4O4KA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
total genus 103
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o4kA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o4kA01
3DSDA 3H66A 3K7WC 1Z2WA 4I5NC 3THOB 5J28A 3QFOA 1AUIA 1S8EA 2JOGA 1T70A 4DT2A 1TCOA 1W24A 1FJMA 4O43A 3LL8A 4FCXA 3GVEA 1HPUA 2BQ8X 1OI8A 4ORAA 4LTYA 4DSYA 4KKZA 2Z72A 3PSNA 4H2BA 3IVEA 1OIEA 3DW8C 3H68A 3E7AA 4KBPA 1T71A 3DSCA 4NZVA 1IT6A 1XZWA 3IVDA 1SU1A 5IOHA 2BCDA 4H1SA 1HP1A 1QHWA 2NPPC 4I5LC 3H62B 5F3WA 3QFKA 3RL5A 1V73A 3ZU0A 2O8AA 3EGHA 2KKNA 4JA9A 2Z06A 2YVTA 3H61A 2AHDA 4M0VA 3FGAC 4V0WA 4DHLA 3QFMA 3P71C 2NYMC 3H63A 4XPNA 2NYLC 3H67A 2GJUA 5DNYA 1KBPA 3TGHA 5HPEA 1OIDA 5EQVA 3THNA 1S70A 3IB7A 2BDXA 1WAO1 2QFRA 3H60A 2O8GA 4G9JA 4UWQA 2WDEA 4TUGA 1S3MA 4H2FA 1M63A 1XM7A 1USHA 1Z2XA 4FBKA 1II7A 3QG5C 4UT3B 3PSOA 2HYPA 2QJCA 1S3NA 3ICFA 4YKEA 3QFNA 2USHA 3H64A 4V0VA 3C9FA 2HY1A 3EGGA 4TUIA 3RQZA 3KBPA 4O5GA 4MOYA 3RL3A 2QFPA 4FBQA 5JJTA 4OR9A 4UT2A 4IYPC 4UT3A 3RL4A 5JPEA 2WDCA 4LU9A 2ZBMA 4H1YP 1QFCA 4O4KA 1JK7A 2XMOA 3E7BA 4H2GA 4IL1A 2IE4C 2P6BA 4MP0A 4ORCA 1WARA 2Z1AA 4H2IA 4FBWA 3ZTVA 2A22A 4JA7A 4V0XA 3T1IA 5INBA 2NXFA 1U32A 4B2OA 1S3LA 4ZX2A 3V4YA 2R17A 4ORBA 2WDFA 1NNWA 2CV9A 3AV0A 1UF3A 5C1VA 3C5WC 3CK2A 2Q8UA 4F0ZA 3H69A 5GTUA 3HVQA 3AUZA 1HO5A 1UTEA 1G5BA 2HYOA 4WWLA 1S95A 4LACC 1MF8A 4O24A 5B8IA 2DFJA 3N5UA 4MOVA 2WDDA 4HD0A 3IB8A 3JYFA 5JPFA 3K7VC 2IE3C 4ZVZA 4Q7FA 4J6OA 2IAEC
chains in the Genus database with same CATH superfamily
4IS1C 2NUFA 5LLQA 1TF6A 5IXMB 3K7WC 1Z2WA 5KL7A 2EMCA 2F4VE 3ADJA 5TSEA 1PDAA 1T70A 2PRTA 2NABA 5IV8B 3OTOE 4DT2A 1W24A 1ZBTA 2LCEA 1UHZA 2BB8A 4DR7E 4R2RA 3FLOA 3DF6A 2K4VA 1A1GA 3LL8A 2DSYA 3KWRA 4Q28A 4F2JC 3ZOQB 2YTNA 1HNWE 2EM9A 5IT9C 2L33A 1OI8A 1NCSA 4DSYA 3HPZA 4AQYE 3TQMA 3DW8C 4X64E 2EM2A 1T71A 3DSCA 5KL2A 1LLMC 2EM7A 4H1SA 5KL5A 1YPNA 2UUBE 1V73A 3RL5A 4R8OA 2EOEA 2I13A 1ZR9A 1TF3A 4NXNE 4KHPE 4ZYDA 4KWYA 4JI6E 2Z06A 2AHDA 4L5NC 2UXCE 2RQLA 2EMLA 3L00A 4JI4E 4DHLA 3JU0A 1BB8A 3C6MA 2LT7A 4XPNA 2LVHA 2NYLC 3RMPA 2GJUA 4BHBA 2EM4A 5HPEA 5A6BD 4B3RE 4WX9A 3EPKA 1QU6A 2V8QB 1A1JA 2EPPA 2EMHA 1N34E 1WAO1 4I8OA 4X8WA 2O8GA 3H60A 3IB7A 4R2AA 4G9JA 4UWQA 5KL4A 2ENAA 2EPCA 3DJWA 1II7A 2RSMA 1WHQA 4ZYEA 4GKJE 3ICFA 3QFNA 2ZO9B 3C9FA 2UU9E 4TUIA 1X49A 3RQZA 2YPNA 2EQ3A 3KBPA 5AC4A 2M7QA 2EWLA 5JJTA 5AC5A 4OR9A 4UT2A 4X62E 4X66E 4GEQB 4RH8A 2B7TA 2EN4A 2ENCA 3RL4A 2WDCA 2J7JA 2HHHE 1DQ3A 1L4SA 2LTSA 3MSWA 2WBUA 1X5WA 2N3GA 4Q35B 2EMFA 4B3SE 4H2GA 4RHBB 2FTXB 4V0XA 5KL6A 3HXLA 4B2OA 2A25A 4ZX2A 2EPZA 2R17A 2E1MA 3VYYA 4DUZE 4ORBA 1IBKE 2WDFA 2EL6A 2RS6A 1ZU1A 4DR5E 2FGGA 1NEIA 4DV2E 2B9DA 2Q8UA 2EMIA 2G7HA 1UTEA 2YRHA 2HYOA 4WWLA 2LV2A 2JP9A 2EMZA 3JAMC 2DLQA 5ADZA 2DFJA 3N5UA 3IB8A 3JYFA 3K7VC 2EN1A 1KJKA 4Q7FA 4M0VA 2IAEC 2VRDA 4DR2E 4R2CA 4DR4E 3H66A 2ZM6E 4JI0E 1UBDC 4P78A 1IMUA 2YT4A 1YUJA 2YTDA 4NXME 2LMZA 2JYAA 4O43A 1J26A 1P47A 2MDRA 2LO3A 2YRKA 4F54A 1T39A 4KKZA 2DLKA 3H68A 4WSPA 2ELZA 3HTXA 2RPCA 1IQSA 4NZVA 1IT6A 4LF5E 1SU1A 3IVDA 4HEIA 4BC9A 1WXRA 5A6KA 2RTXA 2MKNA 4BBYA 4JI2E 4I5LC 3KZYA 2FV4B 2V86A 2DIXA 2YTQA 2EOFA 3F6HA 1WRJA 4WFTA 2L3JA 2HGHA 1BBOA 4DV6E 4JV5E 2EQ0A 2L2MA 5AE3A 2EE8A 1JK1A 2KKNA 1PJQA 2EN7A 2DXNA 3F6GA 2B3TB 3FGAC 2WZOA 2EORA 3QFMA 3P71C 2NYMC 3IWDA 2YSPA 4DR6E 4WXDA 2EQ1A 2EM0A 1JK2A 3H09A 2E72A 4DV0E 2EPNA 1OIDA 2RS7A 5CFFE 4TUGA 2LUQA 1XMOE 2WDEA 1AAYA 4LFBE 1EH6A 1AH5A 1T38A 4DMIA 3EPHA 4FBKA 3QG5C 3PSOA 2HYPA 1TN9A 3J7Yp 2D9HA 1UILA 2VE7C 2EN8A 1YZ9A 1N36E 1A1KA 4R2EA 4LF6E 4DV7E 2YTOA 2V88A 4FBQA 3RL3A 4OOGC 1SR9A 1A1LA 4UT3A 1O0WA 1YYWA 1T4LB 2EM6A 4LU9A 1RC7A 4H1YP 4BCAA 4O4KA 1T4OA 2EOQA 4LFAE 4L8NA 1ZBQA 2XMOA 2UXDE 3VYXA 2EOJA 2EOYA 2B7VA 2MKDA 1DI2A 2UUCE 4WPYA 1RMDA 3C4TA 5LL6R 2NUGA 4MP0A 1WARA 4ORCA 2A22A 2DMIA 4GZNC 1S3LA 2V83A 2JPAA 3BBGA 3V4YA 4GKKE 2WCC3 2CV9A 2YTEA 1UF3A 5C1VA 3C5WC 3JTZA 3CK2A 4DV5E 5AASA 2EL5A 3EPJA 3HVQA 5GTUA 1HO5A 1GTKA 1EH7A 1PJSA 1RQ0A 3EQ1A 4F6MA 1XMQE 1X6FA 4MOVA 4HD0A 2L92A 2JVAA 5JPFA 2IE3C 1X47A 2L2KB 4ZYGA 4WSGA 4LF4E 2EP3A 4I5NC 2EPLX 3QFOA 3LLHA 2V89A 1AUIA 3VK6A 3D03A 1S8EA 2JOGA 2KOUA 1TCOA 2LJHA 1SFEA 4DR3E 1FJMA 2HC5A 1GZ6A 2ELYA 5FLXC 3J80C 5AE1A 1FJGE 2JOXA 3LMLA 4K0KE 2NA2A 5IWAE 2F8BA 3E0JA 3GVEA 2EM3A 5AE2A 5A6AA 2R1FA 2LJUA 3KZZA 4ORAA 4LTYA 2EOMA 2Z72A 1N3GA 1X3CA 1G2DC 3E7AA 5IOHA 2GPIA 2BCDA 1HP1A 2NPPC 3P1XA 5F3WA 2EN2A 3QFKA 1J5EE 2ENHA 4F9AB 3HPSA 3EGHA 4LFCE 4WXCA 2LTRA 2YVTA 1WJPA 3H61A 2CPNA 2YTGA 4V0WA 1HR0E 3BF2A 2H36X 2I9IA 1G2FC 4DKKA 5DNYA 3ADLA 3OMLA 2CT1A 2EOOA 5EQVA 4DV1E 4BHCA 1S70A 4MLVA 2BDXA 2QFRA 1QNTA 2YTIA 3C6KA 3BGHA 1S3MA 4H2FA 2E5LE 4JI7E 2EPKX 3ECRA 1USHA 1IBME 2QJCA 4YKEA 2USHA 4V0VA 1MEYC 1YFHA 4O5GA 2L6MA 2V87A 4MOYA 1B69A 4R2PA 2M1SA 4YHHE 4F9CB 1ZAAC 4LF8E 4R2QA 2EPUA 4F6NA 2DMYA 3HQ1A 1EKZA 4BS9A 2BBGA 1Z1BA 2NUEA 1GQEA 3BIDA 4IL1A 4NHRA 4JI8E 2LUPB 2P6BA 1N33E 4M30A 4H2IA 4FBWA 4MLQA 4JA7A 3ADGA 2M4IA 1N32E 4OX9E 1YYKA 5INBA 1U32A 2CSHA 2LE2A 2N8XA 2EOHA 1A1FA 1A1IA 2JY9A 2K7IA 4FK5C 3AV0A 2M9AA 4YY3E 2EOZA 1STUA 1X48A 1YYOA 4F0ZA 1IQOA 2EM8A 2L3CA 2EMXA 3AUZA 3T1HE 1MGTA 1YSAC 4B3TE 1S95A 2MDGA 1MF8A 5A69A 2GLIA 2HJJA 2IHR1 2LRSA 2UXBE 3ADIA 4N4RB 4J6OA 2EZ6A 2EMYA 4F9BB 2MC6A 3DSDA 4R2SA 3THOB 2MC5A 5J28A 4DR1E 4LF7E 1PJTA 4KZSA 1KYQA 4WYQB 1FKAE 5T6JA 2KONA 5A6BA 2EPXA 4BMJA 5A6JA 2EMAA 2YTJA 2RSIA 2EM5A 2EPRA 5LMNE 4IJDA 4R2DA 4FCXA 1HPUA 2KHXA 4R03A 4ZVZA 2BQ8X 4ZYHA 3PSNA 4H2BA 3IVEA 1OIEA 4HTGA 4KBPA 2VQEE 1HNXE 1XZWA 2EMBA 2JOBA 2WBSA 2CTDA 2YEQA 1BBGA 2DXLA 4LF9E 2EPAA 1QHWA 2JR1A 3H62B 2YSOA 2YTPA 1X6EA 2EPOA 2UUAE 3ZU0A 1WHNA 1XNQE 2O8AA 2EL4A 2YRMA 4DV3E 4JA9A 2ODRC 1DGCA 2L8TA 3H63A 2L2NA 3J81C 3H67A 4BC7A 2EOSA 1KBPA 3TGHA 5LMUE 1YUIA 2JXPA 4DUYE 3THNA 2LBSB 3MHHC 4J8ZA 1M63A 1XM7A 1F2IG 2EMGA 1Z2XA 2YU5A 5KL3A 2DB2A 4UT3B 2WBTA 4DV4E 4M2ZA 1S3NA 1T4NA 3H64A 2HY1A 3EGGA 4JI5E 2V85A 2QFPA 4IYPC 3IWBA 1EH8A 2EOXA 2VF1A 4JI3E 3J7AG 5JPEA 4X65E 1PKPA 2ZBMA 3MHSC 1QFCA 3UK3C 1UN6B 2EMWA 1XNRE 1JK7A 3E7BA 3K6QA 2R76A 4JYAE 2DRPA 2ZOAA 2YTFA 2EOIA 2EMKA 3IWCA 3VHTB 5A2QC 1IBLE 2IE4C 2EPMX 2Z1AA 4M9VC 2EN3A 5BR8E 3ZTVA 4P7DA 3T1IA 2NXFA 2ADRA 2EN6A 2ODRD 4B3ME 2YU8A 1I94E 3C4BA 1X6HA 1NNWA 2VQFE 2N3HA 4JI1E 2YWQA 3H69A 2GHFA 1G5BA 2JWOA 1A1HA 3FIGA 4LACC 2YZTA 3EPLA 3T1YE 2EJ4A 4O24A 1HNZE 5B8IA 2WDDA 2DGCA 4X9JA 3M99B
chains in the Genus database with same CATH topology
3DSDA 3H66A 3K7WC 1Z2WA 4I5NC 3THOB 5J28A 3QFOA 1AUIA 3D03A 1S8EA 2JOGA 1T70A 4DT2A 1TCOA 1W24A 1FJMA 3FLOA 4O43A 3LL8A 3E0JA 3GVEA 4FCXA 1HPUA 2BQ8X 1OI8A 4ORAA 4LTYA 4DSYA 4KKZA 2Z72A 3PSNA 4H2BA 3IVEA 1OIEA 3DW8C 3H68A 3E7AA 4KBPA 1T71A 3DSCA 4NZVA 1IT6A 1XZWA 3IVDA 1SU1A 5IOHA 2YEQA 2BCDA 2DXLA 4H1SA 1HP1A 1QHWA 2NPPC 4I5LC 3H62B 5F3WA 3QFKA 3RL5A 1V73A 3ZU0A 2O8AA 3EGHA 2KKNA 4JA9A 2Z06A 2YVTA 3H61A 2AHDA 2DXNA 4M0VA 3FGAC 4V0WA 4DHLA 3QFMA 3P71C 2NYMC 3H63A 4XPNA 2NYLC 3H67A 2GJUA 5DNYA 1KBPA 3TGHA 5HPEA 1OIDA 5EQVA 3THNA 1S70A 3IB7A 2BDXA 1WAO1 2QFRA 3H60A 2O8GA 4G9JA 4UWQA 2WDEA 4TUGA 1S3MA 4H2FA 1M63A 1XM7A 1USHA 1Z2XA 4FBKA 1II7A 3QG5C 4UT3B 3PSOA 2HYPA 2QJCA 1S3NA 3ICFA 4YKEA 3QFNA 2USHA 2ZO9B 3H64A 3C9FA 4V0VA 2HY1A 3EGGA 4TUIA 3RQZA 3KBPA 4O5GA 4MOYA 3RL3A 2QFPA 4FBQA 5JJTA 4OR9A 4UT2A 4IYPC 4UT3A 3RL4A 5JPEA 2WDCA 4LU9A 2ZBMA 4H1YP 1QFCA 4O4KA 1JK7A 2XMOA 3E7BA 2ZOAA 4H2GA 4IL1A 2IE4C 2P6BA 4MP0A 4ORCA 1WARA 2Z1AA 4H2IA 4FBWA 3ZTVA 2A22A 4JA7A 4V0XA 3T1IA 5INBA 2NXFA 1U32A 4B2OA 1S3LA 4ZX2A 3V4YA 2R17A 4ORBA 2WDFA 1NNWA 2CV9A 3AV0A 1UF3A 5C1VA 3C5WC 3CK2A 2Q8UA 4F0ZA 3H69A 5GTUA 3HVQA 3AUZA 1HO5A 1UTEA 1G5BA 2HYOA 4WWLA 1S95A 4LACC 1MF8A 4O24A 5B8IA 2DFJA 3N5UA 4MOVA 4HD0A 2WDDA 3IB8A 3JYFA 5JPFA 3K7VC 2IE3C 4ZVZA 4Q7FA 4J6OA 2IAEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSD A;  3H66 A;  3K7W C;  1Z2W A;  4I5N C;  3THO B;  5J28 A;  3QFO A;  1AUI A;  1S8E A;  2JOG A;  1T70 A;  4DT2 A;  1TCO A;  1W24 A;  1FJM A;  4O43 A;  3LL8 A;  4FCX A;  3GVE A;  1HPU A;  2BQ8 X;  1OI8 A;  4ORA A;  4LTY A;  4DSY A;  4KKZ A;  2Z72 A;  3PSN A;  4H2B A;  3IVE A;  1OIE A;  3DW8 C;  3H68 A;  3E7A A;  4KBP A;  1T71 A;  3DSC A;  4NZV A;  1IT6 A;  1XZW A;  3IVD A;  1SU1 A;  5IOH A;  2BCD A;  4H1S A;  1HP1 A;  1QHW A;  2NPP C;  4I5L C;  3H62 B;  5F3W A;  3QFK A;  3RL5 A;  1V73 A;  3ZU0 A;  2O8A A;  3EGH A;  2KKN A;  4JA9 A;  2Z06 A;  2YVT A;  3H61 A;  2AHD A;  4M0V A;  3FGA C;  4V0W A;  4DHL A;  3QFM A;  3P71 C;  2NYM C;  3H63 A;  4XPN A;  2NYL C;  3H67 A;  2GJU A;  5DNY A;  1KBP A;  3TGH A;  5HPE A;  1OID A;  5EQV A;  3THN A;  1S70 A;  3IB7 A;  2BDX A;  1WAO 1;  2QFR A;  3H60 A;  2O8G A;  4G9J A;  4UWQ A;  2WDE A;  4TUG A;  1S3M A;  4H2F A;  1M63 A;  1XM7 A;  1USH A;  1Z2X A;  4FBK A;  1II7 A;  3QG5 C;  4UT3 B;  3PSO A;  2HYP A;  2QJC A;  1S3N A;  3ICF A;  4YKE A;  3QFN A;  2USH A;  3H64 A;  4V0V A;  3C9F A;  2HY1 A;  3EGG A;  4TUI A;  3RQZ A;  3KBP A;  4O5G A;  4MOY A;  3RL3 A;  2QFP A;  4FBQ A;  5JJT A;  4OR9 A;  4UT2 A;  4IYP C;  4UT3 A;  3RL4 A;  5JPE A;  2WDC A;  4LU9 A;  2ZBM A;  4H1Y P;  1QFC A;  4O4K A;  1JK7 A;  2XMO A;  3E7B A;  4H2G A;  4IL1 A;  2IE4 C;  2P6B A;  4MP0 A;  4ORC A;  1WAR A;  2Z1A A;  4H2I A;  4FBW A;  3ZTV A;  2A22 A;  4JA7 A;  4V0X A;  3T1I A;  5INB A;  2NXF A;  1U32 A;  4B2O A;  1S3L A;  4ZX2 A;  3V4Y A;  2R17 A;  4ORB A;  2WDF A;  1NNW A;  2CV9 A;  3AV0 A;  1UF3 A;  5C1V A;  3C5W C;  3CK2 A;  2Q8U A;  4F0Z A;  3H69 A;  5GTU A;  3HVQ A;  3AUZ A;  1HO5 A;  1UTE A;  1G5B A;  2HYO A;  4WWL A;  1S95 A;  4LAC C;  1MF8 A;  4O24 A;  5B8I A;  2DFJ A;  3N5U A;  4MOV A;  2WDD A;  4HD0 A;  3IB8 A;  3JYF A;  5JPF A;  3K7V C;  2IE3 C;  4ZVZ A;  4Q7F A;  4J6O A;  2IAE C; 
#chains in the Genus database with same CATH topology
 4IS1 C;  2NUF A;  5LLQ A;  1TF6 A;  5IXM B;  3K7W C;  1Z2W A;  5KL7 A;  2EMC A;  2F4V E;  3ADJ A;  5TSE A;  1PDA A;  1T70 A;  2PRT A;  2NAB A;  5IV8 B;  3OTO E;  4DT2 A;  1W24 A;  1ZBT A;  2LCE A;  1UHZ A;  2BB8 A;  4DR7 E;  4R2R A;  3FLO A;  3DF6 A;  2K4V A;  1A1G A;  3LL8 A;  2DSY A;  3KWR A;  4Q28 A;  4F2J C;  3ZOQ B;  2YTN A;  1HNW E;  2EM9 A;  5IT9 C;  2L33 A;  1OI8 A;  1NCS A;  4DSY A;  3HPZ A;  4AQY E;  3TQM A;  3DW8 C;  4X64 E;  2EM2 A;  1T71 A;  3DSC A;  5KL2 A;  1LLM C;  2EM7 A;  4H1S A;  5KL5 A;  1YPN A;  2UUB E;  1V73 A;  3RL5 A;  4R8O A;  2EOE A;  2I13 A;  1ZR9 A;  1TF3 A;  4NXN E;  4KHP E;  4ZYD A;  4KWY A;  4JI6 E;  2Z06 A;  2AHD A;  4L5N C;  2UXC E;  2RQL A;  2EML A;  3L00 A;  4JI4 E;  4DHL A;  3JU0 A;  1BB8 A;  3C6M A;  2LT7 A;  4XPN A;  2LVH A;  2NYL C;  3RMP A;  2GJU A;  4BHB A;  2EM4 A;  5HPE A;  5A6B D;  4B3R E;  4WX9 A;  3EPK A;  1QU6 A;  2V8Q B;  1A1J A;  2EPP A;  2EMH A;  1N34 E;  1WAO 1;  4I8O A;  4X8W A;  2O8G A;  3H60 A;  3IB7 A;  4R2A A;  4G9J A;  4UWQ A;  5KL4 A;  2ENA A;  2EPC A;  3DJW A;  1II7 A;  2RSM A;  1WHQ A;  4ZYE A;  4GKJ E;  3ICF A;  3QFN A;  2ZO9 B;  3C9F A;  2UU9 E;  4TUI A;  1X49 A;  3RQZ A;  2YPN A;  2EQ3 A;  3KBP A;  5AC4 A;  2M7Q A;  2EWL A;  5JJT A;  5AC5 A;  4OR9 A;  4UT2 A;  4X62 E;  4X66 E;  4GEQ B;  4RH8 A;  2B7T A;  2EN4 A;  2ENC A;  3RL4 A;  2WDC A;  2J7J A;  2HHH E;  1DQ3 A;  1L4S A;  2LTS A;  3MSW A;  2WBU A;  1X5W A;  2N3G A;  4Q35 B;  2EMF A;  4B3S E;  4H2G A;  4RHB B;  2FTX B;  4V0X A;  5KL6 A;  3HXL A;  4B2O A;  2A25 A;  4ZX2 A;  2EPZ A;  2R17 A;  2E1M A;  3VYY A;  4DUZ E;  4ORB A;  1IBK E;  2WDF A;  2EL6 A;  2RS6 A;  1ZU1 A;  4DR5 E;  2FGG A;  1NEI A;  4DV2 E;  2B9D A;  2Q8U A;  2EMI A;  2G7H A;  1UTE A;  2YRH A;  2HYO A;  4WWL A;  2LV2 A;  2JP9 A;  2EMZ A;  3JAM C;  2DLQ A;  5ADZ A;  2DFJ A;  3N5U A;  3IB8 A;  3JYF A;  3K7V C;  2EN1 A;  1KJK A;  4Q7F A;  4M0V A;  2IAE C;  2VRD A;  4DR2 E;  4R2C A;  4DR4 E;  3H66 A;  2ZM6 E;  4JI0 E;  1UBD C;  4P78 A;  1IMU A;  2YT4 A;  1YUJ A;  2YTD A;  4NXM E;  2LMZ A;  2JYA A;  4O43 A;  1J26 A;  1P47 A;  2MDR A;  2LO3 A;  2YRK A;  4F54 A;  1T39 A;  4KKZ A;  2DLK A;  3H68 A;  4WSP A;  2ELZ A;  3HTX A;  2RPC A;  1IQS A;  4NZV A;  1IT6 A;  4LF5 E;  1SU1 A;  3IVD A;  4HEI A;  4BC9 A;  1WXR A;  5A6K A;  2RTX A;  2MKN A;  4BBY A;  4JI2 E;  4I5L C;  3KZY A;  2FV4 B;  2V86 A;  2DIX A;  2YTQ A;  2EOF A;  3F6H A;  1WRJ A;  4WFT A;  2L3J A;  2HGH A;  1BBO A;  4DV6 E;  4JV5 E;  2EQ0 A;  2L2M A;  5AE3 A;  2EE8 A;  1JK1 A;  2KKN A;  1PJQ A;  2EN7 A;  2DXN A;  3F6G A;  2B3T B;  3FGA C;  2WZO A;  2EOR A;  3QFM A;  3P71 C;  2NYM C;  3IWD A;  2YSP A;  4DR6 E;  4WXD A;  2EQ1 A;  2EM0 A;  1JK2 A;  3H09 A;  2E72 A;  4DV0 E;  2EPN A;  1OID A;  2RS7 A;  5CFF E;  4TUG A;  2LUQ A;  1XMO E;  2WDE A;  1AAY A;  4LFB E;  1EH6 A;  1AH5 A;  1T38 A;  4DMI A;  3EPH A;  4FBK A;  3QG5 C;  3PSO A;  2HYP A;  1TN9 A;  3J7Y p;  2D9H A;  1UIL A;  2VE7 C;  2EN8 A;  1YZ9 A;  1N36 E;  1A1K A;  4R2E A;  4LF6 E;  4DV7 E;  2YTO A;  2V88 A;  4FBQ A;  3RL3 A;  4OOG C;  1SR9 A;  1A1L A;  4UT3 A;  1O0W A;  1YYW A;  1T4L B;  2EM6 A;  4LU9 A;  1RC7 A;  4H1Y P;  4BCA A;  4O4K A;  1T4O A;  2EOQ A;  4LFA E;  4L8N A;  1ZBQ A;  2XMO A;  2UXD E;  3VYX A;  2EOJ A;  2EOY A;  2B7V A;  2MKD A;  1DI2 A;  2UUC E;  4WPY A;  1RMD A;  3C4T A;  5LL6 R;  2NUG A;  4MP0 A;  1WAR A;  4ORC A;  2A22 A;  2DMI A;  4GZN C;  1S3L A;  2V83 A;  2JPA A;  3BBG A;  3V4Y A;  4GKK E;  2WCC 3;  2CV9 A;  2YTE A;  1UF3 A;  5C1V A;  3C5W C;  3JTZ A;  3CK2 A;  4DV5 E;  5AAS A;  2EL5 A;  3EPJ A;  3HVQ A;  5GTU A;  1HO5 A;  1GTK A;  1EH7 A;  1PJS A;  1RQ0 A;  3EQ1 A;  4F6M A;  1XMQ E;  1X6F A;  4MOV A;  4HD0 A;  2L92 A;  2JVA A;  5JPF A;  2IE3 C;  1X47 A;  2L2K B;  4ZYG A;  4WSG A;  4LF4 E;  2EP3 A;  4I5N C;  2EPL X;  3QFO A;  3LLH A;  2V89 A;  1AUI A;  3VK6 A;  3D03 A;  1S8E A;  2JOG A;  2KOU A;  1TCO A;  2LJH A;  1SFE A;  4DR3 E;  1FJM A;  2HC5 A;  1GZ6 A;  2ELY A;  5FLX C;  3J80 C;  5AE1 A;  1FJG E;  2JOX A;  3LML A;  4K0K E;  2NA2 A;  5IWA E;  2F8B A;  3E0J A;  3GVE A;  2EM3 A;  5AE2 A;  5A6A A;  2R1F A;  2LJU A;  3KZZ A;  4ORA A;  4LTY A;  2EOM A;  2Z72 A;  1N3G A;  1X3C A;  1G2D C;  3E7A A;  5IOH A;  2GPI A;  2BCD A;  1HP1 A;  2NPP C;  3P1X A;  5F3W A;  2EN2 A;  3QFK A;  1J5E E;  2ENH A;  4F9A B;  3HPS A;  3EGH A;  4LFC E;  4WXC A;  2LTR A;  2YVT A;  1WJP A;  3H61 A;  2CPN A;  2YTG A;  4V0W A;  1HR0 E;  3BF2 A;  2H36 X;  2I9I A;  1G2F C;  4DKK A;  5DNY A;  3ADL A;  3OML A;  2CT1 A;  2EOO A;  5EQV A;  4DV1 E;  4BHC A;  1S70 A;  4MLV A;  2BDX A;  2QFR A;  1QNT A;  2YTI A;  3C6K A;  3BGH A;  1S3M A;  4H2F A;  2E5L E;  4JI7 E;  2EPK X;  3ECR A;  1USH A;  1IBM E;  2QJC A;  4YKE A;  2USH A;  4V0V A;  1MEY C;  1YFH A;  4O5G A;  2L6M A;  2V87 A;  4MOY A;  1B69 A;  4R2P A;  2M1S A;  4YHH E;  4F9C B;  1ZAA C;  4LF8 E;  4R2Q A;  2EPU A;  4F6N A;  2DMY A;  3HQ1 A;  1EKZ A;  4BS9 A;  2BBG A;  1Z1B A;  2NUE A;  1GQE A;  3BID A;  4IL1 A;  4NHR A;  4JI8 E;  2LUP B;  2P6B A;  1N33 E;  4M30 A;  4H2I A;  4FBW A;  4MLQ A;  4JA7 A;  3ADG A;  2M4I A;  1N32 E;  4OX9 E;  1YYK A;  5INB A;  1U32 A;  2CSH A;  2LE2 A;  2N8X A;  2EOH A;  1A1F A;  1A1I A;  2JY9 A;  2K7I A;  4FK5 C;  3AV0 A;  2M9A A;  4YY3 E;  2EOZ A;  1STU A;  1X48 A;  1YYO A;  4F0Z A;  1IQO A;  2EM8 A;  2L3C A;  2EMX A;  3AUZ A;  3T1H E;  1MGT A;  1YSA C;  4B3T E;  1S95 A;  2MDG A;  1MF8 A;  5A69 A;  2GLI A;  2HJJ A;  2IHR 1;  2LRS A;  2UXB E;  3ADI A;  4N4R B;  4J6O A;  2EZ6 A;  2EMY A;  4F9B B;  2MC6 A;  3DSD A;  4R2S A;  3THO B;  2MC5 A;  5J28 A;  4DR1 E;  4LF7 E;  1PJT A;  4KZS A;  1KYQ A;  4WYQ B;  1FKA E;  5T6J A;  2KON A;  5A6B A;  2EPX A;  4BMJ A;  5A6J A;  2EMA A;  2YTJ A;  2RSI A;  2EM5 A;  2EPR A;  5LMN E;  4IJD A;  4R2D A;  4FCX A;  1HPU A;  2KHX A;  4R03 A;  4ZVZ A;  2BQ8 X;  4ZYH A;  3PSN A;  4H2B A;  3IVE A;  1OIE A;  4HTG A;  4KBP A;  2VQE E;  1HNX E;  1XZW A;  2EMB A;  2JOB A;  2WBS A;  2CTD A;  2YEQ A;  1BBG A;  2DXL A;  4LF9 E;  2EPA A;  1QHW A;  2JR1 A;  3H62 B;  2YSO A;  2YTP A;  1X6E A;  2EPO A;  2UUA E;  3ZU0 A;  1WHN A;  1XNQ E;  2O8A A;  2EL4 A;  2YRM A;  4DV3 E;  4JA9 A;  2ODR C;  1DGC A;  2L8T A;  3H63 A;  2L2N A;  3J81 C;  3H67 A;  4BC7 A;  2EOS A;  1KBP A;  3TGH A;  5LMU E;  1YUI A;  2JXP A;  4DUY E;  3THN A;  2LBS B;  3MHH C;  4J8Z A;  1M63 A;  1XM7 A;  1F2I G;  2EMG A;  1Z2X A;  2YU5 A;  5KL3 A;  2DB2 A;  4UT3 B;  2WBT A;  4DV4 E;  4M2Z A;  1S3N A;  1T4N A;  3H64 A;  2HY1 A;  3EGG A;  4JI5 E;  2V85 A;  2QFP A;  4IYP C;  3IWB A;  1EH8 A;  2EOX A;  2VF1 A;  4JI3 E;  3J7A G;  5JPE A;  4X65 E;  1PKP A;  2ZBM A;  3MHS C;  1QFC A;  3UK3 C;  1UN6 B;  2EMW A;  1XNR E;  1JK7 A;  3E7B A;  3K6Q A;  2R76 A;  4JYA E;  2DRP A;  2ZOA A;  2YTF A;  2EOI A;  2EMK A;  3IWC A;  3VHT B;  5A2Q C;  1IBL E;  2IE4 C;  2EPM X;  2Z1A A;  4M9V C;  2EN3 A;  5BR8 E;  3ZTV A;  4P7D A;  3T1I A;  2NXF A;  2ADR A;  2EN6 A;  2ODR D;  4B3M E;  2YU8 A;  1I94 E;  3C4B A;  1X6H A;  1NNW A;  2VQF E;  2N3H A;  4JI1 E;  2YWQ A;  3H69 A;  2GHF A;  1G5B A;  2JWO A;  1A1H A;  3FIG A;  4LAC C;  2YZT A;  3EPL A;  3T1Y E;  2EJ4 A;  4O24 A;  1HNZ E;  5B8I A;  2WDD A;  2DGC A;  4X9J A;  3M99 B; 
#chains in the Genus database with same CATH homology
 3DSD A;  3H66 A;  3K7W C;  1Z2W A;  4I5N C;  3THO B;  5J28 A;  3QFO A;  1AUI A;  3D03 A;  1S8E A;  2JOG A;  1T70 A;  4DT2 A;  1TCO A;  1W24 A;  1FJM A;  3FLO A;  4O43 A;  3LL8 A;  3E0J A;  3GVE A;  4FCX A;  1HPU A;  2BQ8 X;  1OI8 A;  4ORA A;  4LTY A;  4DSY A;  4KKZ A;  2Z72 A;  3PSN A;  4H2B A;  3IVE A;  1OIE A;  3DW8 C;  3H68 A;  3E7A A;  4KBP A;  1T71 A;  3DSC A;  4NZV A;  1IT6 A;  1XZW A;  3IVD A;  1SU1 A;  5IOH A;  2YEQ A;  2BCD A;  2DXL A;  4H1S A;  1HP1 A;  1QHW A;  2NPP C;  4I5L C;  3H62 B;  5F3W A;  3QFK A;  3RL5 A;  1V73 A;  3ZU0 A;  2O8A A;  3EGH A;  2KKN A;  4JA9 A;  2Z06 A;  2YVT A;  3H61 A;  2AHD A;  2DXN A;  4M0V A;  3FGA C;  4V0W A;  4DHL A;  3QFM A;  3P71 C;  2NYM C;  3H63 A;  4XPN A;  2NYL C;  3H67 A;  2GJU A;  5DNY A;  1KBP A;  3TGH A;  5HPE A;  1OID A;  5EQV A;  3THN A;  1S70 A;  3IB7 A;  2BDX A;  1WAO 1;  2QFR A;  3H60 A;  2O8G A;  4G9J A;  4UWQ A;  2WDE A;  4TUG A;  1S3M A;  4H2F A;  1M63 A;  1XM7 A;  1USH A;  1Z2X A;  4FBK A;  1II7 A;  3QG5 C;  4UT3 B;  3PSO A;  2HYP A;  2QJC A;  1S3N A;  3ICF A;  4YKE A;  3QFN A;  2USH A;  2ZO9 B;  3H64 A;  3C9F A;  4V0V A;  2HY1 A;  3EGG A;  4TUI A;  3RQZ A;  3KBP A;  4O5G A;  4MOY A;  3RL3 A;  2QFP A;  4FBQ A;  5JJT A;  4OR9 A;  4UT2 A;  4IYP C;  4UT3 A;  3RL4 A;  5JPE A;  2WDC A;  4LU9 A;  2ZBM A;  4H1Y P;  1QFC A;  4O4K A;  1JK7 A;  2XMO A;  3E7B A;  2ZOA A;  4H2G A;  4IL1 A;  2IE4 C;  2P6B A;  4MP0 A;  4ORC A;  1WAR A;  2Z1A A;  4H2I A;  4FBW A;  3ZTV A;  2A22 A;  4JA7 A;  4V0X A;  3T1I A;  5INB A;  2NXF A;  1U32 A;  4B2O A;  1S3L A;  4ZX2 A;  3V4Y A;  2R17 A;  4ORB A;  2WDF A;  1NNW A;  2CV9 A;  3AV0 A;  1UF3 A;  5C1V A;  3C5W C;  3CK2 A;  2Q8U A;  4F0Z A;  3H69 A;  5GTU A;  3HVQ A;  3AUZ A;  1HO5 A;  1UTE A;  1G5B A;  2HYO A;  4WWL A;  1S95 A;  4LAC C;  1MF8 A;  4O24 A;  5B8I A;  2DFJ A;  3N5U A;  4MOV A;  4HD0 A;  2WDD A;  3IB8 A;  3JYF A;  5JPF A;  3K7V C;  2IE3 C;  4ZVZ A;  4Q7F A;  4J6O A;  2IAE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...