4O4KA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
total genus 103
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o4kA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o4kA01
4UT3B 2BDXA 2Z06A 4H2IA 2Z1AA 4JA7A 3DSDA 5C1VA 4O5GA 2NXFA 2DFJA 3QG5C 2HYPA 3H64A 3IB8A 1IT6A 3THOB 3ICFA 1XM7A 4FBQA 2IE3C 4V0XA 5INBA 5F3WA 1S3NA 4DSYA 4UT2A 4LTYA 2BQ8X 1G5BA 3E7AA 4H2GA 2QFPA 1S8EA 1AUIA 1QFCA 1II7A 4DT2A 3GVEA 4LACC 3QFNA 1V73A 2WDFA 3H61A 3LL8A 4MP0A 2HY1A 4IYPC 3V4YA 2O8GA 2WDCA 4JA9A 3H67A 4FCXA 1NNWA 3QFOA 4ORAA 4KBPA 1XZWA 4V0WA 5JPEA 5J28A 3RL5A 1WARA 3AV0A 3N5UA 3PSOA 4TUIA 5JJTA 3ZTVA 3DSCA 3TGHA 2YVTA 3P71C 3THNA 1TCOA 3H66A 5EQVA 4I5LC 3RL3A 1HO5A 1S95A 4H1SA 2O8AA 3IB7A 2P6BA 3H63A 4FBKA 5B8IA 1T70A 3T1IA 1SU1A 1Z2XA 4I5NC 4ZVZA 1M63A 2ZBMA 2A22A 1UTEA 1MF8A 4MOVA 4TUGA 1JK7A 2IE4C 4H2BA 2NYLC 4J6OA 5HPEA 3EGHA 3H69A 4V0VA 3CK2A 4MOYA 3H60A 4H1YP 4UWQA 3IVDA 4ORBA 1FJMA 2BCDA 1W24A 5GTUA 4HD0A 4ZX2A 1S3LA 1T71A 1OI8A 4M0VA 1QHWA 1OIEA 2GJUA 4O24A 1OIDA 2NYMC 2JOGA 3QFKA 4LU9A 4WWLA 3HVQA 2NPPC 3AUZA 1S3MA 3K7VC 5IOHA 1USHA 3EGGA 2Q8UA 1U32A 2Z72A 3K7WC 4IL1A 4XPNA 4UT3A 1KBPA 3C9FA 3H68A 2R17A 3RQZA 2USHA 3E7BA 4FBWA 3IVEA 3FGAC 1Z2WA 1UF3A 4OR9A 2HYOA 2KKNA 3KBPA 3PSNA 1S70A 2QJCA 1HPUA 2WDDA 3DW8C 4B2OA 5JPFA 3H62B 4DHLA 4H2FA 4NZVA 3C5WC 4YKEA 2IAEC 3RL4A 3JYFA 4O4KA 3ZU0A 1WAO1 4F0ZA 1HP1A 3QFMA 2XMOA 2QFRA 4O43A 2WDEA 2CV9A 4KKZA 4Q7FA 2AHDA 4G9JA 5DNYA 4ORCA
chains in the Genus database with same CATH superfamily
2YTIA 2BDXA 2EM0A 4F6NA 2Z1AA 5A69A 5C1VA 4O5GA 3MSWA 2DFJA 1MGTA 2DMIA 3IWBA 1IT6A 3H64A 1XM7A 2EOYA 2BB8A 4F9BB 3ADIA 2UXBE 2BQ8X 1TF3A 3E7AA 2QFPA 5T6JA 1XMOE 4OX9E 2JPAA 1AUIA 4DT2A 4BHBA 3LL8A 1AAYA 2EQ0A 3OMLA 2EM4A 1X49A 4ZYGA 5FLXC 1A1GA 3H09A 3J80C 3HTXA 4MP0A 3BIDA 4IYPC 2WDCA 3E0JA 1XNQE 2FGGA 1NNWA 4DV0E 4LF5E 3QFOA 4ORAA 4WPYA 1ZU1A 4KBPA 1B69A 2LTSA 1YFHA 3RL5A 2EN2A 4F2JC 4J8ZA 2JVAA 2KOUA 4KZSA 4DUYE 3P71C 5A6AA 3RL3A 1HO5A 1T38A 3D03A 4JI4E 2O8AA 4FBKA 2VRDA 2EL5A 1AH5A 1YYWA 2EPAA 2DIXA 4ZVZA 2EOSA 2HC5A 4MOVA 2M1SA 1JK7A 2IE4C 2NYLC 1GZ6A 2IHR1 3OTOE 4J6OA 5LMNE 5HPEA 4V0VA 3DJWA 2EM9A 4MOYA 5AE1A 1MEYC 1N32E 4UWQA 3IVDA 1UHZA 1O0WA 1PJQA 4RHBB 4DR7E 4WSPA 1HNZE 2I13A 1S3LA 1A1HA 1X6EA 1WXRA 3HQ1A 5AC5A 3JTZA 4M0VA 2LUPB 4WXCA 2GPIA 3M99B 1IQOA 1X47A 2GJUA 2ODRC 1OIDA 2VF1A 2NPPC 3VHTB 1JK2A 2RTXA 2M4IA 3EGGA 1U32A 4M9VC 3BF2A 2JOXA 4B3RE 1UN6B 2JOBA 2DXLA 5AE3A 2DGCA 1PJTA 5IV8B 2HYOA 2KKNA 2EOQA 3PSNA 1YZ9A 2L3JA 3DW8C 4X65E 5IWAE 4NZVA 4HTGA 3C5WC 2YTQA 5CFFE 2YTPA 2WCC3 3RMPA 3HPSA 2DLQA 1RC7A 3C4TA 2NUFA 1N3GA 3T1HE 2GLIA 4JI6E 5TSEA 3QFMA 1JK1A 4WSGA 2VQFE 2FV4B 1SFEA 2RSMA 4R2DA 1P47A 4H2IA 4DUZE 4JA7A 3DSDA 4R03A 2NXFA 4GEQB 2HYPA 2EMHA 3VK6A 2YRMA 4FBQA 2IE3C 2EPCA 2ENAA 2DRPA 2UUCE 4BBYA 1G2FC 4JV5E 1ZBTA 2EQ1A 2UUAE 4LACC 4IS1C 2PRTA 3QFNA 2K7IA 2LO3A 3H61A 2EMAA 3EPKA 3KWRA 2WBSA 4LF6E 1IMUA 2HY1A 2EMFA 4R8OA 5A6KA 2O8GA 2LMZA 3VYXA 2EMWA 4DR6E 4JA9A 5A6JA 2MDRA 2EM3A 4N4RB 4B3ME 4V0WA 1GTKA 3AV0A 4DV6E 2UU9E 5JJTA 3JU0A 3T1YE 3ZTVA 4DR3E 1NEIA 2JY9A 3J81C 1G2DC 5EQVA 4DR2E 1PJSA 4B3TE 2YTFA 1A1JA 2DMYA 4X66E 2JP9A 5B8IA 1T70A 2ADRA 3ADLA 1A1FA 1SU1A 2EOFA 2KHXA 2V88A 2B7TA 4TUGA 2YTOA 3H69A 4F54A 4X62E 4H1YP 4X64E 2V8QB 2EMBA 4P78A 2EPUA 2E1MA 2BBGA 1W24A 2LE2A 4DV1E 1X6FA 3EQ1A 4HD0A 2NUEA 1XNRE 2GHFA 4KHPE 1DQ3A 2MC5A 1QHWA 4NXME 2L33A 4IJDA 2NABA 2NYMC 4WWLA 2RS7A 4WYQB 2CSHA 2EMYA 1YUIA 4DV7E 3ZOQB 5AC4A 3K7VC 5IOHA 2Q8UA 2ELZA 4GKJE 3RQZA 2EWLA 2EM2A 4JI3E 2USHA 2LUQA 2JYAA 3VYYA 2YTGA 5AASA 4FBWA 2EPPA 3FGAC 1UF3A 2N8XA 2WZOA 4OR9A 2L8TA 4M30A 2EPLX 2EOMA 2QJCA 2EP3A 3HPZA 1HPUA 2YT4A 2EL4A 2HHHE 1BBGA 4LF7E 4DHLA 5IT9C 4WX9A 4YKEA 2H36X 4LF8E 2IAEC 3ADJA 3JYFA 3RL4A 2YSOA 2MC6A 3ZU0A 4L8NA 1T4OA 1WAO1 1HP1A 2LV2A 2QFRA 2EPMX 3BGHA 2WDEA 1WRJA 2EMXA 1T4LB 1FKAE 2L3CA 2AHDA 4JI8E 4Q7FA 4G9JA 2YU5A 2LCEA 1PDAA 1QU6A 5DNYA 1ZAAC 2EL6A 4ORCA 2V86A 3C6MA 2Z06A 2ODRD 2E5LE 1WHQA 4R2AA 3QG5C 3ICFA 3IB8A 3THOB 2L92A 1HNXE 2FTXB 1A1IA 4DSYA 4YY3E 4JI2E 1G5BA 2EZ6A 2J7JA 3UK3C 3DF6A 2KONA 4JI1E 1V73A 2WDFA 1I94E 2L2NA 1IBKE 2LJUA 3IWDA 2YTDA 4WXDA 4BHCA 4ZYEA 2EOEA 3L00A 2EPZA 4P7DA 2V83A 4FCXA 1RQ0A 2CTDA 2E72A 2B7VA 2MKNA 1WARA 2ZO9B 4DKKA 3PSOA 1N34E 4DMIA 3DSCA 3TGHA 2YVTA 5AE2A 2VQEE 3THNA 4M2ZA 1TCOA 3H66A 3P1XA 4GKKE 1ZR9A 2RS6A 1S95A 2WBUA 1L4SA 2LRSA 2YZTA 2P6BA 5KL3A 2LJHA 1T4NA 3H63A 1DGCA 3TQMA 1T39A 1Z2XA 3MHSC 3T1IA 2HJJA 1MF8A 4BC7A 4ZYDA 3IWCA 4LFAE 4H2BA 1BB8A 2YTJA 3C4BA 3EPLA 1YSAC 1UILA 2EMCA 2G7HA 2YRHA 5KL5A 4RH8A 5LLQA 2LVHA 3J7Yp 4ORBA 1FJMA 2BCDA 2DB2A 4F9CB 4YHHE 5GTUA 2B3TB 1YYOA 1T71A 4X8WA 2VE7C 3ECRA 3F6HA 2EE8A 2F4VE 4R2QA 3FLOA 1TN9A 3EPJA 1OIEA 1IQSA 5ADZA 4O24A 1N33E 2M9AA 2R76A 2RQLA 5BR8E 5LMUE 1BBOA 3AUZA 1F2IG 3JAMC 4F6MA 1S3MA 1YPNA 1USHA 1X5WA 1N36E 4IL1A 4XPNA 1DI2A 2LBSB 3IVEA 3BBGA 2EN7A 3EPHA 4ZYHA 3KBPA 2EM8A 2MKDA 1S70A 4BMJA 2WDDA 2EN4A 5A2QC 3H62B 2EMKA 2EN3A 4H2FA 2EOZA 3C6KA 3KZYA 4R2EA 4O4KA 1A1KA 3HXLA 4WFTA 4F0ZA 2EPRA 2LTRA 2CV9A 2HGHA 4KKZA 2EN6A 2V87A 4I8OA 2EOOA 4BC9A 2N3GA 2EMLA 4B3SE 4DR1E 2YU8A 5A6BA 2ZOAA 4UT3B 2ENCA 5A6BD 1J5EE 4JI7E 1TF6A 1NCSA 2YTEA 1YUJA 4V0XA 5INBA 5F3WA 4Q35B 2UUBE 2NUGA 1S3NA 4UT2A 4BCAA 2EM5A 4LTYA 1QNTA 1X3CA 4H2GA 4DR4E 2ELYA 2YTNA 1S8EA 2EN8A 2A25A 1QFCA 1IBME 1XMQE 2WBTA 1II7A 3GVEA 2EMIA 1SR9A 1RMDA 5KL7A 1X48A 3F6GA 2EORA 1UBDC 4MLQA 1LLMC 1Z1BA 1KJKA 3V4YA 4DV3E 4LFBE 2DXNA 3H67A 3LLHA 2EPOA 1XZWA 5JPEA 4DR5E 5J28A 4L5NC 3N5UA 2JXPA 4KWYA 4TUIA 5KL2A 2EPKX 1GQEA 4X9JA 4I5LC 2EOIA 4R2CA 2V85A 1EH7A 4JI0E 1FJGE 4BS9A 2D9HA 2B9DA 2L2KB 2EM6A 2JWOA 3IB7A 4H1SA 2L6MA 2EPXA 1YYKA 4I5NC 4MLVA 1EH8A 1M63A 4NXNE 2ZBMA 2A22A 1UTEA 5LL6R 1A1LA 3KZZA 2UXCE 4R2SA 4OOGC 4LF9E 2K4VA 4F9AB 4JI5E 1J26A 3EGHA 2YEQA 1HR0E 3CK2A 4GZNC 2UXDE 3H60A 4AQYE 2EN1A 1HNWE 2L2MA 2ZM6E 4DV2E 4ZX2A 2R1FA 1OI8A 2MDGA 2RPCA 2ENHA 2CT1A 2DSYA 4HEIA 4LU9A 3QFKA 2YSPA 2JOGA 3HVQA 2V89A 2M7QA 1EH6A 2EM7A 2YWQA 4Q28A 2EOJA 1ZBQA 2LT7A 2EOHA 2Z72A 3K7WC 5KL4A 4DV5E 1KBPA 3C9FA 3H68A 2R17A 4UT3A 2EOXA 5IXMB 4LF4E 1STUA 2EPNA 2CPNA 3E7BA 4R2RA 1WHNA 3FIGA 2F8BA 2I9IA 1Z2WA 1IBLE 2EMGA 4FK5C 1PKPA 4K0KE 1X6HA 4B2OA 1WJPA 2JR1A 2YRKA 5JPFA 5KL6A 2RSIA 3LMLA 1EKZA 2EMZA 2N3HA 2DLKA 2XMOA 4DV4E 4O43A 3ADGA 2EQ3A 2YPNA 4NHRA 3J7AG 3MHHC 4JYAE 2EJ4A 1KYQA 3K6QA 4LFCE 4R2PA 2NA2A
chains in the Genus database with same CATH topology
2ZOAA 2BDXA 4UT3B 2Z06A 4H2IA 2Z1AA 4JA7A 3DSDA 5C1VA 4O5GA 2NXFA 2DFJA 3QG5C 2HYPA 3H64A 3IB8A 1IT6A 3THOB 3ICFA 1XM7A 4FBQA 2IE3C 4V0XA 5INBA 5F3WA 1S3NA 4DSYA 4UT2A 4LTYA 2BQ8X 1G5BA 3E7AA 4H2GA 2QFPA 1S8EA 1AUIA 1QFCA 1II7A 4DT2A 3GVEA 4LACC 3QFNA 1V73A 2WDFA 3H61A 3LL8A 4MP0A 2HY1A 4IYPC 3V4YA 2O8GA 2WDCA 3E0JA 2DXNA 4JA9A 3H67A 4FCXA 1NNWA 3QFOA 4ORAA 4KBPA 1XZWA 4V0WA 5JPEA 5J28A 3RL5A 1WARA 3AV0A 2ZO9B 3N5UA 3PSOA 4TUIA 3DSCA 3ZTVA 5JJTA 3TGHA 2YVTA 3P71C 3THNA 1TCOA 3H66A 5EQVA 4I5LC 3RL3A 1HO5A 3D03A 1S95A 4H1SA 2O8AA 3IB7A 2P6BA 3H63A 4FBKA 5B8IA 1T70A 3T1IA 1SU1A 1Z2XA 4I5NC 4ZVZA 1M63A 2ZBMA 2A22A 1UTEA 1MF8A 4MOVA 4TUGA 1JK7A 2IE4C 4H2BA 2NYLC 4J6OA 5HPEA 3EGHA 3H69A 2YEQA 4V0VA 3CK2A 4MOYA 3H60A 4H1YP 4UWQA 3IVDA 4ORBA 1FJMA 2BCDA 1W24A 5GTUA 4HD0A 4ZX2A 1S3LA 1T71A 1OI8A 4M0VA 1QHWA 3FLOA 1OIEA 2GJUA 4O24A 1OIDA 2NYMC 2JOGA 3QFKA 4LU9A 4WWLA 3HVQA 2NPPC 3AUZA 1S3MA 3K7VC 5IOHA 1USHA 3EGGA 2Q8UA 1U32A 2Z72A 3K7WC 4IL1A 4XPNA 4UT3A 1KBPA 3C9FA 3H68A 2R17A 3RQZA 2USHA 2DXLA 3E7BA 4FBWA 3IVEA 3FGAC 1Z2WA 1UF3A 4OR9A 2HYOA 2KKNA 3KBPA 3PSNA 1S70A 2QJCA 1HPUA 2WDDA 3DW8C 4B2OA 5JPFA 3H62B 4DHLA 4H2FA 4NZVA 3C5WC 4YKEA 2IAEC 3RL4A 3JYFA 4O4KA 3ZU0A 1WAO1 4F0ZA 1HP1A 3QFMA 2XMOA 2QFRA 4O43A 2WDEA 2CV9A 4KKZA 4Q7FA 2AHDA 4G9JA 5DNYA 4ORCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UT3 B;  2BDX A;  2Z06 A;  4H2I A;  2Z1A A;  4JA7 A;  3DSD A;  5C1V A;  4O5G A;  2NXF A;  2DFJ A;  3QG5 C;  2HYP A;  3H64 A;  3IB8 A;  1IT6 A;  3THO B;  3ICF A;  1XM7 A;  4FBQ A;  2IE3 C;  4V0X A;  5INB A;  5F3W A;  1S3N A;  4DSY A;  4UT2 A;  4LTY A;  2BQ8 X;  1G5B A;  3E7A A;  4H2G A;  2QFP A;  1S8E A;  1AUI A;  1QFC A;  1II7 A;  4DT2 A;  3GVE A;  4LAC C;  3QFN A;  1V73 A;  2WDF A;  3H61 A;  3LL8 A;  4MP0 A;  2HY1 A;  4IYP C;  3V4Y A;  2O8G A;  2WDC A;  4JA9 A;  3H67 A;  4FCX A;  1NNW A;  3QFO A;  4ORA A;  4KBP A;  1XZW A;  4V0W A;  5JPE A;  5J28 A;  3RL5 A;  1WAR A;  3AV0 A;  3N5U A;  3PSO A;  4TUI A;  5JJT A;  3ZTV A;  3DSC A;  3TGH A;  2YVT A;  3P71 C;  3THN A;  1TCO A;  3H66 A;  5EQV A;  4I5L C;  3RL3 A;  1HO5 A;  1S95 A;  4H1S A;  2O8A A;  3IB7 A;  2P6B A;  3H63 A;  4FBK A;  5B8I A;  1T70 A;  3T1I A;  1SU1 A;  1Z2X A;  4I5N C;  4ZVZ A;  1M63 A;  2ZBM A;  2A22 A;  1UTE A;  1MF8 A;  4MOV A;  4TUG A;  1JK7 A;  2IE4 C;  4H2B A;  2NYL C;  4J6O A;  5HPE A;  3EGH A;  3H69 A;  4V0V A;  3CK2 A;  4MOY A;  3H60 A;  4H1Y P;  4UWQ A;  3IVD A;  4ORB A;  1FJM A;  2BCD A;  1W24 A;  5GTU A;  4HD0 A;  4ZX2 A;  1S3L A;  1T71 A;  1OI8 A;  4M0V A;  1QHW A;  1OIE A;  2GJU A;  4O24 A;  1OID A;  2NYM C;  2JOG A;  3QFK A;  4LU9 A;  4WWL A;  3HVQ A;  2NPP C;  3AUZ A;  1S3M A;  3K7V C;  5IOH A;  1USH A;  3EGG A;  2Q8U A;  1U32 A;  2Z72 A;  3K7W C;  4IL1 A;  4XPN A;  4UT3 A;  1KBP A;  3C9F A;  3H68 A;  2R17 A;  3RQZ A;  2USH A;  3E7B A;  4FBW A;  3IVE A;  3FGA C;  1Z2W A;  1UF3 A;  4OR9 A;  2HYO A;  2KKN A;  3KBP A;  3PSN A;  1S70 A;  2QJC A;  1HPU A;  2WDD A;  3DW8 C;  4B2O A;  5JPF A;  3H62 B;  4DHL A;  4H2F A;  4NZV A;  3C5W C;  4YKE A;  2IAE C;  3RL4 A;  3JYF A;  4O4K A;  3ZU0 A;  1WAO 1;  4F0Z A;  1HP1 A;  3QFM A;  2XMO A;  2QFR A;  4O43 A;  2WDE A;  2CV9 A;  4KKZ A;  4Q7F A;  2AHD A;  4G9J A;  5DNY A;  4ORC A; 
#chains in the Genus database with same CATH topology
 2YTI A;  2BDX A;  2EM0 A;  4F6N A;  2Z1A A;  5A69 A;  5C1V A;  4O5G A;  3MSW A;  2DFJ A;  1MGT A;  2DMI A;  3IWB A;  1IT6 A;  3H64 A;  1XM7 A;  2EOY A;  2BB8 A;  4F9B B;  3ADI A;  2UXB E;  2BQ8 X;  1TF3 A;  3E7A A;  2QFP A;  5T6J A;  1XMO E;  4OX9 E;  2JPA A;  1AUI A;  4DT2 A;  4BHB A;  3LL8 A;  1AAY A;  2EQ0 A;  3OML A;  2EM4 A;  1X49 A;  4ZYG A;  5FLX C;  1A1G A;  3H09 A;  3J80 C;  3HTX A;  4MP0 A;  3BID A;  4IYP C;  2WDC A;  3E0J A;  1XNQ E;  2FGG A;  1NNW A;  4DV0 E;  4LF5 E;  3QFO A;  4ORA A;  4WPY A;  1ZU1 A;  4KBP A;  1B69 A;  2LTS A;  1YFH A;  3RL5 A;  2EN2 A;  4F2J C;  4J8Z A;  2JVA A;  2KOU A;  4KZS A;  4DUY E;  3P71 C;  5A6A A;  3RL3 A;  1HO5 A;  1T38 A;  3D03 A;  4JI4 E;  2O8A A;  4FBK A;  2VRD A;  2EL5 A;  1AH5 A;  1YYW A;  2EPA A;  2DIX A;  4ZVZ A;  2EOS A;  2HC5 A;  4MOV A;  2M1S A;  1JK7 A;  2IE4 C;  2NYL C;  1GZ6 A;  2IHR 1;  3OTO E;  4J6O A;  5LMN E;  5HPE A;  4V0V A;  3DJW A;  2EM9 A;  4MOY A;  5AE1 A;  1MEY C;  1N32 E;  4UWQ A;  3IVD A;  1UHZ A;  1O0W A;  1PJQ A;  4RHB B;  4DR7 E;  4WSP A;  1HNZ E;  2I13 A;  1S3L A;  1A1H A;  1X6E A;  1WXR A;  3HQ1 A;  5AC5 A;  3JTZ A;  4M0V A;  2LUP B;  4WXC A;  2GPI A;  3M99 B;  1IQO A;  1X47 A;  2GJU A;  2ODR C;  1OID A;  2VF1 A;  2NPP C;  3VHT B;  1JK2 A;  2RTX A;  2M4I A;  3EGG A;  1U32 A;  4M9V C;  3BF2 A;  2JOX A;  4B3R E;  1UN6 B;  2JOB A;  2DXL A;  5AE3 A;  2DGC A;  1PJT A;  5IV8 B;  2HYO A;  2KKN A;  2EOQ A;  3PSN A;  1YZ9 A;  2L3J A;  3DW8 C;  4X65 E;  5IWA E;  4NZV A;  4HTG A;  3C5W C;  2YTQ A;  5CFF E;  2YTP A;  2WCC 3;  3RMP A;  3HPS A;  2DLQ A;  1RC7 A;  3C4T A;  2NUF A;  1N3G A;  3T1H E;  2GLI A;  4JI6 E;  5TSE A;  3QFM A;  1JK1 A;  4WSG A;  2VQF E;  2FV4 B;  1SFE A;  2RSM A;  4R2D A;  1P47 A;  4H2I A;  4DUZ E;  4JA7 A;  3DSD A;  4R03 A;  2NXF A;  4GEQ B;  2HYP A;  2EMH A;  3VK6 A;  2YRM A;  4FBQ A;  2IE3 C;  2EPC A;  2ENA A;  2DRP A;  2UUC E;  4BBY A;  1G2F C;  4JV5 E;  1ZBT A;  2EQ1 A;  2UUA E;  4LAC C;  4IS1 C;  2PRT A;  3QFN A;  2K7I A;  2LO3 A;  3H61 A;  2EMA A;  3EPK A;  3KWR A;  2WBS A;  4LF6 E;  1IMU A;  2HY1 A;  2EMF A;  4R8O A;  5A6K A;  2O8G A;  2LMZ A;  3VYX A;  2EMW A;  4DR6 E;  4JA9 A;  5A6J A;  2MDR A;  2EM3 A;  4N4R B;  4B3M E;  4V0W A;  1GTK A;  3AV0 A;  4DV6 E;  2UU9 E;  5JJT A;  3JU0 A;  3T1Y E;  3ZTV A;  4DR3 E;  1NEI A;  2JY9 A;  3J81 C;  1G2D C;  5EQV A;  4DR2 E;  1PJS A;  4B3T E;  2YTF A;  1A1J A;  2DMY A;  4X66 E;  2JP9 A;  5B8I A;  1T70 A;  2ADR A;  3ADL A;  1A1F A;  1SU1 A;  2EOF A;  2KHX A;  2V88 A;  2B7T A;  4TUG A;  2YTO A;  3H69 A;  4F54 A;  4X62 E;  4H1Y P;  4X64 E;  2V8Q B;  2EMB A;  4P78 A;  2EPU A;  2E1M A;  2BBG A;  1W24 A;  2LE2 A;  4DV1 E;  1X6F A;  3EQ1 A;  4HD0 A;  2NUE A;  1XNR E;  2GHF A;  4KHP E;  1DQ3 A;  2MC5 A;  1QHW A;  4NXM E;  2L33 A;  4IJD A;  2NAB A;  2NYM C;  4WWL A;  2RS7 A;  4WYQ B;  2CSH A;  2EMY A;  1YUI A;  4DV7 E;  3ZOQ B;  5AC4 A;  3K7V C;  5IOH A;  2Q8U A;  2ELZ A;  4GKJ E;  3RQZ A;  2EWL A;  2EM2 A;  4JI3 E;  2USH A;  2LUQ A;  2JYA A;  3VYY A;  2YTG A;  5AAS A;  4FBW A;  2EPP A;  3FGA C;  1UF3 A;  2N8X A;  2WZO A;  4OR9 A;  2L8T A;  4M30 A;  2EPL X;  2EOM A;  2QJC A;  2EP3 A;  3HPZ A;  1HPU A;  2YT4 A;  2EL4 A;  2HHH E;  1BBG A;  4LF7 E;  4DHL A;  5IT9 C;  4WX9 A;  4YKE A;  2H36 X;  4LF8 E;  2IAE C;  3ADJ A;  3JYF A;  3RL4 A;  2YSO A;  2MC6 A;  3ZU0 A;  4L8N A;  1T4O A;  1WAO 1;  1HP1 A;  2LV2 A;  2QFR A;  2EPM X;  3BGH A;  2WDE A;  1WRJ A;  2EMX A;  1T4L B;  1FKA E;  2L3C A;  2AHD A;  4JI8 E;  4Q7F A;  4G9J A;  2YU5 A;  2LCE A;  1PDA A;  1QU6 A;  5DNY A;  1ZAA C;  2EL6 A;  4ORC A;  2V86 A;  3C6M A;  2Z06 A;  2ODR D;  2E5L E;  1WHQ A;  4R2A A;  3QG5 C;  3ICF A;  3IB8 A;  3THO B;  2L92 A;  1HNX E;  2FTX B;  1A1I A;  4DSY A;  4YY3 E;  4JI2 E;  1G5B A;  2EZ6 A;  2J7J A;  3UK3 C;  3DF6 A;  2KON A;  4JI1 E;  1V73 A;  2WDF A;  1I94 E;  2L2N A;  1IBK E;  2LJU A;  3IWD A;  2YTD A;  4WXD A;  4BHC A;  4ZYE A;  2EOE A;  3L00 A;  2EPZ A;  4P7D A;  2V83 A;  4FCX A;  1RQ0 A;  2CTD A;  2E72 A;  2B7V A;  2MKN A;  1WAR A;  2ZO9 B;  4DKK A;  3PSO A;  1N34 E;  4DMI A;  3DSC A;  3TGH A;  2YVT A;  5AE2 A;  2VQE E;  3THN A;  4M2Z A;  1TCO A;  3H66 A;  3P1X A;  4GKK E;  1ZR9 A;  2RS6 A;  1S95 A;  2WBU A;  1L4S A;  2LRS A;  2YZT A;  2P6B A;  5KL3 A;  2LJH A;  1T4N A;  3H63 A;  1DGC A;  3TQM A;  1T39 A;  1Z2X A;  3MHS C;  3T1I A;  2HJJ A;  1MF8 A;  4BC7 A;  4ZYD A;  3IWC A;  4LFA E;  4H2B A;  1BB8 A;  2YTJ A;  3C4B A;  3EPL A;  1YSA C;  1UIL A;  2EMC A;  2G7H A;  2YRH A;  5KL5 A;  4RH8 A;  5LLQ A;  2LVH A;  3J7Y p;  4ORB A;  1FJM A;  2BCD A;  2DB2 A;  4F9C B;  4YHH E;  5GTU A;  2B3T B;  1YYO A;  1T71 A;  4X8W A;  2VE7 C;  3ECR A;  3F6H A;  2EE8 A;  2F4V E;  4R2Q A;  3FLO A;  1TN9 A;  3EPJ A;  1OIE A;  1IQS A;  5ADZ A;  4O24 A;  1N33 E;  2M9A A;  2R76 A;  2RQL A;  5BR8 E;  5LMU E;  1BBO A;  3AUZ A;  1F2I G;  3JAM C;  4F6M A;  1S3M A;  1YPN A;  1USH A;  1X5W A;  1N36 E;  4IL1 A;  4XPN A;  1DI2 A;  2LBS B;  3IVE A;  3BBG A;  2EN7 A;  3EPH A;  4ZYH A;  3KBP A;  2EM8 A;  2MKD A;  1S70 A;  4BMJ A;  2WDD A;  2EN4 A;  5A2Q C;  3H62 B;  2EMK A;  2EN3 A;  4H2F A;  2EOZ A;  3C6K A;  3KZY A;  4R2E A;  4O4K A;  1A1K A;  3HXL A;  4WFT A;  4F0Z A;  2EPR A;  2LTR A;  2CV9 A;  2HGH A;  4KKZ A;  2EN6 A;  2V87 A;  4I8O A;  2EOO A;  4BC9 A;  2N3G A;  2EML A;  4B3S E;  4DR1 E;  2YU8 A;  5A6B A;  2ZOA A;  4UT3 B;  2ENC A;  5A6B D;  1J5E E;  4JI7 E;  1TF6 A;  1NCS A;  2YTE A;  1YUJ A;  4V0X A;  5INB A;  5F3W A;  4Q35 B;  2UUB E;  2NUG A;  1S3N A;  4UT2 A;  4BCA A;  2EM5 A;  4LTY A;  1QNT A;  1X3C A;  4H2G A;  4DR4 E;  2ELY A;  2YTN A;  1S8E A;  2EN8 A;  2A25 A;  1QFC A;  1IBM E;  1XMQ E;  2WBT A;  1II7 A;  3GVE A;  2EMI A;  1SR9 A;  1RMD A;  5KL7 A;  1X48 A;  3F6G A;  2EOR A;  1UBD C;  4MLQ A;  1LLM C;  1Z1B A;  1KJK A;  3V4Y A;  4DV3 E;  4LFB E;  2DXN A;  3H67 A;  3LLH A;  2EPO A;  1XZW A;  5JPE A;  4DR5 E;  5J28 A;  4L5N C;  3N5U A;  2JXP A;  4KWY A;  4TUI A;  5KL2 A;  2EPK X;  1GQE A;  4X9J A;  4I5L C;  2EOI A;  4R2C A;  2V85 A;  1EH7 A;  4JI0 E;  1FJG E;  4BS9 A;  2D9H A;  2B9D A;  2L2K B;  2EM6 A;  2JWO A;  3IB7 A;  4H1S A;  2L6M A;  2EPX A;  1YYK A;  4I5N C;  4MLV A;  1EH8 A;  1M63 A;  4NXN E;  2ZBM A;  2A22 A;  1UTE A;  5LL6 R;  1A1L A;  3KZZ A;  2UXC E;  4R2S A;  4OOG C;  4LF9 E;  2K4V A;  4F9A B;  4JI5 E;  1J26 A;  3EGH A;  2YEQ A;  1HR0 E;  3CK2 A;  4GZN C;  2UXD E;  3H60 A;  4AQY E;  2EN1 A;  1HNW E;  2L2M A;  2ZM6 E;  4DV2 E;  4ZX2 A;  2R1F A;  1OI8 A;  2MDG A;  2RPC A;  2ENH A;  2CT1 A;  2DSY A;  4HEI A;  4LU9 A;  3QFK A;  2YSP A;  2JOG A;  3HVQ A;  2V89 A;  2M7Q A;  1EH6 A;  2EM7 A;  2YWQ A;  4Q28 A;  2EOJ A;  1ZBQ A;  2LT7 A;  2EOH A;  2Z72 A;  3K7W C;  5KL4 A;  4DV5 E;  1KBP A;  3C9F A;  3H68 A;  2R17 A;  4UT3 A;  2EOX A;  5IXM B;  4LF4 E;  1STU A;  2EPN A;  2CPN A;  3E7B A;  4R2R A;  1WHN A;  3FIG A;  2F8B A;  2I9I A;  1Z2W A;  1IBL E;  2EMG A;  4FK5 C;  1PKP A;  4K0K E;  1X6H A;  4B2O A;  1WJP A;  2JR1 A;  2YRK A;  5JPF A;  5KL6 A;  2RSI A;  3LML A;  1EKZ A;  2EMZ A;  2N3H A;  2DLK A;  2XMO A;  4DV4 E;  4O43 A;  3ADG A;  2EQ3 A;  2YPN A;  4NHR A;  3J7A G;  3MHH C;  4JYA E;  2EJ4 A;  1KYQ A;  3K6Q A;  4LFC E;  4R2P A;  2NA2 A; 
#chains in the Genus database with same CATH homology
 2ZOA A;  2BDX A;  4UT3 B;  2Z06 A;  4H2I A;  2Z1A A;  4JA7 A;  3DSD A;  5C1V A;  4O5G A;  2NXF A;  2DFJ A;  3QG5 C;  2HYP A;  3H64 A;  3IB8 A;  1IT6 A;  3THO B;  3ICF A;  1XM7 A;  4FBQ A;  2IE3 C;  4V0X A;  5INB A;  5F3W A;  1S3N A;  4DSY A;  4UT2 A;  4LTY A;  2BQ8 X;  1G5B A;  3E7A A;  4H2G A;  2QFP A;  1S8E A;  1AUI A;  1QFC A;  1II7 A;  4DT2 A;  3GVE A;  4LAC C;  3QFN A;  1V73 A;  2WDF A;  3H61 A;  3LL8 A;  4MP0 A;  2HY1 A;  4IYP C;  3V4Y A;  2O8G A;  2WDC A;  3E0J A;  2DXN A;  4JA9 A;  3H67 A;  4FCX A;  1NNW A;  3QFO A;  4ORA A;  4KBP A;  1XZW A;  4V0W A;  5JPE A;  5J28 A;  3RL5 A;  1WAR A;  3AV0 A;  2ZO9 B;  3N5U A;  3PSO A;  4TUI A;  3DSC A;  3ZTV A;  5JJT A;  3TGH A;  2YVT A;  3P71 C;  3THN A;  1TCO A;  3H66 A;  5EQV A;  4I5L C;  3RL3 A;  1HO5 A;  3D03 A;  1S95 A;  4H1S A;  2O8A A;  3IB7 A;  2P6B A;  3H63 A;  4FBK A;  5B8I A;  1T70 A;  3T1I A;  1SU1 A;  1Z2X A;  4I5N C;  4ZVZ A;  1M63 A;  2ZBM A;  2A22 A;  1UTE A;  1MF8 A;  4MOV A;  4TUG A;  1JK7 A;  2IE4 C;  4H2B A;  2NYL C;  4J6O A;  5HPE A;  3EGH A;  3H69 A;  2YEQ A;  4V0V A;  3CK2 A;  4MOY A;  3H60 A;  4H1Y P;  4UWQ A;  3IVD A;  4ORB A;  1FJM A;  2BCD A;  1W24 A;  5GTU A;  4HD0 A;  4ZX2 A;  1S3L A;  1T71 A;  1OI8 A;  4M0V A;  1QHW A;  3FLO A;  1OIE A;  2GJU A;  4O24 A;  1OID A;  2NYM C;  2JOG A;  3QFK A;  4LU9 A;  4WWL A;  3HVQ A;  2NPP C;  3AUZ A;  1S3M A;  3K7V C;  5IOH A;  1USH A;  3EGG A;  2Q8U A;  1U32 A;  2Z72 A;  3K7W C;  4IL1 A;  4XPN A;  4UT3 A;  1KBP A;  3C9F A;  3H68 A;  2R17 A;  3RQZ A;  2USH A;  2DXL A;  3E7B A;  4FBW A;  3IVE A;  3FGA C;  1Z2W A;  1UF3 A;  4OR9 A;  2HYO A;  2KKN A;  3KBP A;  3PSN A;  1S70 A;  2QJC A;  1HPU A;  2WDD A;  3DW8 C;  4B2O A;  5JPF A;  3H62 B;  4DHL A;  4H2F A;  4NZV A;  3C5W C;  4YKE A;  2IAE C;  3RL4 A;  3JYF A;  4O4K A;  3ZU0 A;  1WAO 1;  4F0Z A;  1HP1 A;  3QFM A;  2XMO A;  2QFR A;  4O43 A;  2WDE A;  2CV9 A;  4KKZ A;  4Q7F A;  2AHD A;  4G9J A;  5DNY A;  4ORC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...