1AUIA

Human calcineurin heterodimer
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
473
structure length
378
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSSFEEAKGLDRINERMPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SERINE/THREONINE PHOSPHATASE 2B
total genus 135
structure length 378
sequence length 473
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1997-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1auiA00
5IOHA 3FGAC 2BCDA 4HD0A 3ZTVA 4O5GA 4H2IA 2A22A 5JPFA 4LTYA 1HPUA 1Z2XA 1XM7A 3K7WC 1U32A 1OIDA 2CV9A 2JOGA 4UT3A 3H68A 3JYFA 3THNA 2QJCA 3DSCA 4TUGA 3EGGA 3KBPA 1T70A 3E7AA 2NXFA 4YKEA 2USHA 3AV0A 3V4YA 2ZBMA 2O8GA 3IVEA 4O24A 3N5UA 1T71A 2AHDA 3DW8C 4I5LC 5INBA 1S3LA 4H2GA 4V0WA 3H69A 4DHLA 4KKZA 4DSYA 1UTEA 1FJMA 1HP1A 4M0VA 4O4KA 3RL5A 1QFCA 2Q8UA 3DSDA 2BQ8X 4H2FA 2WDFA 1G5BA 1HO5A 1UF3A 3H66A 4UT3B 4ORAA 2Z06A 2HY1A 1W24A 2Z1AA 5F3WA 4NZVA 1SU1A 1Z2WA 2WDDA 1M63A 1S8EA 4O43A 4ORCA 4MOVA 4XPNA 3PSOA 3H60A 2IE3C 4KBPA 4H1SA 4DT2A 1NNWA 4MOYA 3RL4A 5B8IA 2YVTA 4UT2A 2P6BA 1S70A 3IB7A 4I5NC 3QFNA 3HVQA 3H67A 3IB8A 2QFRA 1S95A 3QFOA 4IL1A 4JA9A 4ZVZA 3PSNA 4J6OA 1MF8A 2BDXA 1S3MA 5J28A 2HYPA 3AUZA 2NYMC 5JJTA 2NPPC 3THOB 2O8AA 3K7VC 4ORBA 4LU9A 2IAEC 5DNYA 4WWLA 1TCOA 1AUIA 4V0VA 2QFPA 4FBQA 2DFJA 4FCXA 3GVEA 3P71C 4Q7FA 4JA7A 4B2OA 2NYLC 3EGHA 3C5WC 5EQVA 1KBPA 1JK7A 3CK2A 1USHA 3H64A 3C9FA 3QFKA 4UWQA 1WAO1 2XMOA 4IYPC 2HYOA 3QG5C 3RL3A 3LL8A 3ZU0A 4MP0A 4FBKA 1OIEA 3E7BA 4LACC 2WDCA 2KKNA 4OR9A 1WARA 2R17A 3H63A 4TUIA 3TGHA 1V73A 4H2BA 4F0ZA 3ICFA 3QFMA 1IT6A 2GJUA 1QHWA 4FBWA 4G9JA 1S3NA 2WDEA 1XZWA 4ZX2A 5GTUA 3IVDA 3T1IA 2Z72A 4H1YP 5JPEA 3RQZA 5HPEA 4V0XA 2IE4C 1II7A 5C1VA 3H62B 3H61A 1OI8A
chains in the Genus database with same CATH superfamily
5IOHA 3FGAC 2BCDA 4HD0A 3ZTVA 4O5GA 4H2IA 2A22A 5JPFA 4LTYA 1HPUA 1Z2XA 1XM7A 3K7WC 1U32A 1OIDA 2CV9A 2JOGA 4UT3A 3H68A 3JYFA 3THNA 2QJCA 3DSCA 4TUGA 2ZOAA 3EGGA 3KBPA 1T70A 3D03A 2NXFA 3E7AA 4YKEA 2USHA 3AV0A 3V4YA 2ZBMA 2O8GA 3IVEA 4O24A 3N5UA 1T71A 2AHDA 3DW8C 4I5LC 5INBA 1S3LA 4H2GA 4V0WA 3H69A 4DHLA 4KKZA 4DSYA 1UTEA 1FJMA 1HP1A 4M0VA 3E0JA 4O4KA 3RL5A 1QFCA 2Q8UA 3DSDA 2BQ8X 4H2FA 2WDFA 1G5BA 1HO5A 1UF3A 3H66A 4UT3B 4ORAA 2Z06A 2HY1A 1W24A 2Z1AA 5F3WA 4NZVA 1SU1A 1Z2WA 2WDDA 2DXNA 1M63A 1S8EA 4O43A 4ORCA 4MOVA 4XPNA 3PSOA 3H60A 2IE3C 4KBPA 4H1SA 2YEQA 4DT2A 1NNWA 4MOYA 3RL4A 5B8IA 2YVTA 4UT2A 2P6BA 1S70A 3IB7A 4I5NC 3QFNA 3HVQA 3H67A 3IB8A 2QFRA 1S95A 3QFOA 4IL1A 4JA9A 4ZVZA 3PSNA 4J6OA 1MF8A 2BDXA 1S3MA 5J28A 2HYPA 3AUZA 2NYMC 5JJTA 2NPPC 3THOB 2O8AA 3K7VC 4ORBA 4LU9A 2IAEC 5DNYA 4WWLA 1TCOA 1AUIA 4V0VA 2QFPA 4FBQA 2DFJA 4FCXA 3GVEA 3P71C 4Q7FA 4JA7A 4B2OA 2NYLC 3EGHA 3C5WC 5EQVA 1KBPA 1JK7A 3CK2A 1USHA 3H64A 3C9FA 3QFKA 4UWQA 1WAO1 2XMOA 4IYPC 2HYOA 3QG5C 3RL3A 3LL8A 3ZU0A 4MP0A 4FBKA 1OIEA 3E7BA 4LACC 2WDCA 2KKNA 4OR9A 1WARA 2R17A 2ZO9B 3H63A 4TUIA 3TGHA 1V73A 3FLOA 4H2BA 3ICFA 4F0ZA 3QFMA 1IT6A 2GJUA 1QHWA 4FBWA 4G9JA 1S3NA 2WDEA 1XZWA 4ZX2A 5GTUA 3IVDA 3T1IA 2Z72A 4H1YP 5JPEA 3RQZA 5HPEA 4V0XA 2IE4C 1II7A 2DXLA 5C1VA 3H62B 3H61A 1OI8A
chains in the Genus database with same CATH topology
5IOHA 3FGAC 2BCDA 4HD0A 3ZTVA 4O5GA 4H2IA 2A22A 5JPFA 4LTYA 1HPUA 1Z2XA 1XM7A 3K7WC 1U32A 1OIDA 2CV9A 2JOGA 4UT3A 3H68A 3JYFA 3THNA 2QJCA 3DSCA 4TUGA 2ZOAA 3EGGA 3KBPA 1T70A 3D03A 2NXFA 3E7AA 4YKEA 2USHA 3AV0A 3V4YA 2ZBMA 2O8GA 3IVEA 4O24A 3N5UA 1T71A 2AHDA 3DW8C 4I5LC 5INBA 1S3LA 4H2GA 4V0WA 3H69A 4DHLA 4KKZA 4DSYA 1UTEA 1FJMA 1HP1A 4M0VA 3E0JA 4O4KA 3RL5A 1QFCA 2Q8UA 3DSDA 2BQ8X 4H2FA 2WDFA 1G5BA 1HO5A 1UF3A 3H66A 4UT3B 4ORAA 2Z06A 2HY1A 1W24A 2Z1AA 5F3WA 4NZVA 1SU1A 1Z2WA 2WDDA 2DXNA 1M63A 1S8EA 4O43A 4ORCA 4MOVA 4XPNA 3PSOA 3H60A 2IE3C 4KBPA 4H1SA 2YEQA 4DT2A 1NNWA 4MOYA 3RL4A 5B8IA 2YVTA 4UT2A 2P6BA 1S70A 3IB7A 4I5NC 3QFNA 3HVQA 3H67A 3IB8A 2QFRA 1S95A 3QFOA 4IL1A 4JA9A 4ZVZA 3PSNA 4J6OA 1MF8A 2BDXA 1S3MA 5J28A 2HYPA 3AUZA 2NYMC 5JJTA 2NPPC 3THOB 2O8AA 3K7VC 4ORBA 4LU9A 2IAEC 5DNYA 4WWLA 1TCOA 1AUIA 4V0VA 2QFPA 4FBQA 2DFJA 4FCXA 3GVEA 3P71C 4Q7FA 4JA7A 4B2OA 2NYLC 3EGHA 3C5WC 5EQVA 1KBPA 1JK7A 3CK2A 1USHA 3H64A 3C9FA 3QFKA 4UWQA 1WAO1 2XMOA 4IYPC 2HYOA 3QG5C 3RL3A 3LL8A 3ZU0A 4MP0A 4FBKA 1OIEA 3E7BA 4LACC 2WDCA 2KKNA 4OR9A 1WARA 2R17A 2ZO9B 3H63A 4TUIA 3TGHA 1V73A 3FLOA 4H2BA 3ICFA 4F0ZA 3QFMA 1IT6A 2GJUA 1QHWA 4FBWA 4G9JA 1S3NA 2WDEA 1XZWA 4ZX2A 5GTUA 3IVDA 3T1IA 2Z72A 4H1YP 5JPEA 3RQZA 5HPEA 4V0XA 2IE4C 1II7A 2DXLA 5C1VA 3H62B 3H61A 1OI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOH A;  3FGA C;  2BCD A;  4HD0 A;  3ZTV A;  4O5G A;  4H2I A;  2A22 A;  5JPF A;  4LTY A;  1HPU A;  1Z2X A;  1XM7 A;  3K7W C;  1U32 A;  1OID A;  2CV9 A;  2JOG A;  4UT3 A;  3H68 A;  3JYF A;  3THN A;  2QJC A;  3DSC A;  4TUG A;  3EGG A;  3KBP A;  1T70 A;  3E7A A;  2NXF A;  4YKE A;  2USH A;  3AV0 A;  3V4Y A;  2ZBM A;  2O8G A;  3IVE A;  4O24 A;  3N5U A;  1T71 A;  2AHD A;  3DW8 C;  4I5L C;  5INB A;  1S3L A;  4H2G A;  4V0W A;  3H69 A;  4DHL A;  4KKZ A;  4DSY A;  1UTE A;  1FJM A;  1HP1 A;  4M0V A;  4O4K A;  3RL5 A;  1QFC A;  2Q8U A;  3DSD A;  2BQ8 X;  4H2F A;  2WDF A;  1G5B A;  1HO5 A;  1UF3 A;  3H66 A;  4UT3 B;  4ORA A;  2Z06 A;  2HY1 A;  1W24 A;  2Z1A A;  5F3W A;  4NZV A;  1SU1 A;  1Z2W A;  2WDD A;  1M63 A;  1S8E A;  4O43 A;  4ORC A;  4MOV A;  4XPN A;  3PSO A;  3H60 A;  2IE3 C;  4KBP A;  4H1S A;  4DT2 A;  1NNW A;  4MOY A;  3RL4 A;  5B8I A;  2YVT A;  4UT2 A;  2P6B A;  1S70 A;  3IB7 A;  4I5N C;  3QFN A;  3HVQ A;  3H67 A;  3IB8 A;  2QFR A;  1S95 A;  3QFO A;  4IL1 A;  4JA9 A;  4ZVZ A;  3PSN A;  4J6O A;  1MF8 A;  2BDX A;  1S3M A;  5J28 A;  2HYP A;  3AUZ A;  2NYM C;  5JJT A;  2NPP C;  3THO B;  2O8A A;  3K7V C;  4ORB A;  4LU9 A;  2IAE C;  5DNY A;  4WWL A;  1TCO A;  1AUI A;  4V0V A;  2QFP A;  4FBQ A;  2DFJ A;  4FCX A;  3GVE A;  3P71 C;  4Q7F A;  4JA7 A;  4B2O A;  2NYL C;  3EGH A;  3C5W C;  5EQV A;  1KBP A;  1JK7 A;  3CK2 A;  1USH A;  3H64 A;  3C9F A;  3QFK A;  4UWQ A;  1WAO 1;  2XMO A;  4IYP C;  2HYO A;  3QG5 C;  3RL3 A;  3LL8 A;  3ZU0 A;  4MP0 A;  4FBK A;  1OIE A;  3E7B A;  4LAC C;  2WDC A;  2KKN A;  4OR9 A;  1WAR A;  2R17 A;  3H63 A;  4TUI A;  3TGH A;  1V73 A;  4H2B A;  4F0Z A;  3ICF A;  3QFM A;  1IT6 A;  2GJU A;  1QHW A;  4FBW A;  4G9J A;  1S3N A;  2WDE A;  1XZW A;  4ZX2 A;  5GTU A;  3IVD A;  3T1I A;  2Z72 A;  4H1Y P;  5JPE A;  3RQZ A;  5HPE A;  4V0X A;  2IE4 C;  1II7 A;  5C1V A;  3H62 B;  3H61 A;  1OI8 A; 
#chains in the Genus database with same CATH topology
 5IOH A;  3FGA C;  2BCD A;  4HD0 A;  3ZTV A;  4O5G A;  4H2I A;  2A22 A;  5JPF A;  4LTY A;  1HPU A;  1Z2X A;  1XM7 A;  3K7W C;  1U32 A;  1OID A;  2CV9 A;  2JOG A;  4UT3 A;  3H68 A;  3JYF A;  3THN A;  2QJC A;  3DSC A;  4TUG A;  2ZOA A;  3EGG A;  3KBP A;  1T70 A;  3D03 A;  2NXF A;  3E7A A;  4YKE A;  2USH A;  3AV0 A;  3V4Y A;  2ZBM A;  2O8G A;  3IVE A;  4O24 A;  3N5U A;  1T71 A;  2AHD A;  3DW8 C;  4I5L C;  5INB A;  1S3L A;  4H2G A;  4V0W A;  3H69 A;  4DHL A;  4KKZ A;  4DSY A;  1UTE A;  1FJM A;  1HP1 A;  4M0V A;  3E0J A;  4O4K A;  3RL5 A;  1QFC A;  2Q8U A;  3DSD A;  2BQ8 X;  4H2F A;  2WDF A;  1G5B A;  1HO5 A;  1UF3 A;  3H66 A;  4UT3 B;  4ORA A;  2Z06 A;  2HY1 A;  1W24 A;  2Z1A A;  5F3W A;  4NZV A;  1SU1 A;  1Z2W A;  2WDD A;  2DXN A;  1M63 A;  1S8E A;  4O43 A;  4ORC A;  4MOV A;  4XPN A;  3PSO A;  3H60 A;  2IE3 C;  4KBP A;  4H1S A;  2YEQ A;  4DT2 A;  1NNW A;  4MOY A;  3RL4 A;  5B8I A;  2YVT A;  4UT2 A;  2P6B A;  1S70 A;  3IB7 A;  4I5N C;  3QFN A;  3HVQ A;  3H67 A;  3IB8 A;  2QFR A;  1S95 A;  3QFO A;  4IL1 A;  4JA9 A;  4ZVZ A;  3PSN A;  4J6O A;  1MF8 A;  2BDX A;  1S3M A;  5J28 A;  2HYP A;  3AUZ A;  2NYM C;  5JJT A;  2NPP C;  3THO B;  2O8A A;  3K7V C;  4ORB A;  4LU9 A;  2IAE C;  5DNY A;  4WWL A;  1TCO A;  1AUI A;  4V0V A;  2QFP A;  4FBQ A;  2DFJ A;  4FCX A;  3GVE A;  3P71 C;  4Q7F A;  4JA7 A;  4B2O A;  2NYL C;  3EGH A;  3C5W C;  5EQV A;  1KBP A;  1JK7 A;  3CK2 A;  1USH A;  3H64 A;  3C9F A;  3QFK A;  4UWQ A;  1WAO 1;  2XMO A;  4IYP C;  2HYO A;  3QG5 C;  3RL3 A;  3LL8 A;  3ZU0 A;  4MP0 A;  4FBK A;  1OIE A;  3E7B A;  4LAC C;  2WDC A;  2KKN A;  4OR9 A;  1WAR A;  2R17 A;  2ZO9 B;  3H63 A;  4TUI A;  3TGH A;  1V73 A;  3FLO A;  4H2B A;  3ICF A;  4F0Z A;  3QFM A;  1IT6 A;  2GJU A;  1QHW A;  4FBW A;  4G9J A;  1S3N A;  2WDE A;  1XZW A;  4ZX2 A;  5GTU A;  3IVD A;  3T1I A;  2Z72 A;  4H1Y P;  5JPE A;  3RQZ A;  5HPE A;  4V0X A;  2IE4 C;  1II7 A;  2DXL A;  5C1V A;  3H62 B;  3H61 A;  1OI8 A; 
#chains in the Genus database with same CATH homology
 5IOH A;  3FGA C;  2BCD A;  4HD0 A;  3ZTV A;  4O5G A;  4H2I A;  2A22 A;  5JPF A;  4LTY A;  1HPU A;  1Z2X A;  1XM7 A;  3K7W C;  1U32 A;  1OID A;  2CV9 A;  2JOG A;  4UT3 A;  3H68 A;  3JYF A;  3THN A;  2QJC A;  3DSC A;  4TUG A;  2ZOA A;  3EGG A;  3KBP A;  1T70 A;  3D03 A;  2NXF A;  3E7A A;  4YKE A;  2USH A;  3AV0 A;  3V4Y A;  2ZBM A;  2O8G A;  3IVE A;  4O24 A;  3N5U A;  1T71 A;  2AHD A;  3DW8 C;  4I5L C;  5INB A;  1S3L A;  4H2G A;  4V0W A;  3H69 A;  4DHL A;  4KKZ A;  4DSY A;  1UTE A;  1FJM A;  1HP1 A;  4M0V A;  3E0J A;  4O4K A;  3RL5 A;  1QFC A;  2Q8U A;  3DSD A;  2BQ8 X;  4H2F A;  2WDF A;  1G5B A;  1HO5 A;  1UF3 A;  3H66 A;  4UT3 B;  4ORA A;  2Z06 A;  2HY1 A;  1W24 A;  2Z1A A;  5F3W A;  4NZV A;  1SU1 A;  1Z2W A;  2WDD A;  2DXN A;  1M63 A;  1S8E A;  4O43 A;  4ORC A;  4MOV A;  4XPN A;  3PSO A;  3H60 A;  2IE3 C;  4KBP A;  4H1S A;  2YEQ A;  4DT2 A;  1NNW A;  4MOY A;  3RL4 A;  5B8I A;  2YVT A;  4UT2 A;  2P6B A;  1S70 A;  3IB7 A;  4I5N C;  3QFN A;  3HVQ A;  3H67 A;  3IB8 A;  2QFR A;  1S95 A;  3QFO A;  4IL1 A;  4JA9 A;  4ZVZ A;  3PSN A;  4J6O A;  1MF8 A;  2BDX A;  1S3M A;  5J28 A;  2HYP A;  3AUZ A;  2NYM C;  5JJT A;  2NPP C;  3THO B;  2O8A A;  3K7V C;  4ORB A;  4LU9 A;  2IAE C;  5DNY A;  4WWL A;  1TCO A;  1AUI A;  4V0V A;  2QFP A;  4FBQ A;  2DFJ A;  4FCX A;  3GVE A;  3P71 C;  4Q7F A;  4JA7 A;  4B2O A;  2NYL C;  3EGH A;  3C5W C;  5EQV A;  1KBP A;  1JK7 A;  3CK2 A;  1USH A;  3H64 A;  3C9F A;  3QFK A;  4UWQ A;  1WAO 1;  2XMO A;  4IYP C;  2HYO A;  3QG5 C;  3RL3 A;  3LL8 A;  3ZU0 A;  4MP0 A;  4FBK A;  1OIE A;  3E7B A;  4LAC C;  2WDC A;  2KKN A;  4OR9 A;  1WAR A;  2R17 A;  2ZO9 B;  3H63 A;  4TUI A;  3TGH A;  1V73 A;  3FLO A;  4H2B A;  3ICF A;  4F0Z A;  3QFM A;  1IT6 A;  2GJU A;  1QHW A;  4FBW A;  4G9J A;  1S3N A;  2WDE A;  1XZW A;  4ZX2 A;  5GTU A;  3IVD A;  3T1I A;  2Z72 A;  4H1Y P;  5JPE A;  3RQZ A;  5HPE A;  4V0X A;  2IE4 C;  1II7 A;  2DXL A;  5C1V A;  3H62 B;  3H61 A;  1OI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...