3HGYA

Crystal structure of cmer bound to taurocholic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
202
structure length
202
Chain Sequence
b'TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CmeR
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: crystal structures of CmeR-bile acid complexes
rcsb
molecule tags Transcription repressor, drug binding
total genus 75
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hgyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hgyA02
4I76A 1UMQA 5C4JJ 5IOZA 1TWGJ 3UKGA 3JRGA 1B72A 1BJZA 2DN0A 1JTYA 5C3EJ 3BTLA 3DPJA 2DMPA 1ZKGA 2YUSA 4Y7NJ 3OIOA 2FBQA 5FLMJ 3LNQA 2GM4A 2H8RA 3BR1A 1AKHB 1ZK8A 2V57A 5EDNA 1RKWA 4ACIA 3BR0A 2O7TA 3HOXJ 1WI3A 2LY9A 5EZHA 1JUMA 2HI3A 3JREA 3JRHA 4BY1J 4IHVA 3HOWJ 1A5JA 1OCPA 4A69C 4MIMA 3ON2A 2HOAA 4C3JJ 1FTTA 4DYCA 2JJ7A 3FISA 1FIAA 2ELKA 3BR2A 3LSRA 2JN6A 3JRBA 3S2DJ 5FKOA 5J3LA 4GFLA 3ZQHA 1B72B 1PUFA 3JRFA 4MFEA 4FTHA 1Y1WJ 4XICA 5FLVA 2EQRA 1JKRC 2VKEA 4A93J 5JLXA 2N8GA 3BR5A 5FMPA 3NRGA 4A3FJ 2Y31A 2F07A 1U9NA 2NVTJ 2DMQA 1UHSA 4M6VA 2OPTA 5H9TA 5EYRA 2CRGA 4QIWN 2UXIA 4B1RA 3HTIA 3LHQA 3NARA 5F1JA 5FKLA 4NDLA 2TRTA 1ETOA 3W6VA 1EF4A 2W53A 3V6GA 4A3MJ 3PM1A 4BY7J 3VPRA 3EGQA 1SFOJ 1QRYA 2XDNA 3C07A 1U78A 3VW2A 1U8BA 3HOYJ 3ON4A 4JYKA 1PUFB 1ETYA 2DA4A 3TP3A 2Y9ZA 5M5WJ 4GFBA 3LJLA 3S1RJ 5FGLA 4G12A 1CQTA 3IH4A 5EFYA 5F0HA 4M3BA 3BG3A 1MBKA 2K40A 2G7SA 4BBSJ 2QCOA 5HAWA 2FQ4A 2M8GX 2ME0A 1MBFA 1ETXA 3M3YJ 2YVEA 4BKXA 1FEXA 3NXCA 2JA5J 3G7RA 3IH2A 3JRDA 1P7IA 4M3FA 3ZQIA 2JWTA 3BR6A 5M3MJ 1LFUP 2JMWA 5CXIA 2LTPA 2NS8A 3BJBA 2EZIA 3B6CA 3Q0VA 3I4NJ 4S0HB 5IPAA 3BQZA 5J1YA 1W0TA 1RKTA 1NTCA 3QBMA 1JT6A 4X6AJ 3A03A 1MNMC 2IEKA 4ABZA 3GBGA 3HB9A 3RH2A 5HSZA 3BG5A 1GVDA 2W48A 2X9DA 3E7LA 1AU7A 3K2AA 2LR8A 2H1KA 3B81A 4AC6A 1UI6A 1LE8A 1JTXA 2XB0X 2L7MP 4D7NA 2K9SA 5D18A 4RBOA 1B8IB 3PPBA 4CYCA 2DA5A 1HLVA 2ID3A 3HIMA 1BA5A 2L7ZA 4GCTA 1JKOC 2NVQJ 1OFCX 4ICHA 4J19A 2LD5A 3S15J 4AF5A 3SDGA 1NK2P 3BG9A 3RZOJ 2VUMJ 3S5RA 2Y30A 3HTAA 1FTZA 3HGYA 4BXXJ 1ITYA 5F08A 2QTQA 4L62A 3OSGA 2HXIA 1JT0A 2GLOA 5K7HA 2AO9A 4EEFG 1AHDP 3PO3J 1RESA 1WH7A 2M34A 4IHWA 3HKZN 5DAJA 2E1OA 4BBRJ 2IU5A 4GCKA 3BTIA 2DA2A 1HDPA 1ZR2A 4IHYA 2NOGA 2XGDA 2DA3A 5GPCA 1X58A 2EBIA 3ZQFA 3CMYA 3HTJA 4XIDA 2M2EA 1IC8A 5C4YA 1XS9A 2WV1A 2GUHA 1JUSA 2DJNA 2XRLA 1LE8B 2CU7A 3GTPJ 4CYCB 3LSPA 2Y0SN 4LOCA 1HDDC 3VOXA 1QVUA 5CW8A 4L5EA 4JNNA 2R5YA 1ZQ3P 1TC3C 2DMNA 2LP0A 3LOCA 1O4XA 1H8AC 3GTQJ 3MNLA 4MK6A 3QPSA 4XK4A 2VI6A 3AQSA 5IYCJ 2CQXA 1TWAJ 2XPUA 2QIBA 5EG0B 3ANGA 2CQQA 3B6AA 1IDYA 4NELA 1TWFJ 2FD5A 3K7AJ 5DS9A 2HOSA 4ME9A 2JA6J 2JA7J 3GTOJ 2EZLA 3VVZA 2YU9J 2ME6A 5J1RA 2HDDA 2UXUA 2O8KA 1IDZA 1HOMA 1GDTA 3HOZJ 5FHPA 3KNWA 3A02A 4KWAA 4A3IJ 4DZJA 3V78A 4GFKA 5F0CA 2OI8A 1JKQC 3S1MJ 2XPWA 5IYDJ 2R0QC 5FJ8J 2R5YB 2Q24A 2PBXA 3BCGA 3JRCA 3OOUA 2NVYJ 2ZB9A 4JP0A 2HQ5A 3FKIJ 1JGGA 1I6HJ 4HKUA 3GTLJ 3AQTA 2FJ1A 3WHCA 1ETWA 4I6ZA 1E3OC 1ZTRA 2I10A 3A01B 2P81A 3CCYA 3CQZJ 2R5ZA 3F1BA 5FKMA 1VNDA 1BW6A 3NNRA 2EZHA 4JX6A 5F27A 4JX5A 4DYQA 1ZGWA 1VF9A 1APLC 3TP0A 3OSFA 4A3LJ 1MBEA 1IUFA 2HOTA 2FX0A 3E7QA 1F43A 2K9NA 3NAUA 2TCTA 2YVHA 2LKXA 1X2MA 3Q3SA 1A6IA 5F0FA 3LWJA 4XRMA 1IG7A 3BRUA 2NP3A 3S1NJ 3S16J 4UDSA 5M5XJ 3S17J 3CRJA 2KT0A 2XB5A 4JL3A 1FIPA 2MGQA 5IP9J 3BNIA 1B8IA 1SGMA 3GTKJ 2EZKA 1X2NA 3WHBA 2G7GA 2DG7A 3BHQA 3HOVJ 2UXHA 1W0UA 1IJWC 1UI5A 3KZ9A 5IP7J 2NX4A 3Q0WA 3VW0A 3IH3A 4QSHA 4A3CJ 2QWTA 3T6NA 2QF7A 2K9QA 2LFBA 2R5ZB 1Q1VA 5IYBJ 3HBLA 2DA6A 4A3DJ 4C2MJ 1QVTA 3RZDJ 5EEAA 2Y2ZA 4FE4A 1Z0XA 3F0CA 3JRAA 2XPVA 1D5YA 2ECBA 4MO7A 3HEFA 2ZCNA 2X6OA 2YS9A 2XGCA 2MSYA 4UUSA 1JJ8C 4D5FA 2RHAA 2E2HJ 2UXOA 2DMTA 2NP5A 2RAEA 3MN2A 3FK7A 3O60A 3NI7A 1T33A 3JSJA 1WH5A 4PXIA 2LVSA 5IOYA 4B3AA 4DYRA 5C4XJ 1G2HA 2DA7A 2WUIA 3G56A 4A3JJ 2LK2A 1WCMJ 3LSJA 3COLA 5EG0A 3JRIA 3RKQA 1Y1VJ 1H89C 2WB1N 2GFNA 2MW8A 2DMUA 3MVPA 3D1NI 1GV2A 1T56A 3ZOBA 1ZR4A 2HYTA 2EH3A 2DG8A 1RETA 4D7MA 9ANTA 4JX4A 3I4MJ 5JLWA 2QOPA 4UUSB 4C3IJ 2VKVA 2OF7A 2G7LA 3P9TA 3G1OA 4IEJA 2G3BA 1POGA 3ZQGA 1XC5A 3Q0UA 2VPRA 5E3MA 2R7ZJ 1DU0A 2XSDC 3VW1A 1GUUA 2D6YA 1ETKA 3ZQCA 3RQIA 4DW6A 3LSGA 3IUVA 1I3QJ 2ZCXA 3O8HA 1S7EA 1NK3P 3BTJA 3NPIA 3EUPA 5M5YJ 3HM5A 4C3HJ 2CUFA 5K7ZA 1ORKA 1FJLA 2O9LA 3A01A 3VOKA 4YZEA 4W97A 4HNVA 1QPIA 3GTJJ 3O8GA 2OERA 5E3NA 1VFCA 2E2JJ 3CWRA 2WAQN 5CXGA 4B4CA 1MSEC 3KKDA 1U9OA 2O7OA 2E19A 3TEDA 5K58A 2M9HA 2JK3A 2ZOZA 1IGNA 3HE0A 3KKCA 1YRNA 4AYBN 1VI0A 3H3VK 4A3EJ 3PASA 5K7FA 5GPAA 2JA8J 3CDLA 4XRSA 5FKKA 3TW7A 2COBA 4FCYA 4DZPA 3SJMA 3H0GJ 2Y9YA 1K61A 1UG2A 1BW5A 2GBYA 1K83J 4CGRA 1JJ6C 1OCTC 4M3EA 3BR3A 2G0EA 4X1EA 3G1MA 4V2GA 2UXPA 2DTZA 3FIWA 4Y52J 2ZOYA 3VP5A 2L0KA 1JUPA 4RDUA 3DCFA 2PMZN 1GT0C 5M3FJ 3VVXA 1DU6A 1JKPC 5GP9A 1YRNB 4QTRA 3S1QJ 4A3BJ 4FE7A 1ETQA 3HDDA 1HCRA 2DA1A 5DTDA 2CUEA 1H88C 1MSFC 2HXOA 2XGEA 1ENHA 3VUQA 1IV6A 3M4OJ 2E2IJ 3RD3A 4NN1A 4JKZA 1I50J 1WPKA 4V2FA 3HTHA 4AUXA 3ZQLA 3FK6A 3SFIA 4D5CA 3S2HJ 1MBJA 1OJLA 4M3DA 1RPWA 2AHQA 5J1UA 2D5VA 2M0CA 2IBDA 5EGOA 2GENA 4GCLA 2ID6A 2IAIA 1MH4A 1P7JA 5AQCA 1XG1A 4W1UA 4FISA 3BQYA 2REKA 2R92J 5FKNA 3PO2J 4UUTA 4MXMA 3IV5A 2L9RA 3ANPA 4A3KJ 1Z77A 1GV5A 2MG4A 5IP6A 4M3GA 3TW6A 2CJJA 1TWCJ 2X48A 5HODA 3DEWA 1HF0A 2ECCA 2LLKA 3G1LA 2HKUA 1TWHJ 3GTMJ 1F36A 3HGGA 5E3OA 4MLOA 3FRQA 3GEUA 5HBUA 4IHXA 5E3LA 2QKOA 4AC0A 1R9TJ 2L7FP 5D1RA 1RR7A 3QPLA 5F04A 1ETVA 5EGOB 1MH3A 1MBHA 1AKHA 5D19A 3L1PA 3GZIA 3VIBA 2PZ9A 3JR9A 1BL0A 1SANA 2ZCMA 4MFDA 3QQAA 2HYJA 4A3GJ 3VVYA 3C2BA 2KDZA 1IRZA 2NVXJ 2RASA 3CJDA 2B63J 2NS7A 2R93J 5EZGA 5C44J 1LFBA 5EF6A 1WGXA 3BTCA 5BNGA 2WGBA 3S14J 1MBGA 3HOUJ 4XRSG 3BT9A 3QKXA 3MKLA 3GTGJ
chains in the Genus database with same CATH superfamily
4I76A 2LG4A 1TWGJ 2FNAA 3JRGA 3UKGA 2D1VA 3FMQA 5ICCA 4U7DA 3J7ZI 3FXQA 3DKXA 2V26A 4IJAA 4Y7NJ 5KAFC 1WFXA 3HXLA 2GM4A 2V57A 2LREA 3F8MA 3CCMI 1RKWA 2W24A 3FMRA 1I3AA 5HDKA 5EZHA 1Z3YA 5ILUA 2QENA 3G2BA 1FP2A 4KA4A 4MIMA 3ON2A 5CPRB 1FTTA 2F48A 5LD2C 5KCMA 2LF8A 1MGTA 3ROUA 4U88A 2ELKA 2JN6A 3RSNA 2FU4A 3FMSA 5H6QA 1FYKA 2DCEA 4MFEA 5E79C 2V9PA 4PJLA 2EQRA 2VIXA 4AVZA 1YJWI 4NUBA 3CCVI 5JLXA 1NH3A 2F5CA 4I01A 5D8KB 2B1EA 3VOEA 3NRGA 2CV2A 4OOIA 2QQAA 1E3HA 3BDDA 2F07A 1R71A 2DMQA 2JSCA 2KISA 1GVJA 5HS8A 3NRVA 1D3YA 3HYIA 3EPZA 1EJ9A 3HTIA 3BG7A 2E1MB 4NDLA 2ZC2A 3SYTA 1SAXA 1ETOA 1EF4A 3K6GA 2EFNA 3KP3A 1FC3A 3HG9A 2KDOA 4HW0A 5EEGA 3PM1A 4BY7J 3VPRA 3RDIA 2KPMA 5ICGA 3K69A 3VW2A 2A5WA 3ON4A 1MD0A 1MNEA 2MC4A 4UB8C 2NRAC 5H6RA 2GXBA 1Z6RA 1PJRA 2G7SA 2ZSHB 2O03A 1ZRFA 1WVRA 4GGGA 2VN2A 4XKCA 2ME0A 4HQEA 1MBFA 3DPUA 1FEXA 2ZMEA 3NXCA 5D5UB 3MKYB 3HTUA 4RS8A 3IAM2 3HZJA 3L2WA 3S3MA 4QPOA 4OU0A 1Y6IA 4XQFA 2EZIA 3B6CA 2NYXA 2CS3A 3Q0VA 4KFCA 3VTIA 2DJIA 4XLPF 2E7WA 1H9GA 1W0TA 2K3PA 3A03A 1BIBA 4YG2F 1ZAOA 1NG6A 1Z6TA 4LLGF 4WF2A 4ABZA 3GBGA 2V79A 5GTHC 3BG5A 3E7LA 3GW2A 3WTYC 3K2AA 3D5SC 3BJOA 4EJVA 1TQPA 1D0ZA 3CLQA 1W7PB 5D18A 4YFNF 4CYCA 5B1BH 2ZMEB 3ZCOA 2OQGA 1JKOC 3ZN0A 1SMYF 4ICHA 1W4MA 2W00A 3S15J 1WI9A 5J40A 2VUMJ 3S5RA 2X51A 3HTAA 4MQVA 4ON0A 1IZ1A 1EA3A 2QTQA 2QVOA 3SXYA 4EEFG 1LVAA 1BC8C 3I58A 2IA0A 3F23A 4M9XA 2VE8A 3CO7C 1KGSA 2VJ5A 2ZJ2A 2IU5A 2DA2A 1X1DA 4ENKA 1TQMA 4RAGA 2M87A 3AG3H 1HW5A 3DKWA 4U87A 4HV6A 1J5YA 4DGWB 1O3RA 2VBYA 2DYRH 1UB9A 4CYCB 3NWTA 3S93A 1B6AA 4XOTA 2ZXHA 1WZ2A 2Y0SN 1QVUA 2Z5UA 2DDBA 2R5YA 1ZG5A 1TC3C 1ZQ3P 5FRMA 1H8AC 3J80K 3GTQJ 2STTA 3H9GA 4XK4A 2WA0A 4B8XA 3OL4A 3DLLF 4I2OA 3GWZA 3CC7I 3OYBA 5EG0B 4LJZF 2KRHA 1KZHA 1ZREA 1IDYA 3HSEA 5DD4A 2R7SA 3M7GA 2FD5A 3K7AJ 4EM0B 3TBIA 2JA6J 3E5XA 5E17F 1ZARA 4WK8F 3RKYA 2PFVA 5J1RA 2HDDA 2O8KA 5L3DA 4IL6C 3W6JB 1T08B 4A3IJ 1Q1HA 1XSVA 4WX9A 1EV7A 2DYSH 1D5VA 1LDKB 4L5IA 1JKQC 4KIBA 4FX4A 4U0YA 3WU0A 5DD8A 5IYDJ 2ZSIB 4NC6A 2R5YB 1ONVA 2HKXA 2HU9A 5LEKA 3JRCA 5HLHA 1I6HJ 2HQ5A 5BS6A 3DEUA 2P8TA 2R7FA 2KIQA 1ETWA 1GXPA 4HLXA 5L3EA 2XROA 1DUXC 3WGIA 3OYNA 2JSPA 1WJAA 1XX5A 3N4MA 3BZKA 3ISPA 3F1BA 5D6FA 2EZHA 4DYQA 1TT0A 2FE3A 4A3LJ 4XR6A 1YIOA 4U9NA 2OBPA 3E7QA 3MCZA 1X3ZB 2A5YB 2F6CA 4HQMA 1G6NA 2K5CA 1G3SA 2ZXJA 4E70A 2NP3A 3ASNH 5JFRA 4DJAA 1A6QA 1YS7A 5FFZA 4CZCA 3GTKJ 2EZKA 3WHBA 4CCJA 5JHUA 1XDSA 5B1AH 2QSHX 2FBKA 4TV7A 3HOVJ 1E3PA 2UXHA 1IJWC 3LL7A 4UY8I 5IP7J 3HRSA 3Q0WA 1JI8A 3OYAA 4G6QA 4Y3OA 5D5XB 4A3CJ 3IL2A 4LLNA 2K9QA 2LFBA 2HNHA 1UHMA 3JAMZ 1IN4A 2K3FA 4C2MJ 5DCFA 1QVTA 2IGNA 2K4BA 3K8PC 1Y56A 2K02A 3WU1B 1XPXA 2DFEA 1D5YA 2HQNA 3OYHA 1PYVA 2F5VA 4UUSA 2QQ9A 2RHAA 2IA2A 2EILH 4BACA 1CGPA 2RAEA 3KEQA 3OIPA 3TO9A 2LH9A 4UVBA 3MN2A 4EM2A 1I39A 1QPMA 4CYDA 3OR1C 4HYEA 1QZYA 2HVRA 1R1TA 3JSJA 2YX4A 1XSDA 1SVOA 3G56A 1JHFA 2IPQX 5FO5A 3OYJA 2CUZA 1D1AA 2DQLA 3COLA 1XDUA 2ICWG 4OAZA 1WHUA 5EEHA 1WJ5A 3RKQA 3C2GA 2D45A 3COAC 3WTWC 4A6DA 3CMAI 2HYTA 3ZOBA 2W1OA 3GXOA 4HNTA 2EH3A 2YU3A 3R61A 4D7MA 4LG3A 9ANTA 3EUHC 4A5MA 5JLWA 3QODA 3S3OA 5CJ9A 1YOVB 4ZYGA 4UUSB 4ZYHA 1KQ8A 2XAJA 3KZYA 1RC9A 2H8WA 1YJ9I 4CH7A 4HNUA 5E1WA 2R7ZJ 4QPQA 2D6YA 2X4HA 4LB6B 1T39A 1OLTA 1I3QJ 3CJNA 2P5LC 5E1XA 1T0FC 2K85A 5M5YJ 1MJ9A 2B7EA 2F4OB 4C3HJ 1EH8A 1FJLA 3OR2C 3VOKA 2L02A 4HF0A 3G3ZA 4HPQA 4U0VA 3T5XA 3FX3A 3ZN1A 1R5ID 5E3NA 1WJBA 3ERED 1NG7A 2WAQN 5CLSA 1MSEC 5L3BA 2M7BA 3IKVA 2E19A 3TEDA 1YYVA 1VQ7I 2L5QA 4E7HA 3PL8A 3KKCA 4KMUX 2GIVA 3HRTA 2V4JC 4AYBN 4KUMA 3WE3A 2R7DA 4D0PA 2JPCA 2FBIA 3OIQA 4XLNF 2HVSA 1GHCA 2DDAA 2DTRA 4BHCA 1ZRCA 4QWQA 2P5KA 3E3VA 3CDLA 4B43A 3CCEI 4LB5A 4LITA 2COBA 2XAHA 5LRSA 4HX4A 1TNTA 2Y9YA 4XNFA 4CGRA 1JJ6C 3BY6A 2BY2A 4N4OB 2IGMA 4X1EA 3I3LA 2IP2A 4LLLA 3MZ8A 3ZMVA 3OYEA 2KJBA 1USSA 5GAEJ 2W82A 2GQQA 1FMWA 3C1DA 3VP5A 2WB1A 4GDFA 4RDUA 3DCFA 1GT0C 3REOA 5CVJA 3SHFA 4KIGA 3F8CA 3EETA 4A3BJ 1ETQA 1FBQA 1OISA 1ENHA 2E2IJ 1VQ6I 3IAS2 1IW7F 1QA6A 2EV6A 1FNNA 3TOAA 2PFBA 4V2FA 2R7QA 4BXUA 2FMYA 4RB3C 1S9HA 3FXOA 2WWYA 2LBFA 1KQ9A 2HYFA 1QZZA 4DOZA 3G71I 1FOKA 5EGOA 4GCLA 2A05A 2DFHA 1YW8A 2CMPA 4ZDOA 1P7JA 4KITB 2ESNA 1EH6A 2PN6A 2KZVA 2YX7A 3PNTA 3BQYA 1W1WE 4OAYA 1UHWA 4L5JA 1X1CA 3I53A 3CP2A 2L9RA 2X0LA 4EJOA 4A0XA 2F4IA 1FT9A 2MG4A 3ULQB 2CW7A 1X4OA 1RNLA 1TWCJ 2X48A 5HODA 2DBBA 3DU6A 5GADJ 3G1LA 2LLKA 2GOXB 1F36A 4IPAA 2LC2A 2ZNYA 1N75A 4HRIA 3VEPA 2LBFB 4AC0A 2GXAA 2CQNA 2LKPA 1RR7A 2CUJA 1V5FA 5EGOB 1T38A 1AKHA 1LNWA 2R7UA 2P7VB 2VQCA 3VYTB 1R4NB 2ZCMA 2IW5A 4A3GJ 4PJ0C 4HA8A 4A0ZA 2ADUA 5BPDA 4B09A 1QU3A 1SFKA 3JCUC 2ELHA 4U0WA 3HPHA 1ON1A 5EF6A 1WGXA 2M30A 3LAPA 2WGBA 4UUVA 3L09A 3HUGB 1MBGA 2BE5F 4CICA 2VKHA 3OYCA 1ZYRF 1UMQA 2XASA 5GTIC 3F22A 2VXZA 2R7RA 1ZH5A 4XMYA 2DN0A 2Q8KA 2Z3YA 3BTLA 2L9SA 2DMPA 1AWCA 2YUSA 2V1UA 3OIOA 1IN5A 3RPUA 5J6XA 5BOXA 3BR1A 1AKHB 4XSZF 4IXAA 1SEUA 1XD7A 2EINH 4NQWA 3I54A 1BR4A 4JBAA 4EGYA 3J80Z 5DCMA 1T98A 1FYMA 4R8HA 4BY1J 3HOWJ 1A5JA 4A69C 1PP7U 4BHPA 3L7WA 3MEXA 3M1EA 4M6XA 1FPQA 3FZVA 4CCLA 4XM3A 3FISA 1FIAA 2GXGA 3M8EA 5KVRA 5AIQA 1BJAA 2VBZA 3D5RC 4E7SA 3LSRA 3JRBA 4GFLA 3VWBA 1DDNA 2HVQA 3ZQHA 4FASD 2ISYA 1ERDA 2FOWA 4HSRA 1Y1WJ 1J09A 3DF8A 1KONA 1WJEA 3E0JB 4Q47A 4A93J 2VKEA 3OY9A 2N8GA 2W25A 4C2TA 1STZA 1Z3XA 4NQWB 1QGPA 3R60A 4E7IA 3EUHA 2L54A 2M0MA 2IGKA 4YIFA 4YEJA 4M6VA 2HTSA 2K9MA 2RGVA 2O61A 5H9TA 5EYRA 4R1HA 1BR2A 4QIWN 1UCRA 5F1JA 4BE1A 2O5RA 2TRTA 3WTTC 3LA7A 3W6VA 2DXIA 3FDYA 3OYDA 3HTSB 4I0BA 2FOKA 2QEXI 4IRVA 3VYRB 1SFOJ 2LDUA 1QRYA 4L9NA 3C07A 1O3TA 1ZELA 1T0FA 3F72A 4JYKA 5LHGA 2M4GA 3ZR8X 2E34A 3OS1A 3G4SI 4IO9F 4G7OF 2XV4S 3GX4X 3BLYA 1L0OC 3TP3A 5M5WJ 3ZQQA 3H3UA 3S1RJ 4GFBA 3LJLA 5FGLA 1CQTA 1UG0A 5F0HA 3WE2A 2BXYA 3KLNA 2WY7Q 2MABA 1KU7A 4BBSJ 2DLLA 3ESWB 1W5TA 2XSJC 4KT6A 2OCCH 3GUDA 1KYZA 1X3UA 3K4NA 2UZKA 2FQ4A 2M8GX 4HX8A 4LG0A 2NOJB 1HW1A 2K86A 4BKXA 4G6TB 2H6CA 1KA8A 3KCCA 2UWMA 1V3FA 1IRXA 1X19A 3D5LA 2JWTA 3BR6A 5FD5A 2H09A 2LTPA 1WKMA 4F7ZA 3RKWA 2VJJA 5B3SH 3IP4B 2HWVA 3K4BA 2LSOA 3I4NJ 3ZXSA 1K4TA 1DPUA 4XONA 1LPQA 5IPAA 5J1YA 2JRTA 1V55H 1NTCA 3VSKA 1YITI 2LMDA 2FSWA 5J4YA 4AIJA 1OYWA 2IEKA 4RGRA 2LNBA 1BOBA 3K2ZA 1GVDA 3EUKL 1AU7A 3PJRA 1SD4A 4MQ9F 2IJLA 1P4XA 4DNCA 1BM9A 3ERMA 2XB0X 4D7NA 1A35A 4LG0B 2EIMH 4L0YB 5IY5H 2ID3A 2AXTC 2VOPA 4C30A 1VQPI 2LOOA 2HZDA 2NVUB 2DOEA 2LD5A 4M71A 2OTLI 4IQ4A 3F9KA 3SDGA 4XLEA 1NK2P 3BG9A 1BN5A 2WADA 4C2UA 3NQOA 5AIPA 4GYGA 1ITYA 2AXLA 3ONQA 5F08A 2XAFA 1A04A 1M1EB 4HLYA 1JT0A 3ZPLA 1FOWA 2M34A 2X85A 4BBRJ 2M7AA 3QAHA 4B3XA 1ZR2A 3QOPA 4GCKA 2YSRA 2DA3A 2A6HF 2O8XA 1SVLA 5GPCA 3I64A 3CC2I 1IC8A 3N97A 3ML6A 3SZGA 4EJWA 2GUHA 2DJNA 2EA4A 2Z99A 2CU7A 1P92A 4IQJA 1R23A 3GO5A 2R7OA 4DBRA 2VLAA 1SD5A 4YIIA 4XKVA 4IZZA 5CW8A 2B9SA 4JNNA 3W2WA 5JVTA 4JK1X 2JT1A 3VDXA 4MK6A 3IUOA 2FNPA 3QPSA 2H94A 4CGZA 3MMYB 5IYCJ 2CQXA 3ANGA 3CCLI 3C2HA 3PUFA 2IS6A 3DTEA 3B6AA 1XCBA 2EJRA 5CVIA 4NELA 4RAYA 5GAGJ 2KJCA 1TWFJ 4A12A 2ZNZA 1XMXA 1VQLI 2RREA 1Z1DA 4EM1A 4WCGA 3WTXC 2P0WA 2E71A 4NNJA 1LEBA 3B02A 3DBRB 2UXUA 3A2KA 3LFKA 1HOMA 3X2QH 1GDTA 5FHPA 2PMHA 2E35A 4L9TA 3QOEA 4GFKA 1FYLA 2DAOA 5FJ8J 2KZGA 1J59A 2DOAA 3SFZA 4CDGA 4A0YA 2PBXA 4JP0A 1JGGA 3GTLJ 3AQTA 1X4PA 1S3JA 4CXFA 2CSOA 1FSEA 2VL8A 2VXDA 2I10A 3F8NA 2K27A 2X6YA 3A01B 3CQZJ 5E18F 2QWWA 2R5ZA 2HS5A 2A61A 3U1KA 5FLXK 2AQFA 2LY2A 4E6KG 1APLC 1KU2A 1DPRA 2HOTA 1VQ4I 1IV8A 2K9NA 2KIMA 2TCTA 3NAUA 2Y0MA 3HKZA 4LFUA 5F0FA 1IG7A 3S1NJ 4UDSA 3CRJA 2XB5A 2M8EA 3V8KA 1FIPA 5AONA 3OMYA 2FJI1 1W7PA 3HHHA 2PQ8A 3BNIA 3BCAA 2CO5A 3H3ZA 2DG7A 1MZBA 3RKXA 3KZ9A 4BQNA 2DK5A 3A0HC 3CLOA 2A68F 3CMMA 2STWA 2HTJA 3GZNB 3OOPA 3PNYA 4QSHA 5D5VB 1DP3A 3T6NA 5DUKA 2XDVA 2R5ZB 1QBJA 2AS5F 2OUMA 2MH2A 4ENMA 4A3DJ 2UUZA 3K0LA 4DQ2A 5EEAA 3I56I 3JRAA 4HG2A 2M1BA 1O3SA 1T8IA 3FXRA 1F4KA 3HEFA 4NC7A 2A6EF 3AKZA 2VKDA 2YS9A 2DFIA 2P6SA 2XKPA 2UXOA 1B1BA 2PMUA 2IS1A 4KT5C 2JQ7A 3GFLA 2BW3B 3O60A 3OL3A 3MKZA 1MDMA 3NI7A 2F2EA 4DYRA 4E7JA 2LK2A 1HW2A 3EUAA 3JTGA 4CHUA 4S04A 4N9IA 2M3AA 5EG0A 4X0GA 1IXRC 5DYMA 3V7SA 1H89C 2GFNA 2ZFWA 1GV2A 1T56A 3PFIA 3E6CC 2DG8A 1BIAA 4PSXA 3KE2A 3JSOA 1CF7A 5JR3A 2IA1A 2RC4A 5L3CA 1B4AA 3IWFA 3C18A 3ZRGA 4UXNA 2WTEA 4C3IJ 3BJAA 2R7XA 4RB2C 3KIOA 3KZZA 4IEJA 3G73A 4Q48A 1POGA 2G3BA 3ZQGA 1XC5A 3Q0UA 5CYVA 1MDMB 1U0JA 3HPGA 3KYDB 4I7HA 1DU0A 4AM3A 1BI3A 1ETKA 4CO8A 1Y8RB 4BE2A 4DW6A 3LSGA 3CESA 2Y69H 4UVAA 2VB6A 3O8HA 2OJED 1O3QA 4KJZA 4ZZLA 1NK3P 3BTJA 2RN7A 1V54H 3I9V2 4XN3A 3IHUA 5BMZA 2KP6A 3B73A 5H2FC 3P9CA 2JUCA 3I71A 4A5NA 1A31A 3O8GA 2OERA 4IVNA 1CF7B 1FBUA 4XSXF 2E2JJ 4KYWA 3CWRA 2MH9A 3OS0A 5CXGA 3SEZA 2HPMA 1R49A 3CJQB 1V5EA 2F4MB 4B44A 2Y48A 5K58A 2M9HA 1TQIA 2JK3A 3VYSB 2ZOZA 4Y13A 3HE0A 3ZP5A 2MA3A 1VI0A 4F92B 3H3VK 1MMGA 2EFWA 1UJ8A 2Z1DA 1RUNA 5K7FA 4PFOA 5GPAA 1ZLJA 3WTUC 2JA8J 1MMAA 4FCYA 3V7RA 4DZPA 3W6KB 2KIFA 3H0GJ 1K61A 1KU9A 1UG2A 1BW5A 2BBYA 2D2WA 3TO7A 1A36A 3AL0B 3M07A 1P4WA 1J7KA 4ENNA 1OCTC 3ZMTA 3MZHA 1HXDA 1UAAA 3OWTA 3G1MA 2O6GE 2UXPA 2DTZA 2X6XA 3FIWA 4Y52J 4WXDA 5CVUA 2L0KA 1T6SA 3BZ6A 3VVXA 1DU6A 5GP9A 2L01A 1U6GA 3CCQI 4ITVA 1FWZA 3O3KA 4FE7A 3EDPA 1K6OA 2IGOA 3ABUA 3PFYA 2CUEA 2W85A 4WWCA 3S8PA 1H88C 2HXOA 2KHMA 2XGEA 3RCOA 3RD3A 4JKZA 4RGUA 3HTHA 3J7AY 1D1CA 2J5OA 3FK6A 5F64A 3SFIA 3ZQLA 4L18B 2JTVA 3S2HJ 4O6JA 1MBJA 1K7AA 3CZ6A 2R3SA 1BOAA 4M3DA 1I1GA 1UZCA 2DI3A 1HKTA 3GFMA 1XN7A 1YQAA 5HS9A 2IBDA 2ID6A 2KIUA 2QUFA 3WU2C 3CF2A 3O6BB 2ESHA 4U7BA 4DVYP 2REKA 2R92J 4RGXA 1QQIA 2XF5A 3TMOA 1ZLKA 1IXCA 3K1PA 2VE9A 1OCOH 3DTKA 5HLTA 1IUYA 2ELJA 3KETA 5IP6A 1GV5A 4IHTA 4S05A 2CJJA 2GZWA 2KKOA 4BJ5C 3PUBA 3DEWA 2HKUA 3TL4X 1PVEA 3OYFA 3CC4I 3HGGA 5E3OA 1IO2A 3RPUD 3E6MA 3V7CA 3N05A 3FRQA 5E3LA 5JHFA 1DGRM 2FMLA 4IOAF 4RB0A 1ETVA 1MH3A 1MBHA 5HVQC 3LAJA 3VIBA 3JR9A 3CMEI 1SANA 1MMNA 5JVGF 1BL0A 4MFDA 1HBXG 2ZY9A 2FA5A 1R36A 4H0EA 2MD0A 1ZHFA 3CTAA 4YFKF 2RASA 3CJDA 3U9GA 2W57A 2NS7A 1D0YA 4ZYEA 4IRIA 3SZTA 2NNNA 5D5WB 1LFBA 1EKEA 3BTCA 5BNGA 3WTVC 1WRJA 4L9VA 2H6BA 3FXJA 1MW7A 2OV7A 2MYSA 4G9YA 1Y39A 2X1DA 1YIJI 1U5TC 3MKLA 5ICFA 3JREA 3QKXA 5C4JJ 2E5NA 3HRUA 3AFHA 4OIRF 1BJZA 2V6CA 1JTYA 2L2OA 5C3EJ 3DPJA 3FXMA 1YI2I 1IN7A 4EMSA 4PGGA 4K2EA 5GAHJ 5FLMJ 3LNQA 1ZK8A 2OC6A 1J75A 2PBIA 2E60A 1SVMA 4ACIA 2O7TA 1MJAA 1BBYA 4Y15A 1C0WA 1B9MA 1WI3A 2LY9A 3DBHB 3G6EI 4OMYA 3TO6A 2HI3A 1QZEA 2W4SA 2F5EA 2IT0A 1XTAA 3FKJA 3JRHA 3T8TA 3QPTA 2CQKA 2HOAA 2W7NA 2HDCA 1YW9A 4DYCA 2GOMA 2DFFA 3T1BA 1TT5B 5LLQA 3E6BA 2XC7A 4MGRA 3S2DJ 5FKOA 5J3LA 2HPIA 2EFPA 3CO6C 4ZC3A 1D1BA 4XICA 2HEOA 1JKRC 3BR5A 2VT2A 2RQQA 4PJMA 5TISC 1TLHB 1U9NA 3PQJA 2I5UA 4BEHA 4ANJA 2NVTJ 1XGNA 2ETHA 1ZG1A 2OPTA 4ZTJA 1FX7A 4B1RA 3LHQA 3NARA 2GWRA 5B5EC 4N4NB 4BAYA 1V5GA 2XUBA 2K4JA 2XAUA 4KIFA 4KN4X 1K6YA 3V6GA 3EGQA 3AG2H 2DOFA 5LBQA 5FLXZ 1YS6A 2XDNA 3E6DA 1U78A 2ISZA 1U8BA 1GLNA 1OCRH 4M9ZA 3R0JA 2V9VA 2CW8A 3ZGKA 1KU3A 1H0MA 1ETYA 2DA4A 2Y9ZA 1OR7C 3LQQA 3A1YA 3BG6A 4BS9A 5LGUA 5EFYA 4M3BA 3BG3A 4HF1A 2K40A 3CCJI 1S6LA 5E8IA 4M9SA 3QYBA 1Y0NA 4BEHB 2QCOA 1E17A 1JGSA 2HZTA 4EJUA 4Z6YA 2JUGA 4ZYAA 1N25A 2JA5J 3TKYA 2OZ6A 4HDUA 1TNSA 3JRDA 3K4MA 1P7IA 4M3FA 4BYYA 2RDPA 5M3MJ 5CXIA 2JMWA 1JHHA 2NS8A 3PSFA 5K1YA 1DGWY 2CFXA 4N9HA 4HX7A 3DTIA 3IKTA 4UHTA 3CJRB 4S0HB 4XLCA 3BPVA 4AD9A 2ZKZA 2KL4A 3BQZA 3HUGA 3K1NA 1ODDA 1T95A 4BUPA 2E1CA 5HDGA 5K5OA 1MNMC 2JVGA 4ZZDA 3HB9A 2PJRA 2HOEA 3GLLA 3RH2A 5HSZA 4GYIA 3P7NA 4P9FA 3IRQA 2XRNA 4FETA 2LR8A 2VQGA 3I4PA 1WSUA 2ZCWA 1S72I 2H1KA 3B81A 1LE8A 1JTXA 4AC6A 2L7MP 1LUJB 2K9SA 4RBOA 1B8IB 2MFZA 4CZZA 2DA5A 3HSFA 4CUGA 1RIOH 2CH0A 4A6EA 4PK4A 2CGPA 4G8XA 1PP8F 1DP7P 1IN6A 3ZQ7A 3EYIA 3S3NA 2V7FA 4YIRX 1WWXA 1FTZA 3HGYA 4L62A 3OSGA 1MNDA 2HXIA 2E36A 2FQ3A 2PMZA 1RESA 1WH7A 1DQUA 3KYCB 1YTYA 3WGGA 2QBYA 4IHWA 5DAJA 1AA7A 1HDPA 4LMYA 4IHYA 3CF5F 1FMVA 2PJRB 3ZQFA 3CMYA 3HTJA 4XIDA 3C3WA 3ABMH 1IN8A 4WIBA 4ESFA 1JUSA 3H5AA 3K70C 1LE8B 1USTA 4KMFA 2FRHA 1BI0A 3IRRA 2A6TA 2FUG2 2WC2A 2R7WA 3RI4A 3P9KA 4P55A 3VOXA 1AOYA 2A2FX 1SFEA 2DMNA 2LP0A 3GLXA 2VC1A 1O4XA 2BZTA 4Q5SF 5LGTA 2VI6A 3QPHA 2XPUA 2B0LA 3R0AA 2CFOA 2XF6A 4RLFA 2QBYB 3I59A 1ACIA 2HOSA 1TL8A 4EV0A 3F6VA 2VBWA 2LYCA 3LA3A 4XRFA 3VVZA 3D0SA 2CWEA 2OZUA 2ME6A 4A2UA 2YU9J 3V8JA 1IDZA 1I6XA 1HQCA 4R79A 2BVLA 4LGWA 3A02A 4M74A 1U2WA 2DO7A 4XORA 1W7PD 5F6FA 4DZJA 1W36C 4OIPF 3TDZC 2MBFA 2OI8A 3GFJA 2C6YA 4Q4ZF 1VQOI 4NB5A 2Q24A 2BEOA 3OOUA 2ZB9A 3FWEA 4C2MA 2VC0A 2QLZA 5LHHA 1D8JA 1K4SA 1PDNC 4I6ZA 2Z16A 4I99C 2A69F 1ZTRA 1Z05A 3I59B 3L00A 4UVCA 1U5TA 2P81A 3CCYA 3PIPF 3HRMA 2CV0A 2QGUA 3OS2A 3NNRA 4UNOA 1VF9A 4F3QA 3FBNB 5L3FA 2O0YA 3VB2A 4NBQA 1IUFA 2ZJQF 2A3SA 2FX0A 5K5QA 3P9IA 1E2XA 1H9TA 2D1HA 1X2MA 3GFIA 2YVHA 4M73A 5LEJA 3K10A 2RV8A 1ZG3A 3LSTA 4XRMA 3BRUA 4OIOF 3S16J 5M5XJ 5IT9K 2M5WA 2KT0A 5LGNA 4JL3A 2FEZA 3DLAA 4LIVA 3BWGA 2RNJA 1X2NA 4IRGA 3ASOH 5ILSA 2EV5A 2NX4A 1XGMA 1R22A 4D1QA 2GIZA 3IH3A 3WG7H 2Y0SA 3MWMA 5KK1A 1JXSA 2QF7A 1U5TB 3GZ5A 1Q1VA 5IYBJ 3TGNA 3HBLA 2DA6A 1VQ8I 1VQ5I 3RZDJ 3HC7A 1XGOA 2BXZA 4FE4A 3AL0C 2YVXA 2KLOA 3DXJF 2XPVA 1I5ZA 4G94A 3H35A 4MO7A 4WXCA 2YPRA 3JSPA 1JJ8C 2E2HJ 2DMTA 3RTRA 2EWNA 1WJFA 4AIKA 3ABTA 3IWZA 2R4GA 1K79A 3FK7A 2DT7B 1T33A 3L2VA 1WH5A 4KNYA 4PXIA 1FSHA 1X3WB 1G2HA 3OV8A 2DA7A 2QQ8A 2RKHA 5HNFA 4KDPA 1IRGA 3JRIA 4IKFA 1Y1VJ 2CW0F 3DEEA 1OR7A 4Y4RA 2WB1N 2K9LA 2B3WA 3EYYA 3CUQC 3MVPA 4BQAA 4E7ZA 2MC3A 3WG9A 3JW4A 1X1PA 2L7KA 2FXAA 3HL2A 4U9LA 2OCEA 4GRIA 2VPLA 2I8DA 3F6OA 5BPIA 4CCMA 1VZ0A 2L4MA 2DT5A 4E7LA 5E3MA 3RYPA 1L3LA 4P5OA 5L3GA 3VW1A 1GUUA 2LF7A 4J00A 3QP6A 3RQIA 4DIQA 4ESJA 1OMIA 2L4AA 1HSTA 3E5UA 4G6DA 1S7EA 3J7AO 3NPIA 3H0DA 3EUPA 2G9WA 3HM5A 5FB2A 4G7HF 2NXNB 2CUFA 3V42A 5K7ZA 3FM5A 1QO0D 2H1LA 4BXFA 1X1AA 3K4LA 3A01A 2O9LA 4YZEA 2COMA 4XLFA 2CV1A 4OINF 1QPIA 3GTJJ 4ESBA 4ENJA 1OQYA 4B4CA 1U9OA 1MKMA 3F8FA 4RA2A 4G7ZF 4EVIA 2YR2A 1LDJA 4PJNA 3KP2A 1F9NA 1YRNA 2HFHA 3DKYA 1BI1A 4A3EJ 4EATA 5HOOA 4XRSA 3LSMA 5FKKA 3TW7A 1MJBA 2Q2EA 3WTZA 3SJMA 3BOQA 3L2QA 4IRHA 1R5HA 2P4WA 5TRDA 3KLOA 4YELA 2Z33A 3DPTA 2BY0A 1K83J 3KEYA 4JOMA 4M3EA 2FF4A 1P9QC 3BR3A 2MLGA 5TGTA 3V4GA 4F52A 3TDUC 4P9UA 5E1ZB 5CQEA 3U1DA 2PMZN 3CP8A 1G3TA 1JKPC 3KP6A 4AIHA 5ILVA 1YRNB 4QTRA 4I0AA 3S1QJ 4CCNA 5K5RA 5HLGA 3HDDA 4YFXF 2DA1A 5DTDA 1HCRA 5CVVA 2PLYA 4D9JA 2BW3A 5LHIA 2Q2EB 2EFOA 3BPXA 1YHQI 4NN1A 2WY8Q 2P6TA 1I50J 1WPKA 4Y17A 2RNGA 4FX0A 2V9KA 1LVKA 2GAUA 5D6EA 4D5CA 3M1CA 1OJLA 4PJJA 4GO1A 2Y75A 5DV5A 2BOLA 1R58A 1RPWA 2H27A 2QKMB 5J1UA 3M9AA 2VOOA 2LKSA 1RR8C 1SMTA 2M0CA 3ABKH 2Q1ZB 1MH4A 4RMNA 4V19K 3LQRA 4FQGA 1U8RA 1XG1A 2HR3A 2XVCA 2OA4A 3H5RA 4HSTA 4W1UA 1W5SA 3QP5A 2WAQA 5FKNA 3PO2J 2X1EA 3H5NA 2Z9OA 2OU2A 4BJ6C 1OCCH 5KHDA 3R4KA 2DPUA 4M3GA 1ZRDA 4OD5A 1B9NA 5FROA 2X6WA 1HF0A 1XMAA 5DUIA 4ZYDA 4AYBA 3I5UA 5LFAA 1X1BA 3GEUA 4IHXA 2IS2A 2CYYA 4BQOA 1S7OA 5A2QK 2A07F 5F04A 1S5LC 5D1RA 3GZIA 3VYUB 5F1RA 2WAEA 4PSWA 4MEYF 2PZ9A 3L9FA 3QQAA 2IS4A 2HYJA 1IF1A 2KDZA 5H20A 2BGCA 2HYGD 3ABLH 2HQAA 1LKXA 2R93J 2IXSA 5C44J 2E5ZA 3BJ6A 4ZJZA 4XLAA 3S14J 3F8BA 3HOUJ 1ZN2A 1XB4A 1Z67A 3HHGA 3SEQA 1HC8A 3GTGJ 5E20A 3SQNA 5IOZA 1B72A 4HZFA 4L9JA 2OTJI 2BY3A 3J81Z 5E8GA 2JA2A 4FHTA 1ZKGA 4DBQA 2FBQA 2MLKA 2H8RA 5EDNA 3K4JA 2DU9A 3H9QA 3LSIA 4RB1A 2JRMA 3BR0A 4KISA 1O57A 3W3CA 4XLHA 1Y0UA 4OIQF 2E1NA 3HOXJ 3J7YJ 3OYMA 1S7AA 1WJCA 1JUMA 3I55I 1Z9CA 3EQLF 4L0ZB 3E1SA 4IHVA 5HNHA 3CCRI 1D0XA 1OCPA 5LRRA 3HOTA 3FM3A 1XGSA 3DPLC 1YO5C 2O3FA 1U3EM 4C3JJ 1HKSA 2VODA 5ED4A 2V1DA 3K4CA 1ULYA 1WQ2A 2JJ7A 4RM2A 2F5DA 2WAFA 3BR2A 1IRFA 2NS0A 3TQNA 2XIGA 3LMMA 4HEA2 3KP4A 3PIOF 1VQMI 2BVMA 3VFZA 1VQKI 2XF7A 1B72B 1B59A 1PUFA 3CDIA 3JRFA 1G3YA 3KPHA 4FTHA 2V1NA 1LQ1A 3CUQA 5FLVA 3V8LA 5FMPA 2VBXA 4A3FJ 3CCUI 2Y31A 4GXOA 2G7HA 2VJ4A 4CSWA 4IF4A 2WV0A 1UHSA 1SC7A 2HGCA 4BDYA 2CRGA 2UXIA 1XSXA 1K78A 1R5GA 5FKLA 1YW7A 5J4VA 1ON2A 4E4HA 3LSHA 3L2UA 2W53A 2JZYA 2CQ7A 2HKOA 4PGHA 4A3MJ 4XBFA 2KRCA 1P2FA 1HKQA 2HDWA 1XMKA 2L9NA 1SD7A 3HOYJ 2PX9A 4LD5A 3NEUA 1IAWA 1PUFB 2GA2A 3M8FA 4PCQA 3RJPA 4CA0A 3BC8A 3CUQB 1P4AA 3IH4A 1P6RA 4G12A 1YFHA 1FBSA 1MBKA 2QSFX 1EH7A 3QU6A 5IT9Z 4BDZA 3KX2A 1RI7A 2J5PA 5HAWA 3WGHA 2JVHA 1Y8QB 3U21A 5J47A 1FZPB 1ETXA 2XKOA 1K78B 3M3YJ 2YVEA 4B47A 3G7RA 2BY1A 3IH2A 4GCVA 3ZQIA 3QYFA 2RVCA 1LFUP 2EA2A 4HF2A 3A0BC 2OD5A 3BJBA 3C7JA 2ZJRF 4XN0A 4ETSA 5CVRA 1LB2A 2P7CB 1Z7UA 3DP7A 3NS4A 1TW2A 4Y33A 1OPCA 1RKTA 3KEOA 3VSLA 3QBMA 3K4KA 1JT6A 3Q5FA 4X6AJ 4UB6C 2Z2SB 1FOXA 1R1UA 2W48A 2PJPA 2X9DA 4JQFA 1QNTA 2MD5A 2BHZA 1YG2A 1OKRA 1ZGAA 1UI6A 1KQ0A 3WTSC 1R6RA 2Q0OA 3GCMA 5BQTA 4I09A 3PPBA 1BR1A 3F21A 1HLVA 3MAJA 4P1WA 3HIMA 2EPFA 1BA5A 2L7ZA 4GCTA 2M45A 2NVQJ 3SWHA 1OFCX 2UV1A 2XHKA 4J19A 4HV5A 1MMSA 1YX3A 4AF5A 2M4KA 2PEXA 1N78A 3RZOJ 3TOBA 2Y30A 3HIFA 4LIUA 4NC8A 4MTDA 4BXXJ 1TZLA 1R7JA 3FXLA 2GLOA 5K7HA 1GXQA 2AO9A 4ZH4F 1AHDP 3PO3J 3FHZA 1TTYA 3I0TA 1G59A 4OWRB 3FF5A 1Z91A 3HKZN 1VQNI 2OQRA 4RAFA 2E1OA 1YLFA 3BTIA 2PI0A 2L9VA 5J8CA 2NOGA 2XGDA 5B66C 3P5JA 3W2AA 1X58A 2EBIA 2IRFG 2KQRA 2M2EA 5C4YA 1XS9A 2DW4A 2WV1A 1G8XA 2XRLA 4BU2A 3GTPJ 2EFQA 3H36A 4PZJA 1G3WA 3LSPA 3IC7A 3AG1H 4LOCA 1HDDC 6PAXA 1R1VA 4L5EA 3RPQA 4UV8A 3KZIC 5HLIA 3T0YA 3LOCA 3MNLA 2AQEA 3QWLA 3AQSA 3DU5A 3Q9VA 5HS7A 3OYIA 1TWAJ 3RQ4A 2QA4I 2QIBA 1QHHD 2KRFA 3HJEA 4II2A 4O3MA 4UV9A 2QM3A 1LJ9A 3FXKA 2CQQA 3LSKA 3KP5A 4C9YA 4IX7A 2DK8A 5KAIC 5DS9A 4EGZA 1F5TA 4ME9A 2JA7J 4BH9A 3GTOJ 2XAGA 2EZLA 2V6EA 3A4CA 2NAZA 3JTHA 2OAZA 4O5VA 3DBLB 2DODA 3FXUA 3CCSI 1HSJA 3HOZJ 2QKLB 3M8JA 3KNWA 4KICA 3FBIB 4KWAA 4BNCA 1O7LA 5DM7F 3K1MA 4E7KA 3V78A 5F0CA 3QRFF 4OD4A 1LDDA 3S1MJ 3QYEA 2EB7A 2PG4A 2XPWA 5J8FA 2R0QC 1REPC 1MMDA 3DWLE 3BCGA 2NVYJ 4AVPA 3FKIJ 4J01A 4H4KC 4HKUA 4II3A 4PUSA 2FJ1A 3WHCA 1E3OC 1FOYA 3LA2A 1RRJA 2QQBA 5FKMA 1VNDA 1BW6A 4MEXF 4JX6A 2EV0A 5F27A 1FLIA 4JX5A 2G7UA 1QHGA 1D8KA 1ZGWA 3ECHA 3TP0A 3OSFA 1MBEA 4F55A 1PUEE 1F43A 1BI2A 4F93B 2LKXA 1UELB 3Q3SA 3OYLA 1A6IA 3LWJA 2BYVE 3MZYA 4MTEA 4AWXB 4YRVA 4BE0A 5DDGA 3S17J 2KFDA 2MGQA 5IP9J 1B8IA 1SGMA 2G7GA 3BHQA 1J0RA 3K9TA 1W0UA 1UI5A 4WXHA 3AG4H 2UXNA 3KFWX 3MQ0A 3VW0A 1W5CC 3BZCA 2QWTA 2KMUA 5ERIA 4RGSA 4IOCF 3UR3C 3W2VA 4NHJA 2Y2ZA 4PFPA 1Z0XA 3F0CA 1JE8A 1N77A 4ZDPA 2UXXA 4QLCU 2XAQA 3H9JA 2ECBA 1SD6A 1T2KA 2ZCNA 2X6OA 1O7FA 3S32A 4F91B 2XGCA 2MSYA 2WBMA 1MIJA 2DPDA 4D5FA 4EJTA 2NP5A 1S29A 1KYWA 2E1MC 3CUOA 2QZ8A 1SFXA 2LVSA 5IOYA 4B3AA 5C4XJ 2WUIA 3AAFA 3CDHA 3DV8A 4A3JJ 1WCMJ 3LSJA 5A2QZ 2HQRA 4AIDA 3RIRA 5CQGA 4BHBA 3ELKA 5FD6A 2MW8A 2DMUA 2E7XA 3D1NI 1ZR4A 3CD6I 2V1XA 1UFMA 3U2RA 1RETA 3GF2A 2DT6A 4ZTFA 2BV6A 4JX4A 4LK1F 3I4MJ 5HDNA 4BQQA 3R6SA 4HDVA 2QOPA 3J81K 2VKVA 2OF7A 1LFPA 2G7LA 4XOPA 3H1CA 1RZ4A 3P9TA 2VQLA 3G1OA 2ZFUA 5ICEA 1S8NA 2VPRA 2XSDC 3GZ6A 3QU3A 4M6YA 3ZQCA 4HOBA 2ZXIA 4ZDLA 3MKWB 3IUVA 2ZCXA 2EIKH 2K7LA 5D4SA 2VQHA 3GYHX 4OMZA 3ECOA 2ZJPF 1ORKA 4I02A 1OYIA 4W97A 2VT3A 4HNVA 3K70D 5D4RA 1VFCA 2X1CA 3KKDA 1Z7LA 1VQ9I 1G4DA 2O7OA 4XL9A 4KN7X 1TW3A 1J2XA 2ZMEC 1IGNA 4FT8A 1HA8A 1I1SA 3NWSA 1RUOA 1OYYA 4CCKA 2QSGX 2ACJA 4ASNA 3MFKA 3BP8A 5FGMA 3PASA 2DQRA 1IXSB 2EIJH 4BJTA 3GEZA 3PSIA 3KP7A 3DFGA 4EQQA 4Z2YA 2GBYA 1XCVA 3O2PE 3ZMZA 4I98B 4RM3A 1R4MB 5DEQA 2TDXA 2G0EA 2JPBA 4V2GA 3UNGC 1FP1D 2NNYA 5IT3A 1W36D 5TJJA 2ZOYA 5DCMB 4AU7A 1SFUA 5CKTA 1V4RA 1JUPA 3HOSA 5DM6F 3HSRA 3SZPA 5M3FJ 5EJCA 1WJDA 5D8LB 1J9IA 3S2WA 4BL0B 3KYLA 3T8RA 2CG4A 2VJIA 2GA1A 1MSFC 4RLQA 2ZO4A 3LFUA 1IV6A 3M4OJ 3VUQA 3L2RA 3H92A 4AUXA 4MNUA 5JI6A 4IHSA 5FFXA 4PDKA 1I27A 3ZMUA 3OYKA 2AHQA 3ZMSA 3JAMK 2D5VA 1YJNI 2R7VA 2GENA 4XKWA 2ZXWH 3E97A 3WODF 4P96A 2IAIA 2VONA 2EK5A 5AQCA 3RYRA 3LWFA 3Q9SA 1SAUA 2VASA 1LEAA 1OCZH 4FISA 1TBXA 4N0BA 1Z21A 4UUTA 4MHGA 3IV5A 4MXMA 1NHAA 2W84A 2FBHA 3ANPA 3SDBA 5KNLA 4A3KJ 3E5QA 3FHNA 1Z77A 2LY1A 3TW6A 3ZMDA 1F1ZA 1R00A 2L3DA 3PNVA 2ECCA 2P5VA 4BGDA 1TWHJ 3GTMJ 1E0EA 1FY7A 4MLOA 1VTNC 5HBUA 2QKOA 2BHYA 1R9TJ 2L7FP 3DQVC 3BCBA 2QYOA 3QPLA 1YE9A 1ZGJA 5D19A 3F3XA 3L1PA 2RQPA 4M72A 2LRDA 1TP4A 3PQKA 3VVYA 2F5FA 3C2BA 4HAMA 1IRZA 4XKBA 3MD2A 3VODA 3OYGA 2NVXJ 3L2CA 3CJTB 2B63J 4RAZA 2ZBKA 5EZGA 4HBLA 4LK0F 2IVMA 2R7TA 2XGXA 3BROA 4B48A 3GMEA 5FRNA 1YX5A 3GVAA 4XRSG 3BT9A 1BC7C 4CCOA
chains in the Genus database with same CATH topology
4I76A 1UMQA 5C4JJ 5IOZA 1TWGJ 3UKGA 3JRGA 1B72A 1BJZA 2DN0A 1JTYA 5C3EJ 3BTLA 3DPJA 2DMPA 1ZKGA 2YUSA 4Y7NJ 3OIOA 2FBQA 5FLMJ 3LNQA 2GM4A 2H8RA 3BR1A 1AKHB 1ZK8A 2V57A 5EDNA 1RKWA 4ACIA 3BR0A 2O7TA 3HOXJ 1WI3A 2LY9A 5EZHA 1JUMA 2HI3A 3JREA 3JRHA 4BY1J 4IHVA 3HOWJ 1A5JA 1OCPA 4A69C 4MIMA 3ON2A 2HOAA 4C3JJ 1FTTA 4DYCA 2JJ7A 3FISA 1FIAA 2ELKA 3BR2A 3LSRA 2JN6A 3JRBA 3S2DJ 5FKOA 5J3LA 4GFLA 3ZQHA 1B72B 1PUFA 3JRFA 4MFEA 4FTHA 1Y1WJ 4XICA 5FLVA 2EQRA 1JKRC 2VKEA 4A93J 5JLXA 2N8GA 3BR5A 5FMPA 3NRGA 4A3FJ 2Y31A 2F07A 1U9NA 2NVTJ 2DMQA 1UHSA 4M6VA 2OPTA 5H9TA 5EYRA 2CRGA 4QIWN 2UXIA 4B1RA 3HTIA 3LHQA 3NARA 5F1JA 5FKLA 4NDLA 2TRTA 1ETOA 3W6VA 1EF4A 2W53A 3V6GA 4A3MJ 3PM1A 4BY7J 3VPRA 3EGQA 1SFOJ 1QRYA 2XDNA 3C07A 1U78A 3VW2A 1U8BA 3HOYJ 3ON4A 4JYKA 1PUFB 1ETYA 2DA4A 3TP3A 2Y9ZA 5M5WJ 4GFBA 3LJLA 3S1RJ 5FGLA 4G12A 1CQTA 3IH4A 5EFYA 5F0HA 4M3BA 3BG3A 1MBKA 2K40A 2G7SA 4BBSJ 2QCOA 5HAWA 2FQ4A 2M8GX 2ME0A 1MBFA 1ETXA 3M3YJ 2YVEA 4BKXA 1FEXA 3NXCA 2JA5J 3G7RA 3IH2A 3JRDA 1P7IA 4M3FA 3ZQIA 2JWTA 3BR6A 5M3MJ 1LFUP 2JMWA 5CXIA 2LTPA 2NS8A 3BJBA 2EZIA 3B6CA 3Q0VA 3I4NJ 4S0HB 5IPAA 3BQZA 5J1YA 1W0TA 1RKTA 1NTCA 3QBMA 1JT6A 4X6AJ 3A03A 1MNMC 2IEKA 4ABZA 3GBGA 3HB9A 3RH2A 5HSZA 3BG5A 1GVDA 2W48A 2X9DA 3E7LA 1AU7A 3K2AA 2LR8A 2H1KA 3B81A 4AC6A 1UI6A 1LE8A 1JTXA 2XB0X 2L7MP 4D7NA 2K9SA 5D18A 4RBOA 1B8IB 3PPBA 4CYCA 2DA5A 1HLVA 2ID3A 3HIMA 1BA5A 2L7ZA 4GCTA 1JKOC 2NVQJ 1OFCX 4ICHA 4J19A 2LD5A 3S15J 4AF5A 3SDGA 1NK2P 3BG9A 3RZOJ 2VUMJ 3S5RA 2Y30A 3HTAA 1FTZA 3HGYA 4BXXJ 1ITYA 5F08A 2QTQA 4L62A 3OSGA 2HXIA 1JT0A 2GLOA 5K7HA 2AO9A 4EEFG 1AHDP 3PO3J 1RESA 1WH7A 2M34A 4IHWA 3HKZN 5DAJA 2E1OA 4BBRJ 2IU5A 4GCKA 3BTIA 2DA2A 1HDPA 1ZR2A 4IHYA 2NOGA 2XGDA 2DA3A 5GPCA 1X58A 2EBIA 3ZQFA 3CMYA 3HTJA 4XIDA 2M2EA 1IC8A 5C4YA 1XS9A 2WV1A 2GUHA 1JUSA 2DJNA 2XRLA 1LE8B 2CU7A 3GTPJ 4CYCB 3LSPA 2Y0SN 4LOCA 1HDDC 3VOXA 1QVUA 5CW8A 4L5EA 4JNNA 2R5YA 1ZQ3P 1TC3C 2DMNA 2LP0A 3LOCA 1O4XA 1H8AC 3GTQJ 3MNLA 4MK6A 3QPSA 4XK4A 2VI6A 3AQSA 5IYCJ 2CQXA 1TWAJ 2XPUA 2QIBA 5EG0B 3ANGA 2CQQA 3B6AA 1IDYA 4NELA 1TWFJ 2FD5A 3K7AJ 5DS9A 2HOSA 4ME9A 2JA6J 2JA7J 3GTOJ 2EZLA 3VVZA 2YU9J 2ME6A 5J1RA 2HDDA 2UXUA 2O8KA 1IDZA 1HOMA 1GDTA 3HOZJ 5FHPA 3KNWA 3A02A 4KWAA 4A3IJ 4DZJA 3V78A 4GFKA 5F0CA 2OI8A 1JKQC 3S1MJ 2XPWA 5IYDJ 2R0QC 5FJ8J 2R5YB 2Q24A 2PBXA 3BCGA 3JRCA 3OOUA 2NVYJ 2ZB9A 4JP0A 2HQ5A 3FKIJ 1JGGA 1I6HJ 4HKUA 3GTLJ 3AQTA 2FJ1A 3WHCA 1ETWA 4I6ZA 1E3OC 1ZTRA 2I10A 3A01B 2P81A 3CCYA 3CQZJ 2R5ZA 3F1BA 5FKMA 1VNDA 1BW6A 3NNRA 2EZHA 4JX6A 5F27A 4JX5A 4DYQA 1ZGWA 1VF9A 1APLC 3TP0A 3OSFA 4A3LJ 1MBEA 1IUFA 2HOTA 2FX0A 3E7QA 1F43A 2K9NA 3NAUA 2TCTA 2YVHA 2LKXA 1X2MA 3Q3SA 1A6IA 5F0FA 3LWJA 4XRMA 1IG7A 3BRUA 2NP3A 3S1NJ 3S16J 4UDSA 5M5XJ 3S17J 3CRJA 2KT0A 2XB5A 4JL3A 1FIPA 2MGQA 5IP9J 3BNIA 1B8IA 1SGMA 3GTKJ 2EZKA 1X2NA 3WHBA 2G7GA 2DG7A 3BHQA 3HOVJ 2UXHA 1W0UA 1IJWC 1UI5A 3KZ9A 5IP7J 2NX4A 3Q0WA 3VW0A 3IH3A 4QSHA 4A3CJ 2QWTA 3T6NA 2QF7A 2K9QA 2LFBA 2R5ZB 1Q1VA 5IYBJ 3HBLA 2DA6A 4A3DJ 4C2MJ 1QVTA 3RZDJ 5EEAA 2Y2ZA 4FE4A 1Z0XA 3F0CA 3JRAA 2XPVA 1D5YA 2ECBA 4MO7A 3HEFA 2ZCNA 2X6OA 2YS9A 2XGCA 2MSYA 4UUSA 1JJ8C 4D5FA 2RHAA 2E2HJ 2UXOA 2DMTA 2NP5A 2RAEA 3MN2A 3FK7A 3O60A 3NI7A 1T33A 3JSJA 1WH5A 4PXIA 2LVSA 5IOYA 4B3AA 4DYRA 5C4XJ 1G2HA 2DA7A 2WUIA 3G56A 4A3JJ 2LK2A 1WCMJ 3LSJA 3COLA 5EG0A 3JRIA 3RKQA 1Y1VJ 1H89C 2WB1N 2GFNA 2MW8A 2DMUA 3MVPA 3D1NI 1GV2A 1T56A 3ZOBA 1ZR4A 2HYTA 2EH3A 2DG8A 1RETA 4D7MA 9ANTA 4JX4A 3I4MJ 5JLWA 2QOPA 4UUSB 4C3IJ 2VKVA 2OF7A 2G7LA 3P9TA 3G1OA 4IEJA 2G3BA 1POGA 3ZQGA 1XC5A 3Q0UA 2VPRA 5E3MA 2R7ZJ 1DU0A 2XSDC 3VW1A 1GUUA 2D6YA 1ETKA 3ZQCA 3RQIA 4DW6A 3LSGA 3IUVA 1I3QJ 2ZCXA 3O8HA 1S7EA 1NK3P 3BTJA 3NPIA 3EUPA 5M5YJ 3HM5A 4C3HJ 2CUFA 5K7ZA 1ORKA 1FJLA 2O9LA 3A01A 3VOKA 4YZEA 4W97A 4HNVA 1QPIA 3GTJJ 3O8GA 2OERA 5E3NA 1VFCA 2E2JJ 3CWRA 2WAQN 5CXGA 4B4CA 1MSEC 3KKDA 1U9OA 2O7OA 2E19A 3TEDA 5K58A 2M9HA 2JK3A 2ZOZA 1IGNA 3HE0A 3KKCA 1YRNA 4AYBN 1VI0A 3H3VK 4A3EJ 3PASA 5K7FA 5GPAA 2JA8J 3CDLA 4XRSA 5FKKA 3TW7A 2COBA 4FCYA 4DZPA 3SJMA 3H0GJ 2Y9YA 1K61A 1UG2A 1BW5A 2GBYA 1K83J 4CGRA 1JJ6C 1OCTC 4M3EA 3BR3A 2G0EA 4X1EA 3G1MA 4V2GA 2UXPA 2DTZA 3FIWA 4Y52J 2ZOYA 3VP5A 2L0KA 1JUPA 4RDUA 3DCFA 2PMZN 1GT0C 5M3FJ 3VVXA 1DU6A 1JKPC 5GP9A 1YRNB 4QTRA 3S1QJ 4A3BJ 4FE7A 1ETQA 3HDDA 1HCRA 2DA1A 5DTDA 2CUEA 1H88C 1MSFC 2HXOA 2XGEA 1ENHA 3VUQA 1IV6A 3M4OJ 2E2IJ 3RD3A 4NN1A 4JKZA 1I50J 1WPKA 4V2FA 3HTHA 4AUXA 3ZQLA 3FK6A 3SFIA 4D5CA 3S2HJ 1MBJA 1OJLA 4M3DA 1RPWA 2AHQA 5J1UA 2D5VA 2M0CA 2IBDA 5EGOA 2GENA 4GCLA 2ID6A 2IAIA 1MH4A 1P7JA 5AQCA 1XG1A 4W1UA 4FISA 3BQYA 2REKA 2R92J 5FKNA 3PO2J 4UUTA 4MXMA 3IV5A 2L9RA 3ANPA 4A3KJ 1Z77A 1GV5A 2MG4A 5IP6A 4M3GA 3TW6A 2CJJA 1TWCJ 2X48A 5HODA 3DEWA 1HF0A 2ECCA 2LLKA 3G1LA 2HKUA 1TWHJ 3GTMJ 1F36A 3HGGA 5E3OA 4MLOA 3FRQA 3GEUA 5HBUA 4IHXA 5E3LA 2QKOA 4AC0A 1R9TJ 2L7FP 5D1RA 1RR7A 3QPLA 5F04A 1ETVA 5EGOB 1MH3A 1MBHA 1AKHA 5D19A 3L1PA 3GZIA 3VIBA 2PZ9A 3JR9A 1BL0A 1SANA 2ZCMA 4MFDA 3QQAA 2HYJA 4A3GJ 3VVYA 3C2BA 2KDZA 1IRZA 2NVXJ 2RASA 3CJDA 2B63J 2NS7A 2R93J 5EZGA 5C44J 1LFBA 5EF6A 1WGXA 3BTCA 5BNGA 2WGBA 3S14J 1MBGA 3HOUJ 4XRSG 3BT9A 3QKXA 3MKLA 3GTGJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I76 A;  1UMQ A;  5C4J J;  5IOZ A;  1TWG J;  3UKG A;  3JRG A;  1B72 A;  1BJZ A;  2DN0 A;  1JTY A;  5C3E J;  3BTL A;  3DPJ A;  2DMP A;  1ZKG A;  2YUS A;  4Y7N J;  3OIO A;  2FBQ A;  5FLM J;  3LNQ A;  2GM4 A;  2H8R A;  3BR1 A;  1AKH B;  1ZK8 A;  2V57 A;  5EDN A;  1RKW A;  4ACI A;  3BR0 A;  2O7T A;  3HOX J;  1WI3 A;  2LY9 A;  5EZH A;  1JUM A;  2HI3 A;  3JRE A;  3JRH A;  4BY1 J;  4IHV A;  3HOW J;  1A5J A;  1OCP A;  4A69 C;  4MIM A;  3ON2 A;  2HOA A;  4C3J J;  1FTT A;  4DYC A;  2JJ7 A;  3FIS A;  1FIA A;  2ELK A;  3BR2 A;  3LSR A;  2JN6 A;  3JRB A;  3S2D J;  5FKO A;  5J3L A;  4GFL A;  3ZQH A;  1B72 B;  1PUF A;  3JRF A;  4MFE A;  4FTH A;  1Y1W J;  4XIC A;  5FLV A;  2EQR A;  1JKR C;  2VKE A;  4A93 J;  5JLX A;  2N8G A;  3BR5 A;  5FMP A;  3NRG A;  4A3F J;  2Y31 A;  2F07 A;  1U9N A;  2NVT J;  2DMQ A;  1UHS A;  4M6V A;  2OPT A;  5H9T A;  5EYR A;  2CRG A;  4QIW N;  2UXI A;  4B1R A;  3HTI A;  3LHQ A;  3NAR A;  5F1J A;  5FKL A;  4NDL A;  2TRT A;  1ETO A;  3W6V A;  1EF4 A;  2W53 A;  3V6G A;  4A3M J;  3PM1 A;  4BY7 J;  3VPR A;  3EGQ A;  1SFO J;  1QRY A;  2XDN A;  3C07 A;  1U78 A;  3VW2 A;  1U8B A;  3HOY J;  3ON4 A;  4JYK A;  1PUF B;  1ETY A;  2DA4 A;  3TP3 A;  2Y9Z A;  5M5W J;  4GFB A;  3LJL A;  3S1R J;  5FGL A;  4G12 A;  1CQT A;  3IH4 A;  5EFY A;  5F0H A;  4M3B A;  3BG3 A;  1MBK A;  2K40 A;  2G7S A;  4BBS J;  2QCO A;  5HAW A;  2FQ4 A;  2M8G X;  2ME0 A;  1MBF A;  1ETX A;  3M3Y J;  2YVE A;  4BKX A;  1FEX A;  3NXC A;  2JA5 J;  3G7R A;  3IH2 A;  3JRD A;  1P7I A;  4M3F A;  3ZQI A;  2JWT A;  3BR6 A;  5M3M J;  1LFU P;  2JMW A;  5CXI A;  2LTP A;  2NS8 A;  3BJB A;  2EZI A;  3B6C A;  3Q0V A;  3I4N J;  4S0H B;  5IPA A;  3BQZ A;  5J1Y A;  1W0T A;  1RKT A;  1NTC A;  3QBM A;  1JT6 A;  4X6A J;  3A03 A;  1MNM C;  2IEK A;  4ABZ A;  3GBG A;  3HB9 A;  3RH2 A;  5HSZ A;  3BG5 A;  1GVD A;  2W48 A;  2X9D A;  3E7L A;  1AU7 A;  3K2A A;  2LR8 A;  2H1K A;  3B81 A;  4AC6 A;  1UI6 A;  1LE8 A;  1JTX A;  2XB0 X;  2L7M P;  4D7N A;  2K9S A;  5D18 A;  4RBO A;  1B8I B;  3PPB A;  4CYC A;  2DA5 A;  1HLV A;  2ID3 A;  3HIM A;  1BA5 A;  2L7Z A;  4GCT A;  1JKO C;  2NVQ J;  1OFC X;  4ICH A;  4J19 A;  2LD5 A;  3S15 J;  4AF5 A;  3SDG A;  1NK2 P;  3BG9 A;  3RZO J;  2VUM J;  3S5R A;  2Y30 A;  3HTA A;  1FTZ A;  3HGY A;  4BXX J;  1ITY A;  5F08 A;  2QTQ A;  4L62 A;  3OSG A;  2HXI A;  1JT0 A;  2GLO A;  5K7H A;  2AO9 A;  4EEF G;  1AHD P;  3PO3 J;  1RES A;  1WH7 A;  2M34 A;  4IHW A;  3HKZ N;  5DAJ A;  2E1O A;  4BBR J;  2IU5 A;  4GCK A;  3BTI A;  2DA2 A;  1HDP A;  1ZR2 A;  4IHY A;  2NOG A;  2XGD A;  2DA3 A;  5GPC A;  1X58 A;  2EBI A;  3ZQF A;  3CMY A;  3HTJ A;  4XID A;  2M2E A;  1IC8 A;  5C4Y A;  1XS9 A;  2WV1 A;  2GUH A;  1JUS A;  2DJN A;  2XRL A;  1LE8 B;  2CU7 A;  3GTP J;  4CYC B;  3LSP A;  2Y0S N;  4LOC A;  1HDD C;  3VOX A;  1QVU A;  5CW8 A;  4L5E A;  4JNN A;  2R5Y A;  1ZQ3 P;  1TC3 C;  2DMN A;  2LP0 A;  3LOC A;  1O4X A;  1H8A C;  3GTQ J;  3MNL A;  4MK6 A;  3QPS A;  4XK4 A;  2VI6 A;  3AQS A;  5IYC J;  2CQX A;  1TWA J;  2XPU A;  2QIB A;  5EG0 B;  3ANG A;  2CQQ A;  3B6A A;  1IDY A;  4NEL A;  1TWF J;  2FD5 A;  3K7A J;  5DS9 A;  2HOS A;  4ME9 A;  2JA6 J;  2JA7 J;  3GTO J;  2EZL A;  3VVZ A;  2YU9 J;  2ME6 A;  5J1R A;  2HDD A;  2UXU A;  2O8K A;  1IDZ A;  1HOM A;  1GDT A;  3HOZ J;  5FHP A;  3KNW A;  3A02 A;  4KWA A;  4A3I J;  4DZJ A;  3V78 A;  4GFK A;  5F0C A;  2OI8 A;  1JKQ C;  3S1M J;  2XPW A;  5IYD J;  2R0Q C;  5FJ8 J;  2R5Y B;  2Q24 A;  2PBX A;  3BCG A;  3JRC A;  3OOU A;  2NVY J;  2ZB9 A;  4JP0 A;  2HQ5 A;  3FKI J;  1JGG A;  1I6H J;  4HKU A;  3GTL J;  3AQT A;  2FJ1 A;  3WHC A;  1ETW A;  4I6Z A;  1E3O C;  1ZTR A;  2I10 A;  3A01 B;  2P81 A;  3CCY A;  3CQZ J;  2R5Z A;  3F1B A;  5FKM A;  1VND A;  1BW6 A;  3NNR A;  2EZH A;  4JX6 A;  5F27 A;  4JX5 A;  4DYQ A;  1ZGW A;  1VF9 A;  1APL C;  3TP0 A;  3OSF A;  4A3L J;  1MBE A;  1IUF A;  2HOT A;  2FX0 A;  3E7Q A;  1F43 A;  2K9N A;  3NAU A;  2TCT A;  2YVH A;  2LKX A;  1X2M A;  3Q3S A;  1A6I A;  5F0F A;  3LWJ A;  4XRM A;  1IG7 A;  3BRU A;  2NP3 A;  3S1N J;  3S16 J;  4UDS A;  5M5X J;  3S17 J;  3CRJ A;  2KT0 A;  2XB5 A;  4JL3 A;  1FIP A;  2MGQ A;  5IP9 J;  3BNI A;  1B8I A;  1SGM A;  3GTK J;  2EZK A;  1X2N A;  3WHB A;  2G7G A;  2DG7 A;  3BHQ A;  3HOV J;  2UXH A;  1W0U A;  1IJW C;  1UI5 A;  3KZ9 A;  5IP7 J;  2NX4 A;  3Q0W A;  3VW0 A;  3IH3 A;  4QSH A;  4A3C J;  2QWT A;  3T6N A;  2QF7 A;  2K9Q A;  2LFB A;  2R5Z B;  1Q1V A;  5IYB J;  3HBL A;  2DA6 A;  4A3D J;  4C2M J;  1QVT A;  3RZD J;  5EEA A;  2Y2Z A;  4FE4 A;  1Z0X A;  3F0C A;  3JRA A;  2XPV A;  1D5Y A;  2ECB A;  4MO7 A;  3HEF A;  2ZCN A;  2X6O A;  2YS9 A;  2XGC A;  2MSY A;  4UUS A;  1JJ8 C;  4D5F A;  2RHA A;  2E2H J;  2UXO A;  2DMT A;  2NP5 A;  2RAE A;  3MN2 A;  3FK7 A;  3O60 A;  3NI7 A;  1T33 A;  3JSJ A;  1WH5 A;  4PXI A;  2LVS A;  5IOY A;  4B3A A;  4DYR A;  5C4X J;  1G2H A;  2DA7 A;  2WUI A;  3G56 A;  4A3J J;  2LK2 A;  1WCM J;  3LSJ A;  3COL A;  5EG0 A;  3JRI A;  3RKQ A;  1Y1V J;  1H89 C;  2WB1 N;  2GFN A;  2MW8 A;  2DMU A;  3MVP A;  3D1N I;  1GV2 A;  1T56 A;  3ZOB A;  1ZR4 A;  2HYT A;  2EH3 A;  2DG8 A;  1RET A;  4D7M A;  9ANT A;  4JX4 A;  3I4M J;  5JLW A;  2QOP A;  4UUS B;  4C3I J;  2VKV A;  2OF7 A;  2G7L A;  3P9T A;  3G1O A;  4IEJ A;  2G3B A;  1POG A;  3ZQG A;  1XC5 A;  3Q0U A;  2VPR A;  5E3M A;  2R7Z J;  1DU0 A;  2XSD C;  3VW1 A;  1GUU A;  2D6Y A;  1ETK A;  3ZQC A;  3RQI A;  4DW6 A;  3LSG A;  3IUV A;  1I3Q J;  2ZCX A;  3O8H A;  1S7E A;  1NK3 P;  3BTJ A;  3NPI A;  3EUP A;  5M5Y J;  3HM5 A;  4C3H J;  2CUF A;  5K7Z A;  1ORK A;  1FJL A;  2O9L A;  3A01 A;  3VOK A;  4YZE A;  4W97 A;  4HNV A;  1QPI A;  3GTJ J;  3O8G A;  2OER A;  5E3N A;  1VFC A;  2E2J J;  3CWR A;  2WAQ N;  5CXG A;  4B4C A;  1MSE C;  3KKD A;  1U9O A;  2O7O A;  2E19 A;  3TED A;  5K58 A;  2M9H A;  2JK3 A;  2ZOZ A;  1IGN A;  3HE0 A;  3KKC A;  1YRN A;  4AYB N;  1VI0 A;  3H3V K;  4A3E J;  3PAS A;  5K7F A;  5GPA A;  2JA8 J;  3CDL A;  4XRS A;  5FKK A;  3TW7 A;  2COB A;  4FCY A;  4DZP A;  3SJM A;  3H0G J;  2Y9Y A;  1K61 A;  1UG2 A;  1BW5 A;  2GBY A;  1K83 J;  4CGR A;  1JJ6 C;  1OCT C;  4M3E A;  3BR3 A;  2G0E A;  4X1E A;  3G1M A;  4V2G A;  2UXP A;  2DTZ A;  3FIW A;  4Y52 J;  2ZOY A;  3VP5 A;  2L0K A;  1JUP A;  4RDU A;  3DCF A;  2PMZ N;  1GT0 C;  5M3F J;  3VVX A;  1DU6 A;  1JKP C;  5GP9 A;  1YRN B;  4QTR A;  3S1Q J;  4A3B J;  4FE7 A;  1ETQ A;  3HDD A;  1HCR A;  2DA1 A;  5DTD A;  2CUE A;  1H88 C;  1MSF C;  2HXO A;  2XGE A;  1ENH A;  3VUQ A;  1IV6 A;  3M4O J;  2E2I J;  3RD3 A;  4NN1 A;  4JKZ A;  1I50 J;  1WPK A;  4V2F A;  3HTH A;  4AUX A;  3ZQL A;  3FK6 A;  3SFI A;  4D5C A;  3S2H J;  1MBJ A;  1OJL A;  4M3D A;  1RPW A;  2AHQ A;  5J1U A;  2D5V A;  2M0C A;  2IBD A;  5EGO A;  2GEN A;  4GCL A;  2ID6 A;  2IAI A;  1MH4 A;  1P7J A;  5AQC A;  1XG1 A;  4W1U A;  4FIS A;  3BQY A;  2REK A;  2R92 J;  5FKN A;  3PO2 J;  4UUT A;  4MXM A;  3IV5 A;  2L9R A;  3ANP A;  4A3K J;  1Z77 A;  1GV5 A;  2MG4 A;  5IP6 A;  4M3G A;  3TW6 A;  2CJJ A;  1TWC J;  2X48 A;  5HOD A;  3DEW A;  1HF0 A;  2ECC A;  2LLK A;  3G1L A;  2HKU A;  1TWH J;  3GTM J;  1F36 A;  3HGG A;  5E3O A;  4MLO A;  3FRQ A;  3GEU A;  5HBU A;  4IHX A;  5E3L A;  2QKO A;  4AC0 A;  1R9T J;  2L7F P;  5D1R A;  1RR7 A;  3QPL A;  5F04 A;  1ETV A;  5EGO B;  1MH3 A;  1MBH A;  1AKH A;  5D19 A;  3L1P A;  3GZI A;  3VIB A;  2PZ9 A;  3JR9 A;  1BL0 A;  1SAN A;  2ZCM A;  4MFD A;  3QQA A;  2HYJ A;  4A3G J;  3VVY A;  3C2B A;  2KDZ A;  1IRZ A;  2NVX J;  2RAS A;  3CJD A;  2B63 J;  2NS7 A;  2R93 J;  5EZG A;  5C44 J;  1LFB A;  5EF6 A;  1WGX A;  3BTC A;  5BNG A;  2WGB A;  3S14 J;  1MBG A;  3HOU J;  4XRS G;  3BT9 A;  3QKX A;  3MKL A;  3GTG J; 
#chains in the Genus database with same CATH topology
 4I76 A;  2LG4 A;  1TWG J;  2FNA A;  3JRG A;  3UKG A;  2D1V A;  3FMQ A;  5ICC A;  4U7D A;  3J7Z I;  3FXQ A;  3DKX A;  2V26 A;  4IJA A;  4Y7N J;  5KAF C;  1WFX A;  3HXL A;  2GM4 A;  2V57 A;  2LRE A;  3F8M A;  3CCM I;  1RKW A;  2W24 A;  3FMR A;  1I3A A;  5HDK A;  5EZH A;  1Z3Y A;  5ILU A;  2QEN A;  3G2B A;  1FP2 A;  4KA4 A;  4MIM A;  3ON2 A;  5CPR B;  1FTT A;  2F48 A;  5LD2 C;  5KCM A;  2LF8 A;  1MGT A;  3ROU A;  4U88 A;  2ELK A;  2JN6 A;  3RSN A;  2FU4 A;  3FMS A;  5H6Q A;  1FYK A;  2DCE A;  4MFE A;  5E79 C;  2V9P A;  4PJL A;  2EQR A;  2VIX A;  4AVZ A;  1YJW I;  4NUB A;  3CCV I;  5JLX A;  1NH3 A;  2F5C A;  4I01 A;  5D8K B;  2B1E A;  3VOE A;  3NRG A;  2CV2 A;  4OOI A;  2QQA A;  1E3H A;  3BDD A;  2F07 A;  1R71 A;  2DMQ A;  2JSC A;  2KIS A;  1GVJ A;  5HS8 A;  3NRV A;  1D3Y A;  3HYI A;  3EPZ A;  1EJ9 A;  3HTI A;  3BG7 A;  2E1M B;  4NDL A;  2ZC2 A;  3SYT A;  1SAX A;  1ETO A;  1EF4 A;  3K6G A;  2EFN A;  3KP3 A;  1FC3 A;  3HG9 A;  2KDO A;  4HW0 A;  5EEG A;  3PM1 A;  4BY7 J;  3VPR A;  3RDI A;  2KPM A;  5ICG A;  3K69 A;  3VW2 A;  2A5W A;  3ON4 A;  1MD0 A;  1MNE A;  2MC4 A;  4UB8 C;  2NRA C;  5H6R A;  2GXB A;  1Z6R A;  1PJR A;  2G7S A;  2ZSH B;  2O03 A;  1ZRF A;  1WVR A;  4GGG A;  2VN2 A;  4XKC A;  2ME0 A;  4HQE A;  1MBF A;  3DPU A;  1FEX A;  2ZME A;  3NXC A;  5D5U B;  3MKY B;  3HTU A;  4RS8 A;  3IAM 2;  3HZJ A;  3L2W A;  3S3M A;  4QPO A;  4OU0 A;  1Y6I A;  4XQF A;  2EZI A;  3B6C A;  2NYX A;  2CS3 A;  3Q0V A;  4KFC A;  3VTI A;  2DJI A;  4XLP F;  2E7W A;  1H9G A;  1W0T A;  2K3P A;  3A03 A;  1BIB A;  4YG2 F;  1ZAO A;  1NG6 A;  1Z6T A;  4LLG F;  4WF2 A;  4ABZ A;  3GBG A;  2V79 A;  5GTH C;  3BG5 A;  3E7L A;  3GW2 A;  3WTY C;  3K2A A;  3D5S C;  3BJO A;  4EJV A;  1TQP A;  1D0Z A;  3CLQ A;  1W7P B;  5D18 A;  4YFN F;  4CYC A;  5B1B H;  2ZME B;  3ZCO A;  2OQG A;  1JKO C;  3ZN0 A;  1SMY F;  4ICH A;  1W4M A;  2W00 A;  3S15 J;  1WI9 A;  5J40 A;  2VUM J;  3S5R A;  2X51 A;  3HTA A;  4MQV A;  4ON0 A;  1IZ1 A;  1EA3 A;  2QTQ A;  2QVO A;  3SXY A;  4EEF G;  1LVA A;  1BC8 C;  3I58 A;  2IA0 A;  3F23 A;  4M9X A;  2VE8 A;  3CO7 C;  1KGS A;  2VJ5 A;  2ZJ2 A;  2IU5 A;  2DA2 A;  1X1D A;  4ENK A;  1TQM A;  4RAG A;  2M87 A;  3AG3 H;  1HW5 A;  3DKW A;  4U87 A;  4HV6 A;  1J5Y A;  4DGW B;  1O3R A;  2VBY A;  2DYR H;  1UB9 A;  4CYC B;  3NWT A;  3S93 A;  1B6A A;  4XOT A;  2ZXH A;  1WZ2 A;  2Y0S N;  1QVU A;  2Z5U A;  2DDB A;  2R5Y A;  1ZG5 A;  1TC3 C;  1ZQ3 P;  5FRM A;  1H8A C;  3J80 K;  3GTQ J;  2STT A;  3H9G A;  4XK4 A;  2WA0 A;  4B8X A;  3OL4 A;  3DLL F;  4I2O A;  3GWZ A;  3CC7 I;  3OYB A;  5EG0 B;  4LJZ F;  2KRH A;  1KZH A;  1ZRE A;  1IDY A;  3HSE A;  5DD4 A;  2R7S A;  3M7G A;  2FD5 A;  3K7A J;  4EM0 B;  3TBI A;  2JA6 J;  3E5X A;  5E17 F;  1ZAR A;  4WK8 F;  3RKY A;  2PFV A;  5J1R A;  2HDD A;  2O8K A;  5L3D A;  4IL6 C;  3W6J B;  1T08 B;  4A3I J;  1Q1H A;  1XSV A;  4WX9 A;  1EV7 A;  2DYS H;  1D5V A;  1LDK B;  4L5I A;  1JKQ C;  4KIB A;  4FX4 A;  4U0Y A;  3WU0 A;  5DD8 A;  5IYD J;  2ZSI B;  4NC6 A;  2R5Y B;  1ONV A;  2HKX A;  2HU9 A;  5LEK A;  3JRC A;  5HLH A;  1I6H J;  2HQ5 A;  5BS6 A;  3DEU A;  2P8T A;  2R7F A;  2KIQ A;  1ETW A;  1GXP A;  4HLX A;  5L3E A;  2XRO A;  1DUX C;  3WGI A;  3OYN A;  2JSP A;  1WJA A;  1XX5 A;  3N4M A;  3BZK A;  3ISP A;  3F1B A;  5D6F A;  2EZH A;  4DYQ A;  1TT0 A;  2FE3 A;  4A3L J;  4XR6 A;  1YIO A;  4U9N A;  2OBP A;  3E7Q A;  3MCZ A;  1X3Z B;  2A5Y B;  2F6C A;  4HQM A;  1G6N A;  2K5C A;  1G3S A;  2ZXJ A;  4E70 A;  2NP3 A;  3ASN H;  5JFR A;  4DJA A;  1A6Q A;  1YS7 A;  5FFZ A;  4CZC A;  3GTK J;  2EZK A;  3WHB A;  4CCJ A;  5JHU A;  1XDS A;  5B1A H;  2QSH X;  2FBK A;  4TV7 A;  3HOV J;  1E3P A;  2UXH A;  1IJW C;  3LL7 A;  4UY8 I;  5IP7 J;  3HRS A;  3Q0W A;  1JI8 A;  3OYA A;  4G6Q A;  4Y3O A;  5D5X B;  4A3C J;  3IL2 A;  4LLN A;  2K9Q A;  2LFB A;  2HNH A;  1UHM A;  3JAM Z;  1IN4 A;  2K3F A;  4C2M J;  5DCF A;  1QVT A;  2IGN A;  2K4B A;  3K8P C;  1Y56 A;  2K02 A;  3WU1 B;  1XPX A;  2DFE A;  1D5Y A;  2HQN A;  3OYH A;  1PYV A;  2F5V A;  4UUS A;  2QQ9 A;  2RHA A;  2IA2 A;  2EIL H;  4BAC A;  1CGP A;  2RAE A;  3KEQ A;  3OIP A;  3TO9 A;  2LH9 A;  4UVB A;  3MN2 A;  4EM2 A;  1I39 A;  1QPM A;  4CYD A;  3OR1 C;  4HYE A;  1QZY A;  2HVR A;  1R1T A;  3JSJ A;  2YX4 A;  1XSD A;  1SVO A;  3G56 A;  1JHF A;  2IPQ X;  5FO5 A;  3OYJ A;  2CUZ A;  1D1A A;  2DQL A;  3COL A;  1XDU A;  2ICW G;  4OAZ A;  1WHU A;  5EEH A;  1WJ5 A;  3RKQ A;  3C2G A;  2D45 A;  3COA C;  3WTW C;  4A6D A;  3CMA I;  2HYT A;  3ZOB A;  2W1O A;  3GXO A;  4HNT A;  2EH3 A;  2YU3 A;  3R61 A;  4D7M A;  4LG3 A;  9ANT A;  3EUH C;  4A5M A;  5JLW A;  3QOD A;  3S3O A;  5CJ9 A;  1YOV B;  4ZYG A;  4UUS B;  4ZYH A;  1KQ8 A;  2XAJ A;  3KZY A;  1RC9 A;  2H8W A;  1YJ9 I;  4CH7 A;  4HNU A;  5E1W A;  2R7Z J;  4QPQ A;  2D6Y A;  2X4H A;  4LB6 B;  1T39 A;  1OLT A;  1I3Q J;  3CJN A;  2P5L C;  5E1X A;  1T0F C;  2K85 A;  5M5Y J;  1MJ9 A;  2B7E A;  2F4O B;  4C3H J;  1EH8 A;  1FJL A;  3OR2 C;  3VOK A;  2L02 A;  4HF0 A;  3G3Z A;  4HPQ A;  4U0V A;  3T5X A;  3FX3 A;  3ZN1 A;  1R5I D;  5E3N A;  1WJB A;  3ERE D;  1NG7 A;  2WAQ N;  5CLS A;  1MSE C;  5L3B A;  2M7B A;  3IKV A;  2E19 A;  3TED A;  1YYV A;  1VQ7 I;  2L5Q A;  4E7H A;  3PL8 A;  3KKC A;  4KMU X;  2GIV A;  3HRT A;  2V4J C;  4AYB N;  4KUM A;  3WE3 A;  2R7D A;  4D0P A;  2JPC A;  2FBI A;  3OIQ A;  4XLN F;  2HVS A;  1GHC A;  2DDA A;  2DTR A;  4BHC A;  1ZRC A;  4QWQ A;  2P5K A;  3E3V A;  3CDL A;  4B43 A;  3CCE I;  4LB5 A;  4LIT A;  2COB A;  2XAH A;  5LRS A;  4HX4 A;  1TNT A;  2Y9Y A;  4XNF A;  4CGR A;  1JJ6 C;  3BY6 A;  2BY2 A;  4N4O B;  2IGM A;  4X1E A;  3I3L A;  2IP2 A;  4LLL A;  3MZ8 A;  3ZMV A;  3OYE A;  2KJB A;  1USS A;  5GAE J;  2W82 A;  2GQQ A;  1FMW A;  3C1D A;  3VP5 A;  2WB1 A;  4GDF A;  4RDU A;  3DCF A;  1GT0 C;  3REO A;  5CVJ A;  3SHF A;  4KIG A;  3F8C A;  3EET A;  4A3B J;  1ETQ A;  1FBQ A;  1OIS A;  1ENH A;  2E2I J;  1VQ6 I;  3IAS 2;  1IW7 F;  1QA6 A;  2EV6 A;  1FNN A;  3TOA A;  2PFB A;  4V2F A;  2R7Q A;  4BXU A;  2FMY A;  4RB3 C;  1S9H A;  3FXO A;  2WWY A;  2LBF A;  1KQ9 A;  2HYF A;  1QZZ A;  4DOZ A;  3G71 I;  1FOK A;  5EGO A;  4GCL A;  2A05 A;  2DFH A;  1YW8 A;  2CMP A;  4ZDO A;  1P7J A;  4KIT B;  2ESN A;  1EH6 A;  2PN6 A;  2KZV A;  2YX7 A;  3PNT A;  3BQY A;  1W1W E;  4OAY A;  1UHW A;  4L5J A;  1X1C A;  3I53 A;  3CP2 A;  2L9R A;  2X0L A;  4EJO A;  4A0X A;  2F4I A;  1FT9 A;  2MG4 A;  3ULQ B;  2CW7 A;  1X4O A;  1RNL A;  1TWC J;  2X48 A;  5HOD A;  2DBB A;  3DU6 A;  5GAD J;  3G1L A;  2LLK A;  2GOX B;  1F36 A;  4IPA A;  2LC2 A;  2ZNY A;  1N75 A;  4HRI A;  3VEP A;  2LBF B;  4AC0 A;  2GXA A;  2CQN A;  2LKP A;  1RR7 A;  2CUJ A;  1V5F A;  5EGO B;  1T38 A;  1AKH A;  1LNW A;  2R7U A;  2P7V B;  2VQC A;  3VYT B;  1R4N B;  2ZCM A;  2IW5 A;  4A3G J;  4PJ0 C;  4HA8 A;  4A0Z A;  2ADU A;  5BPD A;  4B09 A;  1QU3 A;  1SFK A;  3JCU C;  2ELH A;  4U0W A;  3HPH A;  1ON1 A;  5EF6 A;  1WGX A;  2M30 A;  3LAP A;  2WGB A;  4UUV A;  3L09 A;  3HUG B;  1MBG A;  2BE5 F;  4CIC A;  2VKH A;  3OYC A;  1ZYR F;  1UMQ A;  2XAS A;  5GTI C;  3F22 A;  2VXZ A;  2R7R A;  1ZH5 A;  4XMY A;  2DN0 A;  2Q8K A;  2Z3Y A;  3BTL A;  2L9S A;  2DMP A;  1AWC A;  2YUS A;  2V1U A;  3OIO A;  1IN5 A;  3RPU A;  5J6X A;  5BOX A;  3BR1 A;  1AKH B;  4XSZ F;  4IXA A;  1SEU A;  1XD7 A;  2EIN H;  4NQW A;  3I54 A;  1BR4 A;  4JBA A;  4EGY A;  3J80 Z;  5DCM A;  1T98 A;  1FYM A;  4R8H A;  4BY1 J;  3HOW J;  1A5J A;  4A69 C;  1PP7 U;  4BHP A;  3L7W A;  3MEX A;  3M1E A;  4M6X A;  1FPQ A;  3FZV A;  4CCL A;  4XM3 A;  3FIS A;  1FIA A;  2GXG A;  3M8E A;  5KVR A;  5AIQ A;  1BJA A;  2VBZ A;  3D5R C;  4E7S A;  3LSR A;  3JRB A;  4GFL A;  3VWB A;  1DDN A;  2HVQ A;  3ZQH A;  4FAS D;  2ISY A;  1ERD A;  2FOW A;  4HSR A;  1Y1W J;  1J09 A;  3DF8 A;  1KON A;  1WJE A;  3E0J B;  4Q47 A;  4A93 J;  2VKE A;  3OY9 A;  2N8G A;  2W25 A;  4C2T A;  1STZ A;  1Z3X A;  4NQW B;  1QGP A;  3R60 A;  4E7I A;  3EUH A;  2L54 A;  2M0M A;  2IGK A;  4YIF A;  4YEJ A;  4M6V A;  2HTS A;  2K9M A;  2RGV A;  2O61 A;  5H9T A;  5EYR A;  4R1H A;  1BR2 A;  4QIW N;  1UCR A;  5F1J A;  4BE1 A;  2O5R A;  2TRT A;  3WTT C;  3LA7 A;  3W6V A;  2DXI A;  3FDY A;  3OYD A;  3HTS B;  4I0B A;  2FOK A;  2QEX I;  4IRV A;  3VYR B;  1SFO J;  2LDU A;  1QRY A;  4L9N A;  3C07 A;  1O3T A;  1ZEL A;  1T0F A;  3F72 A;  4JYK A;  5LHG A;  2M4G A;  3ZR8 X;  2E34 A;  3OS1 A;  3G4S I;  4IO9 F;  4G7O F;  2XV4 S;  3GX4 X;  3BLY A;  1L0O C;  3TP3 A;  5M5W J;  3ZQQ A;  3H3U A;  3S1R J;  4GFB A;  3LJL A;  5FGL A;  1CQT A;  1UG0 A;  5F0H A;  3WE2 A;  2BXY A;  3KLN A;  2WY7 Q;  2MAB A;  1KU7 A;  4BBS J;  2DLL A;  3ESW B;  1W5T A;  2XSJ C;  4KT6 A;  2OCC H;  3GUD A;  1KYZ A;  1X3U A;  3K4N A;  2UZK A;  2FQ4 A;  2M8G X;  4HX8 A;  4LG0 A;  2NOJ B;  1HW1 A;  2K86 A;  4BKX A;  4G6T B;  2H6C A;  1KA8 A;  3KCC A;  2UWM A;  1V3F A;  1IRX A;  1X19 A;  3D5L A;  2JWT A;  3BR6 A;  5FD5 A;  2H09 A;  2LTP A;  1WKM A;  4F7Z A;  3RKW A;  2VJJ A;  5B3S H;  3IP4 B;  2HWV A;  3K4B A;  2LSO A;  3I4N J;  3ZXS A;  1K4T A;  1DPU A;  4XON A;  1LPQ A;  5IPA A;  5J1Y A;  2JRT A;  1V55 H;  1NTC A;  3VSK A;  1YIT I;  2LMD A;  2FSW A;  5J4Y A;  4AIJ A;  1OYW A;  2IEK A;  4RGR A;  2LNB A;  1BOB A;  3K2Z A;  1GVD A;  3EUK L;  1AU7 A;  3PJR A;  1SD4 A;  4MQ9 F;  2IJL A;  1P4X A;  4DNC A;  1BM9 A;  3ERM A;  2XB0 X;  4D7N A;  1A35 A;  4LG0 B;  2EIM H;  4L0Y B;  5IY5 H;  2ID3 A;  2AXT C;  2VOP A;  4C30 A;  1VQP I;  2LOO A;  2HZD A;  2NVU B;  2DOE A;  2LD5 A;  4M71 A;  2OTL I;  4IQ4 A;  3F9K A;  3SDG A;  4XLE A;  1NK2 P;  3BG9 A;  1BN5 A;  2WAD A;  4C2U A;  3NQO A;  5AIP A;  4GYG A;  1ITY A;  2AXL A;  3ONQ A;  5F08 A;  2XAF A;  1A04 A;  1M1E B;  4HLY A;  1JT0 A;  3ZPL A;  1FOW A;  2M34 A;  2X85 A;  4BBR J;  2M7A A;  3QAH A;  4B3X A;  1ZR2 A;  3QOP A;  4GCK A;  2YSR A;  2DA3 A;  2A6H F;  2O8X A;  1SVL A;  5GPC A;  3I64 A;  3CC2 I;  1IC8 A;  3N97 A;  3ML6 A;  3SZG A;  4EJW A;  2GUH A;  2DJN A;  2EA4 A;  2Z99 A;  2CU7 A;  1P92 A;  4IQJ A;  1R23 A;  3GO5 A;  2R7O A;  4DBR A;  2VLA A;  1SD5 A;  4YII A;  4XKV A;  4IZZ A;  5CW8 A;  2B9S A;  4JNN A;  3W2W A;  5JVT A;  4JK1 X;  2JT1 A;  3VDX A;  4MK6 A;  3IUO A;  2FNP A;  3QPS A;  2H94 A;  4CGZ A;  3MMY B;  5IYC J;  2CQX A;  3ANG A;  3CCL I;  3C2H A;  3PUF A;  2IS6 A;  3DTE A;  3B6A A;  1XCB A;  2EJR A;  5CVI A;  4NEL A;  4RAY A;  5GAG J;  2KJC A;  1TWF J;  4A12 A;  2ZNZ A;  1XMX A;  1VQL I;  2RRE A;  1Z1D A;  4EM1 A;  4WCG A;  3WTX C;  2P0W A;  2E71 A;  4NNJ A;  1LEB A;  3B02 A;  3DBR B;  2UXU A;  3A2K A;  3LFK A;  1HOM A;  3X2Q H;  1GDT A;  5FHP A;  2PMH A;  2E35 A;  4L9T A;  3QOE A;  4GFK A;  1FYL A;  2DAO A;  5FJ8 J;  2KZG A;  1J59 A;  2DOA A;  3SFZ A;  4CDG A;  4A0Y A;  2PBX A;  4JP0 A;  1JGG A;  3GTL J;  3AQT A;  1X4P A;  1S3J A;  4CXF A;  2CSO A;  1FSE A;  2VL8 A;  2VXD A;  2I10 A;  3F8N A;  2K27 A;  2X6Y A;  3A01 B;  3CQZ J;  5E18 F;  2QWW A;  2R5Z A;  2HS5 A;  2A61 A;  3U1K A;  5FLX K;  2AQF A;  2LY2 A;  4E6K G;  1APL C;  1KU2 A;  1DPR A;  2HOT A;  1VQ4 I;  1IV8 A;  2K9N A;  2KIM A;  2TCT A;  3NAU A;  2Y0M A;  3HKZ A;  4LFU A;  5F0F A;  1IG7 A;  3S1N J;  4UDS A;  3CRJ A;  2XB5 A;  2M8E A;  3V8K A;  1FIP A;  5AON A;  3OMY A;  2FJI 1;  1W7P A;  3HHH A;  2PQ8 A;  3BNI A;  3BCA A;  2CO5 A;  3H3Z A;  2DG7 A;  1MZB A;  3RKX A;  3KZ9 A;  4BQN A;  2DK5 A;  3A0H C;  3CLO A;  2A68 F;  3CMM A;  2STW A;  2HTJ A;  3GZN B;  3OOP A;  3PNY A;  4QSH A;  5D5V B;  1DP3 A;  3T6N A;  5DUK A;  2XDV A;  2R5Z B;  1QBJ A;  2AS5 F;  2OUM A;  2MH2 A;  4ENM A;  4A3D J;  2UUZ A;  3K0L A;  4DQ2 A;  5EEA A;  3I56 I;  3JRA A;  4HG2 A;  2M1B A;  1O3S A;  1T8I A;  3FXR A;  1F4K A;  3HEF A;  4NC7 A;  2A6E F;  3AKZ A;  2VKD A;  2YS9 A;  2DFI A;  2P6S A;  2XKP A;  2UXO A;  1B1B A;  2PMU A;  2IS1 A;  4KT5 C;  2JQ7 A;  3GFL A;  2BW3 B;  3O60 A;  3OL3 A;  3MKZ A;  1MDM A;  3NI7 A;  2F2E A;  4DYR A;  4E7J A;  2LK2 A;  1HW2 A;  3EUA A;  3JTG A;  4CHU A;  4S04 A;  4N9I A;  2M3A A;  5EG0 A;  4X0G A;  1IXR C;  5DYM A;  3V7S A;  1H89 C;  2GFN A;  2ZFW A;  1GV2 A;  1T56 A;  3PFI A;  3E6C C;  2DG8 A;  1BIA A;  4PSX A;  3KE2 A;  3JSO A;  1CF7 A;  5JR3 A;  2IA1 A;  2RC4 A;  5L3C A;  1B4A A;  3IWF A;  3C18 A;  3ZRG A;  4UXN A;  2WTE A;  4C3I J;  3BJA A;  2R7X A;  4RB2 C;  3KIO A;  3KZZ A;  4IEJ A;  3G73 A;  4Q48 A;  1POG A;  2G3B A;  3ZQG A;  1XC5 A;  3Q0U A;  5CYV A;  1MDM B;  1U0J A;  3HPG A;  3KYD B;  4I7H A;  1DU0 A;  4AM3 A;  1BI3 A;  1ETK A;  4CO8 A;  1Y8R B;  4BE2 A;  4DW6 A;  3LSG A;  3CES A;  2Y69 H;  4UVA A;  2VB6 A;  3O8H A;  2OJE D;  1O3Q A;  4KJZ A;  4ZZL A;  1NK3 P;  3BTJ A;  2RN7 A;  1V54 H;  3I9V 2;  4XN3 A;  3IHU A;  5BMZ A;  2KP6 A;  3B73 A;  5H2F C;  3P9C A;  2JUC A;  3I71 A;  4A5N A;  1A31 A;  3O8G A;  2OER A;  4IVN A;  1CF7 B;  1FBU A;  4XSX F;  2E2J J;  4KYW A;  3CWR A;  2MH9 A;  3OS0 A;  5CXG A;  3SEZ A;  2HPM A;  1R49 A;  3CJQ B;  1V5E A;  2F4M B;  4B44 A;  2Y48 A;  5K58 A;  2M9H A;  1TQI A;  2JK3 A;  3VYS B;  2ZOZ A;  4Y13 A;  3HE0 A;  3ZP5 A;  2MA3 A;  1VI0 A;  4F92 B;  3H3V K;  1MMG A;  2EFW A;  1UJ8 A;  2Z1D A;  1RUN A;  5K7F A;  4PFO A;  5GPA A;  1ZLJ A;  3WTU C;  2JA8 J;  1MMA A;  4FCY A;  3V7R A;  4DZP A;  3W6K B;  2KIF A;  3H0G J;  1K61 A;  1KU9 A;  1UG2 A;  1BW5 A;  2BBY A;  2D2W A;  3TO7 A;  1A36 A;  3AL0 B;  3M07 A;  1P4W A;  1J7K A;  4ENN A;  1OCT C;  3ZMT A;  3MZH A;  1HXD A;  1UAA A;  3OWT A;  3G1M A;  2O6G E;  2UXP A;  2DTZ A;  2X6X A;  3FIW A;  4Y52 J;  4WXD A;  5CVU A;  2L0K A;  1T6S A;  3BZ6 A;  3VVX A;  1DU6 A;  5GP9 A;  2L01 A;  1U6G A;  3CCQ I;  4ITV A;  1FWZ A;  3O3K A;  4FE7 A;  3EDP A;  1K6O A;  2IGO A;  3ABU A;  3PFY A;  2CUE A;  2W85 A;  4WWC A;  3S8P A;  1H88 C;  2HXO A;  2KHM A;  2XGE A;  3RCO A;  3RD3 A;  4JKZ A;  4RGU A;  3HTH A;  3J7A Y;  1D1C A;  2J5O A;  3FK6 A;  5F64 A;  3SFI A;  3ZQL A;  4L18 B;  2JTV A;  3S2H J;  4O6J A;  1MBJ A;  1K7A A;  3CZ6 A;  2R3S A;  1BOA A;  4M3D A;  1I1G A;  1UZC A;  2DI3 A;  1HKT A;  3GFM A;  1XN7 A;  1YQA A;  5HS9 A;  2IBD A;  2ID6 A;  2KIU A;  2QUF A;  3WU2 C;  3CF2 A;  3O6B B;  2ESH A;  4U7B A;  4DVY P;  2REK A;  2R92 J;  4RGX A;  1QQI A;  2XF5 A;  3TMO A;  1ZLK A;  1IXC A;  3K1P A;  2VE9 A;  1OCO H;  3DTK A;  5HLT A;  1IUY A;  2ELJ A;  3KET A;  5IP6 A;  1GV5 A;  4IHT A;  4S05 A;  2CJJ A;  2GZW A;  2KKO A;  4BJ5 C;  3PUB A;  3DEW A;  2HKU A;  3TL4 X;  1PVE A;  3OYF A;  3CC4 I;  3HGG A;  5E3O A;  1IO2 A;  3RPU D;  3E6M A;  3V7C A;  3N05 A;  3FRQ A;  5E3L A;  5JHF A;  1DGR M;  2FML A;  4IOA F;  4RB0 A;  1ETV A;  1MH3 A;  1MBH A;  5HVQ C;  3LAJ A;  3VIB A;  3JR9 A;  3CME I;  1SAN A;  1MMN A;  5JVG F;  1BL0 A;  4MFD A;  1HBX G;  2ZY9 A;  2FA5 A;  1R36 A;  4H0E A;  2MD0 A;  1ZHF A;  3CTA A;  4YFK F;  2RAS A;  3CJD A;  3U9G A;  2W57 A;  2NS7 A;  1D0Y A;  4ZYE A;  4IRI A;  3SZT A;  2NNN A;  5D5W B;  1LFB A;  1EKE A;  3BTC A;  5BNG A;  3WTV C;  1WRJ A;  4L9V A;  2H6B A;  3FXJ A;  1MW7 A;  2OV7 A;  2MYS A;  4G9Y A;  1Y39 A;  2X1D A;  1YIJ I;  1U5T C;  3MKL A;  5ICF A;  3JRE A;  3QKX A;  5C4J J;  2E5N A;  3HRU A;  3AFH A;  4OIR F;  1BJZ A;  2V6C A;  1JTY A;  2L2O A;  5C3E J;  3DPJ A;  3FXM A;  1YI2 I;  1IN7 A;  4EMS A;  4PGG A;  4K2E A;  5GAH J;  5FLM J;  3LNQ A;  1ZK8 A;  2OC6 A;  1J75 A;  2PBI A;  2E60 A;  1SVM A;  4ACI A;  2O7T A;  1MJA A;  1BBY A;  4Y15 A;  1C0W A;  1B9M A;  1WI3 A;  2LY9 A;  3DBH B;  3G6E I;  4OMY A;  3TO6 A;  2HI3 A;  1QZE A;  2W4S A;  2F5E A;  2IT0 A;  1XTA A;  3FKJ A;  3JRH A;  3T8T A;  3QPT A;  2CQK A;  2HOA A;  2W7N A;  2HDC A;  1YW9 A;  4DYC A;  2GOM A;  2DFF A;  3T1B A;  1TT5 B;  5LLQ A;  3E6B A;  2XC7 A;  4MGR A;  3S2D J;  5FKO A;  5J3L A;  2HPI A;  2EFP A;  3CO6 C;  4ZC3 A;  1D1B A;  4XIC A;  2HEO A;  1JKR C;  3BR5 A;  2VT2 A;  2RQQ A;  4PJM A;  5TIS C;  1TLH B;  1U9N A;  3PQJ A;  2I5U A;  4BEH A;  4ANJ A;  2NVT J;  1XGN A;  2ETH A;  1ZG1 A;  2OPT A;  4ZTJ A;  1FX7 A;  4B1R A;  3LHQ A;  3NAR A;  2GWR A;  5B5E C;  4N4N B;  4BAY A;  1V5G A;  2XUB A;  2K4J A;  2XAU A;  4KIF A;  4KN4 X;  1K6Y A;  3V6G A;  3EGQ A;  3AG2 H;  2DOF A;  5LBQ A;  5FLX Z;  1YS6 A;  2XDN A;  3E6D A;  1U78 A;  2ISZ A;  1U8B A;  1GLN A;  1OCR H;  4M9Z A;  3R0J A;  2V9V A;  2CW8 A;  3ZGK A;  1KU3 A;  1H0M A;  1ETY A;  2DA4 A;  2Y9Z A;  1OR7 C;  3LQQ A;  3A1Y A;  3BG6 A;  4BS9 A;  5LGU A;  5EFY A;  4M3B A;  3BG3 A;  4HF1 A;  2K40 A;  3CCJ I;  1S6L A;  5E8I A;  4M9S A;  3QYB A;  1Y0N A;  4BEH B;  2QCO A;  1E17 A;  1JGS A;  2HZT A;  4EJU A;  4Z6Y A;  2JUG A;  4ZYA A;  1N25 A;  2JA5 J;  3TKY A;  2OZ6 A;  4HDU A;  1TNS A;  3JRD A;  3K4M A;  1P7I A;  4M3F A;  4BYY A;  2RDP A;  5M3M J;  5CXI A;  2JMW A;  1JHH A;  2NS8 A;  3PSF A;  5K1Y A;  1DGW Y;  2CFX A;  4N9H A;  4HX7 A;  3DTI A;  3IKT A;  4UHT A;  3CJR B;  4S0H B;  4XLC A;  3BPV A;  4AD9 A;  2ZKZ A;  2KL4 A;  3BQZ A;  3HUG A;  3K1N A;  1ODD A;  1T95 A;  4BUP A;  2E1C A;  5HDG A;  5K5O A;  1MNM C;  2JVG A;  4ZZD A;  3HB9 A;  2PJR A;  2HOE A;  3GLL A;  3RH2 A;  5HSZ A;  4GYI A;  3P7N A;  4P9F A;  3IRQ A;  2XRN A;  4FET A;  2LR8 A;  2VQG A;  3I4P A;  1WSU A;  2ZCW A;  1S72 I;  2H1K A;  3B81 A;  1LE8 A;  1JTX A;  4AC6 A;  2L7M P;  1LUJ B;  2K9S A;  4RBO A;  1B8I B;  2MFZ A;  4CZZ A;  2DA5 A;  3HSF A;  4CUG A;  1RIO H;  2CH0 A;  4A6E A;  4PK4 A;  2CGP A;  4G8X A;  1PP8 F;  1DP7 P;  1IN6 A;  3ZQ7 A;  3EYI A;  3S3N A;  2V7F A;  4YIR X;  1WWX A;  1FTZ A;  3HGY A;  4L62 A;  3OSG A;  1MND A;  2HXI A;  2E36 A;  2FQ3 A;  2PMZ A;  1RES A;  1WH7 A;  1DQU A;  3KYC B;  1YTY A;  3WGG A;  2QBY A;  4IHW A;  5DAJ A;  1AA7 A;  1HDP A;  4LMY A;  4IHY A;  3CF5 F;  1FMV A;  2PJR B;  3ZQF A;  3CMY A;  3HTJ A;  4XID A;  3C3W A;  3ABM H;  1IN8 A;  4WIB A;  4ESF A;  1JUS A;  3H5A A;  3K70 C;  1LE8 B;  1UST A;  4KMF A;  2FRH A;  1BI0 A;  3IRR A;  2A6T A;  2FUG 2;  2WC2 A;  2R7W A;  3RI4 A;  3P9K A;  4P55 A;  3VOX A;  1AOY A;  2A2F X;  1SFE A;  2DMN A;  2LP0 A;  3GLX A;  2VC1 A;  1O4X A;  2BZT A;  4Q5S F;  5LGT A;  2VI6 A;  3QPH A;  2XPU A;  2B0L A;  3R0A A;  2CFO A;  2XF6 A;  4RLF A;  2QBY B;  3I59 A;  1ACI A;  2HOS A;  1TL8 A;  4EV0 A;  3F6V A;  2VBW A;  2LYC A;  3LA3 A;  4XRF A;  3VVZ A;  3D0S A;  2CWE A;  2OZU A;  2ME6 A;  4A2U A;  2YU9 J;  3V8J A;  1IDZ A;  1I6X A;  1HQC A;  4R79 A;  2BVL A;  4LGW A;  3A02 A;  4M74 A;  1U2W A;  2DO7 A;  4XOR A;  1W7P D;  5F6F A;  4DZJ A;  1W36 C;  4OIP F;  3TDZ C;  2MBF A;  2OI8 A;  3GFJ A;  2C6Y A;  4Q4Z F;  1VQO I;  4NB5 A;  2Q24 A;  2BEO A;  3OOU A;  2ZB9 A;  3FWE A;  4C2M A;  2VC0 A;  2QLZ A;  5LHH A;  1D8J A;  1K4S A;  1PDN C;  4I6Z A;  2Z16 A;  4I99 C;  2A69 F;  1ZTR A;  1Z05 A;  3I59 B;  3L00 A;  4UVC A;  1U5T A;  2P81 A;  3CCY A;  3PIP F;  3HRM A;  2CV0 A;  2QGU A;  3OS2 A;  3NNR A;  4UNO A;  1VF9 A;  4F3Q A;  3FBN B;  5L3F A;  2O0Y A;  3VB2 A;  4NBQ A;  1IUF A;  2ZJQ F;  2A3S A;  2FX0 A;  5K5Q A;  3P9I A;  1E2X A;  1H9T A;  2D1H A;  1X2M A;  3GFI A;  2YVH A;  4M73 A;  5LEJ A;  3K10 A;  2RV8 A;  1ZG3 A;  3LST A;  4XRM A;  3BRU A;  4OIO F;  3S16 J;  5M5X J;  5IT9 K;  2M5W A;  2KT0 A;  5LGN A;  4JL3 A;  2FEZ A;  3DLA A;  4LIV A;  3BWG A;  2RNJ A;  1X2N A;  4IRG A;  3ASO H;  5ILS A;  2EV5 A;  2NX4 A;  1XGM A;  1R22 A;  4D1Q A;  2GIZ A;  3IH3 A;  3WG7 H;  2Y0S A;  3MWM A;  5KK1 A;  1JXS A;  2QF7 A;  1U5T B;  3GZ5 A;  1Q1V A;  5IYB J;  3TGN A;  3HBL A;  2DA6 A;  1VQ8 I;  1VQ5 I;  3RZD J;  3HC7 A;  1XGO A;  2BXZ A;  4FE4 A;  3AL0 C;  2YVX A;  2KLO A;  3DXJ F;  2XPV A;  1I5Z A;  4G94 A;  3H35 A;  4MO7 A;  4WXC A;  2YPR A;  3JSP A;  1JJ8 C;  2E2H J;  2DMT A;  3RTR A;  2EWN A;  1WJF A;  4AIK A;  3ABT A;  3IWZ A;  2R4G A;  1K79 A;  3FK7 A;  2DT7 B;  1T33 A;  3L2V A;  1WH5 A;  4KNY A;  4PXI A;  1FSH A;  1X3W B;  1G2H A;  3OV8 A;  2DA7 A;  2QQ8 A;  2RKH A;  5HNF A;  4KDP A;  1IRG A;  3JRI A;  4IKF A;  1Y1V J;  2CW0 F;  3DEE A;  1OR7 A;  4Y4R A;  2WB1 N;  2K9L A;  2B3W A;  3EYY A;  3CUQ C;  3MVP A;  4BQA A;  4E7Z A;  2MC3 A;  3WG9 A;  3JW4 A;  1X1P A;  2L7K A;  2FXA A;  3HL2 A;  4U9L A;  2OCE A;  4GRI A;  2VPL A;  2I8D A;  3F6O A;  5BPI A;  4CCM A;  1VZ0 A;  2L4M A;  2DT5 A;  4E7L A;  5E3M A;  3RYP A;  1L3L A;  4P5O A;  5L3G A;  3VW1 A;  1GUU A;  2LF7 A;  4J00 A;  3QP6 A;  3RQI A;  4DIQ A;  4ESJ A;  1OMI A;  2L4A A;  1HST A;  3E5U A;  4G6D A;  1S7E A;  3J7A O;  3NPI A;  3H0D A;  3EUP A;  2G9W A;  3HM5 A;  5FB2 A;  4G7H F;  2NXN B;  2CUF A;  3V42 A;  5K7Z A;  3FM5 A;  1QO0 D;  2H1L A;  4BXF A;  1X1A A;  3K4L A;  3A01 A;  2O9L A;  4YZE A;  2COM A;  4XLF A;  2CV1 A;  4OIN F;  1QPI A;  3GTJ J;  4ESB A;  4ENJ A;  1OQY A;  4B4C A;  1U9O A;  1MKM A;  3F8F A;  4RA2 A;  4G7Z F;  4EVI A;  2YR2 A;  1LDJ A;  4PJN A;  3KP2 A;  1F9N A;  1YRN A;  2HFH A;  3DKY A;  1BI1 A;  4A3E J;  4EAT A;  5HOO A;  4XRS A;  3LSM A;  5FKK A;  3TW7 A;  1MJB A;  2Q2E A;  3WTZ A;  3SJM A;  3BOQ A;  3L2Q A;  4IRH A;  1R5H A;  2P4W A;  5TRD A;  3KLO A;  4YEL A;  2Z33 A;  3DPT A;  2BY0 A;  1K83 J;  3KEY A;  4JOM A;  4M3E A;  2FF4 A;  1P9Q C;  3BR3 A;  2MLG A;  5TGT A;  3V4G A;  4F52 A;  3TDU C;  4P9U A;  5E1Z B;  5CQE A;  3U1D A;  2PMZ N;  3CP8 A;  1G3T A;  1JKP C;  3KP6 A;  4AIH A;  5ILV A;  1YRN B;  4QTR A;  4I0A A;  3S1Q J;  4CCN A;  5K5R A;  5HLG A;  3HDD A;  4YFX F;  2DA1 A;  5DTD A;  1HCR A;  5CVV A;  2PLY A;  4D9J A;  2BW3 A;  5LHI A;  2Q2E B;  2EFO A;  3BPX A;  1YHQ I;  4NN1 A;  2WY8 Q;  2P6T A;  1I50 J;  1WPK A;  4Y17 A;  2RNG A;  4FX0 A;  2V9K A;  1LVK A;  2GAU A;  5D6E A;  4D5C A;  3M1C A;  1OJL A;  4PJJ A;  4GO1 A;  2Y75 A;  5DV5 A;  2BOL A;  1R58 A;  1RPW A;  2H27 A;  2QKM B;  5J1U A;  3M9A A;  2VOO A;  2LKS A;  1RR8 C;  1SMT A;  2M0C A;  3ABK H;  2Q1Z B;  1MH4 A;  4RMN A;  4V19 K;  3LQR A;  4FQG A;  1U8R A;  1XG1 A;  2HR3 A;  2XVC A;  2OA4 A;  3H5R A;  4HST A;  4W1U A;  1W5S A;  3QP5 A;  2WAQ A;  5FKN A;  3PO2 J;  2X1E A;  3H5N A;  2Z9O A;  2OU2 A;  4BJ6 C;  1OCC H;  5KHD A;  3R4K A;  2DPU A;  4M3G A;  1ZRD A;  4OD5 A;  1B9N A;  5FRO A;  2X6W A;  1HF0 A;  1XMA A;  5DUI A;  4ZYD A;  4AYB A;  3I5U A;  5LFA A;  1X1B A;  3GEU A;  4IHX A;  2IS2 A;  2CYY A;  4BQO A;  1S7O A;  5A2Q K;  2A07 F;  5F04 A;  1S5L C;  5D1R A;  3GZI A;  3VYU B;  5F1R A;  2WAE A;  4PSW A;  4MEY F;  2PZ9 A;  3L9F A;  3QQA A;  2IS4 A;  2HYJ A;  1IF1 A;  2KDZ A;  5H20 A;  2BGC A;  2HYG D;  3ABL H;  2HQA A;  1LKX A;  2R93 J;  2IXS A;  5C44 J;  2E5Z A;  3BJ6 A;  4ZJZ A;  4XLA A;  3S14 J;  3F8B A;  3HOU J;  1ZN2 A;  1XB4 A;  1Z67 A;  3HHG A;  3SEQ A;  1HC8 A;  3GTG J;  5E20 A;  3SQN A;  5IOZ A;  1B72 A;  4HZF A;  4L9J A;  2OTJ I;  2BY3 A;  3J81 Z;  5E8G A;  2JA2 A;  4FHT A;  1ZKG A;  4DBQ A;  2FBQ A;  2MLK A;  2H8R A;  5EDN A;  3K4J A;  2DU9 A;  3H9Q A;  3LSI A;  4RB1 A;  2JRM A;  3BR0 A;  4KIS A;  1O57 A;  3W3C A;  4XLH A;  1Y0U A;  4OIQ F;  2E1N A;  3HOX J;  3J7Y J;  3OYM A;  1S7A A;  1WJC A;  1JUM A;  3I55 I;  1Z9C A;  3EQL F;  4L0Z B;  3E1S A;  4IHV A;  5HNH A;  3CCR I;  1D0X A;  1OCP A;  5LRR A;  3HOT A;  3FM3 A;  1XGS A;  3DPL C;  1YO5 C;  2O3F A;  1U3E M;  4C3J J;  1HKS A;  2VOD A;  5ED4 A;  2V1D A;  3K4C A;  1ULY A;  1WQ2 A;  2JJ7 A;  4RM2 A;  2F5D A;  2WAF A;  3BR2 A;  1IRF A;  2NS0 A;  3TQN A;  2XIG A;  3LMM A;  4HEA 2;  3KP4 A;  3PIO F;  1VQM I;  2BVM A;  3VFZ A;  1VQK I;  2XF7 A;  1B72 B;  1B59 A;  1PUF A;  3CDI A;  3JRF A;  1G3Y A;  3KPH A;  4FTH A;  2V1N A;  1LQ1 A;  3CUQ A;  5FLV A;  3V8L A;  5FMP A;  2VBX A;  4A3F J;  3CCU I;  2Y31 A;  4GXO A;  2G7H A;  2VJ4 A;  4CSW A;  4IF4 A;  2WV0 A;  1UHS A;  1SC7 A;  2HGC A;  4BDY A;  2CRG A;  2UXI A;  1XSX A;  1K78 A;  1R5G A;  5FKL A;  1YW7 A;  5J4V A;  1ON2 A;  4E4H A;  3LSH A;  3L2U A;  2W53 A;  2JZY A;  2CQ7 A;  2HKO A;  4PGH A;  4A3M J;  4XBF A;  2KRC A;  1P2F A;  1HKQ A;  2HDW A;  1XMK A;  2L9N A;  1SD7 A;  3HOY J;  2PX9 A;  4LD5 A;  3NEU A;  1IAW A;  1PUF B;  2GA2 A;  3M8F A;  4PCQ A;  3RJP A;  4CA0 A;  3BC8 A;  3CUQ B;  1P4A A;  3IH4 A;  1P6R A;  4G12 A;  1YFH A;  1FBS A;  1MBK A;  2QSF X;  1EH7 A;  3QU6 A;  5IT9 Z;  4BDZ A;  3KX2 A;  1RI7 A;  2J5P A;  5HAW A;  3WGH A;  2JVH A;  1Y8Q B;  3U21 A;  5J47 A;  1FZP B;  1ETX A;  2XKO A;  1K78 B;  3M3Y J;  2YVE A;  4B47 A;  3G7R A;  2BY1 A;  3IH2 A;  4GCV A;  3ZQI A;  3QYF A;  2RVC A;  1LFU P;  2EA2 A;  4HF2 A;  3A0B C;  2OD5 A;  3BJB A;  3C7J A;  2ZJR F;  4XN0 A;  4ETS A;  5CVR A;  1LB2 A;  2P7C B;  1Z7U A;  3DP7 A;  3NS4 A;  1TW2 A;  4Y33 A;  1OPC A;  1RKT A;  3KEO A;  3VSL A;  3QBM A;  3K4K A;  1JT6 A;  3Q5F A;  4X6A J;  4UB6 C;  2Z2S B;  1FOX A;  1R1U A;  2W48 A;  2PJP A;  2X9D A;  4JQF A;  1QNT A;  2MD5 A;  2BHZ A;  1YG2 A;  1OKR A;  1ZGA A;  1UI6 A;  1KQ0 A;  3WTS C;  1R6R A;  2Q0O A;  3GCM A;  5BQT A;  4I09 A;  3PPB A;  1BR1 A;  3F21 A;  1HLV A;  3MAJ A;  4P1W A;  3HIM A;  2EPF A;  1BA5 A;  2L7Z A;  4GCT A;  2M45 A;  2NVQ J;  3SWH A;  1OFC X;  2UV1 A;  2XHK A;  4J19 A;  4HV5 A;  1MMS A;  1YX3 A;  4AF5 A;  2M4K A;  2PEX A;  1N78 A;  3RZO J;  3TOB A;  2Y30 A;  3HIF A;  4LIU A;  4NC8 A;  4MTD A;  4BXX J;  1TZL A;  1R7J A;  3FXL A;  2GLO A;  5K7H A;  1GXQ A;  2AO9 A;  4ZH4 F;  1AHD P;  3PO3 J;  3FHZ A;  1TTY A;  3I0T A;  1G59 A;  4OWR B;  3FF5 A;  1Z91 A;  3HKZ N;  1VQN I;  2OQR A;  4RAF A;  2E1O A;  1YLF A;  3BTI A;  2PI0 A;  2L9V A;  5J8C A;  2NOG A;  2XGD A;  5B66 C;  3P5J A;  3W2A A;  1X58 A;  2EBI A;  2IRF G;  2KQR A;  2M2E A;  5C4Y A;  1XS9 A;  2DW4 A;  2WV1 A;  1G8X A;  2XRL A;  4BU2 A;  3GTP J;  2EFQ A;  3H36 A;  4PZJ A;  1G3W A;  3LSP A;  3IC7 A;  3AG1 H;  4LOC A;  1HDD C;  6PAX A;  1R1V A;  4L5E A;  3RPQ A;  4UV8 A;  3KZI C;  5HLI A;  3T0Y A;  3LOC A;  3MNL A;  2AQE A;  3QWL A;  3AQS A;  3DU5 A;  3Q9V A;  5HS7 A;  3OYI A;  1TWA J;  3RQ4 A;  2QA4 I;  2QIB A;  1QHH D;  2KRF A;  3HJE A;  4II2 A;  4O3M A;  4UV9 A;  2QM3 A;  1LJ9 A;  3FXK A;  2CQQ A;  3LSK A;  3KP5 A;  4C9Y A;  4IX7 A;  2DK8 A;  5KAI C;  5DS9 A;  4EGZ A;  1F5T A;  4ME9 A;  2JA7 J;  4BH9 A;  3GTO J;  2XAG A;  2EZL A;  2V6E A;  3A4C A;  2NAZ A;  3JTH A;  2OAZ A;  4O5V A;  3DBL B;  2DOD A;  3FXU A;  3CCS I;  1HSJ A;  3HOZ J;  2QKL B;  3M8J A;  3KNW A;  4KIC A;  3FBI B;  4KWA A;  4BNC A;  1O7L A;  5DM7 F;  3K1M A;  4E7K A;  3V78 A;  5F0C A;  3QRF F;  4OD4 A;  1LDD A;  3S1M J;  3QYE A;  2EB7 A;  2PG4 A;  2XPW A;  5J8F A;  2R0Q C;  1REP C;  1MMD A;  3DWL E;  3BCG A;  2NVY J;  4AVP A;  3FKI J;  4J01 A;  4H4K C;  4HKU A;  4II3 A;  4PUS A;  2FJ1 A;  3WHC A;  1E3O C;  1FOY A;  3LA2 A;  1RRJ A;  2QQB A;  5FKM A;  1VND A;  1BW6 A;  4MEX F;  4JX6 A;  2EV0 A;  5F27 A;  1FLI A;  4JX5 A;  2G7U A;  1QHG A;  1D8K A;  1ZGW A;  3ECH A;  3TP0 A;  3OSF A;  1MBE A;  4F55 A;  1PUE E;  1F43 A;  1BI2 A;  4F93 B;  2LKX A;  1UEL B;  3Q3S A;  3OYL A;  1A6I A;  3LWJ A;  2BYV E;  3MZY A;  4MTE A;  4AWX B;  4YRV A;  4BE0 A;  5DDG A;  3S17 J;  2KFD A;  2MGQ A;  5IP9 J;  1B8I A;  1SGM A;  2G7G A;  3BHQ A;  1J0R A;  3K9T A;  1W0U A;  1UI5 A;  4WXH A;  3AG4 H;  2UXN A;  3KFW X;  3MQ0 A;  3VW0 A;  1W5C C;  3BZC A;  2QWT A;  2KMU A;  5ERI A;  4RGS A;  4IOC F;  3UR3 C;  3W2V A;  4NHJ A;  2Y2Z A;  4PFP A;  1Z0X A;  3F0C A;  1JE8 A;  1N77 A;  4ZDP A;  2UXX A;  4QLC U;  2XAQ A;  3H9J A;  2ECB A;  1SD6 A;  1T2K A;  2ZCN A;  2X6O A;  1O7F A;  3S32 A;  4F91 B;  2XGC A;  2MSY A;  2WBM A;  1MIJ A;  2DPD A;  4D5F A;  4EJT A;  2NP5 A;  1S29 A;  1KYW A;  2E1M C;  3CUO A;  2QZ8 A;  1SFX A;  2LVS A;  5IOY A;  4B3A A;  5C4X J;  2WUI A;  3AAF A;  3CDH A;  3DV8 A;  4A3J J;  1WCM J;  3LSJ A;  5A2Q Z;  2HQR A;  4AID A;  3RIR A;  5CQG A;  4BHB A;  3ELK A;  5FD6 A;  2MW8 A;  2DMU A;  2E7X A;  3D1N I;  1ZR4 A;  3CD6 I;  2V1X A;  1UFM A;  3U2R A;  1RET A;  3GF2 A;  2DT6 A;  4ZTF A;  2BV6 A;  4JX4 A;  4LK1 F;  3I4M J;  5HDN A;  4BQQ A;  3R6S A;  4HDV A;  2QOP A;  3J81 K;  2VKV A;  2OF7 A;  1LFP A;  2G7L A;  4XOP A;  3H1C A;  1RZ4 A;  3P9T A;  2VQL A;  3G1O A;  2ZFU A;  5ICE A;  1S8N A;  2VPR A;  2XSD C;  3GZ6 A;  3QU3 A;  4M6Y A;  3ZQC A;  4HOB A;  2ZXI A;  4ZDL A;  3MKW B;  3IUV A;  2ZCX A;  2EIK H;  2K7L A;  5D4S A;  2VQH A;  3GYH X;  4OMZ A;  3ECO A;  2ZJP F;  1ORK A;  4I02 A;  1OYI A;  4W97 A;  2VT3 A;  4HNV A;  3K70 D;  5D4R A;  1VFC A;  2X1C A;  3KKD A;  1Z7L A;  1VQ9 I;  1G4D A;  2O7O A;  4XL9 A;  4KN7 X;  1TW3 A;  1J2X A;  2ZME C;  1IGN A;  4FT8 A;  1HA8 A;  1I1S A;  3NWS A;  1RUO A;  1OYY A;  4CCK A;  2QSG X;  2ACJ A;  4ASN A;  3MFK A;  3BP8 A;  5FGM A;  3PAS A;  2DQR A;  1IXS B;  2EIJ H;  4BJT A;  3GEZ A;  3PSI A;  3KP7 A;  3DFG A;  4EQQ A;  4Z2Y A;  2GBY A;  1XCV A;  3O2P E;  3ZMZ A;  4I98 B;  4RM3 A;  1R4M B;  5DEQ A;  2TDX A;  2G0E A;  2JPB A;  4V2G A;  3UNG C;  1FP1 D;  2NNY A;  5IT3 A;  1W36 D;  5TJJ A;  2ZOY A;  5DCM B;  4AU7 A;  1SFU A;  5CKT A;  1V4R A;  1JUP A;  3HOS A;  5DM6 F;  3HSR A;  3SZP A;  5M3F J;  5EJC A;  1WJD A;  5D8L B;  1J9I A;  3S2W A;  4BL0 B;  3KYL A;  3T8R A;  2CG4 A;  2VJI A;  2GA1 A;  1MSF C;  4RLQ A;  2ZO4 A;  3LFU A;  1IV6 A;  3M4O J;  3VUQ A;  3L2R A;  3H92 A;  4AUX A;  4MNU A;  5JI6 A;  4IHS A;  5FFX A;  4PDK A;  1I27 A;  3ZMU A;  3OYK A;  2AHQ A;  3ZMS A;  3JAM K;  2D5V A;  1YJN I;  2R7V A;  2GEN A;  4XKW A;  2ZXW H;  3E97 A;  3WOD F;  4P96 A;  2IAI A;  2VON A;  2EK5 A;  5AQC A;  3RYR A;  3LWF A;  3Q9S A;  1SAU A;  2VAS A;  1LEA A;  1OCZ H;  4FIS A;  1TBX A;  4N0B A;  1Z21 A;  4UUT A;  4MHG A;  3IV5 A;  4MXM A;  1NHA A;  2W84 A;  2FBH A;  3ANP A;  3SDB A;  5KNL A;  4A3K J;  3E5Q A;  3FHN A;  1Z77 A;  2LY1 A;  3TW6 A;  3ZMD A;  1F1Z A;  1R00 A;  2L3D A;  3PNV A;  2ECC A;  2P5V A;  4BGD A;  1TWH J;  3GTM J;  1E0E A;  1FY7 A;  4MLO A;  1VTN C;  5HBU A;  2QKO A;  2BHY A;  1R9T J;  2L7F P;  3DQV C;  3BCB A;  2QYO A;  3QPL A;  1YE9 A;  1ZGJ A;  5D19 A;  3F3X A;  3L1P A;  2RQP A;  4M72 A;  2LRD A;  1TP4 A;  3PQK A;  3VVY A;  2F5F A;  3C2B A;  4HAM A;  1IRZ A;  4XKB A;  3MD2 A;  3VOD A;  3OYG A;  2NVX J;  3L2C A;  3CJT B;  2B63 J;  4RAZ A;  2ZBK A;  5EZG A;  4HBL A;  4LK0 F;  2IVM A;  2R7T A;  2XGX A;  3BRO A;  4B48 A;  3GME A;  5FRN A;  1YX5 A;  3GVA A;  4XRS G;  3BT9 A;  1BC7 C;  4CCO A; 
#chains in the Genus database with same CATH homology
 4I76 A;  1UMQ A;  5C4J J;  5IOZ A;  1TWG J;  3UKG A;  3JRG A;  1B72 A;  1BJZ A;  2DN0 A;  1JTY A;  5C3E J;  3BTL A;  3DPJ A;  2DMP A;  1ZKG A;  2YUS A;  4Y7N J;  3OIO A;  2FBQ A;  5FLM J;  3LNQ A;  2GM4 A;  2H8R A;  3BR1 A;  1AKH B;  1ZK8 A;  2V57 A;  5EDN A;  1RKW A;  4ACI A;  3BR0 A;  2O7T A;  3HOX J;  1WI3 A;  2LY9 A;  5EZH A;  1JUM A;  2HI3 A;  3JRE A;  3JRH A;  4BY1 J;  4IHV A;  3HOW J;  1A5J A;  1OCP A;  4A69 C;  4MIM A;  3ON2 A;  2HOA A;  4C3J J;  1FTT A;  4DYC A;  2JJ7 A;  3FIS A;  1FIA A;  2ELK A;  3BR2 A;  3LSR A;  2JN6 A;  3JRB A;  3S2D J;  5FKO A;  5J3L A;  4GFL A;  3ZQH A;  1B72 B;  1PUF A;  3JRF A;  4MFE A;  4FTH A;  1Y1W J;  4XIC A;  5FLV A;  2EQR A;  1JKR C;  2VKE A;  4A93 J;  5JLX A;  2N8G A;  3BR5 A;  5FMP A;  3NRG A;  4A3F J;  2Y31 A;  2F07 A;  1U9N A;  2NVT J;  2DMQ A;  1UHS A;  4M6V A;  2OPT A;  5H9T A;  5EYR A;  2CRG A;  4QIW N;  2UXI A;  4B1R A;  3HTI A;  3LHQ A;  3NAR A;  5F1J A;  5FKL A;  4NDL A;  2TRT A;  1ETO A;  3W6V A;  1EF4 A;  2W53 A;  3V6G A;  4A3M J;  3PM1 A;  4BY7 J;  3VPR A;  3EGQ A;  1SFO J;  1QRY A;  2XDN A;  3C07 A;  1U78 A;  3VW2 A;  1U8B A;  3HOY J;  3ON4 A;  4JYK A;  1PUF B;  1ETY A;  2DA4 A;  3TP3 A;  2Y9Z A;  5M5W J;  4GFB A;  3LJL A;  3S1R J;  5FGL A;  4G12 A;  1CQT A;  3IH4 A;  5EFY A;  5F0H A;  4M3B A;  3BG3 A;  1MBK A;  2K40 A;  2G7S A;  4BBS J;  2QCO A;  5HAW A;  2FQ4 A;  2M8G X;  2ME0 A;  1MBF A;  1ETX A;  3M3Y J;  2YVE A;  4BKX A;  1FEX A;  3NXC A;  2JA5 J;  3G7R A;  3IH2 A;  3JRD A;  1P7I A;  4M3F A;  3ZQI A;  2JWT A;  3BR6 A;  5M3M J;  1LFU P;  2JMW A;  5CXI A;  2LTP A;  2NS8 A;  3BJB A;  2EZI A;  3B6C A;  3Q0V A;  3I4N J;  4S0H B;  5IPA A;  3BQZ A;  5J1Y A;  1W0T A;  1RKT A;  1NTC A;  3QBM A;  1JT6 A;  4X6A J;  3A03 A;  1MNM C;  2IEK A;  4ABZ A;  3GBG A;  3HB9 A;  3RH2 A;  5HSZ A;  3BG5 A;  1GVD A;  2W48 A;  2X9D A;  3E7L A;  1AU7 A;  3K2A A;  2LR8 A;  2H1K A;  3B81 A;  4AC6 A;  1UI6 A;  1LE8 A;  1JTX A;  2XB0 X;  2L7M P;  4D7N A;  2K9S A;  5D18 A;  4RBO A;  1B8I B;  3PPB A;  4CYC A;  2DA5 A;  1HLV A;  2ID3 A;  3HIM A;  1BA5 A;  2L7Z A;  4GCT A;  1JKO C;  2NVQ J;  1OFC X;  4ICH A;  4J19 A;  2LD5 A;  3S15 J;  4AF5 A;  3SDG A;  1NK2 P;  3BG9 A;  3RZO J;  2VUM J;  3S5R A;  2Y30 A;  3HTA A;  1FTZ A;  3HGY A;  4BXX J;  1ITY A;  5F08 A;  2QTQ A;  4L62 A;  3OSG A;  2HXI A;  1JT0 A;  2GLO A;  5K7H A;  2AO9 A;  4EEF G;  1AHD P;  3PO3 J;  1RES A;  1WH7 A;  2M34 A;  4IHW A;  3HKZ N;  5DAJ A;  2E1O A;  4BBR J;  2IU5 A;  4GCK A;  3BTI A;  2DA2 A;  1HDP A;  1ZR2 A;  4IHY A;  2NOG A;  2XGD A;  2DA3 A;  5GPC A;  1X58 A;  2EBI A;  3ZQF A;  3CMY A;  3HTJ A;  4XID A;  2M2E A;  1IC8 A;  5C4Y A;  1XS9 A;  2WV1 A;  2GUH A;  1JUS A;  2DJN A;  2XRL A;  1LE8 B;  2CU7 A;  3GTP J;  4CYC B;  3LSP A;  2Y0S N;  4LOC A;  1HDD C;  3VOX A;  1QVU A;  5CW8 A;  4L5E A;  4JNN A;  2R5Y A;  1ZQ3 P;  1TC3 C;  2DMN A;  2LP0 A;  3LOC A;  1O4X A;  1H8A C;  3GTQ J;  3MNL A;  4MK6 A;  3QPS A;  4XK4 A;  2VI6 A;  3AQS A;  5IYC J;  2CQX A;  1TWA J;  2XPU A;  2QIB A;  5EG0 B;  3ANG A;  2CQQ A;  3B6A A;  1IDY A;  4NEL A;  1TWF J;  2FD5 A;  3K7A J;  5DS9 A;  2HOS A;  4ME9 A;  2JA6 J;  2JA7 J;  3GTO J;  2EZL A;  3VVZ A;  2YU9 J;  2ME6 A;  5J1R A;  2HDD A;  2UXU A;  2O8K A;  1IDZ A;  1HOM A;  1GDT A;  3HOZ J;  5FHP A;  3KNW A;  3A02 A;  4KWA A;  4A3I J;  4DZJ A;  3V78 A;  4GFK A;  5F0C A;  2OI8 A;  1JKQ C;  3S1M J;  2XPW A;  5IYD J;  2R0Q C;  5FJ8 J;  2R5Y B;  2Q24 A;  2PBX A;  3BCG A;  3JRC A;  3OOU A;  2NVY J;  2ZB9 A;  4JP0 A;  2HQ5 A;  3FKI J;  1JGG A;  1I6H J;  4HKU A;  3GTL J;  3AQT A;  2FJ1 A;  3WHC A;  1ETW A;  4I6Z A;  1E3O C;  1ZTR A;  2I10 A;  3A01 B;  2P81 A;  3CCY A;  3CQZ J;  2R5Z A;  3F1B A;  5FKM A;  1VND A;  1BW6 A;  3NNR A;  2EZH A;  4JX6 A;  5F27 A;  4JX5 A;  4DYQ A;  1ZGW A;  1VF9 A;  1APL C;  3TP0 A;  3OSF A;  4A3L J;  1MBE A;  1IUF A;  2HOT A;  2FX0 A;  3E7Q A;  1F43 A;  2K9N A;  3NAU A;  2TCT A;  2YVH A;  2LKX A;  1X2M A;  3Q3S A;  1A6I A;  5F0F A;  3LWJ A;  4XRM A;  1IG7 A;  3BRU A;  2NP3 A;  3S1N J;  3S16 J;  4UDS A;  5M5X J;  3S17 J;  3CRJ A;  2KT0 A;  2XB5 A;  4JL3 A;  1FIP A;  2MGQ A;  5IP9 J;  3BNI A;  1B8I A;  1SGM A;  3GTK J;  2EZK A;  1X2N A;  3WHB A;  2G7G A;  2DG7 A;  3BHQ A;  3HOV J;  2UXH A;  1W0U A;  1IJW C;  1UI5 A;  3KZ9 A;  5IP7 J;  2NX4 A;  3Q0W A;  3VW0 A;  3IH3 A;  4QSH A;  4A3C J;  2QWT A;  3T6N A;  2QF7 A;  2K9Q A;  2LFB A;  2R5Z B;  1Q1V A;  5IYB J;  3HBL A;  2DA6 A;  4A3D J;  4C2M J;  1QVT A;  3RZD J;  5EEA A;  2Y2Z A;  4FE4 A;  1Z0X A;  3F0C A;  3JRA A;  2XPV A;  1D5Y A;  2ECB A;  4MO7 A;  3HEF A;  2ZCN A;  2X6O A;  2YS9 A;  2XGC A;  2MSY A;  4UUS A;  1JJ8 C;  4D5F A;  2RHA A;  2E2H J;  2UXO A;  2DMT A;  2NP5 A;  2RAE A;  3MN2 A;  3FK7 A;  3O60 A;  3NI7 A;  1T33 A;  3JSJ A;  1WH5 A;  4PXI A;  2LVS A;  5IOY A;  4B3A A;  4DYR A;  5C4X J;  1G2H A;  2DA7 A;  2WUI A;  3G56 A;  4A3J J;  2LK2 A;  1WCM J;  3LSJ A;  3COL A;  5EG0 A;  3JRI A;  3RKQ A;  1Y1V J;  1H89 C;  2WB1 N;  2GFN A;  2MW8 A;  2DMU A;  3MVP A;  3D1N I;  1GV2 A;  1T56 A;  3ZOB A;  1ZR4 A;  2HYT A;  2EH3 A;  2DG8 A;  1RET A;  4D7M A;  9ANT A;  4JX4 A;  3I4M J;  5JLW A;  2QOP A;  4UUS B;  4C3I J;  2VKV A;  2OF7 A;  2G7L A;  3P9T A;  3G1O A;  4IEJ A;  2G3B A;  1POG A;  3ZQG A;  1XC5 A;  3Q0U A;  2VPR A;  5E3M A;  2R7Z J;  1DU0 A;  2XSD C;  3VW1 A;  1GUU A;  2D6Y A;  1ETK A;  3ZQC A;  3RQI A;  4DW6 A;  3LSG A;  3IUV A;  1I3Q J;  2ZCX A;  3O8H A;  1S7E A;  1NK3 P;  3BTJ A;  3NPI A;  3EUP A;  5M5Y J;  3HM5 A;  4C3H J;  2CUF A;  5K7Z A;  1ORK A;  1FJL A;  2O9L A;  3A01 A;  3VOK A;  4YZE A;  4W97 A;  4HNV A;  1QPI A;  3GTJ J;  3O8G A;  2OER A;  5E3N A;  1VFC A;  2E2J J;  3CWR A;  2WAQ N;  5CXG A;  4B4C A;  1MSE C;  3KKD A;  1U9O A;  2O7O A;  2E19 A;  3TED A;  5K58 A;  2M9H A;  2JK3 A;  2ZOZ A;  1IGN A;  3HE0 A;  3KKC A;  1YRN A;  4AYB N;  1VI0 A;  3H3V K;  4A3E J;  3PAS A;  5K7F A;  5GPA A;  2JA8 J;  3CDL A;  4XRS A;  5FKK A;  3TW7 A;  2COB A;  4FCY A;  4DZP A;  3SJM A;  3H0G J;  2Y9Y A;  1K61 A;  1UG2 A;  1BW5 A;  2GBY A;  1K83 J;  4CGR A;  1JJ6 C;  1OCT C;  4M3E A;  3BR3 A;  2G0E A;  4X1E A;  3G1M A;  4V2G A;  2UXP A;  2DTZ A;  3FIW A;  4Y52 J;  2ZOY A;  3VP5 A;  2L0K A;  1JUP A;  4RDU A;  3DCF A;  2PMZ N;  1GT0 C;  5M3F J;  3VVX A;  1DU6 A;  1JKP C;  5GP9 A;  1YRN B;  4QTR A;  3S1Q J;  4A3B J;  4FE7 A;  1ETQ A;  3HDD A;  1HCR A;  2DA1 A;  5DTD A;  2CUE A;  1H88 C;  1MSF C;  2HXO A;  2XGE A;  1ENH A;  3VUQ A;  1IV6 A;  3M4O J;  2E2I J;  3RD3 A;  4NN1 A;  4JKZ A;  1I50 J;  1WPK A;  4V2F A;  3HTH A;  4AUX A;  3ZQL A;  3FK6 A;  3SFI A;  4D5C A;  3S2H J;  1MBJ A;  1OJL A;  4M3D A;  1RPW A;  2AHQ A;  5J1U A;  2D5V A;  2M0C A;  2IBD A;  5EGO A;  2GEN A;  4GCL A;  2ID6 A;  2IAI A;  1MH4 A;  1P7J A;  5AQC A;  1XG1 A;  4W1U A;  4FIS A;  3BQY A;  2REK A;  2R92 J;  5FKN A;  3PO2 J;  4UUT A;  4MXM A;  3IV5 A;  2L9R A;  3ANP A;  4A3K J;  1Z77 A;  1GV5 A;  2MG4 A;  5IP6 A;  4M3G A;  3TW6 A;  2CJJ A;  1TWC J;  2X48 A;  5HOD A;  3DEW A;  1HF0 A;  2ECC A;  2LLK A;  3G1L A;  2HKU A;  1TWH J;  3GTM J;  1F36 A;  3HGG A;  5E3O A;  4MLO A;  3FRQ A;  3GEU A;  5HBU A;  4IHX A;  5E3L A;  2QKO A;  4AC0 A;  1R9T J;  2L7F P;  5D1R A;  1RR7 A;  3QPL A;  5F04 A;  1ETV A;  5EGO B;  1MH3 A;  1MBH A;  1AKH A;  5D19 A;  3L1P A;  3GZI A;  3VIB A;  2PZ9 A;  3JR9 A;  1BL0 A;  1SAN A;  2ZCM A;  4MFD A;  3QQA A;  2HYJ A;  4A3G J;  3VVY A;  3C2B A;  2KDZ A;  1IRZ A;  2NVX J;  2RAS A;  3CJD A;  2B63 J;  2NS7 A;  2R93 J;  5EZG A;  5C44 J;  1LFB A;  5EF6 A;  1WGX A;  3BTC A;  5BNG A;  2WGB A;  3S14 J;  1MBG A;  3HOU J;  4XRS G;  3BT9 A;  3QKX A;  3MKL A;  3GTG J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...