1AUIA

Human calcineurin heterodimer
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
473
structure length
378
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSSFEEAKGLDRINERMPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SERINE/THREONINE PHOSPHATASE 2B
total genus 135
structure length 378
sequence length 473
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1997-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1auiA00
3T1IA 1G5BA 2BDXA 1S3NA 1KBPA 1QFCA 2WDCA 3K7VC 2WDEA 3LL8A 4I5NC 2NXFA 2QFPA 3H66A 4Q7FA 4WWLA 2IE4C 4FBWA 4F0ZA 4LTYA 4O43A 4UWQA 5INBA 2NYLC 2BCDA 2Z1AA 1T71A 2AHDA 4YKEA 3ZTVA 3P71C 3QFNA 4H1SA 5B8IA 5GTUA 2NYMC 3FGAC 1M63A 1XZWA 4ORCA 4FBQA 1S8EA 3DW8C 3H69A 2JOGA 4UT3B 3CK2A 2Z72A 1Z2XA 1V73A 1II7A 3RL4A 3KBPA 1AUIA 4TUIA 2QFRA 1OI8A 1MF8A 1U32A 4KKZA 3AUZA 1S95A 5DNYA 1Z2WA 4V0VA 3DSCA 1S70A 3THNA 3IB7A 3ICFA 1QHWA 2Z06A 3AV0A 2A22A 2XMOA 4O4KA 4DSYA 1UTEA 3GVEA 2WDFA 5JJTA 2YVTA 4H2IA 3H62B 4I5LC 2IAEC 3C9FA 3JYFA 1TCOA 1HP1A 4XPNA 3THOB 4H2GA 2HYOA 1XM7A 3H64A 1S3LA 1HPUA 3ZU0A 5JPFA 3E7BA 3PSOA 1T70A 1UF3A 3IVDA 1S3MA 4IL1A 4ORAA 4V0XA 4G9JA 3IB8A 3QFMA 4DHLA 2O8AA 4TUGA 3RL5A 4LACC 3H60A 2GJUA 3IVEA 1JK7A 1FJMA 3HVQA 2Q8UA 5EQVA 4DT2A 2QJCA 5J28A 1WAO1 3H67A 2IE3C 4B2OA 3EGGA 3C5WC 2KKNA 1WARA 2BQ8X 5HPEA 2P6BA 4KBPA 4FBKA 1SU1A 2O8GA 2HY1A 5F3WA 1NNWA 1USHA 3H63A 3PSNA 5IOHA 4ORBA 4MP0A 3E7AA 4M0VA 3V4YA 4LU9A 2WDDA 2USHA 1OIEA 4O24A 3RQZA 5C1VA 4V0WA 2ZBMA 3QG5C 4JA7A 1OIDA 3N5UA 5JPEA 2NPPC 3EGHA 4IYPC 2HYPA 4UT3A 3H61A 4H2FA 3K7WC 4HD0A 4OR9A 3TGHA 3DSDA 3QFKA 4MOVA 4ZVZA 2CV9A 2DFJA 4H2BA 4O5GA 4FCXA 3QFOA 1IT6A 4UT2A 4ZX2A 4MOYA 4NZVA 4JA9A 1W24A 4H1YP 4J6OA 3RL3A 3H68A 2R17A 1HO5A
chains in the Genus database with same CATH superfamily
3T1IA 1G5BA 2BDXA 1S3NA 1KBPA 1QFCA 2WDCA 3K7VC 2WDEA 3LL8A 4I5NC 2NXFA 2QFPA 3H66A 4Q7FA 4WWLA 2IE4C 4FBWA 4F0ZA 4LTYA 3D03A 4O43A 4UWQA 2ZO9B 5INBA 2NYLC 2BCDA 2Z1AA 1T71A 2AHDA 4YKEA 3ZTVA 3P71C 3QFNA 4H1SA 5B8IA 5GTUA 2NYMC 3FGAC 1M63A 1XZWA 4ORCA 4FBQA 1S8EA 3DW8C 3H69A 2JOGA 4UT3B 3CK2A 2Z72A 1Z2XA 1V73A 1II7A 3RL4A 3KBPA 1AUIA 4TUIA 2QFRA 1OI8A 1MF8A 1U32A 4KKZA 3AUZA 3E0JA 1S95A 5DNYA 1Z2WA 4V0VA 3DSCA 1S70A 3THNA 3IB7A 3FLOA 1QHWA 2Z06A 3ICFA 3AV0A 2A22A 2XMOA 4O4KA 4DSYA 1UTEA 3GVEA 2WDFA 5JJTA 2YVTA 4H2IA 3H62B 4I5LC 2IAEC 3C9FA 3JYFA 1TCOA 1HP1A 4XPNA 3THOB 4H2GA 2HYOA 1XM7A 3H64A 1S3LA 1HPUA 3ZU0A 5JPFA 3E7BA 3PSOA 1T70A 1UF3A 3IVDA 1S3MA 4IL1A 4ORAA 4V0XA 4G9JA 3IB8A 3QFMA 4DHLA 2O8AA 4TUGA 3RL5A 4LACC 3H60A 2GJUA 3IVEA 1JK7A 1FJMA 3HVQA 2Q8UA 5EQVA 4DT2A 2QJCA 2ZOAA 5J28A 1WAO1 3H67A 2IE3C 4B2OA 3EGGA 3C5WC 2KKNA 1WARA 2BQ8X 5HPEA 2P6BA 4KBPA 4FBKA 1SU1A 2YEQA 2O8GA 2HY1A 5F3WA 1NNWA 1USHA 3H63A 3PSNA 5IOHA 4ORBA 4MP0A 3E7AA 4M0VA 3V4YA 4LU9A 2WDDA 2USHA 1OIEA 4O24A 3RQZA 5C1VA 4V0WA 2ZBMA 3QG5C 4JA7A 1OIDA 3N5UA 5JPEA 2NPPC 3EGHA 4IYPC 2HYPA 4UT3A 3H61A 4H2FA 3K7WC 4HD0A 4OR9A 3TGHA 3DSDA 3QFKA 4MOVA 4ZVZA 2CV9A 2DFJA 2DXNA 4H2BA 4FCXA 4O5GA 3QFOA 1IT6A 4UT2A 4ZX2A 4MOYA 4NZVA 4JA9A 1W24A 2DXLA 4H1YP 4J6OA 3RL3A 3H68A 2R17A 1HO5A
chains in the Genus database with same CATH topology
3T1IA 1G5BA 2BDXA 1S3NA 1KBPA 1QFCA 2WDCA 3K7VC 2WDEA 3LL8A 4I5NC 2NXFA 2QFPA 3H66A 4Q7FA 4WWLA 2IE4C 4FBWA 4F0ZA 4LTYA 3D03A 4O43A 4UWQA 2ZO9B 5INBA 2NYLC 2BCDA 2Z1AA 1T71A 2AHDA 4YKEA 3ZTVA 3P71C 3QFNA 4H1SA 5B8IA 5GTUA 2NYMC 3FGAC 1M63A 1XZWA 4ORCA 4FBQA 1S8EA 3DW8C 3H69A 2JOGA 4UT3B 3CK2A 2Z72A 1Z2XA 1V73A 1II7A 3RL4A 3KBPA 1AUIA 4TUIA 2QFRA 1OI8A 1MF8A 1U32A 4KKZA 3AUZA 3E0JA 1S95A 5DNYA 1Z2WA 4V0VA 3DSCA 1S70A 3THNA 3IB7A 3FLOA 1QHWA 2Z06A 3ICFA 3AV0A 2A22A 2XMOA 4O4KA 4DSYA 1UTEA 3GVEA 2WDFA 5JJTA 2YVTA 4H2IA 3H62B 4I5LC 2IAEC 3C9FA 3JYFA 1TCOA 1HP1A 4XPNA 3THOB 4H2GA 2HYOA 1XM7A 3H64A 1S3LA 1HPUA 3ZU0A 5JPFA 3E7BA 3PSOA 1T70A 1UF3A 3IVDA 1S3MA 4IL1A 4ORAA 4V0XA 4G9JA 3IB8A 3QFMA 4DHLA 2O8AA 4TUGA 3RL5A 4LACC 3H60A 2GJUA 3IVEA 1JK7A 1FJMA 3HVQA 2Q8UA 5EQVA 4DT2A 2QJCA 2ZOAA 5J28A 1WAO1 3H67A 2IE3C 4B2OA 3EGGA 3C5WC 2KKNA 1WARA 2BQ8X 5HPEA 2P6BA 4KBPA 4FBKA 1SU1A 2YEQA 2O8GA 2HY1A 5F3WA 1NNWA 1USHA 3H63A 3PSNA 5IOHA 4ORBA 4MP0A 3E7AA 4M0VA 3V4YA 4LU9A 2WDDA 2USHA 1OIEA 4O24A 3RQZA 5C1VA 4V0WA 2ZBMA 3QG5C 4JA7A 1OIDA 3N5UA 5JPEA 2NPPC 3EGHA 4IYPC 2HYPA 4UT3A 3H61A 4H2FA 3K7WC 4HD0A 4OR9A 3TGHA 3DSDA 3QFKA 4MOVA 4ZVZA 2CV9A 2DFJA 2DXNA 4H2BA 4FCXA 4O5GA 3QFOA 1IT6A 4UT2A 4ZX2A 4MOYA 4NZVA 4JA9A 1W24A 2DXLA 4H1YP 4J6OA 3RL3A 3H68A 2R17A 1HO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1I A;  1G5B A;  2BDX A;  1S3N A;  1KBP A;  1QFC A;  2WDC A;  3K7V C;  2WDE A;  3LL8 A;  4I5N C;  2NXF A;  2QFP A;  3H66 A;  4Q7F A;  4WWL A;  2IE4 C;  4FBW A;  4F0Z A;  4LTY A;  4O43 A;  4UWQ A;  5INB A;  2NYL C;  2BCD A;  2Z1A A;  1T71 A;  2AHD A;  4YKE A;  3ZTV A;  3P71 C;  3QFN A;  4H1S A;  5B8I A;  5GTU A;  2NYM C;  3FGA C;  1M63 A;  1XZW A;  4ORC A;  4FBQ A;  1S8E A;  3DW8 C;  3H69 A;  2JOG A;  4UT3 B;  3CK2 A;  2Z72 A;  1Z2X A;  1V73 A;  1II7 A;  3RL4 A;  3KBP A;  1AUI A;  4TUI A;  2QFR A;  1OI8 A;  1MF8 A;  1U32 A;  4KKZ A;  3AUZ A;  1S95 A;  5DNY A;  1Z2W A;  4V0V A;  3DSC A;  1S70 A;  3THN A;  3IB7 A;  3ICF A;  1QHW A;  2Z06 A;  3AV0 A;  2A22 A;  2XMO A;  4O4K A;  4DSY A;  1UTE A;  3GVE A;  2WDF A;  5JJT A;  2YVT A;  4H2I A;  3H62 B;  4I5L C;  2IAE C;  3C9F A;  3JYF A;  1TCO A;  1HP1 A;  4XPN A;  3THO B;  4H2G A;  2HYO A;  1XM7 A;  3H64 A;  1S3L A;  1HPU A;  3ZU0 A;  5JPF A;  3E7B A;  3PSO A;  1T70 A;  1UF3 A;  3IVD A;  1S3M A;  4IL1 A;  4ORA A;  4V0X A;  4G9J A;  3IB8 A;  3QFM A;  4DHL A;  2O8A A;  4TUG A;  3RL5 A;  4LAC C;  3H60 A;  2GJU A;  3IVE A;  1JK7 A;  1FJM A;  3HVQ A;  2Q8U A;  5EQV A;  4DT2 A;  2QJC A;  5J28 A;  1WAO 1;  3H67 A;  2IE3 C;  4B2O A;  3EGG A;  3C5W C;  2KKN A;  1WAR A;  2BQ8 X;  5HPE A;  2P6B A;  4KBP A;  4FBK A;  1SU1 A;  2O8G A;  2HY1 A;  5F3W A;  1NNW A;  1USH A;  3H63 A;  3PSN A;  5IOH A;  4ORB A;  4MP0 A;  3E7A A;  4M0V A;  3V4Y A;  4LU9 A;  2WDD A;  2USH A;  1OIE A;  4O24 A;  3RQZ A;  5C1V A;  4V0W A;  2ZBM A;  3QG5 C;  4JA7 A;  1OID A;  3N5U A;  5JPE A;  2NPP C;  3EGH A;  4IYP C;  2HYP A;  4UT3 A;  3H61 A;  4H2F A;  3K7W C;  4HD0 A;  4OR9 A;  3TGH A;  3DSD A;  3QFK A;  4MOV A;  4ZVZ A;  2CV9 A;  2DFJ A;  4H2B A;  4O5G A;  4FCX A;  3QFO A;  1IT6 A;  4UT2 A;  4ZX2 A;  4MOY A;  4NZV A;  4JA9 A;  1W24 A;  4H1Y P;  4J6O A;  3RL3 A;  3H68 A;  2R17 A;  1HO5 A; 
#chains in the Genus database with same CATH topology
 3T1I A;  1G5B A;  2BDX A;  1S3N A;  1KBP A;  1QFC A;  2WDC A;  3K7V C;  2WDE A;  3LL8 A;  4I5N C;  2NXF A;  2QFP A;  3H66 A;  4Q7F A;  4WWL A;  2IE4 C;  4FBW A;  4F0Z A;  4LTY A;  3D03 A;  4O43 A;  4UWQ A;  2ZO9 B;  5INB A;  2NYL C;  2BCD A;  2Z1A A;  1T71 A;  2AHD A;  4YKE A;  3ZTV A;  3P71 C;  3QFN A;  4H1S A;  5B8I A;  5GTU A;  2NYM C;  3FGA C;  1M63 A;  1XZW A;  4ORC A;  4FBQ A;  1S8E A;  3DW8 C;  3H69 A;  2JOG A;  4UT3 B;  3CK2 A;  2Z72 A;  1Z2X A;  1V73 A;  1II7 A;  3RL4 A;  3KBP A;  1AUI A;  4TUI A;  2QFR A;  1OI8 A;  1MF8 A;  1U32 A;  4KKZ A;  3AUZ A;  3E0J A;  1S95 A;  5DNY A;  1Z2W A;  4V0V A;  3DSC A;  1S70 A;  3THN A;  3IB7 A;  3FLO A;  1QHW A;  2Z06 A;  3ICF A;  3AV0 A;  2A22 A;  2XMO A;  4O4K A;  4DSY A;  1UTE A;  3GVE A;  2WDF A;  5JJT A;  2YVT A;  4H2I A;  3H62 B;  4I5L C;  2IAE C;  3C9F A;  3JYF A;  1TCO A;  1HP1 A;  4XPN A;  3THO B;  4H2G A;  2HYO A;  1XM7 A;  3H64 A;  1S3L A;  1HPU A;  3ZU0 A;  5JPF A;  3E7B A;  3PSO A;  1T70 A;  1UF3 A;  3IVD A;  1S3M A;  4IL1 A;  4ORA A;  4V0X A;  4G9J A;  3IB8 A;  3QFM A;  4DHL A;  2O8A A;  4TUG A;  3RL5 A;  4LAC C;  3H60 A;  2GJU A;  3IVE A;  1JK7 A;  1FJM A;  3HVQ A;  2Q8U A;  5EQV A;  4DT2 A;  2QJC A;  2ZOA A;  5J28 A;  1WAO 1;  3H67 A;  2IE3 C;  4B2O A;  3EGG A;  3C5W C;  2KKN A;  1WAR A;  2BQ8 X;  5HPE A;  2P6B A;  4KBP A;  4FBK A;  1SU1 A;  2YEQ A;  2O8G A;  2HY1 A;  5F3W A;  1NNW A;  1USH A;  3H63 A;  3PSN A;  5IOH A;  4ORB A;  4MP0 A;  3E7A A;  4M0V A;  3V4Y A;  4LU9 A;  2WDD A;  2USH A;  1OIE A;  4O24 A;  3RQZ A;  5C1V A;  4V0W A;  2ZBM A;  3QG5 C;  4JA7 A;  1OID A;  3N5U A;  5JPE A;  2NPP C;  3EGH A;  4IYP C;  2HYP A;  4UT3 A;  3H61 A;  4H2F A;  3K7W C;  4HD0 A;  4OR9 A;  3TGH A;  3DSD A;  3QFK A;  4MOV A;  4ZVZ A;  2CV9 A;  2DFJ A;  2DXN A;  4H2B A;  4FCX A;  4O5G A;  3QFO A;  1IT6 A;  4UT2 A;  4ZX2 A;  4MOY A;  4NZV A;  4JA9 A;  1W24 A;  2DXL A;  4H1Y P;  4J6O A;  3RL3 A;  3H68 A;  2R17 A;  1HO5 A; 
#chains in the Genus database with same CATH homology
 3T1I A;  1G5B A;  2BDX A;  1S3N A;  1KBP A;  1QFC A;  2WDC A;  3K7V C;  2WDE A;  3LL8 A;  4I5N C;  2NXF A;  2QFP A;  3H66 A;  4Q7F A;  4WWL A;  2IE4 C;  4FBW A;  4F0Z A;  4LTY A;  3D03 A;  4O43 A;  4UWQ A;  2ZO9 B;  5INB A;  2NYL C;  2BCD A;  2Z1A A;  1T71 A;  2AHD A;  4YKE A;  3ZTV A;  3P71 C;  3QFN A;  4H1S A;  5B8I A;  5GTU A;  2NYM C;  3FGA C;  1M63 A;  1XZW A;  4ORC A;  4FBQ A;  1S8E A;  3DW8 C;  3H69 A;  2JOG A;  4UT3 B;  3CK2 A;  2Z72 A;  1Z2X A;  1V73 A;  1II7 A;  3RL4 A;  3KBP A;  1AUI A;  4TUI A;  2QFR A;  1OI8 A;  1MF8 A;  1U32 A;  4KKZ A;  3AUZ A;  3E0J A;  1S95 A;  5DNY A;  1Z2W A;  4V0V A;  3DSC A;  1S70 A;  3THN A;  3IB7 A;  3FLO A;  1QHW A;  2Z06 A;  3ICF A;  3AV0 A;  2A22 A;  2XMO A;  4O4K A;  4DSY A;  1UTE A;  3GVE A;  2WDF A;  5JJT A;  2YVT A;  4H2I A;  3H62 B;  4I5L C;  2IAE C;  3C9F A;  3JYF A;  1TCO A;  1HP1 A;  4XPN A;  3THO B;  4H2G A;  2HYO A;  1XM7 A;  3H64 A;  1S3L A;  1HPU A;  3ZU0 A;  5JPF A;  3E7B A;  3PSO A;  1T70 A;  1UF3 A;  3IVD A;  1S3M A;  4IL1 A;  4ORA A;  4V0X A;  4G9J A;  3IB8 A;  3QFM A;  4DHL A;  2O8A A;  4TUG A;  3RL5 A;  4LAC C;  3H60 A;  2GJU A;  3IVE A;  1JK7 A;  1FJM A;  3HVQ A;  2Q8U A;  5EQV A;  4DT2 A;  2QJC A;  2ZOA A;  5J28 A;  1WAO 1;  3H67 A;  2IE3 C;  4B2O A;  3EGG A;  3C5W C;  2KKN A;  1WAR A;  2BQ8 X;  5HPE A;  2P6B A;  4KBP A;  4FBK A;  1SU1 A;  2YEQ A;  2O8G A;  2HY1 A;  5F3W A;  1NNW A;  1USH A;  3H63 A;  3PSN A;  5IOH A;  4ORB A;  4MP0 A;  3E7A A;  4M0V A;  3V4Y A;  4LU9 A;  2WDD A;  2USH A;  1OIE A;  4O24 A;  3RQZ A;  5C1V A;  4V0W A;  2ZBM A;  3QG5 C;  4JA7 A;  1OID A;  3N5U A;  5JPE A;  2NPP C;  3EGH A;  4IYP C;  2HYP A;  4UT3 A;  3H61 A;  4H2F A;  3K7W C;  4HD0 A;  4OR9 A;  3TGH A;  3DSD A;  3QFK A;  4MOV A;  4ZVZ A;  2CV9 A;  2DFJ A;  2DXN A;  4H2B A;  4FCX A;  4O5G A;  3QFO A;  1IT6 A;  4UT2 A;  4ZX2 A;  4MOY A;  4NZV A;  4JA9 A;  1W24 A;  2DXL A;  4H1Y P;  4J6O A;  3RL3 A;  3H68 A;  2R17 A;  1HO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...