4O4KA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 103
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o4kA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o4kA01
1W24A 1IT6A 1UF3A 3DSCA 4FBQA 2A22A 4DHLA 1T71A 1JK7A 2YVTA 1U32A 2NYLC 4IYPC 4UT2A 5F3WA 3TGHA 2AHDA 2NXFA 3AUZA 4KBPA 3RL5A 4O24A 2Z06A 2WDEA 2WDFA 3RQZA 4H1YP 3DSDA 3RL4A 3IVDA 3RL3A 2IE3C 4V0XA 4V0WA 5GTUA 2QFRA 3P71C 4O5GA 1SU1A 4H2BA 1XZWA 3CK2A 2WDCA 2XMOA 4FBKA 1G5BA 4FBWA 3H63A 2NYMC 4ZVZA 2JOGA 1OI8A 4DSYA 1NNWA 4V0VA 2BQ8X 4DT2A 3ZTVA 1OIDA 3V4YA 3IB8A 3H67A 4MP0A 4Q7FA 1S95A 4NZVA 2ZBMA 4ORAA 2BDXA 1MF8A 3THNA 2IE4C 2Q8UA 3GVEA 2Z1AA 3QFKA 2BCDA 2NPPC 3E7BA 4ORCA 3H69A 3N5UA 4ZX2A 2IAEC 3H62B 3JYFA 4UT3A 3H66A 1II7A 5J28A 1S70A 2QJCA 1OIEA 1WARA 3EGGA 3H68A 5IOHA 3DW8C 2R17A 3IVEA 2CV9A 4O4KA 4LACC 1WAO1 4H2FA 3QG5C 3LL8A 2DFJA 1KBPA 4G9JA 4H2GA 1S3LA 4MOVA 3QFMA 3QFOA 3AV0A 1QFCA 4I5LC 4XPNA 4YKEA 1XM7A 4LU9A 1S8EA 4WWLA 3H61A 5JPFA 4H1SA 1QHWA 2USHA 3C9FA 2P6BA 4LTYA 4FCXA 1HO5A 4HD0A 2HYOA 2HYPA 3K7VC 3PSNA 4O43A 1FJMA 4KKZA 5JJTA 1S3NA 1Z2XA 4H2IA 5JPEA 5C1VA 3ICFA 1HP1A 3EGHA 4TUGA 2GJUA 4ORBA 3PSOA 2O8AA 4MOYA 5HPEA 2WDDA 1HPUA 4F0ZA 3C5WC 1UTEA 1Z2WA 1T70A 3QFNA 4JA7A 2QFPA 4IL1A 2KKNA 4B2OA 3FGAC 5DNYA 2Z72A 1S3MA 3E7AA 1V73A 5EQVA 3THOB 3HVQA 3H64A 4M0VA 4UT3B 4TUIA 1M63A 5INBA 4JA9A 3ZU0A 1AUIA 5B8IA 1TCOA 2HY1A 4UWQA 4J6OA 3IB7A 3T1IA 4OR9A 4I5NC 3H60A 1USHA 3KBPA 3K7WC 2O8GA
chains in the Genus database with same CATH superfamily
2KONA 2EPNA 4DR7E 3FLOA 2L2MA 2DRPA 2UUCE 1X48A 4DR5E 2NYLC 5LLQA 2E5LE 1HNZE 4B3ME 4K0KE 3DSDA 2EMXA 2EMFA 4DUZE 1L4SA 2LUQA 2V8QB 2EPRA 4ZYGA 5A6JA 3RL3A 2EOYA 2EMWA 1A1KA 2NUFA 1RMDA 2QFRA 2JVAA 4H2BA 2LCEA 1BB8A 4MLVA 4RHBB 4LF6E 1X6FA 3CK2A 2UXBE 1A1LA 2N3HA 3KWRA 4DUYE 1OI8A 3KZYA 4BCAA 4DKKA 1YFHA 3ADGA 3J7AG 4DR3E 5A6KA 1AH5A 4OX9E 5A6AA 3EPHA 2EQ3A 3V4YA 2I13A 4WX9A 4LFAE 2RSMA 4N4RB 2EOEA 4WPYA 4B3TE 4LF9E 2Q8UA 2NPPC 4ORCA 3H69A 2EM5A 3H62B 2EJ4A 2EL4A 2M9AA 5IT9C 3H66A 1NEIA 2EPZA 2CTDA 4Q28A 4R2RA 5AE1A 1OIEA 1WARA 2EMGA 3DW8C 2CV9A 2YTGA 2EWLA 2WCC3 4P78A 2MKNA 1EH6A 2J7JA 2YRMA 2V89A 1FKAE 1S3LA 2YTNA 4MOVA 2EM3A 4R2CA 1QFCA 4XPNA 4YKEA 2MDRA 1XM7A 1X3CA 2EL6A 1TN9A 1N33E 1PDAA 4X9JA 3H61A 3HXLA 4H1SA 5A2QC 2L3JA 2P6BA 4LTYA 4F9AB 4ZYEA 1QNTA 5A6BD 2HYOA 1N36E 2HYPA 3K7VC 1XMQE 2EOIA 4YHHE 1ZU1A 2EOZA 3F6GA 4WFTA 1JK2A 2L6MA 4NXNE 3EGHA 5IXMB 1IBLE 1FJGE 4MOYA 2DXLA 2YWQA 4M30A 2VQFE 1A1IA 1HPUA 2LTRA 1A1GA 5HPEA 5KL7A 2YTIA 3M99B 1T4LB 1B69A 3C5WC 1P47A 2L2KB 4F0ZA 2WZOA 2LJHA 2L8TA 4DV3E 2EPLX 2DLKA 2Z72A 5KL2A 1GTKA 1ZR9A 4JYAE 1YUJA 4R2AA 2CSHA 3KZZA 4KWYA 3THOB 1N32E 2ZO9B 3HTXA 4GEQB 1M63A 2LE2A 5B8IA 2HY1A 1WXRA 4J6OA 2NABA 5CFFE 1HNXE 4LF4E 5FLXC 3IB7A 3T1IA 2JP9A 3KBPA 2YSOA 5AC4A 1W24A 1UF3A 3HQ1A 1T39A 2JY9A 4LFCE 2EPOA 2A22A 3HPZA 1PJSA 2GHFA 4X65E 3J81C 1X5WA 2L92A 1UBDC 4DHLA 5F3WA 1WJPA 2YRKA 3AUZA 4KBPA 2Z06A 1EH7A 2WDFA 3BF2A 3JU0A 4H1YP 1WHQA 2LJUA 2EMZA 2KHXA 3IVDA 2EM2A 2EM8A 2IE3C 5A69A 3ADIA 4V0XA 2G7HA 4V0WA 2DSYA 5LL6R 1EKZA 4O5GA 1ZBQA 2RS6A 1X6EA 4FBKA 2YU5A 2VF1A 4R8OA 4WXCA 4ZVZA 4F54A 2JOGA 1BBGA 2YTDA 1NNWA 4F9CB 2R76A 2YTQA 4ZYDA 4V0VA 2EMCA 4DT2A 4ZYHA 3T1YE 1OIDA 2B3TB 2JXPA 2RPCA 2LT7A 2F4VE 4Q7FA 2DMYA 1MGTA 1IMUA 4ORAA 3K6QA 1YUIA 2ODRC 3UK3C 2EP3A 2Z1AA 2K4VA 3QFKA 2EOXA 1JK1A 4MLQA 5AE3A 1X47A 2EM7A 1J26A 3JYFA 1G2DC 1S70A 2QJCA 1X6HA 2KOUA 2GLIA 2VE7C 4LACC 2YTPA 1WAO1 3JTZA 1TF3A 2EOHA 4FK5C 2E72A 2EM4A 2LMZA 4P7DA 4H2GA 3QFOA 2HJJA 3AV0A 2R1FA 3H09A 4I5LC 1J5EE 3D03A 5KL6A 1QU6A 2JYAA 2V86A 2JR1A 5ADZA 2L3CA 5JPFA 1YSAC 3C9FA 1T4NA 4FCXA 2IHR1 2VQEE 3ZOQB 2FGGA 4HD0A 2EPMX 4L5NC 2V83A 4M9VC 2EMBA 3PSNA 1G2FC 1N34E 4X62E 2EN1A 5JPEA 4DMIA 3ICFA 4ORBA 2N8XA 1LLMC 4LF5E 3C4BA 4DV4E 2EOOA 1T70A 2EPUA 1UTEA 2QFPA 4IL1A 3C4TA 2EM6A 3DJWA 1KJKA 4B2OA 2EMKA 2EN4A 2EPKX 1S3MA 4GKJE 3LMLA 3T1HE 1V73A 4B3SE 3C6MA 2ENHA 2EMHA 1O0WA 3HVQA 4HTGA 3VYYA 4LFBE 1PKPA 2H36X 3TQMA 1T38A 2LO3A 2LBSB 5LMUE 2EZ6A 4DR1E 1SR9A 4I5NC 2UU9E 2EN7A 2JOBA 2MDGA 2M7QA 2O8GA 1IT6A 4X66E 3DSCA 2EPXA 1TF6A 1T71A 4BHBA 2V85A 1JK7A 3DF6A 4R2PA 3TGHA 4WXDA 2NXFA 2YRHA 2A25A 1YYWA 2WDEA 4WSGA 3RQZA 2EMLA 5AASA 5KL5A 4IS1C 3RL4A 4YY3E 2EN2A 4KHPE 4L8NA 3MSWA 2UXCE 1SFEA 1SU1A 2YSPA 2YTEA 2WDCA 2XMOA 1G5BA 2BB8A 2V88A 4BS9A 2EE8A 3H63A 4FBWA 5T6JA 2ZOAA 3EQ1A 1STUA 3JAMC 4JV5E 4BMJA 2EN6A 3EPKA 4BC9A 2ELYA 1YZ9A 1BBOA 2BQ8X 4LF7E 3ZTVA 3IWDA 3P1XA 3IB8A 2LTSA 3H67A 1RQ0A 4MP0A 1S95A 2JPAA 4NZVA 2JOXA 2ZBMA 1MF8A 3THNA 1UN6B 2IE4C 2EN8A 2K7IA 1I94E 2BCDA 3E7BA 2BBGA 4ZX2A 2IAEC 4UT3A 1A1JA 1II7A 5J28A 3H68A 1Z1BA 2MC5A 5IOHA 2B7VA 1YYKA 2EQ0A 4NHRA 4DR6E 2R17A 4DV2E 1DI2A 2DFJA 4BC7A 2JWOA 2I9IA 2DGCA 2UUBE 1KBPA 2EMYA 2M1SA 4M2ZA 1RC7A 4WWLA 2USHA 2DB2A 2GPIA 2EOFA 3ADLA 4KKZA 5JJTA 2EMAA 2DMIA 2HGHA 1F2IG 2D9HA 1HNWE 4H2IA 1HP1A 4TUGA 3LLHA 2V87A 3PSOA 3VK6A 4WSPA 2WDDA 4JI6E 1KYQA 2HHHE 2DXNA 1Z2WA 3QFNA 4JA7A 4DV0E 4F6MA 4NXME 1ZAAC 5DNYA 2KKNA 3J80C 3FGAC 4R03A 3EPJA 1YYOA 2UXDE 2EPCA 4JI3E 3E7AA 2EOMA 5EQVA 1X49A 2LV2A 4UT3B 3J7Yp 4X8WA 5INBA 3ZU0A 1AUIA 2MC6A 1TCOA 2EL5A 5AC5A 2WBUA 1WHNA 2EMIA 4R2SA 1A1HA 3H60A 1USHA 3ECRA 3MHSC 2ENCA 2YZTA 4JI7E 3VYXA 4FBQA 2EOJA 4R2EA 2YPNA 4DV7E 2YVTA 1U32A 2MKDA 4IYPC 2EM9A 4UT2A 2AHDA 3RL5A 2YTOA 4O24A 3BGHA 4RH8A 2B7TA 5IWAE 2EPPA 4IJDA 1IQOA 4OOGC 4DV1E 5GTUA 2NUEA 3P71C 1XZWA 4BHCA 4LF8E 2N3GA 3E0JA 2CT1A 4F9BB 2NYMC 2F8BA 5LMNE 1T4OA 4F6NA 2EOSA 2VRDA 4DSYA 1YPNA 2M4IA 2WBSA 4DR4E 2EPAA 3FIGA 5A6BA 3VHTB 2EORA 4DR2E 1DQ3A 3ADJA 4DV6E 3BIDA 2UUAE 2PRTA 3EPLA 4JI0E 2BDXA 2LRSA 4GKKE 3GVEA 1ZBTA 1DGCA 3N5UA 2ADRA 4I8OA 2RS7A 4B3RE 2DLQA 2E1MA 4BBYA 2L33A 1UHZA 3EGGA 4JI1E 1WRJA 1MEYC 4JI5E 3IVEA 4O4KA 2EQ1A 4X64E 4H2FA 2DIXA 2FTXB 3QG5C 3LL8A 2EM0A 4JI4E 4JI8E 3MHHC 4G9JA 4Q35B 4WYQB 3QFMA 1HR0E 2YEQA 2CPNA 2NA2A 4KZSA 4LU9A 4R2DA 4GZNC 3RMPA 1PJQA 5KL3A 1S8EA 1XMOE 2YT4A 2LUPB 4AQYE 1QHWA 3BBGA 1UILA 3HPSA 2EN3A 1HO5A 4JI2E 1GQEA 4O43A 3L00A 1FJMA 1S3NA 2YU8A 1XNRE 1Z2XA 2EOQA 1AAYA 5C1VA 2FV4B 2GJUA 5IV8B 5TSEA 2O8AA 3OTOE 2YTFA 3F6HA 4J8ZA 2B9DA 2RQLA 1GZ6A 3OMLA 1IBME 2LVHA 1NCSA 1XNQE 4F2JC 3IWBA 4R2QA 5KL4A 5BR8E 2RSIA 5AE2A 2ZM6E 3H64A 2WBTA 4M0VA 4TUIA 4DV5E 2HC5A 4JA9A 1N3GA 4UWQA 3IWCA 1IQSA 2YTJA 2NUGA 1IBKE 2L2NA 2RTXA 4HEIA 1PJTA 2ELZA 4OR9A 1EH8A 3C6KA 1A1FA 2ODRD 2ENAA 3K7WC
chains in the Genus database with same CATH topology
1W24A 1IT6A 1UF3A 3DSCA 4FBQA 3FLOA 2A22A 4DHLA 1T71A 1JK7A 2YVTA 1U32A 2NYLC 4IYPC 4UT2A 5F3WA 3TGHA 2AHDA 2NXFA 3AUZA 4KBPA 3RL5A 4O24A 2Z06A 2WDEA 2WDFA 3RQZA 3DSDA 4H1YP 3RL4A 3IVDA 3RL3A 2IE3C 4V0XA 4V0WA 5GTUA 2QFRA 3P71C 4O5GA 1SU1A 4H2BA 1XZWA 3CK2A 2WDCA 2XMOA 4FBKA 1G5BA 3E0JA 4FBWA 3H63A 2NYMC 4ZVZA 2ZOAA 2JOGA 1OI8A 4DSYA 1NNWA 4V0VA 2BQ8X 4DT2A 3ZTVA 1OIDA 3V4YA 3IB8A 3H67A 4MP0A 4Q7FA 1S95A 4NZVA 2ZBMA 4ORAA 2BDXA 1MF8A 3THNA 2IE4C 2Q8UA 3GVEA 2Z1AA 3QFKA 2BCDA 2NPPC 3E7BA 4ORCA 3H69A 3N5UA 4ZX2A 2IAEC 3H62B 3JYFA 4UT3A 3H66A 1II7A 5J28A 1S70A 2QJCA 1OIEA 1WARA 3EGGA 3H68A 5IOHA 3DW8C 2R17A 3IVEA 2CV9A 4O4KA 4LACC 1WAO1 4H2FA 3QG5C 3LL8A 2DFJA 1KBPA 4G9JA 4H2GA 1S3LA 4MOVA 3QFMA 3QFOA 2YEQA 3AV0A 1QFCA 4I5LC 4XPNA 4YKEA 1XM7A 3D03A 4LU9A 1S8EA 4WWLA 3H61A 5JPFA 4H1SA 1QHWA 2USHA 3C9FA 2P6BA 4LTYA 4FCXA 1HO5A 4HD0A 2HYOA 2HYPA 3K7VC 3PSNA 4O43A 1FJMA 4KKZA 5JJTA 1S3NA 1Z2XA 4H2IA 5JPEA 5C1VA 3ICFA 1HP1A 3EGHA 4TUGA 2GJUA 4ORBA 3PSOA 2O8AA 2DXLA 4MOYA 2WDDA 5HPEA 1HPUA 4F0ZA 3C5WC 1UTEA 1Z2WA 1T70A 2DXNA 3QFNA 4JA7A 2QFPA 4IL1A 2KKNA 4B2OA 3FGAC 5DNYA 2Z72A 1S3MA 3E7AA 1V73A 5EQVA 3THOB 2ZO9B 3HVQA 3H64A 4M0VA 4UT3B 4TUIA 1M63A 5INBA 4JA9A 3ZU0A 1AUIA 5B8IA 1TCOA 2HY1A 4UWQA 4J6OA 3IB7A 3T1IA 4OR9A 4I5NC 3H60A 1USHA 3KBPA 3K7WC 2O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W24 A;  1IT6 A;  1UF3 A;  3DSC A;  4FBQ A;  2A22 A;  4DHL A;  1T71 A;  1JK7 A;  2YVT A;  1U32 A;  2NYL C;  4IYP C;  4UT2 A;  5F3W A;  3TGH A;  2AHD A;  2NXF A;  3AUZ A;  4KBP A;  3RL5 A;  4O24 A;  2Z06 A;  2WDE A;  2WDF A;  3RQZ A;  4H1Y P;  3DSD A;  3RL4 A;  3IVD A;  3RL3 A;  2IE3 C;  4V0X A;  4V0W A;  5GTU A;  2QFR A;  3P71 C;  4O5G A;  1SU1 A;  4H2B A;  1XZW A;  3CK2 A;  2WDC A;  2XMO A;  4FBK A;  1G5B A;  4FBW A;  3H63 A;  2NYM C;  4ZVZ A;  2JOG A;  1OI8 A;  4DSY A;  1NNW A;  4V0V A;  2BQ8 X;  4DT2 A;  3ZTV A;  1OID A;  3V4Y A;  3IB8 A;  3H67 A;  4MP0 A;  4Q7F A;  1S95 A;  4NZV A;  2ZBM A;  4ORA A;  2BDX A;  1MF8 A;  3THN A;  2IE4 C;  2Q8U A;  3GVE A;  2Z1A A;  3QFK A;  2BCD A;  2NPP C;  3E7B A;  4ORC A;  3H69 A;  3N5U A;  4ZX2 A;  2IAE C;  3H62 B;  3JYF A;  4UT3 A;  3H66 A;  1II7 A;  5J28 A;  1S70 A;  2QJC A;  1OIE A;  1WAR A;  3EGG A;  3H68 A;  5IOH A;  3DW8 C;  2R17 A;  3IVE A;  2CV9 A;  4O4K A;  4LAC C;  1WAO 1;  4H2F A;  3QG5 C;  3LL8 A;  2DFJ A;  1KBP A;  4G9J A;  4H2G A;  1S3L A;  4MOV A;  3QFM A;  3QFO A;  3AV0 A;  1QFC A;  4I5L C;  4XPN A;  4YKE A;  1XM7 A;  4LU9 A;  1S8E A;  4WWL A;  3H61 A;  5JPF A;  4H1S A;  1QHW A;  2USH A;  3C9F A;  2P6B A;  4LTY A;  4FCX A;  1HO5 A;  4HD0 A;  2HYO A;  2HYP A;  3K7V C;  3PSN A;  4O43 A;  1FJM A;  4KKZ A;  5JJT A;  1S3N A;  1Z2X A;  4H2I A;  5JPE A;  5C1V A;  3ICF A;  1HP1 A;  3EGH A;  4TUG A;  2GJU A;  4ORB A;  3PSO A;  2O8A A;  4MOY A;  5HPE A;  2WDD A;  1HPU A;  4F0Z A;  3C5W C;  1UTE A;  1Z2W A;  1T70 A;  3QFN A;  4JA7 A;  2QFP A;  4IL1 A;  2KKN A;  4B2O A;  3FGA C;  5DNY A;  2Z72 A;  1S3M A;  3E7A A;  1V73 A;  5EQV A;  3THO B;  3HVQ A;  3H64 A;  4M0V A;  4UT3 B;  4TUI A;  1M63 A;  5INB A;  4JA9 A;  3ZU0 A;  1AUI A;  5B8I A;  1TCO A;  2HY1 A;  4UWQ A;  4J6O A;  3IB7 A;  3T1I A;  4OR9 A;  4I5N C;  3H60 A;  1USH A;  3KBP A;  3K7W C;  2O8G A; 
#chains in the Genus database with same CATH topology
 2KON A;  2EPN A;  4DR7 E;  3FLO A;  2L2M A;  2DRP A;  2UUC E;  1X48 A;  4DR5 E;  2NYL C;  5LLQ A;  2E5L E;  1HNZ E;  4B3M E;  4K0K E;  3DSD A;  2EMX A;  2EMF A;  4DUZ E;  1L4S A;  2LUQ A;  2V8Q B;  2EPR A;  4ZYG A;  5A6J A;  3RL3 A;  2EOY A;  2EMW A;  1A1K A;  2NUF A;  1RMD A;  2QFR A;  2JVA A;  4H2B A;  2LCE A;  1BB8 A;  4MLV A;  4RHB B;  4LF6 E;  1X6F A;  3CK2 A;  2UXB E;  1A1L A;  2N3H A;  3KWR A;  4DUY E;  1OI8 A;  3KZY A;  4BCA A;  4DKK A;  1YFH A;  3ADG A;  3J7A G;  4DR3 E;  5A6K A;  1AH5 A;  4OX9 E;  5A6A A;  3EPH A;  2EQ3 A;  3V4Y A;  2I13 A;  4WX9 A;  4LFA E;  2RSM A;  4N4R B;  2EOE A;  4WPY A;  4B3T E;  4LF9 E;  2Q8U A;  2NPP C;  4ORC A;  3H69 A;  2EM5 A;  3H62 B;  2EJ4 A;  2EL4 A;  2M9A A;  5IT9 C;  3H66 A;  1NEI A;  2EPZ A;  2CTD A;  4Q28 A;  4R2R A;  5AE1 A;  1OIE A;  1WAR A;  2EMG A;  3DW8 C;  2CV9 A;  2YTG A;  2EWL A;  2WCC 3;  4P78 A;  2MKN A;  1EH6 A;  2J7J A;  2YRM A;  2V89 A;  1FKA E;  1S3L A;  2YTN A;  4MOV A;  2EM3 A;  4R2C A;  1QFC A;  4XPN A;  4YKE A;  2MDR A;  1XM7 A;  1X3C A;  2EL6 A;  1TN9 A;  1N33 E;  1PDA A;  4X9J A;  3H61 A;  3HXL A;  4H1S A;  5A2Q C;  2L3J A;  2P6B A;  4LTY A;  4F9A B;  4ZYE A;  1QNT A;  5A6B D;  2HYO A;  1N36 E;  2HYP A;  3K7V C;  1XMQ E;  2EOI A;  4YHH E;  1ZU1 A;  2EOZ A;  3F6G A;  4WFT A;  1JK2 A;  2L6M A;  4NXN E;  3EGH A;  5IXM B;  1IBL E;  1FJG E;  4MOY A;  2DXL A;  2YWQ A;  4M30 A;  2VQF E;  1A1I A;  1HPU A;  2LTR A;  1A1G A;  5HPE A;  5KL7 A;  2YTI A;  3M99 B;  1T4L B;  1B69 A;  3C5W C;  1P47 A;  2L2K B;  4F0Z A;  2WZO A;  2LJH A;  2L8T A;  4DV3 E;  2EPL X;  2DLK A;  2Z72 A;  5KL2 A;  1GTK A;  1ZR9 A;  4JYA E;  1YUJ A;  4R2A A;  2CSH A;  3KZZ A;  4KWY A;  3THO B;  1N32 E;  2ZO9 B;  3HTX A;  4GEQ B;  1M63 A;  2LE2 A;  5B8I A;  2HY1 A;  1WXR A;  4J6O A;  2NAB A;  5CFF E;  1HNX E;  4LF4 E;  5FLX C;  3IB7 A;  3T1I A;  2JP9 A;  3KBP A;  2YSO A;  5AC4 A;  1W24 A;  1UF3 A;  3HQ1 A;  1T39 A;  2JY9 A;  4LFC E;  2EPO A;  2A22 A;  3HPZ A;  1PJS A;  2GHF A;  4X65 E;  3J81 C;  1X5W A;  2L92 A;  1UBD C;  4DHL A;  5F3W A;  1WJP A;  2YRK A;  3AUZ A;  4KBP A;  2Z06 A;  1EH7 A;  2WDF A;  3BF2 A;  3JU0 A;  4H1Y P;  1WHQ A;  2LJU A;  2EMZ A;  2KHX A;  3IVD A;  2EM2 A;  2EM8 A;  2IE3 C;  5A69 A;  3ADI A;  4V0X A;  2G7H A;  4V0W A;  2DSY A;  5LL6 R;  1EKZ A;  4O5G A;  1ZBQ A;  2RS6 A;  1X6E A;  4FBK A;  2YU5 A;  2VF1 A;  4R8O A;  4WXC A;  4ZVZ A;  4F54 A;  2JOG A;  1BBG A;  2YTD A;  1NNW A;  4F9C B;  2R76 A;  2YTQ A;  4ZYD A;  4V0V A;  2EMC A;  4DT2 A;  4ZYH A;  3T1Y E;  1OID A;  2B3T B;  2JXP A;  2RPC A;  2LT7 A;  2F4V E;  4Q7F A;  2DMY A;  1MGT A;  1IMU A;  4ORA A;  3K6Q A;  1YUI A;  2ODR C;  3UK3 C;  2EP3 A;  2Z1A A;  2K4V A;  3QFK A;  2EOX A;  1JK1 A;  4MLQ A;  5AE3 A;  1X47 A;  2EM7 A;  1J26 A;  3JYF A;  1G2D C;  1S70 A;  2QJC A;  1X6H A;  2KOU A;  2GLI A;  2VE7 C;  4LAC C;  2YTP A;  1WAO 1;  3JTZ A;  1TF3 A;  2EOH A;  4FK5 C;  2E72 A;  2EM4 A;  2LMZ A;  4P7D A;  4H2G A;  3QFO A;  2HJJ A;  3AV0 A;  2R1F A;  3H09 A;  4I5L C;  1J5E E;  3D03 A;  5KL6 A;  1QU6 A;  2JYA A;  2V86 A;  2JR1 A;  5ADZ A;  2L3C A;  5JPF A;  1YSA C;  3C9F A;  1T4N A;  4FCX A;  2IHR 1;  2VQE E;  3ZOQ B;  2FGG A;  4HD0 A;  2EPM X;  4L5N C;  2V83 A;  4M9V C;  2EMB A;  3PSN A;  1G2F C;  1N34 E;  4X62 E;  2EN1 A;  5JPE A;  4DMI A;  3ICF A;  4ORB A;  2N8X A;  1LLM C;  4LF5 E;  3C4B A;  4DV4 E;  2EOO A;  1T70 A;  2EPU A;  1UTE A;  2QFP A;  4IL1 A;  3C4T A;  2EM6 A;  3DJW A;  1KJK A;  4B2O A;  2EMK A;  2EN4 A;  2EPK X;  1S3M A;  4GKJ E;  3LML A;  3T1H E;  1V73 A;  4B3S E;  3C6M A;  2ENH A;  2EMH A;  1O0W A;  3HVQ A;  4HTG A;  3VYY A;  4LFB E;  1PKP A;  2H36 X;  3TQM A;  1T38 A;  2LO3 A;  2LBS B;  5LMU E;  2EZ6 A;  4DR1 E;  1SR9 A;  4I5N C;  2UU9 E;  2EN7 A;  2JOB A;  2MDG A;  2M7Q A;  2O8G A;  1IT6 A;  4X66 E;  3DSC A;  2EPX A;  1TF6 A;  1T71 A;  4BHB A;  2V85 A;  1JK7 A;  3DF6 A;  4R2P A;  3TGH A;  4WXD A;  2NXF A;  2YRH A;  2A25 A;  1YYW A;  2WDE A;  4WSG A;  3RQZ A;  2EML A;  5AAS A;  5KL5 A;  4IS1 C;  3RL4 A;  4YY3 E;  2EN2 A;  4KHP E;  4L8N A;  3MSW A;  2UXC E;  1SFE A;  1SU1 A;  2YSP A;  2YTE A;  2WDC A;  2XMO A;  1G5B A;  2BB8 A;  2V88 A;  4BS9 A;  2EE8 A;  3H63 A;  4FBW A;  5T6J A;  2ZOA A;  3EQ1 A;  1STU A;  3JAM C;  4JV5 E;  4BMJ A;  2EN6 A;  3EPK A;  4BC9 A;  2ELY A;  1YZ9 A;  1BBO A;  2BQ8 X;  4LF7 E;  3ZTV A;  3IWD A;  3P1X A;  3IB8 A;  2LTS A;  3H67 A;  1RQ0 A;  4MP0 A;  1S95 A;  2JPA A;  4NZV A;  2JOX A;  2ZBM A;  1MF8 A;  3THN A;  1UN6 B;  2IE4 C;  2EN8 A;  2K7I A;  1I94 E;  2BCD A;  3E7B A;  2BBG A;  4ZX2 A;  2IAE C;  4UT3 A;  1A1J A;  1II7 A;  5J28 A;  3H68 A;  1Z1B A;  2MC5 A;  5IOH A;  2B7V A;  1YYK A;  2EQ0 A;  4NHR A;  4DR6 E;  2R17 A;  4DV2 E;  1DI2 A;  2DFJ A;  4BC7 A;  2JWO A;  2I9I A;  2DGC A;  2UUB E;  1KBP A;  2EMY A;  2M1S A;  4M2Z A;  1RC7 A;  4WWL A;  2USH A;  2DB2 A;  2GPI A;  2EOF A;  3ADL A;  4KKZ A;  5JJT A;  2EMA A;  2DMI A;  2HGH A;  1F2I G;  2D9H A;  1HNW E;  4H2I A;  1HP1 A;  4TUG A;  3LLH A;  2V87 A;  3PSO A;  3VK6 A;  4WSP A;  2WDD A;  4JI6 E;  1KYQ A;  2HHH E;  2DXN A;  1Z2W A;  3QFN A;  4JA7 A;  4DV0 E;  4F6M A;  4NXM E;  1ZAA C;  5DNY A;  2KKN A;  3J80 C;  3FGA C;  4R03 A;  3EPJ A;  1YYO A;  2UXD E;  2EPC A;  4JI3 E;  3E7A A;  2EOM A;  5EQV A;  1X49 A;  2LV2 A;  4UT3 B;  3J7Y p;  4X8W A;  5INB A;  3ZU0 A;  1AUI A;  2MC6 A;  1TCO A;  2EL5 A;  5AC5 A;  2WBU A;  1WHN A;  2EMI A;  4R2S A;  1A1H A;  3H60 A;  1USH A;  3ECR A;  3MHS C;  2ENC A;  2YZT A;  4JI7 E;  3VYX A;  4FBQ A;  2EOJ A;  4R2E A;  2YPN A;  4DV7 E;  2YVT A;  1U32 A;  2MKD A;  4IYP C;  2EM9 A;  4UT2 A;  2AHD A;  3RL5 A;  2YTO A;  4O24 A;  3BGH A;  4RH8 A;  2B7T A;  5IWA E;  2EPP A;  4IJD A;  1IQO A;  4OOG C;  4DV1 E;  5GTU A;  2NUE A;  3P71 C;  1XZW A;  4BHC A;  4LF8 E;  2N3G A;  3E0J A;  2CT1 A;  4F9B B;  2NYM C;  2F8B A;  5LMN E;  1T4O A;  4F6N A;  2EOS A;  2VRD A;  4DSY A;  1YPN A;  2M4I A;  2WBS A;  4DR4 E;  2EPA A;  3FIG A;  5A6B A;  3VHT B;  2EOR A;  4DR2 E;  1DQ3 A;  3ADJ A;  4DV6 E;  3BID A;  2UUA E;  2PRT A;  3EPL A;  4JI0 E;  2BDX A;  2LRS A;  4GKK E;  3GVE A;  1ZBT A;  1DGC A;  3N5U A;  2ADR A;  4I8O A;  2RS7 A;  4B3R E;  2DLQ A;  2E1M A;  4BBY A;  2L33 A;  1UHZ A;  3EGG A;  4JI1 E;  1WRJ A;  1MEY C;  4JI5 E;  3IVE A;  4O4K A;  2EQ1 A;  4X64 E;  4H2F A;  2DIX A;  2FTX B;  3QG5 C;  3LL8 A;  2EM0 A;  4JI4 E;  4JI8 E;  3MHH C;  4G9J A;  4Q35 B;  4WYQ B;  3QFM A;  1HR0 E;  2YEQ A;  2CPN A;  2NA2 A;  4KZS A;  4LU9 A;  4R2D A;  4GZN C;  3RMP A;  1PJQ A;  5KL3 A;  1S8E A;  1XMO E;  2YT4 A;  2LUP B;  4AQY E;  1QHW A;  3BBG A;  1UIL A;  3HPS A;  2EN3 A;  1HO5 A;  4JI2 E;  1GQE A;  4O43 A;  3L00 A;  1FJM A;  1S3N A;  2YU8 A;  1XNR E;  1Z2X A;  2EOQ A;  1AAY A;  5C1V A;  2FV4 B;  2GJU A;  5IV8 B;  5TSE A;  2O8A A;  3OTO E;  2YTF A;  3F6H A;  4J8Z A;  2B9D A;  2RQL A;  1GZ6 A;  3OML A;  1IBM E;  2LVH A;  1NCS A;  1XNQ E;  4F2J C;  3IWB A;  4R2Q A;  5KL4 A;  5BR8 E;  2RSI A;  5AE2 A;  2ZM6 E;  3H64 A;  2WBT A;  4M0V A;  4TUI A;  4DV5 E;  2HC5 A;  4JA9 A;  1N3G A;  4UWQ A;  3IWC A;  1IQS A;  2YTJ A;  2NUG A;  1IBK E;  2L2N A;  2RTX A;  4HEI A;  1PJT A;  2ELZ A;  4OR9 A;  1EH8 A;  3C6K A;  1A1F A;  2ODR D;  2ENA A;  3K7W C; 
#chains in the Genus database with same CATH homology
 1W24 A;  1IT6 A;  1UF3 A;  3DSC A;  4FBQ A;  3FLO A;  2A22 A;  4DHL A;  1T71 A;  1JK7 A;  2YVT A;  1U32 A;  2NYL C;  4IYP C;  4UT2 A;  5F3W A;  3TGH A;  2AHD A;  2NXF A;  3AUZ A;  4KBP A;  3RL5 A;  4O24 A;  2Z06 A;  2WDE A;  2WDF A;  3RQZ A;  3DSD A;  4H1Y P;  3RL4 A;  3IVD A;  3RL3 A;  2IE3 C;  4V0X A;  4V0W A;  5GTU A;  2QFR A;  3P71 C;  4O5G A;  1SU1 A;  4H2B A;  1XZW A;  3CK2 A;  2WDC A;  2XMO A;  4FBK A;  1G5B A;  3E0J A;  4FBW A;  3H63 A;  2NYM C;  4ZVZ A;  2ZOA A;  2JOG A;  1OI8 A;  4DSY A;  1NNW A;  4V0V A;  2BQ8 X;  4DT2 A;  3ZTV A;  1OID A;  3V4Y A;  3IB8 A;  3H67 A;  4MP0 A;  4Q7F A;  1S95 A;  4NZV A;  2ZBM A;  4ORA A;  2BDX A;  1MF8 A;  3THN A;  2IE4 C;  2Q8U A;  3GVE A;  2Z1A A;  3QFK A;  2BCD A;  2NPP C;  3E7B A;  4ORC A;  3H69 A;  3N5U A;  4ZX2 A;  2IAE C;  3H62 B;  3JYF A;  4UT3 A;  3H66 A;  1II7 A;  5J28 A;  1S70 A;  2QJC A;  1OIE A;  1WAR A;  3EGG A;  3H68 A;  5IOH A;  3DW8 C;  2R17 A;  3IVE A;  2CV9 A;  4O4K A;  4LAC C;  1WAO 1;  4H2F A;  3QG5 C;  3LL8 A;  2DFJ A;  1KBP A;  4G9J A;  4H2G A;  1S3L A;  4MOV A;  3QFM A;  3QFO A;  2YEQ A;  3AV0 A;  1QFC A;  4I5L C;  4XPN A;  4YKE A;  1XM7 A;  3D03 A;  4LU9 A;  1S8E A;  4WWL A;  3H61 A;  5JPF A;  4H1S A;  1QHW A;  2USH A;  3C9F A;  2P6B A;  4LTY A;  4FCX A;  1HO5 A;  4HD0 A;  2HYO A;  2HYP A;  3K7V C;  3PSN A;  4O43 A;  1FJM A;  4KKZ A;  5JJT A;  1S3N A;  1Z2X A;  4H2I A;  5JPE A;  5C1V A;  3ICF A;  1HP1 A;  3EGH A;  4TUG A;  2GJU A;  4ORB A;  3PSO A;  2O8A A;  2DXL A;  4MOY A;  2WDD A;  5HPE A;  1HPU A;  4F0Z A;  3C5W C;  1UTE A;  1Z2W A;  1T70 A;  2DXN A;  3QFN A;  4JA7 A;  2QFP A;  4IL1 A;  2KKN A;  4B2O A;  3FGA C;  5DNY A;  2Z72 A;  1S3M A;  3E7A A;  1V73 A;  5EQV A;  3THO B;  2ZO9 B;  3HVQ A;  3H64 A;  4M0V A;  4UT3 B;  4TUI A;  1M63 A;  5INB A;  4JA9 A;  3ZU0 A;  1AUI A;  5B8I A;  1TCO A;  2HY1 A;  4UWQ A;  4J6O A;  3IB7 A;  3T1I A;  4OR9 A;  4I5N C;  3H60 A;  1USH A;  3KBP A;  3K7W C;  2O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...