4O4KA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 103
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o4kA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o4kA01
3PSOA 1W24A 4ZX2A 4H1SA 3EGHA 1V73A 4LTYA 1XZWA 2BDXA 3EGGA 3PSNA 4MOYA 2Q8UA 2WDDA 4MP0A 2WDCA 4H2FA 4TUIA 3H62B 4Q7FA 1II7A 3IVEA 4F0ZA 4V0VA 4TUGA 3RL5A 1NNWA 2NPPC 4MOVA 4NZVA 2YVTA 4YKEA 1S3LA 2IAEC 2Z06A 2Z72A 1JK7A 3N5UA 3FGAC 4J6OA 2HYPA 3H61A 2R17A 2HYOA 3H66A 3GVEA 4FBQA 4ORBA 2HY1A 4OR9A 2IE3C 3DW8C 4WWLA 1TCOA 3THNA 1S70A 3KBPA 1S3MA 4DT2A 1AUIA 1HPUA 4I5LC 4H2BA 3H63A 3IB8A 3IVDA 4O5GA 1HO5A 4O24A 1OIEA 4DSYA 3C9FA 2IE4C 4ZVZA 3H60A 3DSCA 2Z1AA 4HD0A 2AHDA 1SU1A 3AUZA 3ZTVA 5INBA 2USHA 1OI8A 3QFKA 4B2OA 1QHWA 4UT3B 3H69A 1Z2WA 4FBWA 4LACC 3TGHA 5J28A 1UF3A 4ORCA 1KBPA 3RL4A 2NYLC 3QFNA 2NXFA 4IYPC 3RL3A 1M63A 1HP1A 1U32A 5C1VA 1S3NA 4O4KA 4LU9A 5B8IA 1IT6A 3QG5C 1XM7A 3H68A 3IB7A 2XMOA 3THOB 1WAO1 4G9JA 3C5WC 3T1IA 4I5NC 2KKNA 3E7BA 4H1YP 5DNYA 3AV0A 1S95A 2BQ8X 4XPNA 2QFPA 1T71A 1UTEA 4V0WA 2O8GA 4JA7A 2CV9A 5F3WA 4JA9A 3K7WC 4UT2A 3K7VC 5HPEA 2WDEA 4H2IA 2BCDA 1Z2XA 3RQZA 3E7AA 2GJUA 5GTUA 4DHLA 5JJTA 3V4YA 1QFCA 3HVQA 3DSDA 4KBPA 4O43A 2O8AA 4M0VA 4ORAA 2DFJA 4UWQA 3H64A 1OIDA 4FBKA 1WARA 1T70A 1FJMA 2A22A 3LL8A 3P71C 2QFRA 3QFOA 3CK2A 5EQVA 5IOHA 2ZBMA 3ZU0A 2JOGA 1G5BA 3H67A 4IL1A 3ICFA 4FCXA 1MF8A 2QJCA 4UT3A 4H2GA 3QFMA 4KKZA 3JYFA 1S8EA 1USHA 5JPFA 5JPEA 2P6BA 2WDFA 4V0XA 2NYMC
chains in the Genus database with same CATH superfamily
4H1SA 2EPKX 1N32E 4R2RA 2F4VE 2EPNA 2MC6A 4ZYHA 2HGHA 1V73A 4DR7E 4KZSA 4R03A 3EGGA 1G2FC 2DLQA 2EPLX 3D03A 4M30A 2DMIA 4LF8E 2EOSA 2JXPA 4R8OA 5KL7A 1T4LB 2K7IA 2EOZA 3MSWA 4TUIA 1IBLE 2EL6A 1YSAC 3IVEA 4F0ZA 2M1SA 2DGCA 3VYYA 2J7JA 4LF9E 1NNWA 2EMKA 3ADJA 2YVTA 2G7HA 2YTNA 3H61A 4DV7E 2IE3C 1FJGE 2LT7A 2MDGA 2EPRA 4BHCA 4LF6E 1S3MA 1EKZA 2LRSA 1YFHA 1YYOA 1A1GA 4JI3E 2YU5A 2HC5A 2EMWA 5A6BA 1ZBTA 1JK2A 2IE4C 2ELYA 2EM7A 2ENHA 3BBGA 5INBA 2EN2A 4DV6E 4OX9E 2B9DA 2LBSB 1OI8A 3QFKA 4UT3B 2JWOA 3F6HA 1Z2WA 4DV3E 1RMDA 1GQEA 2EP3A 2GPIA 4X64E 2NXFA 3RL3A 1M63A 2EQ0A 3EPHA 1MEYC 2EOHA 2LO3A 3ADIA 1YPNA 1DGCA 3HTXA 2V89A 1WAO1 3MHHC 4IS1C 2VF1A 3T1IA 2EN3A 2KKNA 2UU9E 2EJ4A 2YPNA 2DXLA 5DNYA 2HHHE 1I94E 4JYAE 1X6EA 3KZZA 5F3WA 4JA7A 4F9BB 1TN9A 3JAMC 1LLMC 2EMYA 4UT2A 1PJTA 1TF6A 4LF7E 2EM4A 2ENAA 4WXCA 1AAYA 2WDEA 1NCSA 4ZYDA 3ADLA 2V87A 2BCDA 2RS6A 2JP9A 2EN6A 4JI5E 2N3HA 2GLIA 5GTUA 1QFCA 1WXRA 1A1LA 2O8AA 3ECRA 3K6QA 3VYXA 1SFEA 2UUCE 4B3ME 2B3TB 2UXBE 2EM5A 3H64A 1FJMA 3E0JA 4P7DA 1HNZE 3QFOA 5EQVA 1P47A 3M99B 2JOGA 3LLHA 2L3CA 4IL1A 2VQEE 2EMAA 2I13A 2EOOA 4KKZA 1QNTA 3EPJA 4I8OA 1S8EA 5JPFA 2EM6A 2L2MA 2NYMC 2DMYA 2EPMX 1W24A 4ZX2A 2ZM6E 2WZOA 2YTOA 2DB2A 2EOJA 4Q28A 2YSPA 4AQYE 1O0WA 3IWBA 1XZWA 2UUBE 2YRMA 2N3GA 1UILA 2WDDA 4MP0A 2WDCA 2EMZA 5T6JA 4H2FA 4Q7FA 4F9AB 2D9HA 2EPOA 2LV2A 4V0VA 2EPCA 4DUZE 2YRHA 1EH6A 4YKEA 3OTOE 2VE7C 2DIXA 5IT9C 2V88A 2EMHA 4HEIA 4WXDA 5LL6R 2ZO9B 4FBQA 1T39A 4WWLA 1X47A 2YTDA 4DMIA 3KBPA 1HPUA 2LVHA 3H63A 3IB8A 2LUPB 2KOUA 2CPNA 4O5GA 1OIEA 5A6KA 1J26A 1ZBQA 4ZVZA 4HD0A 2VRDA 5A6JA 1SU1A 3ZTVA 4Q35B 3J7Yp 2M7QA 1X3CA 4LACC 4FBWA 2YTGA 4X9JA 1UF3A 4ORCA 3DJWA 2EM3A 4F2JC 3JU0A 1HP1A 1T4NA 2CSHA 2EOQA 1EH7A 1S3NA 1UHZA 5B8IA 5KL2A 4DR1E 4MLVA 3H68A 3IB7A 1QU6A 2EOYA 1A1FA 4G9JA 1XNQE 4FK5C 4I5NC 1L4SA 4GKJE 1BBGA 2ENCA 4R2EA 2EOXA 3AV0A 1TF3A 3RMPA 2EPPA 2BQ8X 4OOGC 2QFPA 4V0WA 5AE2A 1UTEA 2O8GA 2JOBA 2YSOA 1X49A 3JTZA 1HNWE 4JA9A 2A25A 2H36X 3K7WC 5HPEA 3FLOA 3C4TA 2L92A 4ZYGA 2LE2A 2JY9A 2EN8A 1STUA 1F2IG 1Z2XA 1DQ3A 1AH5A 4B3TE 3RQZA 2NUFA 5IWAE 2L3JA 3HVQA 2EN7A 4F6NA 1XMOE 1X6HA 2E72A 1HNXE 4DV5E 2JPAA 2LMZA 2EPUA 2YTQA 2EZ6A 2NUEA 4B3RE 1T70A 2YTIA 3LL8A 4N4RB 3CK2A 2YT4A 5IOHA 4LFCE 1Z1BA 3ICFA 4DUYE 3LMLA 3TQMA 3T1YE 1PJQA 2EL4A 2RSMA 4H2GA 4NXME 5AE1A 5KL4A 3F6GA 1HR0E 5JPEA 4NXNE 3E7BA 3RL4A 3DSDA 3PSOA 1GTKA 1PJSA 2WBSA 5KL5A 2L8TA 3DF6A 1PKPA 2EQ1A 3ADGA 4K0KE 1UBDC 4DR3E 4MOYA 4LFAE 2V8QB 2RQLA 1YZ9A 2EMBA 2EPXA 1IQSA 5LMUE 2E1MA 2YTJA 4P78A 4X62E 5KL6A 1II7A 5FLXC 1WJPA 4TUGA 4MOVA 4KHPE 4BMJA 4NZVA 2L6MA 4M2ZA 4JI1E 2IAEC 2Z06A 2CT1A 1JK7A 4J6OA 3FGAC 4WSGA 1NEIA 5ADZA 2HYOA 3H66A 3FIGA 2HY1A 4OR9A 1UN6B 3DW8C 2YU8A 1S70A 2EM2A 1AUIA 4DT2A 2EQ3A 4I5LC 5AASA 2EOMA 1X48A 2V85A 1N3GA 2R76A 4M9VC 2EN4A 4DSYA 4O24A 2EMGA 4JI2E 4WFTA 3H60A 2EMIA 4JV5E 4YY3E 5A69A 3AUZA 2NABA 4WPYA 4WX9A 3J81C 4B2OA 2BB8A 1QHWA 4LFBE 3BF2A 1YUIA 2LTSA 2N8XA 2ODRC 3HPZA 4DV0E 5KL3A 1KBPA 2NYLC 4IYPC 4YHHE 1U32A 5C1VA 3P1XA 2LUQA 4LU9A 3QG5C 2RS7A 2VQFE 4BC7A 2I9IA 2MDRA 5BR8E 2EM8A 2XMOA 2RPCA 2YTEA 4RHBB 4J8ZA 3HXLA 1IQOA 4X8WA 1YYKA 1XMQE 1S95A 4XPNA 1T71A 4LF5E 4WYQB 5TSEA 2EOIA 2DSYA 1YUJA 2NA2A 1B69A 2B7VA 2M9AA 2EM9A 2EMXA 1RQ0A 4DHLA 1BBOA 5JJTA 2DXNA 3HQ1A 4KBPA 1FKAE 4O43A 2EMCA 5LMNE 2LTRA 2V86A 4M0VA 3EPKA 1ZR9A 3VK6A 4UWQA 2L2NA 4R2SA 1GZ6A 4WSPA 1A1KA 2A22A 4DV4E 2RTXA 4JI7E 4JI4E 3J7AG 1DI2A 3MHSC 2E5LE 2ZBMA 3ZU0A 1ZU1A 1G5BA 4FCXA 1MF8A 2NUGA 4DR5E 2GHFA 5AC4A 3JYFA 3BGHA 4F6MA 2CTDA 2WDFA 3T1HE 1IBKE 4JI8E 3C6KA 3ZOQB 1ZAAC 2WBUA 3EGHA 2ELZA 4LTYA 4F9CB 4GKKE 1WHNA 2BDXA 2DLKA 2YTFA 3PSNA 4NHRA 2KONA 2UUAE 2Q8UA 3L00A 4F54A 2ADRA 2EPAA 3BIDA 4DR6E 2JOXA 2EM0A 5A2QC 4R2AA 3HPSA 2EL5A 3IWDA 2UXCE 3H62B 4GEQB 1A1JA 2R1FA 2JVAA 4BCAA 3RL5A 2NPPC 2V83A 2FV4B 2EOEA 4R2QA 4BS9A 4JI6E 2EWLA 3KZYA 1S3LA 2YEQA 2Z72A 3N5UA 2HYPA 4B3SE 2UXDE 2HJJA 5IV8B 2R17A 4DV2E 3GVEA 4ORBA 2MC5A 4KWYA 3TGHA 2EOFA 3C6MA 3THNA 1G2DC 1TCOA 3H09A 2LJUA 2BBGA 4H2BA 2F8BA 2LJHA 3OMLA 4GZNC 4L5NC 2IHR1 3IVDA 1KJKA 2PRTA 1HO5A 1J5EE 4DR2E 2L2KB 3C9FA 2EORA 3DSCA 2Z1AA 2FGGA 2AHDA 4X66E 2USHA 4R2CA 1PDAA 3H69A 5J28A 4DR4E 3EQ1A 3C4BA 5A6BD 1BB8A 3QFNA 1KYQA 4BBYA 5IXMB 4R2DA 4O4KA 1X6FA 1EH8A 1IT6A 2MKDA 2YRKA 1XM7A 4DV1E 3THOB 2YTPA 3C5WC 5LLQA 1RC7A 1IMUA 2YWQA 4BC9A 5AE3A 4H1YP 1WRJA 3J80C 4R2PA 2WBTA 1T4OA 4ZYEA 1JK1A 2EE8A 2K4VA 3UK3C 2CV9A 2LCEA 5A6AA 2EPZA 2EN1A 1N33E 4L8NA 3VHTB 1A1HA 3K7VC 2JYAA 1A1IA 2KHXA 4H2IA 1MGTA 4HTGA 4RH8A 1SR9A 4BHBA 2YZTA 3E7AA 2B7TA 2GJUA 3V4YA 3EPLA 2RSIA 5CFFE 2ODRD 4ORAA 2DFJA 3IWCA 1YYWA 2JR1A 1WHQA 1OIDA 4FBKA 3KWRA 1WARA 4DKKA 3P71C 1XNRE 1N34E 2QFRA 2ZOAA 2MKNA 3H67A 4MLQA 4UT3A 4X65E 2L33A 2M4IA 2WCC3 2QJCA 1X5WA 2DRPA 4JI0E 4IJDA 3QFMA 4LF4E 5AC5A 1T38A 2EMLA 2FTXB 1N36E 1USHA 1IBME 2P6BA 4V0XA 2EMFA
chains in the Genus database with same CATH topology
3PSOA 1W24A 4ZX2A 4H1SA 3EGHA 1V73A 4LTYA 1XZWA 2BDXA 3EGGA 3PSNA 4MOYA 2Q8UA 2WDDA 3D03A 4MP0A 2WDCA 4H2FA 4TUIA 3H62B 4Q7FA 1II7A 3IVEA 4F0ZA 4V0VA 4TUGA 3RL5A 1NNWA 2NPPC 4MOVA 4NZVA 2YVTA 4YKEA 2YEQA 1S3LA 2IAEC 2Z06A 2Z72A 1JK7A 3N5UA 3FGAC 4J6OA 2HYPA 3H61A 2R17A 2HYOA 2ZO9B 3GVEA 3H66A 4FBQA 2HY1A 4OR9A 2IE3C 3DW8C 4ORBA 1TCOA 3THNA 1S70A 3KBPA 4WWLA 1S3MA 4DT2A 1AUIA 1HPUA 4I5LC 4H2BA 3H63A 3IB8A 3IVDA 4O5GA 1HO5A 4O24A 1OIEA 4DSYA 3C9FA 2IE4C 4ZVZA 3H60A 3DSCA 2Z1AA 4HD0A 2AHDA 1SU1A 3AUZA 3ZTVA 5INBA 2USHA 1OI8A 3QFKA 4B2OA 1QHWA 4UT3B 3H69A 1Z2WA 4FBWA 4LACC 3TGHA 5J28A 1UF3A 4ORCA 1KBPA 3RL4A 2NYLC 3QFNA 2NXFA 4IYPC 3RL3A 1M63A 1HP1A 1U32A 5C1VA 1S3NA 4O4KA 4LU9A 5B8IA 1IT6A 3QG5C 1XM7A 3H68A 3IB7A 2XMOA 3THOB 1WAO1 4G9JA 3C5WC 3T1IA 4I5NC 2KKNA 3E7BA 4H1YP 2DXLA 5DNYA 3AV0A 1S95A 2BQ8X 4XPNA 2QFPA 1T71A 1UTEA 4V0WA 2O8GA 4JA7A 2CV9A 5F3WA 4JA9A 3K7WC 4UT2A 3K7VC 5HPEA 2WDEA 3FLOA 4H2IA 2BCDA 1Z2XA 3RQZA 3E7AA 2GJUA 5GTUA 4DHLA 5JJTA 2DXNA 3V4YA 1QFCA 3HVQA 3DSDA 4KBPA 4O43A 2O8AA 4M0VA 4ORAA 2DFJA 4UWQA 3H64A 1OIDA 4FBKA 1WARA 1T70A 1FJMA 2A22A 3LL8A 3P71C 3E0JA 2QFRA 3QFOA 3CK2A 5EQVA 5IOHA 2ZOAA 2ZBMA 3ZU0A 2JOGA 1G5BA 3H67A 4IL1A 3ICFA 4FCXA 1MF8A 2QJCA 4UT3A 4H2GA 3QFMA 4KKZA 3JYFA 1S8EA 1USHA 5JPFA 5JPEA 2P6BA 2WDFA 4V0XA 2NYMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSO A;  1W24 A;  4ZX2 A;  4H1S A;  3EGH A;  1V73 A;  4LTY A;  1XZW A;  2BDX A;  3EGG A;  3PSN A;  4MOY A;  2Q8U A;  2WDD A;  4MP0 A;  2WDC A;  4H2F A;  4TUI A;  3H62 B;  4Q7F A;  1II7 A;  3IVE A;  4F0Z A;  4V0V A;  4TUG A;  3RL5 A;  1NNW A;  2NPP C;  4MOV A;  4NZV A;  2YVT A;  4YKE A;  1S3L A;  2IAE C;  2Z06 A;  2Z72 A;  1JK7 A;  3N5U A;  3FGA C;  4J6O A;  2HYP A;  3H61 A;  2R17 A;  2HYO A;  3H66 A;  3GVE A;  4FBQ A;  4ORB A;  2HY1 A;  4OR9 A;  2IE3 C;  3DW8 C;  4WWL A;  1TCO A;  3THN A;  1S70 A;  3KBP A;  1S3M A;  4DT2 A;  1AUI A;  1HPU A;  4I5L C;  4H2B A;  3H63 A;  3IB8 A;  3IVD A;  4O5G A;  1HO5 A;  4O24 A;  1OIE A;  4DSY A;  3C9F A;  2IE4 C;  4ZVZ A;  3H60 A;  3DSC A;  2Z1A A;  4HD0 A;  2AHD A;  1SU1 A;  3AUZ A;  3ZTV A;  5INB A;  2USH A;  1OI8 A;  3QFK A;  4B2O A;  1QHW A;  4UT3 B;  3H69 A;  1Z2W A;  4FBW A;  4LAC C;  3TGH A;  5J28 A;  1UF3 A;  4ORC A;  1KBP A;  3RL4 A;  2NYL C;  3QFN A;  2NXF A;  4IYP C;  3RL3 A;  1M63 A;  1HP1 A;  1U32 A;  5C1V A;  1S3N A;  4O4K A;  4LU9 A;  5B8I A;  1IT6 A;  3QG5 C;  1XM7 A;  3H68 A;  3IB7 A;  2XMO A;  3THO B;  1WAO 1;  4G9J A;  3C5W C;  3T1I A;  4I5N C;  2KKN A;  3E7B A;  4H1Y P;  5DNY A;  3AV0 A;  1S95 A;  2BQ8 X;  4XPN A;  2QFP A;  1T71 A;  1UTE A;  4V0W A;  2O8G A;  4JA7 A;  2CV9 A;  5F3W A;  4JA9 A;  3K7W C;  4UT2 A;  3K7V C;  5HPE A;  2WDE A;  4H2I A;  2BCD A;  1Z2X A;  3RQZ A;  3E7A A;  2GJU A;  5GTU A;  4DHL A;  5JJT A;  3V4Y A;  1QFC A;  3HVQ A;  3DSD A;  4KBP A;  4O43 A;  2O8A A;  4M0V A;  4ORA A;  2DFJ A;  4UWQ A;  3H64 A;  1OID A;  4FBK A;  1WAR A;  1T70 A;  1FJM A;  2A22 A;  3LL8 A;  3P71 C;  2QFR A;  3QFO A;  3CK2 A;  5EQV A;  5IOH A;  2ZBM A;  3ZU0 A;  2JOG A;  1G5B A;  3H67 A;  4IL1 A;  3ICF A;  4FCX A;  1MF8 A;  2QJC A;  4UT3 A;  4H2G A;  3QFM A;  4KKZ A;  3JYF A;  1S8E A;  1USH A;  5JPF A;  5JPE A;  2P6B A;  2WDF A;  4V0X A;  2NYM C; 
#chains in the Genus database with same CATH topology
 4H1S A;  2EPK X;  1N32 E;  4R2R A;  2F4V E;  2EPN A;  2MC6 A;  4ZYH A;  2HGH A;  1V73 A;  4DR7 E;  4KZS A;  4R03 A;  3EGG A;  1G2F C;  2DLQ A;  2EPL X;  3D03 A;  4M30 A;  2DMI A;  4LF8 E;  2EOS A;  2JXP A;  4R8O A;  5KL7 A;  1T4L B;  2K7I A;  2EOZ A;  3MSW A;  4TUI A;  1IBL E;  2EL6 A;  1YSA C;  3IVE A;  4F0Z A;  2M1S A;  2DGC A;  3VYY A;  2J7J A;  4LF9 E;  1NNW A;  2EMK A;  3ADJ A;  2YVT A;  2G7H A;  2YTN A;  3H61 A;  4DV7 E;  2IE3 C;  1FJG E;  2LT7 A;  2MDG A;  2EPR A;  4BHC A;  4LF6 E;  1S3M A;  1EKZ A;  2LRS A;  1YFH A;  1YYO A;  1A1G A;  4JI3 E;  2YU5 A;  2HC5 A;  2EMW A;  5A6B A;  1ZBT A;  1JK2 A;  2IE4 C;  2ELY A;  2EM7 A;  2ENH A;  3BBG A;  5INB A;  2EN2 A;  4DV6 E;  4OX9 E;  2B9D A;  2LBS B;  1OI8 A;  3QFK A;  4UT3 B;  2JWO A;  3F6H A;  1Z2W A;  4DV3 E;  1RMD A;  1GQE A;  2EP3 A;  2GPI A;  4X64 E;  2NXF A;  3RL3 A;  1M63 A;  2EQ0 A;  3EPH A;  1MEY C;  2EOH A;  2LO3 A;  3ADI A;  1YPN A;  1DGC A;  3HTX A;  2V89 A;  1WAO 1;  3MHH C;  4IS1 C;  2VF1 A;  3T1I A;  2EN3 A;  2KKN A;  2UU9 E;  2EJ4 A;  2YPN A;  2DXL A;  5DNY A;  2HHH E;  1I94 E;  4JYA E;  1X6E A;  3KZZ A;  5F3W A;  4JA7 A;  4F9B B;  1TN9 A;  3JAM C;  1LLM C;  2EMY A;  4UT2 A;  1PJT A;  1TF6 A;  4LF7 E;  2EM4 A;  2ENA A;  4WXC A;  1AAY A;  2WDE A;  1NCS A;  4ZYD A;  3ADL A;  2V87 A;  2BCD A;  2RS6 A;  2JP9 A;  2EN6 A;  4JI5 E;  2N3H A;  2GLI A;  5GTU A;  1QFC A;  1WXR A;  1A1L A;  2O8A A;  3ECR A;  3K6Q A;  3VYX A;  1SFE A;  2UUC E;  4B3M E;  2B3T B;  2UXB E;  2EM5 A;  3H64 A;  1FJM A;  3E0J A;  4P7D A;  1HNZ E;  3QFO A;  5EQV A;  1P47 A;  3M99 B;  2JOG A;  3LLH A;  2L3C A;  4IL1 A;  2VQE E;  2EMA A;  2I13 A;  2EOO A;  4KKZ A;  1QNT A;  3EPJ A;  4I8O A;  1S8E A;  5JPF A;  2EM6 A;  2L2M A;  2NYM C;  2DMY A;  2EPM X;  1W24 A;  4ZX2 A;  2ZM6 E;  2WZO A;  2YTO A;  2DB2 A;  2EOJ A;  4Q28 A;  2YSP A;  4AQY E;  1O0W A;  3IWB A;  1XZW A;  2UUB E;  2YRM A;  2N3G A;  1UIL A;  2WDD A;  4MP0 A;  2WDC A;  2EMZ A;  5T6J A;  4H2F A;  4Q7F A;  4F9A B;  2D9H A;  2EPO A;  2LV2 A;  4V0V A;  2EPC A;  4DUZ E;  2YRH A;  1EH6 A;  4YKE A;  3OTO E;  2VE7 C;  2DIX A;  5IT9 C;  2V88 A;  2EMH A;  4HEI A;  4WXD A;  5LL6 R;  2ZO9 B;  4FBQ A;  1T39 A;  4WWL A;  1X47 A;  2YTD A;  4DMI A;  3KBP A;  1HPU A;  2LVH A;  3H63 A;  3IB8 A;  2LUP B;  2KOU A;  2CPN A;  4O5G A;  1OIE A;  5A6K A;  1J26 A;  1ZBQ A;  4ZVZ A;  4HD0 A;  2VRD A;  5A6J A;  1SU1 A;  3ZTV A;  4Q35 B;  3J7Y p;  2M7Q A;  1X3C A;  4LAC C;  4FBW A;  2YTG A;  4X9J A;  1UF3 A;  4ORC A;  3DJW A;  2EM3 A;  4F2J C;  3JU0 A;  1HP1 A;  1T4N A;  2CSH A;  2EOQ A;  1EH7 A;  1S3N A;  1UHZ A;  5B8I A;  5KL2 A;  4DR1 E;  4MLV A;  3H68 A;  3IB7 A;  1QU6 A;  2EOY A;  1A1F A;  4G9J A;  1XNQ E;  4FK5 C;  4I5N C;  1L4S A;  4GKJ E;  1BBG A;  2ENC A;  4R2E A;  2EOX A;  3AV0 A;  1TF3 A;  3RMP A;  2EPP A;  2BQ8 X;  4OOG C;  2QFP A;  4V0W A;  5AE2 A;  1UTE A;  2O8G A;  2JOB A;  2YSO A;  1X49 A;  3JTZ A;  1HNW E;  4JA9 A;  2A25 A;  2H36 X;  3K7W C;  5HPE A;  3FLO A;  3C4T A;  2L92 A;  4ZYG A;  2LE2 A;  2JY9 A;  2EN8 A;  1STU A;  1F2I G;  1Z2X A;  1DQ3 A;  1AH5 A;  4B3T E;  3RQZ A;  2NUF A;  5IWA E;  2L3J A;  3HVQ A;  2EN7 A;  4F6N A;  1XMO E;  1X6H A;  2E72 A;  1HNX E;  4DV5 E;  2JPA A;  2LMZ A;  2EPU A;  2YTQ A;  2EZ6 A;  2NUE A;  4B3R E;  1T70 A;  2YTI A;  3LL8 A;  4N4R B;  3CK2 A;  2YT4 A;  5IOH A;  4LFC E;  1Z1B A;  3ICF A;  4DUY E;  3LML A;  3TQM A;  3T1Y E;  1PJQ A;  2EL4 A;  2RSM A;  4H2G A;  4NXM E;  5AE1 A;  5KL4 A;  3F6G A;  1HR0 E;  5JPE A;  4NXN E;  3E7B A;  3RL4 A;  3DSD A;  3PSO A;  1GTK A;  1PJS A;  2WBS A;  5KL5 A;  2L8T A;  3DF6 A;  1PKP A;  2EQ1 A;  3ADG A;  4K0K E;  1UBD C;  4DR3 E;  4MOY A;  4LFA E;  2V8Q B;  2RQL A;  1YZ9 A;  2EMB A;  2EPX A;  1IQS A;  5LMU E;  2E1M A;  2YTJ A;  4P78 A;  4X62 E;  5KL6 A;  1II7 A;  5FLX C;  1WJP A;  4TUG A;  4MOV A;  4KHP E;  4BMJ A;  4NZV A;  2L6M A;  4M2Z A;  4JI1 E;  2IAE C;  2Z06 A;  2CT1 A;  1JK7 A;  4J6O A;  3FGA C;  4WSG A;  1NEI A;  5ADZ A;  2HYO A;  3H66 A;  3FIG A;  2HY1 A;  4OR9 A;  1UN6 B;  3DW8 C;  2YU8 A;  1S70 A;  2EM2 A;  1AUI A;  4DT2 A;  2EQ3 A;  4I5L C;  5AAS A;  2EOM A;  1X48 A;  2V85 A;  1N3G A;  2R76 A;  4M9V C;  2EN4 A;  4DSY A;  4O24 A;  2EMG A;  4JI2 E;  4WFT A;  3H60 A;  2EMI A;  4JV5 E;  4YY3 E;  5A69 A;  3AUZ A;  2NAB A;  4WPY A;  4WX9 A;  3J81 C;  4B2O A;  2BB8 A;  1QHW A;  4LFB E;  3BF2 A;  1YUI A;  2LTS A;  2N8X A;  2ODR C;  3HPZ A;  4DV0 E;  5KL3 A;  1KBP A;  2NYL C;  4IYP C;  4YHH E;  1U32 A;  5C1V A;  3P1X A;  2LUQ A;  4LU9 A;  3QG5 C;  2RS7 A;  2VQF E;  4BC7 A;  2I9I A;  2MDR A;  5BR8 E;  2EM8 A;  2XMO A;  2RPC A;  2YTE A;  4RHB B;  4J8Z A;  3HXL A;  1IQO A;  4X8W A;  1YYK A;  1XMQ E;  1S95 A;  4XPN A;  1T71 A;  4LF5 E;  4WYQ B;  5TSE A;  2EOI A;  2DSY A;  1YUJ A;  2NA2 A;  1B69 A;  2B7V A;  2M9A A;  2EM9 A;  2EMX A;  1RQ0 A;  4DHL A;  1BBO A;  5JJT A;  2DXN A;  3HQ1 A;  4KBP A;  1FKA E;  4O43 A;  2EMC A;  5LMN E;  2LTR A;  2V86 A;  4M0V A;  3EPK A;  1ZR9 A;  3VK6 A;  4UWQ A;  2L2N A;  4R2S A;  1GZ6 A;  4WSP A;  1A1K A;  2A22 A;  4DV4 E;  2RTX A;  4JI7 E;  4JI4 E;  3J7A G;  1DI2 A;  3MHS C;  2E5L E;  2ZBM A;  3ZU0 A;  1ZU1 A;  1G5B A;  4FCX A;  1MF8 A;  2NUG A;  4DR5 E;  2GHF A;  5AC4 A;  3JYF A;  3BGH A;  4F6M A;  2CTD A;  2WDF A;  3T1H E;  1IBK E;  4JI8 E;  3C6K A;  3ZOQ B;  1ZAA C;  2WBU A;  3EGH A;  2ELZ A;  4LTY A;  4F9C B;  4GKK E;  1WHN A;  2BDX A;  2DLK A;  2YTF A;  3PSN A;  4NHR A;  2KON A;  2UUA E;  2Q8U A;  3L00 A;  4F54 A;  2ADR A;  2EPA A;  3BID A;  4DR6 E;  2JOX A;  2EM0 A;  5A2Q C;  4R2A A;  3HPS A;  2EL5 A;  3IWD A;  2UXC E;  3H62 B;  4GEQ B;  1A1J A;  2R1F A;  2JVA A;  4BCA A;  3RL5 A;  2NPP C;  2V83 A;  2FV4 B;  2EOE A;  4R2Q A;  4BS9 A;  4JI6 E;  2EWL A;  3KZY A;  1S3L A;  2YEQ A;  2Z72 A;  3N5U A;  2HYP A;  4B3S E;  2UXD E;  2HJJ A;  5IV8 B;  2R17 A;  4DV2 E;  3GVE A;  4ORB A;  2MC5 A;  4KWY A;  3TGH A;  2EOF A;  3C6M A;  3THN A;  1G2D C;  1TCO A;  3H09 A;  2LJU A;  2BBG A;  4H2B A;  2F8B A;  2LJH A;  3OML A;  4GZN C;  4L5N C;  2IHR 1;  3IVD A;  1KJK A;  2PRT A;  1HO5 A;  1J5E E;  4DR2 E;  2L2K B;  3C9F A;  2EOR A;  3DSC A;  2Z1A A;  2FGG A;  2AHD A;  4X66 E;  2USH A;  4R2C A;  1PDA A;  3H69 A;  5J28 A;  4DR4 E;  3EQ1 A;  3C4B A;  5A6B D;  1BB8 A;  3QFN A;  1KYQ A;  4BBY A;  5IXM B;  4R2D A;  4O4K A;  1X6F A;  1EH8 A;  1IT6 A;  2MKD A;  2YRK A;  1XM7 A;  4DV1 E;  3THO B;  2YTP A;  3C5W C;  5LLQ A;  1RC7 A;  1IMU A;  2YWQ A;  4BC9 A;  5AE3 A;  4H1Y P;  1WRJ A;  3J80 C;  4R2P A;  2WBT A;  1T4O A;  4ZYE A;  1JK1 A;  2EE8 A;  2K4V A;  3UK3 C;  2CV9 A;  2LCE A;  5A6A A;  2EPZ A;  2EN1 A;  1N33 E;  4L8N A;  3VHT B;  1A1H A;  3K7V C;  2JYA A;  1A1I A;  2KHX A;  4H2I A;  1MGT A;  4HTG A;  4RH8 A;  1SR9 A;  4BHB A;  2YZT A;  3E7A A;  2B7T A;  2GJU A;  3V4Y A;  3EPL A;  2RSI A;  5CFF E;  2ODR D;  4ORA A;  2DFJ A;  3IWC A;  1YYW A;  2JR1 A;  1WHQ A;  1OID A;  4FBK A;  3KWR A;  1WAR A;  4DKK A;  3P71 C;  1XNR E;  1N34 E;  2QFR A;  2ZOA A;  2MKN A;  3H67 A;  4MLQ A;  4UT3 A;  4X65 E;  2L33 A;  2M4I A;  2WCC 3;  2QJC A;  1X5W A;  2DRP A;  4JI0 E;  4IJD A;  3QFM A;  4LF4 E;  5AC5 A;  1T38 A;  2EML A;  2FTX B;  1N36 E;  1USH A;  1IBM E;  2P6B A;  4V0X A;  2EMF A; 
#chains in the Genus database with same CATH homology
 3PSO A;  1W24 A;  4ZX2 A;  4H1S A;  3EGH A;  1V73 A;  4LTY A;  1XZW A;  2BDX A;  3EGG A;  3PSN A;  4MOY A;  2Q8U A;  2WDD A;  3D03 A;  4MP0 A;  2WDC A;  4H2F A;  4TUI A;  3H62 B;  4Q7F A;  1II7 A;  3IVE A;  4F0Z A;  4V0V A;  4TUG A;  3RL5 A;  1NNW A;  2NPP C;  4MOV A;  4NZV A;  2YVT A;  4YKE A;  2YEQ A;  1S3L A;  2IAE C;  2Z06 A;  2Z72 A;  1JK7 A;  3N5U A;  3FGA C;  4J6O A;  2HYP A;  3H61 A;  2R17 A;  2HYO A;  2ZO9 B;  3GVE A;  3H66 A;  4FBQ A;  2HY1 A;  4OR9 A;  2IE3 C;  3DW8 C;  4ORB A;  1TCO A;  3THN A;  1S70 A;  3KBP A;  4WWL A;  1S3M A;  4DT2 A;  1AUI A;  1HPU A;  4I5L C;  4H2B A;  3H63 A;  3IB8 A;  3IVD A;  4O5G A;  1HO5 A;  4O24 A;  1OIE A;  4DSY A;  3C9F A;  2IE4 C;  4ZVZ A;  3H60 A;  3DSC A;  2Z1A A;  4HD0 A;  2AHD A;  1SU1 A;  3AUZ A;  3ZTV A;  5INB A;  2USH A;  1OI8 A;  3QFK A;  4B2O A;  1QHW A;  4UT3 B;  3H69 A;  1Z2W A;  4FBW A;  4LAC C;  3TGH A;  5J28 A;  1UF3 A;  4ORC A;  1KBP A;  3RL4 A;  2NYL C;  3QFN A;  2NXF A;  4IYP C;  3RL3 A;  1M63 A;  1HP1 A;  1U32 A;  5C1V A;  1S3N A;  4O4K A;  4LU9 A;  5B8I A;  1IT6 A;  3QG5 C;  1XM7 A;  3H68 A;  3IB7 A;  2XMO A;  3THO B;  1WAO 1;  4G9J A;  3C5W C;  3T1I A;  4I5N C;  2KKN A;  3E7B A;  4H1Y P;  2DXL A;  5DNY A;  3AV0 A;  1S95 A;  2BQ8 X;  4XPN A;  2QFP A;  1T71 A;  1UTE A;  4V0W A;  2O8G A;  4JA7 A;  2CV9 A;  5F3W A;  4JA9 A;  3K7W C;  4UT2 A;  3K7V C;  5HPE A;  2WDE A;  3FLO A;  4H2I A;  2BCD A;  1Z2X A;  3RQZ A;  3E7A A;  2GJU A;  5GTU A;  4DHL A;  5JJT A;  2DXN A;  3V4Y A;  1QFC A;  3HVQ A;  3DSD A;  4KBP A;  4O43 A;  2O8A A;  4M0V A;  4ORA A;  2DFJ A;  4UWQ A;  3H64 A;  1OID A;  4FBK A;  1WAR A;  1T70 A;  1FJM A;  2A22 A;  3LL8 A;  3P71 C;  3E0J A;  2QFR A;  3QFO A;  3CK2 A;  5EQV A;  5IOH A;  2ZOA A;  2ZBM A;  3ZU0 A;  2JOG A;  1G5B A;  3H67 A;  4IL1 A;  3ICF A;  4FCX A;  1MF8 A;  2QJC A;  4UT3 A;  4H2G A;  3QFM A;  4KKZ A;  3JYF A;  1S8E A;  1USH A;  5JPF A;  5JPE A;  2P6B A;  2WDF A;  4V0X A;  2NYM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...