1AUIA

Human calcineurin heterodimer
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
473
structure length
378
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSSFEEAKGLDRINERMPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PHOSPHATASE 2B
publication title Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 135
structure length 378
sequence length 473
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1997-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1auiA00
3EGHA 3GVEA 4OR9A 4YKEA 3THOB 3AV0A 3T1IA 1FJMA 4ZX2A 2O8GA 2KKNA 4MOVA 3RL4A 3QFOA 4FBKA 4ORCA 1OIDA 3THNA 3RL3A 3H60A 1NNWA 4I5LC 2NXFA 2XMOA 4IYPC 4MOYA 4J6OA 4O24A 2WDEA 4JA9A 3P71C 4LACC 1Z2XA 2GJUA 4M0VA 2JOGA 3QFMA 3CK2A 2NYLC 3H66A 4Q7FA 3H69A 3KBPA 1Z2WA 4IL1A 3IB7A 2WDDA 1M63A 4FCXA 1OI8A 2Z72A 3K7VC 2CV9A 3N5UA 2Q8UA 4KBPA 1XZWA 3DW8C 1AUIA 3H63A 1II7A 3HVQA 1S70A 2BCDA 1JK7A 1S3MA 2R17A 2IAEC 2DFJA 3AUZA 1T70A 3IB8A 1T71A 1W24A 1S8EA 1SU1A 3K7WC 1QHWA 4MP0A 4V0VA 4XPNA 2BQ8X 4TUGA 3DSCA 4I5NC 4TUIA 1S3NA 4O43A 2IE3C 5JJTA 5JPEA 3H62B 3C9FA 1USHA 4JA7A 2HYPA 2Z06A 4V0XA 3H64A 3E7BA 2AHDA 1TCOA 2WDFA 4UT3A 3RL5A 3LL8A 4H1SA 1HPUA 3E7AA 4H1YP 4UWQA 4H2GA 2A22A 3IVEA 5GTUA 5EQVA 5JPFA 2NPPC 4ORAA 3H67A 4ZVZA 4ORBA 1OIEA 3IVDA 2BDXA 2QJCA 2WDCA 1WAO1 3ZTVA 3DSDA 2QFRA 3QFNA 5DNYA 3C5WC 2P6BA 2HY1A 4H2IA 2ZBMA 4KKZA 3ZU0A 1HO5A 2YVTA 4DT2A 5J28A 4H2FA 4LU9A 4O5GA 4UT2A 5IOHA 3PSOA 5B8IA 2NYMC 1G5BA 3QG5C 1HP1A 1QFCA 1WARA 1XM7A 2O8AA 4LTYA 5F3WA 1MF8A 1S95A 2Z1AA 4FBQA 3PSNA 4H2BA 4G9JA 4V0WA 5C1VA 3ICFA 4HD0A 2IE4C 1U32A 4NZVA 4O4KA 4DHLA 3TGHA 5HPEA 1KBPA 3RQZA 4UT3B 3EGGA 3H68A 3H61A 1IT6A 4F0ZA 1V73A 1UF3A 4WWLA 3V4YA 1UTEA 2QFPA 3FGAC 1S3LA 2USHA 2HYOA 3JYFA 4B2OA 3QFKA 4DSYA 5INBA 4FBWA
chains in the Genus database with same CATH superfamily
3EGHA 3GVEA 4OR9A 4YKEA 3THOB 3AV0A 3T1IA 1FJMA 4ZX2A 2O8GA 2KKNA 4MOVA 3RL4A 3QFOA 4FBKA 4ORCA 1OIDA 3THNA 3RL3A 3H60A 3D03A 1NNWA 4I5LC 2NXFA 2XMOA 4IYPC 4MOYA 4J6OA 4O24A 2WDEA 4JA9A 3P71C 4LACC 1Z2XA 2GJUA 4M0VA 2JOGA 3QFMA 3CK2A 2NYLC 3H66A 4Q7FA 3H69A 3KBPA 1Z2WA 4IL1A 3IB7A 2WDDA 1M63A 4FCXA 1OI8A 2Z72A 3K7VC 2CV9A 3N5UA 2Q8UA 4KBPA 1XZWA 3DW8C 1AUIA 3H63A 1II7A 3HVQA 1S70A 2BCDA 1JK7A 1S3MA 2R17A 2IAEC 2DFJA 3AUZA 1T70A 3IB8A 1T71A 1W24A 1S8EA 1SU1A 3K7WC 1QHWA 4MP0A 4V0VA 4XPNA 2BQ8X 4TUGA 3DSCA 4I5NC 4TUIA 1S3NA 4O43A 2IE3C 3FLOA 5JJTA 5JPEA 3H62B 3C9FA 1USHA 4JA7A 2HYPA 2Z06A 4V0XA 3H64A 3E7BA 2AHDA 1TCOA 2WDFA 4UT3A 3RL5A 3LL8A 4H1SA 1HPUA 3E7AA 4H1YP 4UWQA 4H2GA 2A22A 3IVEA 5GTUA 5EQVA 5JPFA 2NPPC 4ORAA 3H67A 4ZVZA 4ORBA 1OIEA 3IVDA 2BDXA 2QJCA 2WDCA 1WAO1 3ZTVA 3DSDA 2QFRA 3QFNA 2ZO9B 5DNYA 2DXNA 3C5WC 2P6BA 2HY1A 4H2IA 2ZBMA 4KKZA 3ZU0A 1HO5A 2YVTA 4DT2A 5J28A 2YEQA 4H2FA 4LU9A 4O5GA 4UT2A 5IOHA 3PSOA 5B8IA 2NYMC 1G5BA 3QG5C 1HP1A 1QFCA 1WARA 1XM7A 2O8AA 4LTYA 5F3WA 1MF8A 1S95A 2Z1AA 4FBQA 3PSNA 4H2BA 4G9JA 4V0WA 5C1VA 3ICFA 2ZOAA 4HD0A 2IE4C 3E0JA 1U32A 4NZVA 4O4KA 4DHLA 3TGHA 5HPEA 1KBPA 3RQZA 4UT3B 3EGGA 3H68A 3H61A 1IT6A 4F0ZA 2DXLA 1V73A 1UF3A 4WWLA 3V4YA 1UTEA 2QFPA 3FGAC 1S3LA 2USHA 2HYOA 3JYFA 4B2OA 3QFKA 4DSYA 5INBA 4FBWA
chains in the Genus database with same CATH topology
3EGHA 3GVEA 4OR9A 4YKEA 3THOB 3AV0A 3T1IA 1FJMA 4ZX2A 2O8GA 2KKNA 4MOVA 3RL4A 3QFOA 4FBKA 4ORCA 1OIDA 3THNA 3RL3A 3H60A 3D03A 1NNWA 4I5LC 2NXFA 2XMOA 4IYPC 4MOYA 4J6OA 4O24A 2WDEA 4JA9A 3P71C 4LACC 1Z2XA 2GJUA 4M0VA 2JOGA 3QFMA 3CK2A 2NYLC 3H66A 4Q7FA 3H69A 3KBPA 1Z2WA 4IL1A 3IB7A 2WDDA 1M63A 4FCXA 1OI8A 2Z72A 3K7VC 2CV9A 3N5UA 2Q8UA 4KBPA 1XZWA 3DW8C 1AUIA 3H63A 1II7A 3HVQA 1S70A 2BCDA 1JK7A 1S3MA 2R17A 2IAEC 2DFJA 3AUZA 1T70A 3IB8A 1T71A 1W24A 1S8EA 1SU1A 3K7WC 1QHWA 4MP0A 4V0VA 4XPNA 2BQ8X 4TUGA 3DSCA 4I5NC 4TUIA 1S3NA 4O43A 2IE3C 3FLOA 5JJTA 5JPEA 3H62B 3C9FA 1USHA 4JA7A 2HYPA 2Z06A 4V0XA 3H64A 3E7BA 2AHDA 1TCOA 2WDFA 4UT3A 3RL5A 3LL8A 4H1SA 1HPUA 3E7AA 4H1YP 4UWQA 4H2GA 2A22A 3IVEA 5GTUA 5EQVA 5JPFA 2NPPC 4ORAA 3H67A 4ZVZA 4ORBA 1OIEA 3IVDA 2BDXA 2QJCA 2WDCA 1WAO1 3ZTVA 3DSDA 2QFRA 3QFNA 2ZO9B 5DNYA 2DXNA 3C5WC 2P6BA 2HY1A 4H2IA 2ZBMA 4KKZA 3ZU0A 1HO5A 2YVTA 4DT2A 5J28A 2YEQA 4H2FA 4LU9A 4O5GA 4UT2A 5IOHA 3PSOA 5B8IA 2NYMC 1G5BA 3QG5C 1HP1A 1QFCA 1WARA 1XM7A 2O8AA 4LTYA 5F3WA 1MF8A 1S95A 2Z1AA 4FBQA 3PSNA 4H2BA 4G9JA 4V0WA 5C1VA 3ICFA 2ZOAA 4HD0A 2IE4C 3E0JA 1U32A 4NZVA 4O4KA 4DHLA 3TGHA 5HPEA 1KBPA 3RQZA 4UT3B 3EGGA 3H68A 3H61A 1IT6A 4F0ZA 2DXLA 1V73A 1UF3A 4WWLA 3V4YA 1UTEA 2QFPA 3FGAC 1S3LA 2USHA 2HYOA 3JYFA 4B2OA 3QFKA 4DSYA 5INBA 4FBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGH A;  3GVE A;  4OR9 A;  4YKE A;  3THO B;  3AV0 A;  3T1I A;  1FJM A;  4ZX2 A;  2O8G A;  2KKN A;  4MOV A;  3RL4 A;  3QFO A;  4FBK A;  4ORC A;  1OID A;  3THN A;  3RL3 A;  3H60 A;  1NNW A;  4I5L C;  2NXF A;  2XMO A;  4IYP C;  4MOY A;  4J6O A;  4O24 A;  2WDE A;  4JA9 A;  3P71 C;  4LAC C;  1Z2X A;  2GJU A;  4M0V A;  2JOG A;  3QFM A;  3CK2 A;  2NYL C;  3H66 A;  4Q7F A;  3H69 A;  3KBP A;  1Z2W A;  4IL1 A;  3IB7 A;  2WDD A;  1M63 A;  4FCX A;  1OI8 A;  2Z72 A;  3K7V C;  2CV9 A;  3N5U A;  2Q8U A;  4KBP A;  1XZW A;  3DW8 C;  1AUI A;  3H63 A;  1II7 A;  3HVQ A;  1S70 A;  2BCD A;  1JK7 A;  1S3M A;  2R17 A;  2IAE C;  2DFJ A;  3AUZ A;  1T70 A;  3IB8 A;  1T71 A;  1W24 A;  1S8E A;  1SU1 A;  3K7W C;  1QHW A;  4MP0 A;  4V0V A;  4XPN A;  2BQ8 X;  4TUG A;  3DSC A;  4I5N C;  4TUI A;  1S3N A;  4O43 A;  2IE3 C;  5JJT A;  5JPE A;  3H62 B;  3C9F A;  1USH A;  4JA7 A;  2HYP A;  2Z06 A;  4V0X A;  3H64 A;  3E7B A;  2AHD A;  1TCO A;  2WDF A;  4UT3 A;  3RL5 A;  3LL8 A;  4H1S A;  1HPU A;  3E7A A;  4H1Y P;  4UWQ A;  4H2G A;  2A22 A;  3IVE A;  5GTU A;  5EQV A;  5JPF A;  2NPP C;  4ORA A;  3H67 A;  4ZVZ A;  4ORB A;  1OIE A;  3IVD A;  2BDX A;  2QJC A;  2WDC A;  1WAO 1;  3ZTV A;  3DSD A;  2QFR A;  3QFN A;  5DNY A;  3C5W C;  2P6B A;  2HY1 A;  4H2I A;  2ZBM A;  4KKZ A;  3ZU0 A;  1HO5 A;  2YVT A;  4DT2 A;  5J28 A;  4H2F A;  4LU9 A;  4O5G A;  4UT2 A;  5IOH A;  3PSO A;  5B8I A;  2NYM C;  1G5B A;  3QG5 C;  1HP1 A;  1QFC A;  1WAR A;  1XM7 A;  2O8A A;  4LTY A;  5F3W A;  1MF8 A;  1S95 A;  2Z1A A;  4FBQ A;  3PSN A;  4H2B A;  4G9J A;  4V0W A;  5C1V A;  3ICF A;  4HD0 A;  2IE4 C;  1U32 A;  4NZV A;  4O4K A;  4DHL A;  3TGH A;  5HPE A;  1KBP A;  3RQZ A;  4UT3 B;  3EGG A;  3H68 A;  3H61 A;  1IT6 A;  4F0Z A;  1V73 A;  1UF3 A;  4WWL A;  3V4Y A;  1UTE A;  2QFP A;  3FGA C;  1S3L A;  2USH A;  2HYO A;  3JYF A;  4B2O A;  3QFK A;  4DSY A;  5INB A;  4FBW A; 
#chains in the Genus database with same CATH topology
 3EGH A;  3GVE A;  4OR9 A;  4YKE A;  3THO B;  3AV0 A;  3T1I A;  1FJM A;  4ZX2 A;  2O8G A;  2KKN A;  4MOV A;  3RL4 A;  3QFO A;  4FBK A;  4ORC A;  1OID A;  3THN A;  3RL3 A;  3H60 A;  3D03 A;  1NNW A;  4I5L C;  2NXF A;  2XMO A;  4IYP C;  4MOY A;  4J6O A;  4O24 A;  2WDE A;  4JA9 A;  3P71 C;  4LAC C;  1Z2X A;  2GJU A;  4M0V A;  2JOG A;  3QFM A;  3CK2 A;  2NYL C;  3H66 A;  4Q7F A;  3H69 A;  3KBP A;  1Z2W A;  4IL1 A;  3IB7 A;  2WDD A;  1M63 A;  4FCX A;  1OI8 A;  2Z72 A;  3K7V C;  2CV9 A;  3N5U A;  2Q8U A;  4KBP A;  1XZW A;  3DW8 C;  1AUI A;  3H63 A;  1II7 A;  3HVQ A;  1S70 A;  2BCD A;  1JK7 A;  1S3M A;  2R17 A;  2IAE C;  2DFJ A;  3AUZ A;  1T70 A;  3IB8 A;  1T71 A;  1W24 A;  1S8E A;  1SU1 A;  3K7W C;  1QHW A;  4MP0 A;  4V0V A;  4XPN A;  2BQ8 X;  4TUG A;  3DSC A;  4I5N C;  4TUI A;  1S3N A;  4O43 A;  2IE3 C;  3FLO A;  5JJT A;  5JPE A;  3H62 B;  3C9F A;  1USH A;  4JA7 A;  2HYP A;  2Z06 A;  4V0X A;  3H64 A;  3E7B A;  2AHD A;  1TCO A;  2WDF A;  4UT3 A;  3RL5 A;  3LL8 A;  4H1S A;  1HPU A;  3E7A A;  4H1Y P;  4UWQ A;  4H2G A;  2A22 A;  3IVE A;  5GTU A;  5EQV A;  5JPF A;  2NPP C;  4ORA A;  3H67 A;  4ZVZ A;  4ORB A;  1OIE A;  3IVD A;  2BDX A;  2QJC A;  2WDC A;  1WAO 1;  3ZTV A;  3DSD A;  2QFR A;  3QFN A;  2ZO9 B;  5DNY A;  2DXN A;  3C5W C;  2P6B A;  2HY1 A;  4H2I A;  2ZBM A;  4KKZ A;  3ZU0 A;  1HO5 A;  2YVT A;  4DT2 A;  5J28 A;  2YEQ A;  4H2F A;  4LU9 A;  4O5G A;  4UT2 A;  5IOH A;  3PSO A;  5B8I A;  2NYM C;  1G5B A;  3QG5 C;  1HP1 A;  1QFC A;  1WAR A;  1XM7 A;  2O8A A;  4LTY A;  5F3W A;  1MF8 A;  1S95 A;  2Z1A A;  4FBQ A;  3PSN A;  4H2B A;  4G9J A;  4V0W A;  5C1V A;  3ICF A;  2ZOA A;  4HD0 A;  2IE4 C;  3E0J A;  1U32 A;  4NZV A;  4O4K A;  4DHL A;  3TGH A;  5HPE A;  1KBP A;  3RQZ A;  4UT3 B;  3EGG A;  3H68 A;  3H61 A;  1IT6 A;  4F0Z A;  2DXL A;  1V73 A;  1UF3 A;  4WWL A;  3V4Y A;  1UTE A;  2QFP A;  3FGA C;  1S3L A;  2USH A;  2HYO A;  3JYF A;  4B2O A;  3QFK A;  4DSY A;  5INB A;  4FBW A; 
#chains in the Genus database with same CATH homology
 3EGH A;  3GVE A;  4OR9 A;  4YKE A;  3THO B;  3AV0 A;  3T1I A;  1FJM A;  4ZX2 A;  2O8G A;  2KKN A;  4MOV A;  3RL4 A;  3QFO A;  4FBK A;  4ORC A;  1OID A;  3THN A;  3RL3 A;  3H60 A;  3D03 A;  1NNW A;  4I5L C;  2NXF A;  2XMO A;  4IYP C;  4MOY A;  4J6O A;  4O24 A;  2WDE A;  4JA9 A;  3P71 C;  4LAC C;  1Z2X A;  2GJU A;  4M0V A;  2JOG A;  3QFM A;  3CK2 A;  2NYL C;  3H66 A;  4Q7F A;  3H69 A;  3KBP A;  1Z2W A;  4IL1 A;  3IB7 A;  2WDD A;  1M63 A;  4FCX A;  1OI8 A;  2Z72 A;  3K7V C;  2CV9 A;  3N5U A;  2Q8U A;  4KBP A;  1XZW A;  3DW8 C;  1AUI A;  3H63 A;  1II7 A;  3HVQ A;  1S70 A;  2BCD A;  1JK7 A;  1S3M A;  2R17 A;  2IAE C;  2DFJ A;  3AUZ A;  1T70 A;  3IB8 A;  1T71 A;  1W24 A;  1S8E A;  1SU1 A;  3K7W C;  1QHW A;  4MP0 A;  4V0V A;  4XPN A;  2BQ8 X;  4TUG A;  3DSC A;  4I5N C;  4TUI A;  1S3N A;  4O43 A;  2IE3 C;  3FLO A;  5JJT A;  5JPE A;  3H62 B;  3C9F A;  1USH A;  4JA7 A;  2HYP A;  2Z06 A;  4V0X A;  3H64 A;  3E7B A;  2AHD A;  1TCO A;  2WDF A;  4UT3 A;  3RL5 A;  3LL8 A;  4H1S A;  1HPU A;  3E7A A;  4H1Y P;  4UWQ A;  4H2G A;  2A22 A;  3IVE A;  5GTU A;  5EQV A;  5JPF A;  2NPP C;  4ORA A;  3H67 A;  4ZVZ A;  4ORB A;  1OIE A;  3IVD A;  2BDX A;  2QJC A;  2WDC A;  1WAO 1;  3ZTV A;  3DSD A;  2QFR A;  3QFN A;  2ZO9 B;  5DNY A;  2DXN A;  3C5W C;  2P6B A;  2HY1 A;  4H2I A;  2ZBM A;  4KKZ A;  3ZU0 A;  1HO5 A;  2YVT A;  4DT2 A;  5J28 A;  2YEQ A;  4H2F A;  4LU9 A;  4O5G A;  4UT2 A;  5IOH A;  3PSO A;  5B8I A;  2NYM C;  1G5B A;  3QG5 C;  1HP1 A;  1QFC A;  1WAR A;  1XM7 A;  2O8A A;  4LTY A;  5F3W A;  1MF8 A;  1S95 A;  2Z1A A;  4FBQ A;  3PSN A;  4H2B A;  4G9J A;  4V0W A;  5C1V A;  3ICF A;  2ZOA A;  4HD0 A;  2IE4 C;  3E0J A;  1U32 A;  4NZV A;  4O4K A;  4DHL A;  3TGH A;  5HPE A;  1KBP A;  3RQZ A;  4UT3 B;  3EGG A;  3H68 A;  3H61 A;  1IT6 A;  4F0Z A;  2DXL A;  1V73 A;  1UF3 A;  4WWL A;  3V4Y A;  1UTE A;  2QFP A;  3FGA C;  1S3L A;  2USH A;  2HYO A;  3JYF A;  4B2O A;  3QFK A;  4DSY A;  5INB A;  4FBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...