FKM A;  4G6Q A;  5E17 F;  4AIK A;  2EV0 A;  2P4W A;  2YPR A;  4DYR A;  1WJD A;  2I10 A;  1IV6 A;  2PN6 A;  2IAI A;  5E20 A;  3LSI A;  3OYB A;  1FP1 D;  5K5O A;  3ZRG A;  2VXZ A;  4DW6 A;  3K4M A;  3CO7 C;  4FE4 A;  4OAY A;  2IGN A;  4IRV A;  3BCG A;  1OIS A;  2LLK A;  4EEF G;  1X2M A;  2W4S A;  2ECB A;  3A2K A;  3DPT A;  3DEU A;  3E0J B;  4XNF A;  4A3I J;  2GWR A;  2Z33 A;  1XGN A;  2CFO A;  3CDH A;  3RQ4 A;  1KGS A;  4LOC A;  1F5T A;  2ADU A;  1LDD A;  1LDK B;  2FJI 1;  5DV5 A;  2CQK A;  4E4H A;  1UG0 A;  2EZK A;  1YJN I;  1G8X A;  3KZ9 A;  2ZXI A;  2H8R A;  4HV6 A;  1BI1 A;  4BU2 A;  2G9W A;  1GV2 A;  1V3F A;  4L0Y B;  3CP8 A;  2LNB A;  5FRN A;  1OR7 C;  2DAO A;  2YU3 A;  4PXI A;  1IUF A;  2R7V A;  3T0Y A;  2DA4 A;  2H94 A;  2DFI A;  3WHC A;  1J5Y A;  1WVR A;  2XKP A;  4ZDL A;  4BAC A;  2EA2 A;  2K9L A;  2V1X A;  3CCS I;  2OF7 A;  2DU9 A;  2NNY A;  1YJ9 I;  5FMP A;  2L54 A;  5ED4 A;  3FBN B;  1GXP A;  2DT6 A;  5GAD J;  2QEX I;  3CJD A;  1X1B A;  3L00 A;  2HXI A;  3IKV A;  3JRC A;  2UXO A;  2P7V B;  4MEY F;  4CXF A;  3VW2 A;  3Q0W A;  4NQW A;  5K58 A;  1L0O C;  2JSP A;  2X6X A;  2O6G E;  4NBQ A;  1MZB A;  2HQR A;  2IXS A;  4KWA A;  2RNJ A;  1JUM A;  3S93 A;  2DOF A;  5EGO A;  2XRL A;  2LOO A;  5ERI A;  1FSE A;  4P1W A;  4LIT A;  3SZP A;  3ZR8 X;  2Y0S N;  2OPT A;  3WHB A;  2CO5 A;  1YHQ I;  1HW2 A;  2L5Q A;  4EJV A;  2VPR A;  3ASN H;  4PJL A;  1BIA A;  4PGG A;  1MBE A;  4GO1 A;  3H9J A;  3JRI A;  2ZCW A;  2WV1 A;  4EJT A;  3G1O A;  1R9T J;  5HOD A;  4LIU A;  4OAZ A;  3J7Z I;  4XM3 A;  3V6G A;  3NAR A;  5GTI C;  2WTE A;  4U7B A;  2ELJ A;  2F5V A;  5FKN A;  3ANP A;  3S1N J;  2WV0 A;  3EQL F;  3DKX A;  3I59 B;  5CQE A;  4XBF A;  3O8G A;  1E2X A;  1X3Z B;  3ABL H;  4PSW A;  3PO2 J;  3OYK A;  2OV7 A;  1I6X A;  1R5I D;  1DU6 A;  1I27 A;  1YQA A;  1YRN B;  4QPQ A;  3BG7 A;  2QYO A;  5DUK A;  4O5V A;  3TW6 A;  1KON A;  4C30 A;  2RAS A;  2Q0O A;  4LG0 A;  2R92 J;  3C7J A;  3B81 A;  2MYS A;  4XOR A;  3HTS B;  4B3A A;  2GIV A;  1ETO A;  4M6V A;  2H1L A;  3K4K A;  1VQL I;  4G94 A;  2FBK A;  5LEJ A;  1XDS A;  1PUF A;  1P4W A;  1R5H A;  4PSX A;  1QNT A;  2ELH A;  2DCE A;  3MFK A;  4ESJ A;  2ZJR F;  2M9H A;  3LSM A;  3VB2 A;  1D3Y A;  2Y48 A;  3B6C A;  1ZR4 A;  2NVX J;  3WTT C;  3G56 A;  3COA C;  1XSV A;  3GUD A;  1FIA A;  2XVC A;  4MFE A;  1GHC A;  1PP7 U;  1OKR A;  2YSR A;  4Y4R A;  3K8P C;  2MSY A;  1W0T A;  1U78 A;  1K6O A;  2IA1 A;  3W2A A;  4I0A A;  1AU7 A;  1E0E A;  2NRA C;  3RD3 A;  3S8P A;  2CRG A;  2EIN H;  3OL3 A;  3BR3 A;  4E7H A;  2G3B A;  2GBY A;  3QOP A;  4P9U A;  2HGC A;  1R4M B;  1SAU A;  2Z2S B;  2DMQ A;  2XDV A;  2D1H A;  2GA2 A;  2ZME C;  1SD5 A;  4A12 A;  4IJA A;  3PQK A;  5A2Q Z;  1FMW A;  4ZYA A;  2K9M A;  4MGR A;  2JTV A;  2FSW A;  2UWM A;  4CYC B;  5K5Q A;  1WHU A;  2X51 A;  2OTJ I;  5BQT A;  2FOK A;  2MFZ A;  2DFF A;  4XQF A;  3G73 A;  2P5L C;  4XR6 A;  3VIB A;  2X6O A;  4FHT A;  3R0A A;  4CCM A;  5HSZ A;  1SD4 A;  1IXS B;  4KIT B;  2LKS A;  1TQP A;  2CQN A;  3HZJ A;  4DGW B;  5IT9 K;  4CCJ A;  5TJJ A;  2VBY A;  1KU2 A;  4ENN A;  2M5W A;  1FBQ A;  3R4K A;  5HS8 A;  3LA2 A;  5FD6 A;  1Y56 A;  2IVM A;  4B8X A;  1S3J A;  3LMM A;  1KA8 A;  4HBL A;  4WXD A;  2HKO A;  2YX7 A;  3CUQ A;  3LA3 A;  4HX4 A;  4S05 A;  3SQN A;  5EYR A;  3EUK L;  2ZSI B;  5C4J J;  4F52 A;  3GFM A;  4M74 A;  3O3K A;  2M0M A;  5DCM A;  4ETS A;  2R7W A;  3EYI A;  2DO7 A;  2DMU A;  3J80 K;  3Q0V A;  1AKH A;  3S16 J;  3DKY A;  2PJR B;  1RKW A;  3F72 A;  4PCQ A;  4LLL A;  1ACI A;  2VE9 A;  3TOA A;  1CF7 B;  3JCU C;  3H92 A;  1PDN C;  3L09 A;  2PFV A;  2BY2 A;  3H5N A;  2A3S A;  2ZNY A;  1P6R A;  3QWL A;  3WU0 A;  1W36 C;  4OD5 A;  2L3D A;  1N25 A;  4IRI A;  5H20 A;  4MQV A;  4OIO F;  4BE1 A;  2JPB A;  1TP4 A;  2QSF X;  2ZXH A;  5F0F A;  2B7E A;  4A3K J;  3NEU A;  4UUS B;  3I56 I;  5JLX A;  1EKE A;  1MBF A;  2RRE A;  3S3N A;  1CQT A;  2HQ5 A;  2PMZ A;  2XF5 A;  2P5V A;  2VBX A;  4EAT A;  5FRO A;  3CJT B;  5DTD A;  2RV8 A;  1DP3 A;  1Z21 A;  3VVZ A;  5F1R A;  4A3M J;  3CP2 A;  4FCY A;  5D6F A;  5F27 A;  5KK1 A;  3W2V A;  3C1D A;  3G7R A;  4DOZ A;  2JA8 J;  1AWC A;  1LVA A;  3RKX A;  4IHW A;  5K1Y A;  1UFM A;  1W1W E;  2E1O A;  2O7O A;  3EUH C;  1DGR M;  1BI2 A;  2ZJQ F;  4Z2Y A;  2H27 A;  2V1U A;  3TP3 A;  3JR9 A;  3BZC A;  3L2Q A;  1POG A;  1U2W A;  2K9N A;  3BP8 A;  1XPX A;  2WAD A;  2ZB9 A;  1Z0X A;  3HXL A;  2G7L A;  4MNU A;  2CMP A;  1STZ A;  3SEZ A;  2E36 A;  1GVD A;  3HC7 A;  1I6H J;  2NS0 A;  4KT6 A;  4PJN A;  3F23 A;  2VQH A;  5LFA A;  2QA4 I;  4CO8 A;  3QRF F;  2V6C A;  2EFN A;  3K2A A;  3ZQC A;  2GEN A;  3X2Q H;  4L18 B;  2HNH A;  1QZE A;  2FBI A;  1GXQ A;  3GVA A;  1V4R A;  4L9T A;  5ILS A;  2Y9Y A;  4U7D A;  1OCR H;  1OYW A;  2VKV A;  3EET A;  2EH3 A;  2QUF A;  1Z7U A;  1LVK A;  2BHZ A;  5JFR A;  4KNY A;  3CMA I;  3CWR A;  2V1N A;  1NTC A;  3OIP A;  4CZC A;  2EWN A;  3AL0 C;  2DFE A;  4EQQ A;  4BEH B;  2FQ4 A;  1NH3 A;  2CWE A;  2KIM A;  2LSO A;  3S3O A;  3F6O A;  2LF7 A;  3GO5 A;  1G3S A;  3FXO A;  1I3Q J;  1XB4 A;  3F21 A;  2HDC A;  1DU0 A;  2Z9O A;  5FO5 A;  4HLY A;  2UXP A;  2W82 A;  4GDF A;  3WTY C;  3ASO H;  3BCB A;  3GEZ A;  2Q2E B;  3ANG A;  1ZRF A;  2F07 A;  4AC0 A;  1HW5 A;  4U87 A;  3EUA A;  2DPD A;  2E1M B;  1W36 D;  3QPH A;  2DA6 A;  2NVY J;  4GYI A;  2ZCN A;  3KEY A;  1ZH5 A;  3F1B A;  1Z3Y A;  2JWT A;  3SZG A;  3KET A;  1ZRE A;  1FOX A;  2DOD A;  2IBD A;  2DTZ A;  4ENK A;  3FK6 A;  1HOM A;  1GUU A;  2JVH A;  2F4I A;  3DTK A;  5E1Z B;  5J3L A;  2OCC H;  3CJQ B;  1NHA A;  2VUM J;  4B44 A;  3MVP A;  4WXH A;  2YVE A;  1ETW A;  2HS5 A;  2B3W A;  5CXG A;  3OSF A;  1S7A A;  2DOA A;  2R5Y A;  1ZK8 A;  5F04 A;  1MND A;  5D8K B;  1UAA A;  2E5Z A;  3OYI A;  2KRF A;  1F1Z A;  4ITV A;  3LWJ A;  1S6L A;  5IT9 Z;  4V2F A;  2LH9 A;  4GFB A;  4RB0 A;  5LGN A;  5IYB J;  3OS2 A;  2ZNZ A;  4RMN A;  3PSI A;  1HDP A;  2BOL A;  2BY1 A;  1YG2 A;  2L0K A;  3BJO A;  4ZH4 F;  2QOP A;  3PIO F;  1T95 A;  1Z6T A;  4M73 A;  3DLL F;  2R7Z J;  1LEB A;  3KP2 A;  4L9V A;  1IN4 A;  2QBY A;  2Y30 A;  1S5L C;  4NC6 A;  5FKL A;  1B59 A;  4MLO A;  4CCO A;  3OYF A;  3BQY A;  5E1W A;  2KZV A;  3RSN A;  3J80 Z;  2E5N A;  4CDG A;  3S1M J;  4B47 A;  2DYR H;  5JVT A;  3OL4 A;  2OER A;  2KJB A;  2LMD A;  4R1H A;  2PI0 A;  1FTT A;  4GFK A;  2DMP A;  4G6D A;  1RKT A;  2VQG A;  3U1K A;  4QTR A;  2X0L A;  2UXH A;  3LJL A;  4GCT A;  1A04 A;  2GXG A;  5JLW A;  4NUB A;  4XKC A;  3GWZ A;  5L3B A;  1FEX A;  3BCA A;  2GOX B;  5JHU A;  2X6W A;  2CU7 A;  2H09 A;  3QYF A;  3CC7 I;  2PMH A;  5EEH A;  5HLH A;  3VSK A;  1MMN A;  4WX9 A;  5IYC J;  2LBF B;  1ZG1 A;  2DG7 A;  3O2P E;  2NYX A;  2R4G A;  3FK7 A;  4MEX F;  1U5T A;  1Y6I A;  3OYJ A;  3HSF A;  2HZD A;  2K27 A;  3EPZ A;  1FT9 A;  5DYM A;  3CC4 I;  3M7G A;  1TBX A;  1VI0 A;  1E3P A;  4KMU X;  2EQR A;  5H9T A;  3OYN A;  3U2R A;  1G3T A;  5GAH J;  4MIM A;  2O0Y A;  5M5Y J;  3UKG A;  2EK5 A;  3TGN A;  2BYV E;  3RJP A;  1BIB A;  4BS9 A;  3KKC A;  2K5C A;  2ZO4 A;  2A61 A;  3OOP A;  2ZCM A;  1RPW A;  2WAQ N;  1L3L A;  3SJM A;  1RUN A;  2FUG 2;  3QOD A;  3DU5 A;  1YE9 A;  2Y31 A;  2EZH A;  2GLO A;  3HTH A;  2ZOZ A;  2IT0 A;  4ICH A;  4D5C A;  5DEQ A;  1Y39 A;  4AUX A;  1D8K A;  2FNA A;  1Z91 A;  2HU9 A;  2IA2 A;  5J6X A;  6PAX A;  4M9S A;  3GX4 X;  3E7Q A;  3FIW A;  2Z5U A;  3A4C A;  2RVC A;  2XRO A;  3D0S A;  3HRS A;  1U8B A;  3V4G A;  2QWW A;  3NI7 A;  4OD4 A;  4A3J J;  4LFU A;  2WY7 Q;  3A1Y A;  4AID A;  1O3R A;  3PIP F;  2X48 A;  3E6C C;  1AHD P;  3LA7 A;  3K1N A;  1MW7 A;  3FX3 A;  4L5J A;  1B9M A;  2BEO A;  3ABK H;  4ON0 A;  3WOD F;  1Z3X A;  3QPS A;  5K7H A;  1EH6 A;  1HKS A;  1FSH A;  5L3C A;  3ESW B;  3PAS A;  4LJZ F;  3SHF A;  1MMD A;  2QIB A;  2Z99 A;  3VYR B;  1I39 A;  2K40 A;  3GZI A;  1MBG A;  1XC5 A;  4ZZL A;  1LPQ A;  1T8I A;  3ZPL A;  1QVT A;  3FM5 A;  5DDG A;  5HNH A;  3EGQ A;  4L62 A;  1OQY A;  4UV8 A;  4CYD A;  1QVU A;  2Z16 A;  1WQ2 A;  2L4A A;  3CCJ I;  3EUP A;  2ACJ A;  4M3F A;  2EIK H;  1ZGJ A;  2J5O A;  3CCU I;  3HE0 A;  1XN7 A;  1FOY A;  4GYG A;  1FYL A;  2FRH A;  4Q4Z F;  1YX5 A;  3MKL A;  4A6E A;  1NK3 P;  3NPI A;  1O3Q A;  5HS7 A;  1T6S A;  1WI9 A;  4BH9 A;  2P6S A;  3AG4 H;  4M6Y A;  3IUV A;  1XG1 A;  2WAQ A;  2AS5 F;  4FET A;  4DYQ A;  4NEL A;  3L2R A;  4AVP A;  3HBL A;  4HX8 A;  2JA6 J;  5BPI A;  1BM9 A;  1OPC A;  1PP8 F;  2LRE A;  4BDZ A;  3VYT B;  5M5X J;  4RBO A;  2GQQ A;  3T1B A;  1FOW A;  2TDX A;  3G3Z A;  3F8M A;  2HZT A;  4CCL A;  4NC8 A;  3HUG B;  4BXX J;  1BI0 A;  4U9L A;  3HG9 A;  3JRD A;  2KDO A;  3ONQ A;  2OI8 A;  1P4A A;  2A2F X;  5K7F A;  2NXN B;  1UHW A;  2OAZ A;  4MHG A;  3RI4 A;  5E18 F;  1BC8 C;  3I59 A;  3P5J A;  5CVJ A;  4D5F A;  4AYB A;  2QSG X;  4JOM A;  1IRG A;  4ESF A;  1G59 A;  3DTE A;  3BR5 A;  1YRN A;  4OIP F;  4G8X A;  2CV2 A;  2GM4 A;  4ZJZ A;  3HOY J;  4HPQ A;  1MBK A;  1RC9 A;  2AQF A;  5L3F A;  2CQ7 A;  3I4M J;  1S9H A;  2XGC A;  3DBH B;  2BGC A;  4XON A;  2DN0 A;  4ZTJ A;  1F43 A;  2EFQ A;  3F8B A;  1TW2 A;  5IPA A;  3BTC A;  3E3V A;  5GTH C;  2LKP A;  1ZG3 A;  2XHK A;  3HOW J;  4C3J J;  3MKW B;  4XSZ F;  4YEJ A;  5EG0 B;  3ZQF A;  3CCQ I;  4HZF A;  1D0Z A;  1VQN I;  3MQ0 A;  4HKU A;  2WGB A;  1WGX A;  2CUZ A;  3VVY A;  1QQI A;  1RET A;  2HVQ A;  2FOW A;  4RM2 A;  3M3Y J;  1EJ9 A;  3DP7 A;  3RPU A;  4ABZ A;  1RRJ A;  1J9I A;  5E8I A;  2VJ5 A;  3HOV J;  2B63 J;  1J0R A;  1FYM A;  1OLT A;  4IHS A;  3JW4 A;  1PYV A;  1HKT A;  3GTG J;  3HRT A;  2OU2 A;  3REO A;  3E5Q A;  1IXC A;  2F4O B;  3ZMD A;  4WCG A;  2OJE D;  2E2J J;  1P2F A;  3CUQ C;  3F8C A;  5J1Y A;  3FMR A;  4CYC A;  2ISY A;  3HKZ A;  3U21 A;  3V7S A;  2XRN A;  2HTS A;  3CCE I;  3I54 A;  2D2W A;  3SFZ A;  3ROU A;  2JVG A;  3V7C A;  4CH7 A;  2P81 A;  5IOZ A;  2HVR A;  3RTR A;  4DQ2 A;  4CSW A;  2WY8 Q;  2KMU A;  2MW8 A;  4Y17 A;  3NAU A;  3K4J A;  2P6T A;  4RAZ A;  1GDT A;  3OOU A;  2ZCX A;  2J5P A;  2WWY A;  4UB8 C;  2NVU B;  3B73 A;  1ETY A;  2F5F A;  2IGM A;  1Q1V A;  4EVI A;  4A3G J;  4YIR X;  3V7R A;  1ITY A;  1FP2 A;  1Z7L A;  4UHT A;  3L2W A;  3LOC A;  2N8G A;  2PMU A;  4AWX B;  3AQS A;  1T33 A;  4XRM A;  1KYZ A;  5EF6 A;  1V5E A;  4KN4 X;  3V8L A;  5HLT A;  1XDU A;  3K4B A;  4B1R A;  1BOA A;  4PZJ A;  1QGP A;  3S1Q J;  4XKV A;  2EV5 A;  3P9C A;  4B09 A;  1FOK A;  3MN2 A;  3WGG A;  1ZGW A;  1F9N A;  1J7K A;  4PFP A;  2PJR A;  1EH8 A;  1LFP A;  2KRH A;  4BXU A;  4U0W A;  4BKX A;  1CF7 A;  2PJP A;  1WWX A;  2TRT A;  5LEK A;  5B5E C;  3ZQI A;  3LAJ A;  1I3A A;  4U88 A;  1FBU A;  3GYH X;  3H1C A;  5B1B H;  1T39 A;  3AG1 H;  1MMS A;  4XSX F;  3WGH A;  3K6G A;  2GIZ A;  3TDU C;  1SMT A;  2JZY A;  3PQJ A;  1VQP I;  5D4S A;  1W7P B;  1AOY A;  3I71 A;  2DXI A;  3C18 A;  1MMG A;  2BXZ A;  2GZW A;  1ZLK A;  1MDM B;  2M7B A;  4AD9 A;  5M3M J;  3KCC A;  2MA3 A;  1F4K A;  4R79 A;  2L9N A;  1MIJ A;  5D5U B;  3GZN B;  3N05 A;  5HLI A;  3IH3 A;  5LHH A;  4HOB A;  2O61 A;  5C4Y A;  1Z6R A;  2JRT A;  3TKY A;  3CLQ A;  1DPR A;  4XOP A;  2LRD A;  3R0J A;  3LSR A;  4AM3 A;  1LUJ B;  3MZY A;  2W48 A;  3PM1 A;  2UV1 A;  1P7I A;  2R7O A;  1XSX A;  3GTM J;  1BW5 A;  4UDS A;  2WA0 A;  1MBH A;  3KZY A;  3S14 J;  4MK6 A;  4A3L J;  3RDI A;  4OIN F;  3DV8 A;  5IP7 J;  5FB2 A;  4S04 A;  1UZC A;  2V79 A;  3HHH A;  1FMV A;  2CSO A;  3KP7 A;  4PJJ A;  4CA0 A;  2QLZ A;  5IY5 H;  2CW8 A;  3RYR A;  5DUI A;  3JTG A;  2X6Y A;  3PNY A;  3I3L A;  1H88 C;  1PUE E;  3WTU C;  3BZK A;  3VEP A;  3K7A J;  3PUB A;  2LYC A;  3GTP J;  4QLC U;  3D5S C;  1BN5 A;  3TL4 X;  4JK1 X;  5CPR B;  3NQO A;  1MBJ A;  3K0L A;  5D18 A;  3QYB A;  4BEH A;  2XAU A;  3ZGK A;  2R0Q C;  1IN6 A;  4UUV A;  1D5V A;  1V5G A;  2ZC2 A;  3IWF A;  3F9K A;  1LNW A;  3NRG A;  1OCT C;  5B1A H;  2XGE A;  3CMM A;  1MJ9 A;  1BA5 A;  5H6Q A;  3BR1 A;  3V42 A;  2YR2 A;  4GFL A;  2HKU A;  1XCB A;  1LQ1 A;  3KLO A;  4CZZ A;  1K83 J;  1VQO I;  1W0U A;  4CCK A;  2ESN A;  1JHF A;  2ZSH B;  1QO0 D;  4XID A;  1A36 A;  2MAB A;  2O5R A;  3LST A;  4BBS J;  1QPM A;  4E70 A;  3JRF A;  3G1L A;  3MNL A;  1MH3 A;  2CQQ A;  1R1U A;  5FLM J;  1WH5 A;  3F8F A;  3L9F A;  3M8J A;  1XX5 A;  3GXO A;  2Q8K A;  1TWF J;  1GVJ A;  2F2E A;  2VT2 A;  3HHG A;  4IRG A;  4HNU A;  2CV1 A;  1JUS A;  3FBI B;  5GAG J;  1X1P A;  3KE2 A;  2CG4 A;  3I0T A;  2Y0S A;  4M3E A;  4HF0 A;  3TO9 A;  2HYJ A;  3GCM A;  2KQR A;  4F92 B;  4AIJ A;  3OWT A;  3K4N A;  2R3S A;  5FRM A;  3FXK A;  4HF1 A;  2W25 A;  3LSH A;  3SEQ A;  1ORK A;  1JKO C;  4ACI A;  3ECH A;  1ON1 A;  2XUB A;  5CLS A;  1IO2 A;  1BW6 A;  4O3M A;  1QRY A;  1HF0 A;  5AON A;  4NN1 A;  5D1R A;  1DGW Y;  1S72 I;  3CMY A;  5TIS C;  2E19 A;  4KMF A;  2BW3 A;  3T8T A;  5DM6 F;  4MTE A;  1USS A;  2R7X A;  1J2X A;  2ID3 A;  3L2U A;  2NS7 A;  4N9H A;  2F5D A;  4YFX F;  4IQ4 A;  4OOI A;  3CES A;  4RGU A;  2AHQ A;  1HDD C;  1HW1 A;  1QA6 A;  5L3E A;  1R71 A;  1SMY F;  2V9P A;  1T38 A;  1LDJ A;  2EIL H;  5TGT A;  2CH0 A;  2IW5 A;  1Y1V J;  1IXR C;  3KEO A;  2GXA A;  1NG6 A;  2LFB A;  3ZMZ A;  1U5T C;  1WJC A;  3H5A A;  2M2E A;  2L9V A;  2B1E A;  3ZMS A;  3LL7 A;  2COB A;  1R22 A;  2HYF A;  2L2O A;  2HXO A;  2M7A A;  5D5V B;  4M9X A;  3A03 A;  4D7M A; 
#chains in the Genus database with same CATH homology
 2PZ9 A;  3BQY A;  4V2G A;  5DS9 A;  2W53 A;  2YU9 J;  1JT6 A;  3S1M J;  1H89 C;  2OER A;  3DCF A;  5EZH A;  4QSH A;  3HTA A;  3RH2 A;  2NP5 A;  3JRE A;  1FTT A;  2ID6 A;  2VI6 A;  3KKD A;  1S7E A;  2DMP A;  2M34 A;  1RKT A;  3JRA A;  1JTX A;  4GFK A;  4JKZ A;  4QTR A;  2UXH A;  3LJL A;  5CXI A;  4GCT A;  4JL3 A;  3HKZ N;  2R5Z B;  3SDG A;  5JLW A;  3BTJ A;  4JX5 A;  2ELK A;  1LE8 A;  2NVQ J;  4W97 A;  1FEX A;  3AQT A;  5F0C A;  4A3E J;  3HIM A;  5C44 J;  3NXC A;  2LP0 A;  2ME6 A;  2CU7 A;  5GPA A;  3OSG A;  4JX6 A;  5FHP A;  5F1J A;  3BTI A;  3QKX A;  4Y7N J;  2EZI A;  4JYK A;  2IEK A;  3LSJ A;  5IYC J;  2HI3 A;  1JJ8 C;  2DG7 A;  3FK7 A;  2ZOY A;  4GCK A;  2DA7 A;  2HOT A;  4J19 A;  3JRG A;  2CUE A;  5E3N A;  4S0H B;  2G7S A;  2M0C A;  2MG4 A;  3Q0U A;  2DA2 A;  3ON2 A;  1LE8 B;  2K9S A;  5C3E J;  3DPJ A;  2R93 J;  1VI0 A;  4RDU A;  3JSJ A;  3S2D J;  2EQR A;  4B4C A;  3L1P A;  4A69 C;  2O7T A;  5H9T A;  1X58 A;  3ZOB A;  5J1R A;  4MIM A;  5M5Y J;  3UKG A;  2MGQ A;  3ZQL A;  4A3D J;  3KKC A;  2WUI A;  1I50 J;  3Q3S A;  5HBU A;  2ZCM A;  1RPW A;  5HAW A;  2WAQ N;  4IHV A;  2DJN A;  2GUH A;  3SJM A;  4L5E A;  2E2H J;  1BL0 A;  2HDD A;  2Y31 A;  2EZH A;  1MH4 A;  2GLO A;  4JNN A;  3HTH A;  3BG9 A;  2CUF A;  2ZOZ A;  4DYC A;  1SAN A;  2Y2Z A;  3HM5 A;  2XPU A;  4D5C A;  4ICH A;  2M8G X;  3PPB A;  2G7G A;  1WPK A;  4AUX A;  2GFN A;  4MFD A;  1IJW C;  1P7J A;  1VF9 A;  3QQA A;  3S15 J;  1JKQ C;  3E7Q A;  3ON4 A;  3FIW A;  2LVS A;  1WH7 A;  1UI6 A;  1JTY A;  3RZD J;  3BHQ A;  1U8B A;  3O8H A;  3NI7 A;  4A3J J;  5IP9 J;  1A5J A;  4IHY A;  2UXU A;  2XGD A;  2FJ1 A;  1TWA J;  3HTI A;  3O60 A;  5FKM A;  2X48 A;  1AHD P;  1ENH A;  2DA1 A;  3C2B A;  3HGG A;  2XPV A;  3CDL A;  4DYR A;  2Y9Z A;  3QPS A;  5K7H A;  2I10 A;  1IV6 A;  2PMZ N;  4A3F J;  3CRJ A;  3PAS A;  2IAI A;  2QIB A;  3CQZ J;  4DW6 A;  5FKK A;  3A02 A;  2K40 A;  1JUP A;  4FE4 A;  2CQX A;  5F08 A;  3GTK J;  3BJB A;  3BCG A;  3GZI A;  1MBG A;  1XC5 A;  3ZQH A;  2LLK A;  4EEF G;  1X2M A;  1F36 A;  2ECB A;  4L62 A;  1QVT A;  4A3I J;  3EGQ A;  3BG5 A;  4LOC A;  1IDZ A;  2K9Q A;  1QVU A;  3EUP A;  4M3F A;  2XPW A;  1VFC A;  2EZK A;  3GTQ J;  3VOX A;  3HE0 A;  1NK2 P;  3KZ9 A;  3HDD A;  4BY7 J;  2H8R A;  5EZG A;  4I6Z A;  2L7M P;  3MKL A;  3NPI A;  1NK3 P;  5FKO A;  1GV2 A;  1TC3 C;  2ME0 A;  3IUV A;  1XG1 A;  4Y52 J;  4PXI A;  1IUF A;  4IEJ A;  2DA4 A;  3WHC A;  5K7Z A;  4DYQ A;  3S5R A;  5EEA A;  4NEL A;  1IC8 A;  1SFO J;  3HBL A;  5FMP A;  5E3M A;  2OF7 A;  2JA6 J;  1APL C;  1JGG A;  4XRS G;  1HCR A;  3HOZ J;  3CJD A;  3HTJ A;  5M5X J;  1JT0 A;  2HXI A;  3JRC A;  4RBO A;  5J1U A;  1EF4 A;  2UXO A;  1WCM J;  3VW2 A;  3Q0W A;  5K58 A;  5D19 A;  1IDY A;  3FIS A;  4KWA A;  4BXX J;  1JJ6 C;  5F0H A;  2NVT J;  1WI3 A;  2VKE A;  3JRD A;  1JUM A;  1UHS A;  2OI8 A;  5EGO A;  3BR2 A;  2KDZ A;  5K7F A;  2XRL A;  4A3B J;  5EG0 A;  2Y0S N;  2OPT A;  3WHB A;  2LD5 A;  1IGN A;  4X6A J;  3VVX A;  3GTL J;  2L7F P;  4D5F A;  1UG2 A;  2QKO A;  1H8A C;  2VPR A;  4M3B A;  3BR5 A;  1YRN A;  2GM4 A;  1ZQ3 P;  3HEF A;  3HOY J;  1MBE A;  5M5W J;  4FTH A;  1MBK A;  3BT9 A;  3CCY A;  3JRI A;  2WV1 A;  3I4M J;  2XGC A;  2L9R A;  2V57 A;  3G1O A;  1R9T J;  4QIW N;  5HOD A;  3V6G A;  2DN0 A;  3NAR A;  1F43 A;  3F0C A;  5EGO B;  5IPA A;  3BTC A;  4NDL A;  3HOW J;  5FKN A;  4C3J J;  3S1N J;  3ANP A;  3A01 A;  5EG0 B;  4D7N A;  3ZQF A;  1IG7 A;  3PO2 J;  3O8G A;  1VND A;  3FKI J;  4FE7 A;  4HKU A;  3IV5 A;  5IP6 A;  1IRZ A;  1WGX A;  3B6A A;  2REK A;  2WGB A;  3VVY A;  1DU6 A;  3S1R J;  1YRN B;  1SGM A;  3BTL A;  1RET A;  3M3Y J;  3TW6 A;  3IH4 A;  5M3F J;  4ABZ A;  2RAS A;  5CW8 A;  5IOY A;  1TWC J;  2R92 J;  3B81 A;  3TW7 A;  3HOV J;  2B63 J;  5DAJ A;  4B3A A;  1ETO A;  3QPL A;  4M6V A;  3LHQ A;  2YS9 A;  3LSG A;  3GTG J;  4A93 J;  1T56 A;  1PUF A;  1ETX A;  1LFB A;  1XS9 A;  3A01 B;  1MNM C;  2WB1 N;  2D5V A;  3RZO J;  2M9H A;  2E2J J;  2DG8 A;  1ZR4 A;  3B6C A;  2JJ7 A;  3RKQ A;  2NVX J;  3BRU A;  5J1Y A;  3E7L A;  4CYC A;  3G56 A;  2DA3 A;  1FIA A;  4MFE A;  2MSY A;  1W0T A;  4BBR J;  1U78 A;  3BQZ A;  1AU7 A;  2O9L A;  1HLV A;  4BY1 J;  2P81 A;  5IOZ A;  3TED A;  3RD3 A;  2CRG A;  3BR3 A;  2MW8 A;  2JA5 J;  2GBY A;  3GTO J;  3NAU A;  2YUS A;  5E3O A;  2FBQ A;  2G3B A;  2LKX A;  1GDT A;  5AQC A;  3OOU A;  2DMQ A;  1PUF B;  2ZCX A;  1ETY A;  2G0E A;  3H0G J;  4A3G J;  1Q1V A;  3HB9 A;  1ITY A;  3W6V A;  3S17 J;  2E2I J;  4YZE A;  3LOC A;  2N8G A;  2XB0 X;  2NX4 A;  4A3C J;  3AQS A;  1T33 A;  4AC6 A;  4XRM A;  4CYC B;  1ZR2 A;  5EF6 A;  1ETV A;  4B1R A;  3S1Q J;  3GEU A;  4JX4 A;  3P9T A;  3VIB A;  2XB5 A;  3MN2 A;  1ZGW A;  1ETK A;  2X6O A;  3SFI A;  5HSZ A;  1QPI A;  1B72 A;  1E3O C;  1UMQ A;  1Z77 A;  4BKX A;  2TRT A;  4M3G A;  3ZQI A;  2JA7 J;  3GTJ J;  9ANT A;  2IU5 A;  2UXI A;  4IHX A;  5EYR A;  2NS8 A;  3D1N I;  1TWG J;  2AO9 A;  3VOK A;  5C4J J;  3HOX J;  5EFY A;  4HNV A;  1JKR C;  2Q24 A;  1X2N A;  1AKH A;  2DMU A;  3T6N A;  3Q0V A;  3LSP A;  3S16 J;  2XSD C;  5M3M J;  3NNR A;  2NP3 A;  1LFU P;  4I76 A;  1RKW A;  3BG3 A;  1B72 B;  1D5Y A;  3QBM A;  3IH3 A;  1UI5 A;  5C4Y A;  3H3V K;  2ECC A;  2DMN A;  1K61 A;  2R5Y B;  3LSR A;  2W48 A;  3PM1 A;  1P7I A;  2D6Y A;  1FTZ A;  1ZKG A;  1ZTR A;  3RQI A;  5GPC A;  3GTM J;  1BW5 A;  5C4X J;  2DA5 A;  4UDS A;  5F0F A;  4A3K J;  1B8I A;  4UUS B;  1AKH B;  1U9N A;  5JLX A;  1RES A;  1MBH A;  3S14 J;  4MK6 A;  1MBF A;  4M3D A;  3TP0 A;  2HQ5 A;  1CQT A;  4A3L J;  4JP0 A;  2EZL A;  3FRQ A;  4XIC A;  5IP7 J;  5DTD A;  3VVZ A;  4A3M J;  4FCY A;  5F27 A;  2XDN A;  2HOA A;  3OIO A;  3NRG A;  3VUQ A;  2LY9 A;  3IH2 A;  2JA8 J;  3G7R A;  5E3L A;  4IHW A;  3V78 A;  2E1O A;  2O7O A;  1GV5 A;  5GP9 A;  3BR6 A;  1H88 C;  2H1K A;  1G2H A;  2FD5 A;  3TP3 A;  3K7A J;  3JR9 A;  3I4N J;  1B8I B;  1POG A;  2K9N A;  3LNQ A;  3GTP J;  4FIS A;  2ZB9 A;  2G7L A;  1Z0X A;  1JKP C;  2HYT A;  4XRS A;  4XK4 A;  4C3H J;  2LK2 A;  1MBJ A;  2RHA A;  3DEW A;  5D18 A;  1GVD A;  1I6H J;  3COL A;  2R0Q C;  3G1M A;  2JK3 A;  3K2A A;  3ZQC A;  2GEN A;  1OCT C;  4MXM A;  2XGE A;  1ETQ A;  3JRB A;  5FLV A;  2JMW A;  1MSF C;  1BA5 A;  3BR1 A;  5FGL A;  4GFL A;  2HKU A;  3VW1 A;  2Y9Y A;  1OFC X;  2YVH A;  2VKV A;  2RAE A;  2EH3 A;  1U9O A;  5IYD J;  1K83 J;  4DZP A;  1W0U A;  1BJZ A;  2HOS A;  1FJL A;  3VPR A;  3CWR A;  1NTC A;  5EDN A;  2DMT A;  4XID A;  2FQ4 A;  4BBS J;  2X9D A;  3JRF A;  3G1L A;  3MNL A;  1MH3 A;  2CQQ A;  5FLM J;  1WH5 A;  4X1E A;  4C2M J;  4GCL A;  5BNG A;  1TWF J;  1FIP A;  1I3Q J;  1OCP A;  2LTP A;  1JUS A;  1DU0 A;  2EBI A;  4M3E A;  2UXP A;  2O8K A;  3M4O J;  2HYJ A;  4ME9 A;  2CJJ A;  1GT0 C;  5FJ8 J;  3BNI A;  2PBX A;  3ANG A;  4CGR A;  2F07 A;  3VP5 A;  4AC0 A;  1ORK A;  1Y1W J;  1JKO C;  4ACI A;  2QTQ A;  2QF7 A;  3BR0 A;  2DA6 A;  2NVY J;  1BW6 A;  2ZCN A;  3F1B A;  1QRY A;  1HF0 A;  4NN1 A;  2JWT A;  5D1R A;  1O4X A;  2QWT A;  3S2H J;  1RR7 A;  3CMY A;  2IBD A;  3HOU J;  2DTZ A;  1HOM A;  3FK6 A;  2E19 A;  1GUU A;  3PO3 J;  4AYB N;  3JRH A;  5J3L A;  2QCO A;  4DZJ A;  2ID3 A;  2NS7 A;  2VUM J;  3HGY A;  2LR8 A;  3GBG A;  3MVP A;  2NOG A;  3ZQG A;  2YVE A;  1TWH J;  1ETW A;  1HDD C;  1A6I A;  2AHQ A;  5CXG A;  3OSF A;  4W1U A;  2R5Y A;  1ZK8 A;  5F04 A;  4G12 A;  3KNW A;  2FX0 A;  3LWJ A;  2L7Z A;  4AF5 A;  1OJL A;  4MO7 A;  4V2F A;  4GFB A;  1Y1V J;  2TCT A;  5IYB J;  4UUS A;  2LFB A;  2KT0 A;  1HDP A;  2L0K A;  2QOP A;  2M2E A;  2JN6 A;  2R5Z A;  2R7Z J;  2COB A;  4UUT A;  2HXO A;  4C3I J;  3C07 A;  1MSE C;  2Y30 A;  3VW0 A;  3A03 A;  5FKL A;  4MLO A;  4D7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...