4O4KA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 103
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o4kA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o4kA01
2Z06A 3E7BA 4JA7A 2GJUA 1FJMA 1HO5A 3RL4A 4UT3A 1S8EA 3H67A 1XZWA 2QJCA 3QFOA 3H66A 3H63A 3H60A 5EQVA 3T1IA 3QFMA 3C9FA 4J6OA 4KKZA 3AV0A 2ZBMA 4TUIA 4F0ZA 2R17A 4DSYA 3DW8C 3H64A 4IL1A 5F3WA 3H62B 4IYPC 2A22A 2NXFA 2Z72A 4G9JA 4O5GA 4UWQA 1SU1A 4FCXA 3LL8A 5J28A 4LTYA 4H2IA 5JPEA 2WDCA 3PSOA 4H1YP 2BQ8X 4DHLA 3V4YA 3PSNA 3IVDA 4YKEA 3C5WC 4O4KA 5JJTA 3IB7A 4O43A 4HD0A 1V73A 4Q7FA 4V0WA 4H2BA 1UF3A 1S3NA 1HP1A 3RL3A 5C1VA 3CK2A 2YVTA 3DSCA 3IVEA 1W24A 3K7WC 4O24A 3EGGA 5HPEA 3N5UA 2DFJA 4M0VA 2Q8UA 1MF8A 3RL5A 4MP0A 4DT2A 4LU9A 3FGAC 3TGHA 1II7A 4KBPA 1WAO1 3H61A 5B8IA 4FBKA 1S3MA 2NYLC 3QFKA 2NYMC 1Z2WA 4TUGA 5INBA 1KBPA 2USHA 3E7AA 5DNYA 2O8GA 2Z1AA 2JOGA 2O8AA 1HPUA 2IAEC 2WDFA 3RQZA 2QFRA 2XMOA 1OI8A 1T71A 4MOYA 3DSDA 4XPNA 4NZVA 3KBPA 4ORBA 4ZVZA 4WWLA 3ZTVA 3K7VC 4JA9A 1IT6A 5IOHA 3ZU0A 3THNA 3ICFA 1UTEA 1AUIA 1USHA 2KKNA 2WDEA 4V0XA 3H69A 2WDDA 1OIEA 4FBQA 1JK7A 4B2OA 1Z2XA 4ORAA 4FBWA 3EGHA 3AUZA 1WARA 1NNWA 1OIDA 1QHWA 1S3LA 2BCDA 2HYPA 2P6BA 4H2GA 5JPFA 3IB8A 1U32A 4OR9A 2QFPA 3H68A 1QFCA 4H1SA 1XM7A 1S70A 2HYOA 4MOVA 4UT3B 1S95A 5GTUA 1M63A 4ZX2A 1T70A 3QFNA 2NPPC 3P71C 2HY1A 3HVQA 4H2FA 4ORCA 3JYFA 1G5BA 2IE3C 3GVEA 2AHDA 4I5LC 2IE4C 4V0VA 3QG5C 4I5NC 3THOB 4UT2A 2CV9A 1TCOA 4LACC 2BDXA
chains in the Genus database with same CATH superfamily
4LF6E 4MLQA 3FIGA 4HTGA 3E7BA 1YPNA 2EPNA 3H67A 3KZYA 3C6MA 5EQVA 2EOZA 3QFMA 4N4RB 3DF6A 4ZYEA 4TUIA 4F54A 4WPYA 2L2KB 1N33E 1STUA 2VE7C 3ZOQB 2FV4B 2LCEA 4GKKE 1SU1A 1YUJA 1J5EE 5J28A 3HXLA 4LF8E 1A1GA 2HHHE 4H1YP 2BQ8X 4MLVA 3V4YA 4OOGC 3PSNA 1A1HA 4YKEA 4DR5E 1YSAC 5JJTA 3MHHC 2YU8A 4BHBA 2MC6A 4H2BA 2GLIA 2ENCA 2LBSB 4R2RA 1XMQE 2JXPA 5KL5A 1J26A 2L3JA 1IMUA 2EMCA 3IVEA 3IWBA 4F2JC 3K7WC 2EN7A 4O24A 4R2PA 4DR2E 1YFHA 2JWOA 1HNXE 5HPEA 4NXME 4WYQB 5AC4A 2EMXA 2NABA 2YTQA 2MDRA 2LTRA 4GZNC 4MP0A 1EH8A 3TQMA 3TGHA 2EOFA 4DUZE 5B8IA 2EN8A 4FBKA 2DMYA 3M99B 1GTKA 2YPNA 3KZZA 4JI6E 1NEIA 4LFCE 2NYLC 3QFKA 1Z2WA 4X8WA 2EOMA 2L2MA 2YSPA 1KBPA 3E7AA 5DNYA 1FJGE 2O8GA 2Z1AA 4LFBE 2O8AA 2ODRC 2EMZA 2UUBE 1ZBTA 3ADIA 3RQZA 5A6JA 1AH5A 2EPUA 2EM9A 3HTXA 4DUYE 1OI8A 1T71A 2XMOA 3KBPA 3MHSC 1O0WA 5IXMB 2PRTA 4ZVZA 4WWLA 3ADGA 1X49A 3LMLA 3JU0A 2LV2A 3ZU0A 3THNA 4NHRA 4Q35B 5KL7A 2KKNA 2EPZA 4DR6E 4F9BB 2WDDA 1JK7A 4KWYA 3E0JA 2MKDA 3MSWA 1WARA 4YHHE 2EWLA 4JYAE 1OIDA 2HYPA 4M9VC 4H2GA 5JPFA 2EOEA 2WCC3 1U32A 2V87A 4OR9A 4M2ZA 1S95A 3C4BA 4JI0E 1M63A 1A1JA 3QFNA 3P71C 2LJUA 4GKJE 4ORCA 2DSYA 3EPLA 2H36X 1IQOA 2M7QA 4DR4E 3GVEA 3RMPA 2B9DA 2JR1A 2VRDA 1TN9A 2EPRA 2ELYA 2YTGA 2ADRA 1PJQA 1YYKA 2V89A 1PKPA 2BDXA 2E5LE 5CFFE 5LL6R 3T1HE 5KL2A 2RSMA 2B7VA 4DV4E 1DI2A 2RS6A 2EPOA 3HQ1A 5LMNE 2GHFA 1HO5A 3RL4A 2V85A 2EOHA 3QFOA 1WXRA 3H66A 3H63A 4KKZA 4J6OA 2ZOAA 3AV0A 1RMDA 2EM6A 4DSYA 4DV2E 5F3WA 2EOIA 2EOOA 3H62B 4IYPC 2NXFA 2Z72A 1WHQA 5LLQA 1GZ6A 2MKNA 1SR9A 1MEYC 1ZU1A 3F6GA 3BIDA 2EM8A 4H2IA 2I13A 2A25A 2EM2A 1B69A 2YTFA 1ZBQA 4WX9A 4IS1C 2ODRD 4F6MA 4O4KA 2DRPA 4O43A 4HD0A 3IWCA 4Q7FA 2VF1A 2YTIA 2L8TA 4KZSA 1S3NA 2LVHA 1EH7A 3VK6A 5IT9C 1XNQE 2EPMX 3CK2A 1YUIA 2BBGA 4B3RE 2YRMA 2YTNA 4M0VA 2J7JA 4AQYE 1T39A 4JI4E 2N3HA 3ECRA 4DR3E 1I94E 1HNZE 4DT2A 3FGAC 4BBYA 1WAO1 3H61A 2L6MA 1AAYA 1BBGA 4IJDA 1YZ9A 2NYMC 1N3GA 3KWRA 1N36E 2D9HA 2VQFE 3EPKA 2EM7A 1JK2A 2WDFA 2I9IA 1YYOA 1BBOA 1DGCA 2ENAA 3ZTVA 4WSPA 4JA9A 1IT6A 4R8OA 2JP9A 4WXDA 1AUIA 1UTEA 1USHA 3OTOE 1EH6A 2WDEA 2EJ4A 1L4SA 3J7AG 2DGCA 2KHXA 4P7DA 4B2OA 2B3TB 2EMYA 3AUZA 2ZO9B 1NNWA 4WSGA 2R1FA 3VHTB 2V86A 2YRHA 2LMZA 3BF2A 1A1LA 2WZOA 3H68A 3H09A 1S70A 1KJKA 2YTJA 1UBDC 2EOQA 2LE2A 4DV7E 2MDGA 2RQLA 2EM0A 2YRKA 4DV6E 2EQ3A 4KHPE 1T70A 4ZX2A 1G2DC 2HY1A 3HPSA 4WFTA 2EOSA 2EPLX 5A6AA 2YSOA 4P78A 1XMOE 2EM4A 2F8BA 4DV0E 2JOXA 2LO3A 2E72A 3QG5C 4I5NC 4WXCA 3THOB 4L8NA 2EMHA 2EMGA 1TCOA 4LACC 2Z06A 2EN2A 2GJUA 3HPZA 1WJPA 4OX9E 1XZWA 2G7HA 5TSEA 4X65E 2UUAE 3T1IA 1T38A 2DB2A 1A1IA 2R17A 5A6KA 3DJWA 4LF4E 4R03A 3DW8C 5AE1A 4ZYHA 3J80C 1X5WA 4DR7E 3L00A 3H64A 3ADJA 2EL5A 4YY3E 2ELZA 1IQSA 4O5GA 4G9JA 4UWQA 1PJSA 5AC5A 3EPJA 5AE3A 3LL8A 5JPEA 2E1MA 4L5NC 2WDCA 3PSOA 5KL4A 2YTPA 3C5WC 4ZYGA 4R2DA 3EPHA 4V0WA 2EMBA 2EPXA 4BMJA 1IBME 1TF3A 4X62E 2EP3A 2GPIA 3D03A 2L3CA 2RSIA 1X48A 1X6HA 1HP1A 3RL3A 5C1VA 1XNRE 1LLMC 2NUEA 2YT4A 2LRSA 2WBTA 3DSCA 1RQ0A 2HJJA 2FGGA 3EGGA 4K0KE 4F6NA 1IBLE 2M4IA 2EQ0A 3VYXA 2L33A 2V83A 3UK3C 1EKZA 3ADLA 3K6QA 2RTXA 1QU6A 4DV1E 2UXBE 4B3SE 4TUGA 1N32E 5INBA 1WHNA 4X9JA 4R2QA 1GQEA 2EMKA 5KL6A 4B3ME 5A69A 1BB8A 1PDAA 2JOGA 1HPUA 1JK1A 4JI2E 4R2CA 2EMWA 5IV8B 3DSDA 4NZVA 2EQ1A 4ORBA 4JI7E 4ZYDA 2YTEA 3OMLA 2EZ6A 3ICFA 2V88A 3T1YE 2YZTA 2MC5A 4V0XA 1OIEA 4FBQA 1PJTA 1F2IG 2F4VE 4BHCA 1X47A 1Z2XA 4ORAA 2YWQA 1X6FA 3EGHA 5AASA 1WRJA 4LF5E 1S3LA 1X3CA 2DIXA 2EPPA 4Q28A 4F9AB 2EE8A 4H1SA 2L92A 2NUGA 2HYOA 4MOVA 4UT3B 5GTUA 2EN6A 4R2EA 2V8QB 2BB8A 1A1KA 2EMFA 1HNWE 3HVQA 2IE3C 4RH8A 1P47A 2DLKA 3JTZA 4JI5E 5BR8E 2AHDA 2YTOA 4I5LC 2HC5A 1DQ3A 4LF7E 5IWAE 2HGHA 1RC7A 2K7IA 2LUPB 4JA7A 2JVAA 2FTXB 1FJMA 3VYYA 4UT3A 5FLXC 1S8EA 3P1XA 2QJCA 1Z1BA 3H60A 2WBUA 2EMLA 1NCSA 1X6EA 1MGTA 3C9FA 2ZBMA 2EN1A 4DV3E 4F0ZA 5AE2A 1ZR9A 2M9AA 2EM5A 3J7Yp 1ZAAC 2A22A 2N3GA 4J8ZA 4HEIA 4FCXA 1T4OA 5A6BA 2L2NA 4LTYA 1TF6A 2EM3A 1T4NA 4DV5E 2VQEE 4BCAA 1KYQA 4DHLA 3IVDA 2EPKX 2EN4A 3LLHA 1A1FA 3IB7A 2N8XA 3F6HA 5LMUE 1V73A 2LTSA 4BC9A 2CSHA 1UF3A 1HR0E 2EORA 4R2SA 2CPNA 1IBKE 2B7TA 2YVTA 5T6JA 2EL6A 1W24A 4JI3E 5KL3A 2UUCE 3N5UA 2DFJA 2Q8UA 4R2AA 1MF8A 3BGHA 4BC7A 3RL5A 2ZM6E 4LU9A 4X66E 2RPCA 1II7A 2EOJA 2R76A 4KBPA 2IHR1 4LF9E 4I8OA 4X64E 1S3MA 2EPCA 3J81C 2DMIA 2YEQA 4JV5E 2JYAA 3BBGA 2USHA 2KONA 4JI1E 1G2FC 1YYWA 3IWDA 2IAEC 2YU5A 2DXNA 2RS7A 1SFEA 4JI8E 2JPAA 2QFRA 4MOYA 2DLQA 4XPNA 2EOYA 5A6BD 5A2QC 2LJHA 3JAMC 2LT7A 4B3TE 3K7VC 1T4LB 2ENHA 5IOHA 2CT1A 3H69A 2LUQA 1UILA 1N34E 3FLOA 2EPAA 4F9CB 2JOBA 1FKAE 4FBWA 2JY9A 2K4VA 3EQ1A 4M30A 1QHWA 4GEQB 1UN6B 2BCDA 2EMAA 2EMIA 2P6BA 4DMIA 3IB8A 2YTDA 2QFPA 3C6KA 1QFCA 1XM7A 4BS9A 2NA2A 2NUFA 1UHZA 2EOXA 4DKKA 4FK5C 4NXNE 4IL1A 2NPPC 2KOUA 4H2FA 3JYFA 5ADZA 1G5BA 2EN3A 1QNTA 2WBSA 4DR1E 2EL4A 4RHBB 2M1SA 3C4TA 2IE4C 2UXCE 4V0VA 2UXDE 2UU9E 2CTDA 4LFAE 2DXLA 2CV9A 4UT2A
chains in the Genus database with same CATH topology
2Z06A 3E7BA 4JA7A 2GJUA 1FJMA 1HO5A 3RL4A 4UT3A 1S8EA 3H67A 1XZWA 2QJCA 3QFOA 3H66A 3H63A 3H60A 5EQVA 3T1IA 3QFMA 3C9FA 4J6OA 4KKZA 2ZOAA 3AV0A 2ZBMA 4TUIA 4F0ZA 2R17A 4DSYA 3DW8C 3H64A 4IL1A 5F3WA 3H62B 4IYPC 2A22A 2NXFA 2Z72A 4G9JA 4O5GA 4UWQA 1SU1A 4FCXA 3LL8A 5J28A 4LTYA 4H2IA 5JPEA 2WDCA 3PSOA 4H1YP 2BQ8X 4DHLA 3V4YA 3PSNA 3IVDA 4YKEA 3C5WC 4O4KA 5JJTA 3IB7A 4O43A 4HD0A 1V73A 4Q7FA 4V0WA 4H2BA 1UF3A 3D03A 1S3NA 1HP1A 3RL3A 5C1VA 3CK2A 2YVTA 3DSCA 3IVEA 1W24A 3K7WC 4O24A 3EGGA 5HPEA 3N5UA 2DFJA 4M0VA 2Q8UA 1MF8A 3RL5A 4MP0A 4DT2A 4LU9A 3FGAC 3TGHA 1II7A 4KBPA 1WAO1 3H61A 5B8IA 4FBKA 1S3MA 2NYLC 3QFKA 2NYMC 2YEQA 1Z2WA 4TUGA 5INBA 1KBPA 2USHA 3E7AA 5DNYA 2O8GA 2Z1AA 2JOGA 2O8AA 1HPUA 2IAEC 2WDFA 2DXNA 3RQZA 2QFRA 2XMOA 1OI8A 1T71A 4MOYA 3DSDA 4XPNA 4NZVA 3KBPA 4ORBA 4ZVZA 4WWLA 3ZTVA 3K7VC 4JA9A 1IT6A 5IOHA 3ZU0A 3THNA 3ICFA 1UTEA 1AUIA 1USHA 2KKNA 2WDEA 4V0XA 3H69A 2WDDA 1OIEA 4FBQA 1JK7A 3FLOA 3E0JA 4B2OA 1Z2XA 4ORAA 4FBWA 3EGHA 2ZO9B 3AUZA 1WARA 1NNWA 1OIDA 1QHWA 1S3LA 2BCDA 2P6BA 2HYPA 4H2GA 5JPFA 3IB8A 1U32A 4OR9A 2QFPA 3H68A 1QFCA 4H1SA 1XM7A 1S70A 2HYOA 4MOVA 4UT3B 1S95A 5GTUA 1M63A 4ZX2A 1T70A 3QFNA 2NPPC 3P71C 2HY1A 3HVQA 4H2FA 4ORCA 3JYFA 1G5BA 2IE3C 3GVEA 2AHDA 4I5LC 2IE4C 4V0VA 3QG5C 4I5NC 3THOB 2DXLA 2CV9A 4UT2A 1TCOA 4LACC 2BDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z06 A;  3E7B A;  4JA7 A;  2GJU A;  1FJM A;  1HO5 A;  3RL4 A;  4UT3 A;  1S8E A;  3H67 A;  1XZW A;  2QJC A;  3QFO A;  3H66 A;  3H63 A;  3H60 A;  5EQV A;  3T1I A;  3QFM A;  3C9F A;  4J6O A;  4KKZ A;  3AV0 A;  2ZBM A;  4TUI A;  4F0Z A;  2R17 A;  4DSY A;  3DW8 C;  3H64 A;  4IL1 A;  5F3W A;  3H62 B;  4IYP C;  2A22 A;  2NXF A;  2Z72 A;  4G9J A;  4O5G A;  4UWQ A;  1SU1 A;  4FCX A;  3LL8 A;  5J28 A;  4LTY A;  4H2I A;  5JPE A;  2WDC A;  3PSO A;  4H1Y P;  2BQ8 X;  4DHL A;  3V4Y A;  3PSN A;  3IVD A;  4YKE A;  3C5W C;  4O4K A;  5JJT A;  3IB7 A;  4O43 A;  4HD0 A;  1V73 A;  4Q7F A;  4V0W A;  4H2B A;  1UF3 A;  1S3N A;  1HP1 A;  3RL3 A;  5C1V A;  3CK2 A;  2YVT A;  3DSC A;  3IVE A;  1W24 A;  3K7W C;  4O24 A;  3EGG A;  5HPE A;  3N5U A;  2DFJ A;  4M0V A;  2Q8U A;  1MF8 A;  3RL5 A;  4MP0 A;  4DT2 A;  4LU9 A;  3FGA C;  3TGH A;  1II7 A;  4KBP A;  1WAO 1;  3H61 A;  5B8I A;  4FBK A;  1S3M A;  2NYL C;  3QFK A;  2NYM C;  1Z2W A;  4TUG A;  5INB A;  1KBP A;  2USH A;  3E7A A;  5DNY A;  2O8G A;  2Z1A A;  2JOG A;  2O8A A;  1HPU A;  2IAE C;  2WDF A;  3RQZ A;  2QFR A;  2XMO A;  1OI8 A;  1T71 A;  4MOY A;  3DSD A;  4XPN A;  4NZV A;  3KBP A;  4ORB A;  4ZVZ A;  4WWL A;  3ZTV A;  3K7V C;  4JA9 A;  1IT6 A;  5IOH A;  3ZU0 A;  3THN A;  3ICF A;  1UTE A;  1AUI A;  1USH A;  2KKN A;  2WDE A;  4V0X A;  3H69 A;  2WDD A;  1OIE A;  4FBQ A;  1JK7 A;  4B2O A;  1Z2X A;  4ORA A;  4FBW A;  3EGH A;  3AUZ A;  1WAR A;  1NNW A;  1OID A;  1QHW A;  1S3L A;  2BCD A;  2HYP A;  2P6B A;  4H2G A;  5JPF A;  3IB8 A;  1U32 A;  4OR9 A;  2QFP A;  3H68 A;  1QFC A;  4H1S A;  1XM7 A;  1S70 A;  2HYO A;  4MOV A;  4UT3 B;  1S95 A;  5GTU A;  1M63 A;  4ZX2 A;  1T70 A;  3QFN A;  2NPP C;  3P71 C;  2HY1 A;  3HVQ A;  4H2F A;  4ORC A;  3JYF A;  1G5B A;  2IE3 C;  3GVE A;  2AHD A;  4I5L C;  2IE4 C;  4V0V A;  3QG5 C;  4I5N C;  3THO B;  4UT2 A;  2CV9 A;  1TCO A;  4LAC C;  2BDX A; 
#chains in the Genus database with same CATH topology
 4LF6 E;  4MLQ A;  3FIG A;  4HTG A;  3E7B A;  1YPN A;  2EPN A;  3H67 A;  3KZY A;  3C6M A;  5EQV A;  2EOZ A;  3QFM A;  4N4R B;  3DF6 A;  4ZYE A;  4TUI A;  4F54 A;  4WPY A;  2L2K B;  1N33 E;  1STU A;  2VE7 C;  3ZOQ B;  2FV4 B;  2LCE A;  4GKK E;  1SU1 A;  1YUJ A;  1J5E E;  5J28 A;  3HXL A;  4LF8 E;  1A1G A;  2HHH E;  4H1Y P;  2BQ8 X;  4MLV A;  3V4Y A;  4OOG C;  3PSN A;  1A1H A;  4YKE A;  4DR5 E;  1YSA C;  5JJT A;  3MHH C;  2YU8 A;  4BHB A;  2MC6 A;  4H2B A;  2GLI A;  2ENC A;  2LBS B;  4R2R A;  1XMQ E;  2JXP A;  5KL5 A;  1J26 A;  2L3J A;  1IMU A;  2EMC A;  3IVE A;  3IWB A;  4F2J C;  3K7W C;  2EN7 A;  4O24 A;  4R2P A;  4DR2 E;  1YFH A;  2JWO A;  1HNX E;  5HPE A;  4NXM E;  4WYQ B;  5AC4 A;  2EMX A;  2NAB A;  2YTQ A;  2MDR A;  2LTR A;  4GZN C;  4MP0 A;  1EH8 A;  3TQM A;  3TGH A;  2EOF A;  4DUZ E;  5B8I A;  2EN8 A;  4FBK A;  2DMY A;  3M99 B;  1GTK A;  2YPN A;  3KZZ A;  4JI6 E;  1NEI A;  4LFC E;  2NYL C;  3QFK A;  1Z2W A;  4X8W A;  2EOM A;  2L2M A;  2YSP A;  1KBP A;  3E7A A;  5DNY A;  1FJG E;  2O8G A;  2Z1A A;  4LFB E;  2O8A A;  2ODR C;  2EMZ A;  2UUB E;  1ZBT A;  3ADI A;  3RQZ A;  5A6J A;  1AH5 A;  2EPU A;  2EM9 A;  3HTX A;  4DUY E;  1OI8 A;  1T71 A;  2XMO A;  3KBP A;  3MHS C;  1O0W A;  5IXM B;  2PRT A;  4ZVZ A;  4WWL A;  3ADG A;  1X49 A;  3LML A;  3JU0 A;  2LV2 A;  3ZU0 A;  3THN A;  4NHR A;  4Q35 B;  5KL7 A;  2KKN A;  2EPZ A;  4DR6 E;  4F9B B;  2WDD A;  1JK7 A;  4KWY A;  3E0J A;  2MKD A;  3MSW A;  1WAR A;  4YHH E;  2EWL A;  4JYA E;  1OID A;  2HYP A;  4M9V C;  4H2G A;  5JPF A;  2EOE A;  2WCC 3;  1U32 A;  2V87 A;  4OR9 A;  4M2Z A;  1S95 A;  3C4B A;  4JI0 E;  1M63 A;  1A1J A;  3QFN A;  3P71 C;  2LJU A;  4GKJ E;  4ORC A;  2DSY A;  3EPL A;  2H36 X;  1IQO A;  2M7Q A;  4DR4 E;  3GVE A;  3RMP A;  2B9D A;  2JR1 A;  2VRD A;  1TN9 A;  2EPR A;  2ELY A;  2YTG A;  2ADR A;  1PJQ A;  1YYK A;  2V89 A;  1PKP A;  2BDX A;  2E5L E;  5CFF E;  5LL6 R;  3T1H E;  5KL2 A;  2RSM A;  2B7V A;  4DV4 E;  1DI2 A;  2RS6 A;  2EPO A;  3HQ1 A;  5LMN E;  2GHF A;  1HO5 A;  3RL4 A;  2V85 A;  2EOH A;  3QFO A;  1WXR A;  3H66 A;  3H63 A;  4KKZ A;  4J6O A;  2ZOA A;  3AV0 A;  1RMD A;  2EM6 A;  4DSY A;  4DV2 E;  5F3W A;  2EOI A;  2EOO A;  3H62 B;  4IYP C;  2NXF A;  2Z72 A;  1WHQ A;  5LLQ A;  1GZ6 A;  2MKN A;  1SR9 A;  1MEY C;  1ZU1 A;  3F6G A;  3BID A;  2EM8 A;  4H2I A;  2I13 A;  2A25 A;  2EM2 A;  1B69 A;  2YTF A;  1ZBQ A;  4WX9 A;  4IS1 C;  2ODR D;  4F6M A;  4O4K A;  2DRP A;  4O43 A;  4HD0 A;  3IWC A;  4Q7F A;  2VF1 A;  2YTI A;  2L8T A;  4KZS A;  1S3N A;  2LVH A;  1EH7 A;  3VK6 A;  5IT9 C;  1XNQ E;  2EPM X;  3CK2 A;  1YUI A;  2BBG A;  4B3R E;  2YRM A;  2YTN A;  4M0V A;  2J7J A;  4AQY E;  1T39 A;  4JI4 E;  2N3H A;  3ECR A;  4DR3 E;  1I94 E;  1HNZ E;  4DT2 A;  3FGA C;  4BBY A;  1WAO 1;  3H61 A;  2L6M A;  1AAY A;  1BBG A;  4IJD A;  1YZ9 A;  2NYM C;  1N3G A;  3KWR A;  1N36 E;  2D9H A;  2VQF E;  3EPK A;  2EM7 A;  1JK2 A;  2WDF A;  2I9I A;  1YYO A;  1BBO A;  1DGC A;  2ENA A;  3ZTV A;  4WSP A;  4JA9 A;  1IT6 A;  4R8O A;  2JP9 A;  4WXD A;  1AUI A;  1UTE A;  1USH A;  3OTO E;  1EH6 A;  2WDE A;  2EJ4 A;  1L4S A;  3J7A G;  2DGC A;  2KHX A;  4P7D A;  4B2O A;  2B3T B;  2EMY A;  3AUZ A;  2ZO9 B;  1NNW A;  4WSG A;  2R1F A;  3VHT B;  2V86 A;  2YRH A;  2LMZ A;  3BF2 A;  1A1L A;  2WZO A;  3H68 A;  3H09 A;  1S70 A;  1KJK A;  2YTJ A;  1UBD C;  2EOQ A;  2LE2 A;  4DV7 E;  2MDG A;  2RQL A;  2EM0 A;  2YRK A;  4DV6 E;  2EQ3 A;  4KHP E;  1T70 A;  4ZX2 A;  1G2D C;  2HY1 A;  3HPS A;  4WFT A;  2EOS A;  2EPL X;  5A6A A;  2YSO A;  4P78 A;  1XMO E;  2EM4 A;  2F8B A;  4DV0 E;  2JOX A;  2LO3 A;  2E72 A;  3QG5 C;  4I5N C;  4WXC A;  3THO B;  4L8N A;  2EMH A;  2EMG A;  1TCO A;  4LAC C;  2Z06 A;  2EN2 A;  2GJU A;  3HPZ A;  1WJP A;  4OX9 E;  1XZW A;  2G7H A;  5TSE A;  4X65 E;  2UUA E;  3T1I A;  1T38 A;  2DB2 A;  1A1I A;  2R17 A;  5A6K A;  3DJW A;  4LF4 E;  4R03 A;  3DW8 C;  5AE1 A;  4ZYH A;  3J80 C;  1X5W A;  4DR7 E;  3L00 A;  3H64 A;  3ADJ A;  2EL5 A;  4YY3 E;  2ELZ A;  1IQS A;  4O5G A;  4G9J A;  4UWQ A;  1PJS A;  5AC5 A;  3EPJ A;  5AE3 A;  3LL8 A;  5JPE A;  2E1M A;  4L5N C;  2WDC A;  3PSO A;  5KL4 A;  2YTP A;  3C5W C;  4ZYG A;  4R2D A;  3EPH A;  4V0W A;  2EMB A;  2EPX A;  4BMJ A;  1IBM E;  1TF3 A;  4X62 E;  2EP3 A;  2GPI A;  3D03 A;  2L3C A;  2RSI A;  1X48 A;  1X6H A;  1HP1 A;  3RL3 A;  5C1V A;  1XNR E;  1LLM C;  2NUE A;  2YT4 A;  2LRS A;  2WBT A;  3DSC A;  1RQ0 A;  2HJJ A;  2FGG A;  3EGG A;  4K0K E;  4F6N A;  1IBL E;  2M4I A;  2EQ0 A;  3VYX A;  2L33 A;  2V83 A;  3UK3 C;  1EKZ A;  3ADL A;  3K6Q A;  2RTX A;  1QU6 A;  4DV1 E;  2UXB E;  4B3S E;  4TUG A;  1N32 E;  5INB A;  1WHN A;  4X9J A;  4R2Q A;  1GQE A;  2EMK A;  5KL6 A;  4B3M E;  5A69 A;  1BB8 A;  1PDA A;  2JOG A;  1HPU A;  1JK1 A;  4JI2 E;  4R2C A;  2EMW A;  5IV8 B;  3DSD A;  4NZV A;  2EQ1 A;  4ORB A;  4JI7 E;  4ZYD A;  2YTE A;  3OML A;  2EZ6 A;  3ICF A;  2V88 A;  3T1Y E;  2YZT A;  2MC5 A;  4V0X A;  1OIE A;  4FBQ A;  1PJT A;  1F2I G;  2F4V E;  4BHC A;  1X47 A;  1Z2X A;  4ORA A;  2YWQ A;  1X6F A;  3EGH A;  5AAS A;  1WRJ A;  4LF5 E;  1S3L A;  1X3C A;  2DIX A;  2EPP A;  4Q28 A;  4F9A B;  2EE8 A;  4H1S A;  2L92 A;  2NUG A;  2HYO A;  4MOV A;  4UT3 B;  5GTU A;  2EN6 A;  4R2E A;  2V8Q B;  2BB8 A;  1A1K A;  2EMF A;  1HNW E;  3HVQ A;  2IE3 C;  4RH8 A;  1P47 A;  2DLK A;  3JTZ A;  4JI5 E;  5BR8 E;  2AHD A;  2YTO A;  4I5L C;  2HC5 A;  1DQ3 A;  4LF7 E;  5IWA E;  2HGH A;  1RC7 A;  2K7I A;  2LUP B;  4JA7 A;  2JVA A;  2FTX B;  1FJM A;  3VYY A;  4UT3 A;  5FLX C;  1S8E A;  3P1X A;  2QJC A;  1Z1B A;  3H60 A;  2WBU A;  2EML A;  1NCS A;  1X6E A;  1MGT A;  3C9F A;  2ZBM A;  2EN1 A;  4DV3 E;  4F0Z A;  5AE2 A;  1ZR9 A;  2M9A A;  2EM5 A;  3J7Y p;  1ZAA C;  2A22 A;  2N3G A;  4J8Z A;  4HEI A;  4FCX A;  1T4O A;  5A6B A;  2L2N A;  4LTY A;  1TF6 A;  2EM3 A;  1T4N A;  4DV5 E;  2VQE E;  4BCA A;  1KYQ A;  4DHL A;  3IVD A;  2EPK X;  2EN4 A;  3LLH A;  1A1F A;  3IB7 A;  2N8X A;  3F6H A;  5LMU E;  1V73 A;  2LTS A;  4BC9 A;  2CSH A;  1UF3 A;  1HR0 E;  2EOR A;  4R2S A;  2CPN A;  1IBK E;  2B7T A;  2YVT A;  5T6J A;  2EL6 A;  1W24 A;  4JI3 E;  5KL3 A;  2UUC E;  3N5U A;  2DFJ A;  2Q8U A;  4R2A A;  1MF8 A;  3BGH A;  4BC7 A;  3RL5 A;  2ZM6 E;  4LU9 A;  4X66 E;  2RPC A;  1II7 A;  2EOJ A;  2R76 A;  4KBP A;  2IHR 1;  4LF9 E;  4I8O A;  4X64 E;  1S3M A;  2EPC A;  3J81 C;  2DMI A;  2YEQ A;  4JV5 E;  2JYA A;  3BBG A;  2USH A;  2KON A;  4JI1 E;  1G2F C;  1YYW A;  3IWD A;  2IAE C;  2YU5 A;  2DXN A;  2RS7 A;  1SFE A;  4JI8 E;  2JPA A;  2QFR A;  4MOY A;  2DLQ A;  4XPN A;  2EOY A;  5A6B D;  5A2Q C;  2LJH A;  3JAM C;  2LT7 A;  4B3T E;  3K7V C;  1T4L B;  2ENH A;  5IOH A;  2CT1 A;  3H69 A;  2LUQ A;  1UIL A;  1N34 E;  3FLO A;  2EPA A;  4F9C B;  2JOB A;  1FKA E;  4FBW A;  2JY9 A;  2K4V A;  3EQ1 A;  4M30 A;  1QHW A;  4GEQ B;  1UN6 B;  2BCD A;  2EMA A;  2EMI A;  2P6B A;  4DMI A;  3IB8 A;  2YTD A;  2QFP A;  3C6K A;  1QFC A;  1XM7 A;  4BS9 A;  2NA2 A;  2NUF A;  1UHZ A;  2EOX A;  4DKK A;  4FK5 C;  4NXN E;  4IL1 A;  2NPP C;  2KOU A;  4H2F A;  3JYF A;  5ADZ A;  1G5B A;  2EN3 A;  1QNT A;  2WBS A;  4DR1 E;  2EL4 A;  4RHB B;  2M1S A;  3C4T A;  2IE4 C;  2UXC E;  4V0V A;  2UXD E;  2UU9 E;  2CTD A;  4LFA E;  2DXL A;  2CV9 A;  4UT2 A; 
#chains in the Genus database with same CATH homology
 2Z06 A;  3E7B A;  4JA7 A;  2GJU A;  1FJM A;  1HO5 A;  3RL4 A;  4UT3 A;  1S8E A;  3H67 A;  1XZW A;  2QJC A;  3QFO A;  3H66 A;  3H63 A;  3H60 A;  5EQV A;  3T1I A;  3QFM A;  3C9F A;  4J6O A;  4KKZ A;  2ZOA A;  3AV0 A;  2ZBM A;  4TUI A;  4F0Z A;  2R17 A;  4DSY A;  3DW8 C;  3H64 A;  4IL1 A;  5F3W A;  3H62 B;  4IYP C;  2A22 A;  2NXF A;  2Z72 A;  4G9J A;  4O5G A;  4UWQ A;  1SU1 A;  4FCX A;  3LL8 A;  5J28 A;  4LTY A;  4H2I A;  5JPE A;  2WDC A;  3PSO A;  4H1Y P;  2BQ8 X;  4DHL A;  3V4Y A;  3PSN A;  3IVD A;  4YKE A;  3C5W C;  4O4K A;  5JJT A;  3IB7 A;  4O43 A;  4HD0 A;  1V73 A;  4Q7F A;  4V0W A;  4H2B A;  1UF3 A;  3D03 A;  1S3N A;  1HP1 A;  3RL3 A;  5C1V A;  3CK2 A;  2YVT A;  3DSC A;  3IVE A;  1W24 A;  3K7W C;  4O24 A;  3EGG A;  5HPE A;  3N5U A;  2DFJ A;  4M0V A;  2Q8U A;  1MF8 A;  3RL5 A;  4MP0 A;  4DT2 A;  4LU9 A;  3FGA C;  3TGH A;  1II7 A;  4KBP A;  1WAO 1;  3H61 A;  5B8I A;  4FBK A;  1S3M A;  2NYL C;  3QFK A;  2NYM C;  2YEQ A;  1Z2W A;  4TUG A;  5INB A;  1KBP A;  2USH A;  3E7A A;  5DNY A;  2O8G A;  2Z1A A;  2JOG A;  2O8A A;  1HPU A;  2IAE C;  2WDF A;  2DXN A;  3RQZ A;  2QFR A;  2XMO A;  1OI8 A;  1T71 A;  4MOY A;  3DSD A;  4XPN A;  4NZV A;  3KBP A;  4ORB A;  4ZVZ A;  4WWL A;  3ZTV A;  3K7V C;  4JA9 A;  1IT6 A;  5IOH A;  3ZU0 A;  3THN A;  3ICF A;  1UTE A;  1AUI A;  1USH A;  2KKN A;  2WDE A;  4V0X A;  3H69 A;  2WDD A;  1OIE A;  4FBQ A;  1JK7 A;  3FLO A;  3E0J A;  4B2O A;  1Z2X A;  4ORA A;  4FBW A;  3EGH A;  2ZO9 B;  3AUZ A;  1WAR A;  1NNW A;  1OID A;  1QHW A;  1S3L A;  2BCD A;  2P6B A;  2HYP A;  4H2G A;  5JPF A;  3IB8 A;  1U32 A;  4OR9 A;  2QFP A;  3H68 A;  1QFC A;  4H1S A;  1XM7 A;  1S70 A;  2HYO A;  4MOV A;  4UT3 B;  1S95 A;  5GTU A;  1M63 A;  4ZX2 A;  1T70 A;  3QFN A;  2NPP C;  3P71 C;  2HY1 A;  3HVQ A;  4H2F A;  4ORC A;  3JYF A;  1G5B A;  2IE3 C;  3GVE A;  2AHD A;  4I5L C;  2IE4 C;  4V0V A;  3QG5 C;  4I5N C;  3THO B;  2DXL A;  2CV9 A;  4UT2 A;  1TCO A;  4LAC C;  2BDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...