3CK2A

Crystal structure of conserved uncharacterized protein (predicted phosphoesterase cog0622) from streptococcus pneumoniae tigr4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
174
Chain Sequence
AMAKQTIIVMSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNMDFYAGYPERLVTELGSTKIIQTHGHLFDINFNFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFKVDFLTRDHEVYPGLSKEFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved uncharacterized protein (predicted phosphoesterase COG0622) from Streptococcus pneumoniae TIGR4.
rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords Conserved uncharacterized protein (predicted phosphoesterase
total genus 45
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ck2A00
4MP0A 4I5NC 2ZBMA 4B2OA 4V0XA 1G5BA 4O5GA 3FGAC 3THOB 3ICFA 2AHDA 2IE3C 5JPEA 4XPNA 2BDXA 1WARA 1T71A 4H2FA 4Q7FA 3THNA 4V0VA 2YVTA 3RQZA 4G9JA 5DNYA 4NZVA 2HYPA 1OIEA 1T70A 2DFJA 3E7BA 3RL3A 4UWQA 2Z06A 4ORBA 1V73A 2USHA 3H63A 4OR9A 5C1VA 3V4YA 1UF3A 1II7A 3JYFA 5IOHA 3H62B 1JK7A 4F0ZA 2P6BA 1HO5A 4V0WA 4ZX2A 2NYLC 2IAEC 2CV9A 4FBKA 1OIDA 4H2BA 2BCDA 2QFRA 1UTEA 2R17A 4TUIA 1U32A 1XZWA 1AUIA 5JPFA 1XM7A 3EGGA 3H61A 1HP1A 2WDFA 1NNWA 4O4KA 1HPUA 1S8EA 2NYMC 3P71C 2QFPA 1FJMA 3KBPA 2Z72A 3ZTVA 3CK2A 4HD0A 2NPPC 3K7WC 1S3MA 3PSOA 2O8GA 5GTUA 3EGHA 2WDCA 3HVQA 4YKEA 4ORAA 3AUZA 5F3WA 3IVDA 5HPEA 3LL8A 4UT2A 2GJUA 2NXFA 3RL5A 3QFNA 1Z2XA 4IYPC 4M0VA 4H1YP 3PSNA 1S3NA 3QFMA 3T1IA 3GVEA 4H2GA 1QFCA 2HY1A 3H69A 3DSDA 3DSCA 3IVEA 3H67A 4MOYA 1M63A 4O24A 1S3LA 3K7VC 3H64A 4MOVA 5J28A 1S70A 1MF8A 2WDDA 3IB7A 5INBA 2JOGA 4ORCA 4H1SA 1WAO1 4FBWA 4IL1A 4FBQA 5EQVA 3E7AA 4I5LC 4DHLA 4DT2A 3H66A 2QJCA 3C5WC 2BQ8X 1Z2WA 3QG5C 4TUGA 3C9FA 3H60A 4DSYA 3AV0A 2Q8UA 2XMOA 3QFOA 1IT6A 4J6OA 4LTYA 4UT3B 3RL4A 3H68A 4JA9A 3DW8C 5JJTA 1USHA 4FCXA 1TCOA 1SU1A 2O8AA 1W24A 2HYOA 2Z1AA 2A22A 3IB8A 4O43A 4JA7A 4WWLA 4KKZA 1S95A 3N5UA 4LU9A 3ZU0A 4LACC 4UT3A 5B8IA 4KBPA 2IE4C 4H2IA 1QHWA 2WDEA 1OI8A 4ZVZA 3QFKA 3TGHA 2KKNA 1KBPA
chains in the Genus database with same CATH superfamily
4MP0A 4I5NC 2ZBMA 4B2OA 4V0XA 1G5BA 4O5GA 3FGAC 3THOB 3ICFA 2AHDA 2IE3C 5JPEA 4XPNA 2BDXA 1WARA 1T71A 4H2FA 4Q7FA 2YEQA 3THNA 4V0VA 2YVTA 3RQZA 4G9JA 5DNYA 4NZVA 2HYPA 2DXNA 1OIEA 1T70A 2DFJA 3E7BA 3RL3A 4UWQA 2Z06A 4ORBA 1V73A 2USHA 3H63A 4OR9A 5C1VA 3V4YA 1UF3A 1II7A 3JYFA 5IOHA 3H62B 1JK7A 4F0ZA 2P6BA 1HO5A 4V0WA 4ZX2A 2NYLC 2IAEC 2CV9A 4FBKA 1OIDA 4H2BA 2BCDA 2QFRA 1UTEA 2R17A 3D03A 4TUIA 1U32A 1XZWA 1AUIA 5JPFA 1XM7A 3EGGA 3H61A 1HP1A 2WDFA 1NNWA 4O4KA 1HPUA 1S8EA 2NYMC 3P71C 2QFPA 1FJMA 3KBPA 2Z72A 3ZTVA 3CK2A 4HD0A 2NPPC 3K7WC 1S3MA 3PSOA 2O8GA 5GTUA 3EGHA 2WDCA 3FLOA 3HVQA 4YKEA 4ORAA 3AUZA 5F3WA 3IVDA 5HPEA 3LL8A 4UT2A 2GJUA 2NXFA 3RL5A 3QFNA 1Z2XA 4IYPC 4M0VA 2ZOAA 4H1YP 3PSNA 1S3NA 3QFMA 3T1IA 3GVEA 4H2GA 1QFCA 2HY1A 3H69A 3DSDA 3DSCA 3IVEA 3H67A 4MOYA 1M63A 4O24A 2ZO9B 1S3LA 3K7VC 3H64A 2DXLA 4MOVA 5J28A 1S70A 1MF8A 2WDDA 3IB7A 5INBA 2JOGA 4ORCA 4H1SA 1WAO1 4FBWA 4IL1A 4FBQA 5EQVA 3E7AA 4I5LC 4DHLA 4DT2A 3H66A 2QJCA 3C5WC 2BQ8X 1Z2WA 3QG5C 4TUGA 3C9FA 3H60A 4DSYA 3AV0A 2Q8UA 2XMOA 3QFOA 1IT6A 4J6OA 4LTYA 4UT3B 3RL4A 3H68A 4JA9A 3DW8C 5JJTA 1USHA 4FCXA 1TCOA 1SU1A 2O8AA 1W24A 2HYOA 2Z1AA 2A22A 3IB8A 4O43A 4JA7A 4WWLA 4KKZA 1S95A 3N5UA 4LU9A 3ZU0A 4LACC 4UT3A 5B8IA 4KBPA 3E0JA 2IE4C 4H2IA 1QHWA 2WDEA 1OI8A 4ZVZA 3QFKA 3TGHA 2KKNA 1KBPA
chains in the Genus database with same CATH topology
4MP0A 4I5NC 2ZBMA 4B2OA 4V0XA 1G5BA 4O5GA 3FGAC 3THOB 3ICFA 2AHDA 2IE3C 5JPEA 4XPNA 2BDXA 1WARA 1T71A 4H2FA 4Q7FA 2YEQA 3THNA 4V0VA 2YVTA 3RQZA 4G9JA 5DNYA 4NZVA 2HYPA 2DXNA 1OIEA 1T70A 2DFJA 3E7BA 3RL3A 4UWQA 2Z06A 4ORBA 1V73A 2USHA 3H63A 4OR9A 5C1VA 3V4YA 1UF3A 1II7A 3JYFA 5IOHA 3H62B 1JK7A 4F0ZA 2P6BA 1HO5A 4V0WA 4ZX2A 2NYLC 2IAEC 2CV9A 4FBKA 1OIDA 4H2BA 2BCDA 2QFRA 1UTEA 2R17A 3D03A 4TUIA 1U32A 1XZWA 1AUIA 5JPFA 1XM7A 3EGGA 3H61A 1HP1A 2WDFA 1NNWA 4O4KA 1HPUA 1S8EA 2NYMC 3P71C 2QFPA 1FJMA 3KBPA 2Z72A 3ZTVA 3CK2A 4HD0A 2NPPC 3K7WC 1S3MA 3PSOA 2O8GA 5GTUA 3EGHA 2WDCA 3FLOA 3HVQA 4YKEA 4ORAA 3AUZA 5F3WA 3IVDA 5HPEA 3LL8A 4UT2A 2GJUA 2NXFA 3RL5A 3QFNA 1Z2XA 4IYPC 4M0VA 2ZOAA 4H1YP 3PSNA 1S3NA 3QFMA 3T1IA 3GVEA 4H2GA 1QFCA 2HY1A 3H69A 3DSDA 3DSCA 3IVEA 3H67A 4MOYA 1M63A 4O24A 2ZO9B 1S3LA 3K7VC 3H64A 2DXLA 4MOVA 5J28A 1S70A 1MF8A 2WDDA 3IB7A 5INBA 2JOGA 4ORCA 4H1SA 1WAO1 4FBWA 4IL1A 4FBQA 5EQVA 3E7AA 4I5LC 4DHLA 4DT2A 3H66A 2QJCA 3C5WC 2BQ8X 1Z2WA 3QG5C 4TUGA 3C9FA 3H60A 4DSYA 3AV0A 2Q8UA 2XMOA 3QFOA 1IT6A 4J6OA 4LTYA 4UT3B 3RL4A 3H68A 4JA9A 3DW8C 5JJTA 1USHA 4FCXA 1TCOA 1SU1A 2O8AA 1W24A 2HYOA 2Z1AA 2A22A 3IB8A 4O43A 4JA7A 4WWLA 4KKZA 1S95A 3N5UA 4LU9A 3ZU0A 4LACC 4UT3A 5B8IA 4KBPA 3E0JA 2IE4C 4H2IA 1QHWA 2WDEA 1OI8A 4ZVZA 3QFKA 3TGHA 2KKNA 1KBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MP0 A;  4I5N C;  2ZBM A;  4B2O A;  4V0X A;  1G5B A;  4O5G A;  3FGA C;  3THO B;  3ICF A;  2AHD A;  2IE3 C;  5JPE A;  4XPN A;  2BDX A;  1WAR A;  1T71 A;  4H2F A;  4Q7F A;  3THN A;  4V0V A;  2YVT A;  3RQZ A;  4G9J A;  5DNY A;  4NZV A;  2HYP A;  1OIE A;  1T70 A;  2DFJ A;  3E7B A;  3RL3 A;  4UWQ A;  2Z06 A;  4ORB A;  1V73 A;  2USH A;  3H63 A;  4OR9 A;  5C1V A;  3V4Y A;  1UF3 A;  1II7 A;  3JYF A;  5IOH A;  3H62 B;  1JK7 A;  4F0Z A;  2P6B A;  1HO5 A;  4V0W A;  4ZX2 A;  2NYL C;  2IAE C;  2CV9 A;  4FBK A;  1OID A;  4H2B A;  2BCD A;  2QFR A;  1UTE A;  2R17 A;  4TUI A;  1U32 A;  1XZW A;  1AUI A;  5JPF A;  1XM7 A;  3EGG A;  3H61 A;  1HP1 A;  2WDF A;  1NNW A;  4O4K A;  1HPU A;  1S8E A;  2NYM C;  3P71 C;  2QFP A;  1FJM A;  3KBP A;  2Z72 A;  3ZTV A;  3CK2 A;  4HD0 A;  2NPP C;  3K7W C;  1S3M A;  3PSO A;  2O8G A;  5GTU A;  3EGH A;  2WDC A;  3HVQ A;  4YKE A;  4ORA A;  3AUZ A;  5F3W A;  3IVD A;  5HPE A;  3LL8 A;  4UT2 A;  2GJU A;  2NXF A;  3RL5 A;  3QFN A;  1Z2X A;  4IYP C;  4M0V A;  4H1Y P;  3PSN A;  1S3N A;  3QFM A;  3T1I A;  3GVE A;  4H2G A;  1QFC A;  2HY1 A;  3H69 A;  3DSD A;  3DSC A;  3IVE A;  3H67 A;  4MOY A;  1M63 A;  4O24 A;  1S3L A;  3K7V C;  3H64 A;  4MOV A;  5J28 A;  1S70 A;  1MF8 A;  2WDD A;  3IB7 A;  5INB A;  2JOG A;  4ORC A;  4H1S A;  1WAO 1;  4FBW A;  4IL1 A;  4FBQ A;  5EQV A;  3E7A A;  4I5L C;  4DHL A;  4DT2 A;  3H66 A;  2QJC A;  3C5W C;  2BQ8 X;  1Z2W A;  3QG5 C;  4TUG A;  3C9F A;  3H60 A;  4DSY A;  3AV0 A;  2Q8U A;  2XMO A;  3QFO A;  1IT6 A;  4J6O A;  4LTY A;  4UT3 B;  3RL4 A;  3H68 A;  4JA9 A;  3DW8 C;  5JJT A;  1USH A;  4FCX A;  1TCO A;  1SU1 A;  2O8A A;  1W24 A;  2HYO A;  2Z1A A;  2A22 A;  3IB8 A;  4O43 A;  4JA7 A;  4WWL A;  4KKZ A;  1S95 A;  3N5U A;  4LU9 A;  3ZU0 A;  4LAC C;  4UT3 A;  5B8I A;  4KBP A;  2IE4 C;  4H2I A;  1QHW A;  2WDE A;  1OI8 A;  4ZVZ A;  3QFK A;  3TGH A;  2KKN A;  1KBP A; 
#chains in the Genus database with same CATH topology
 4MP0 A;  4I5N C;  2ZBM A;  4B2O A;  4V0X A;  1G5B A;  4O5G A;  3FGA C;  3THO B;  3ICF A;  2AHD A;  2IE3 C;  5JPE A;  4XPN A;  2BDX A;  1WAR A;  1T71 A;  4H2F A;  4Q7F A;  2YEQ A;  3THN A;  4V0V A;  2YVT A;  3RQZ A;  4G9J A;  5DNY A;  4NZV A;  2HYP A;  2DXN A;  1OIE A;  1T70 A;  2DFJ A;  3E7B A;  3RL3 A;  4UWQ A;  2Z06 A;  4ORB A;  1V73 A;  2USH A;  3H63 A;  4OR9 A;  5C1V A;  3V4Y A;  1UF3 A;  1II7 A;  3JYF A;  5IOH A;  3H62 B;  1JK7 A;  4F0Z A;  2P6B A;  1HO5 A;  4V0W A;  4ZX2 A;  2NYL C;  2IAE C;  2CV9 A;  4FBK A;  1OID A;  4H2B A;  2BCD A;  2QFR A;  1UTE A;  2R17 A;  3D03 A;  4TUI A;  1U32 A;  1XZW A;  1AUI A;  5JPF A;  1XM7 A;  3EGG A;  3H61 A;  1HP1 A;  2WDF A;  1NNW A;  4O4K A;  1HPU A;  1S8E A;  2NYM C;  3P71 C;  2QFP A;  1FJM A;  3KBP A;  2Z72 A;  3ZTV A;  3CK2 A;  4HD0 A;  2NPP C;  3K7W C;  1S3M A;  3PSO A;  2O8G A;  5GTU A;  3EGH A;  2WDC A;  3FLO A;  3HVQ A;  4YKE A;  4ORA A;  3AUZ A;  5F3W A;  3IVD A;  5HPE A;  3LL8 A;  4UT2 A;  2GJU A;  2NXF A;  3RL5 A;  3QFN A;  1Z2X A;  4IYP C;  4M0V A;  2ZOA A;  4H1Y P;  3PSN A;  1S3N A;  3QFM A;  3T1I A;  3GVE A;  4H2G A;  1QFC A;  2HY1 A;  3H69 A;  3DSD A;  3DSC A;  3IVE A;  3H67 A;  4MOY A;  1M63 A;  4O24 A;  2ZO9 B;  1S3L A;  3K7V C;  3H64 A;  2DXL A;  4MOV A;  5J28 A;  1S70 A;  1MF8 A;  2WDD A;  3IB7 A;  5INB A;  2JOG A;  4ORC A;  4H1S A;  1WAO 1;  4FBW A;  4IL1 A;  4FBQ A;  5EQV A;  3E7A A;  4I5L C;  4DHL A;  4DT2 A;  3H66 A;  2QJC A;  3C5W C;  2BQ8 X;  1Z2W A;  3QG5 C;  4TUG A;  3C9F A;  3H60 A;  4DSY A;  3AV0 A;  2Q8U A;  2XMO A;  3QFO A;  1IT6 A;  4J6O A;  4LTY A;  4UT3 B;  3RL4 A;  3H68 A;  4JA9 A;  3DW8 C;  5JJT A;  1USH A;  4FCX A;  1TCO A;  1SU1 A;  2O8A A;  1W24 A;  2HYO A;  2Z1A A;  2A22 A;  3IB8 A;  4O43 A;  4JA7 A;  4WWL A;  4KKZ A;  1S95 A;  3N5U A;  4LU9 A;  3ZU0 A;  4LAC C;  4UT3 A;  5B8I A;  4KBP A;  3E0J A;  2IE4 C;  4H2I A;  1QHW A;  2WDE A;  1OI8 A;  4ZVZ A;  3QFK A;  3TGH A;  2KKN A;  1KBP A; 
#chains in the Genus database with same CATH homology
 4MP0 A;  4I5N C;  2ZBM A;  4B2O A;  4V0X A;  1G5B A;  4O5G A;  3FGA C;  3THO B;  3ICF A;  2AHD A;  2IE3 C;  5JPE A;  4XPN A;  2BDX A;  1WAR A;  1T71 A;  4H2F A;  4Q7F A;  2YEQ A;  3THN A;  4V0V A;  2YVT A;  3RQZ A;  4G9J A;  5DNY A;  4NZV A;  2HYP A;  2DXN A;  1OIE A;  1T70 A;  2DFJ A;  3E7B A;  3RL3 A;  4UWQ A;  2Z06 A;  4ORB A;  1V73 A;  2USH A;  3H63 A;  4OR9 A;  5C1V A;  3V4Y A;  1UF3 A;  1II7 A;  3JYF A;  5IOH A;  3H62 B;  1JK7 A;  4F0Z A;  2P6B A;  1HO5 A;  4V0W A;  4ZX2 A;  2NYL C;  2IAE C;  2CV9 A;  4FBK A;  1OID A;  4H2B A;  2BCD A;  2QFR A;  1UTE A;  2R17 A;  3D03 A;  4TUI A;  1U32 A;  1XZW A;  1AUI A;  5JPF A;  1XM7 A;  3EGG A;  3H61 A;  1HP1 A;  2WDF A;  1NNW A;  4O4K A;  1HPU A;  1S8E A;  2NYM C;  3P71 C;  2QFP A;  1FJM A;  3KBP A;  2Z72 A;  3ZTV A;  3CK2 A;  4HD0 A;  2NPP C;  3K7W C;  1S3M A;  3PSO A;  2O8G A;  5GTU A;  3EGH A;  2WDC A;  3FLO A;  3HVQ A;  4YKE A;  4ORA A;  3AUZ A;  5F3W A;  3IVD A;  5HPE A;  3LL8 A;  4UT2 A;  2GJU A;  2NXF A;  3RL5 A;  3QFN A;  1Z2X A;  4IYP C;  4M0V A;  2ZOA A;  4H1Y P;  3PSN A;  1S3N A;  3QFM A;  3T1I A;  3GVE A;  4H2G A;  1QFC A;  2HY1 A;  3H69 A;  3DSD A;  3DSC A;  3IVE A;  3H67 A;  4MOY A;  1M63 A;  4O24 A;  2ZO9 B;  1S3L A;  3K7V C;  3H64 A;  2DXL A;  4MOV A;  5J28 A;  1S70 A;  1MF8 A;  2WDD A;  3IB7 A;  5INB A;  2JOG A;  4ORC A;  4H1S A;  1WAO 1;  4FBW A;  4IL1 A;  4FBQ A;  5EQV A;  3E7A A;  4I5L C;  4DHL A;  4DT2 A;  3H66 A;  2QJC A;  3C5W C;  2BQ8 X;  1Z2W A;  3QG5 C;  4TUG A;  3C9F A;  3H60 A;  4DSY A;  3AV0 A;  2Q8U A;  2XMO A;  3QFO A;  1IT6 A;  4J6O A;  4LTY A;  4UT3 B;  3RL4 A;  3H68 A;  4JA9 A;  3DW8 C;  5JJT A;  1USH A;  4FCX A;  1TCO A;  1SU1 A;  2O8A A;  1W24 A;  2HYO A;  2Z1A A;  2A22 A;  3IB8 A;  4O43 A;  4JA7 A;  4WWL A;  4KKZ A;  1S95 A;  3N5U A;  4LU9 A;  3ZU0 A;  4LAC C;  4UT3 A;  5B8I A;  4KBP A;  3E0J A;  2IE4 C;  4H2I A;  1QHW A;  2WDE A;  1OI8 A;  4ZVZ A;  3QFK A;  3TGH A;  2KKN A;  1KBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...