3CK2A

Crystal structure of conserved uncharacterized protein (predicted phosphoesterase cog0622) from streptococcus pneumoniae tigr4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
174
Chain Sequence
AMAKQTIIVMSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNMDFYAGYPERLVTELGSTKIIQTHGHLFDINFNFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFKVDFLTRDHEVYPGLSKEFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved uncharacterized protein (predicted phosphoesterase COG0622) from Streptococcus pneumoniae TIGR4.
rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords Conserved uncharacterized protein (predicted phosphoesterase
total genus 45
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ck2A00
1XZWA 3LL8A 2O8GA 2BDXA 2O8AA 1W24A 2IAEC 2NXFA 4JA7A 2IE4C 3C5WC 3H62B 4DHLA 4MOYA 1M63A 4TUIA 4NZVA 4MP0A 2CV9A 2USHA 2Z1AA 4MOVA 4UT2A 1T71A 4KBPA 4O5GA 3H64A 4O43A 3H67A 3E7AA 5GTUA 1AUIA 1S3NA 1OIDA 2WDEA 2ZBMA 4FBQA 5B8IA 1XM7A 2QFRA 3PSNA 4F0ZA 4H2FA 4ORAA 3C9FA 4H1SA 5JPEA 3QFMA 5F3WA 2Z06A 3QFOA 3DSDA 1QFCA 4H2BA 4H2GA 1S95A 3IB7A 2WDFA 3ICFA 5EQVA 5DNYA 2BQ8X 4DSYA 4M0VA 3H63A 4H2IA 3QG5C 1HPUA 3DW8C 2R17A 3THNA 3ZTVA 1WARA 1UTEA 3IB8A 3K7WC 4UWQA 3TGHA 1OI8A 2Q8UA 3HVQA 2NYMC 3P71C 3AUZA 3KBPA 4JA9A 3RL5A 3V4YA 3THOB 3DSCA 4I5LC 5HPEA 3GVEA 4B2OA 1S3LA 3H61A 3N5UA 4DT2A 4UT3B 3RQZA 1MF8A 4IYPC 4OR9A 2P6BA 1U32A 2HYOA 4Q7FA 2NYLC 1HO5A 2WDDA 1II7A 1TCOA 4KKZA 4XPNA 4LU9A 4V0VA 4ZVZA 5JPFA 1HP1A 2XMOA 4ZX2A 3QFKA 1KBPA 3QFNA 3E7BA 3K7VC 4V0WA 1SU1A 4G9JA 4HD0A 4LTYA 4ORBA 4YKEA 2AHDA 3IVEA 3AV0A 4H1YP 5INBA 3RL4A 4FBWA 2Z72A 1S70A 4UT3A 3JYFA 2JOGA 1OIEA 3H69A 4TUGA 3RL3A 1S3MA 4WWLA 3H68A 1USHA 2DFJA 4LACC 1WAO1 1V73A 1NNWA 4O24A 4I5NC 3EGGA 1T70A 2NPPC 4FCXA 4ORCA 2YVTA 1G5BA 4V0XA 2IE3C 5J28A 4J6OA 5JJTA 3H60A 1JK7A 4IL1A 4O4KA 2QFPA 3ZU0A 1QHWA 1Z2XA 2HY1A 2GJUA 3T1IA 4FBKA 1S8EA 1UF3A 3H66A 3PSOA 2WDCA 3CK2A 2QJCA 2KKNA 3IVDA 3EGHA 2A22A 5IOHA 2HYPA 1FJMA 5C1VA 2BCDA 1Z2WA 1IT6A 3FGAC
chains in the Genus database with same CATH superfamily
1XZWA 3LL8A 2O8GA 2BDXA 2O8AA 1W24A 2IAEC 2NXFA 4JA7A 2IE4C 3C5WC 3H62B 4DHLA 4MOYA 1M63A 4TUIA 4NZVA 4MP0A 2CV9A 2USHA 2Z1AA 4MOVA 4UT2A 1T71A 4KBPA 4O5GA 3H64A 4O43A 3H67A 2ZO9B 3E7AA 5GTUA 1AUIA 1S3NA 1OIDA 2WDEA 2ZBMA 4FBQA 5B8IA 1XM7A 2QFRA 3PSNA 4F0ZA 4H2FA 4ORAA 3C9FA 4H1SA 5JPEA 3QFMA 5F3WA 2Z06A 3QFOA 3DSDA 1QFCA 4H2BA 4H2GA 1S95A 2DXNA 3IB7A 2WDFA 3ICFA 5EQVA 5DNYA 2BQ8X 4DSYA 4M0VA 3H63A 4H2IA 3E0JA 3QG5C 1HPUA 3DW8C 2R17A 3THNA 3ZTVA 1WARA 1UTEA 3IB8A 3K7WC 4UWQA 3TGHA 1OI8A 2Q8UA 3HVQA 2NYMC 3P71C 3AUZA 3KBPA 4JA9A 3RL5A 3V4YA 3THOB 3DSCA 3FLOA 4I5LC 3GVEA 4B2OA 1S3LA 3H61A 3N5UA 5HPEA 4DT2A 4UT3B 3RQZA 1MF8A 4IYPC 4OR9A 2P6BA 1U32A 2HYOA 4Q7FA 2NYLC 1HO5A 2WDDA 1II7A 1TCOA 4KKZA 4XPNA 4LU9A 4V0VA 4ZVZA 5JPFA 1HP1A 2YEQA 2XMOA 4ZX2A 2ZOAA 3QFKA 1KBPA 3QFNA 3E7BA 3K7VC 4V0WA 1SU1A 4G9JA 4HD0A 4LTYA 4ORBA 4YKEA 2AHDA 3IVEA 3AV0A 4H1YP 5INBA 3RL4A 4FBWA 2Z72A 1S70A 4UT3A 3JYFA 2JOGA 1OIEA 3H69A 4TUGA 3RL3A 1S3MA 2DXLA 4WWLA 3H68A 1USHA 2DFJA 4LACC 1WAO1 1V73A 1NNWA 4O24A 4I5NC 3EGGA 1T70A 2NPPC 4FCXA 4ORCA 2YVTA 1G5BA 4V0XA 2IE3C 5J28A 4J6OA 5JJTA 3H60A 1JK7A 4IL1A 4O4KA 2QFPA 3ZU0A 1QHWA 1Z2XA 2HY1A 2GJUA 3T1IA 3D03A 4FBKA 1S8EA 1UF3A 3H66A 3PSOA 2WDCA 3CK2A 2QJCA 2KKNA 3IVDA 3EGHA 2A22A 5IOHA 2HYPA 1FJMA 5C1VA 2BCDA 1Z2WA 1IT6A 3FGAC
chains in the Genus database with same CATH topology
1XZWA 3LL8A 2O8GA 2BDXA 2O8AA 1W24A 2IAEC 2NXFA 4JA7A 2IE4C 3C5WC 3H62B 4DHLA 4MOYA 1M63A 4TUIA 4NZVA 4MP0A 2CV9A 2USHA 2Z1AA 4MOVA 4UT2A 1T71A 4KBPA 4O5GA 3H64A 4O43A 3H67A 2ZO9B 3E7AA 5GTUA 1AUIA 1S3NA 1OIDA 2WDEA 2ZBMA 4FBQA 5B8IA 1XM7A 2QFRA 3PSNA 4F0ZA 4H2FA 4ORAA 3C9FA 4H1SA 5JPEA 3QFMA 5F3WA 2Z06A 3QFOA 3DSDA 1QFCA 4H2BA 4H2GA 1S95A 2DXNA 3IB7A 2WDFA 3ICFA 5EQVA 5DNYA 2BQ8X 4DSYA 4M0VA 3H63A 4H2IA 3E0JA 3QG5C 1HPUA 3DW8C 2R17A 3THNA 3ZTVA 1WARA 1UTEA 3IB8A 3K7WC 4UWQA 3TGHA 1OI8A 2Q8UA 3HVQA 2NYMC 3P71C 3AUZA 3KBPA 4JA9A 3RL5A 3V4YA 3THOB 3DSCA 3FLOA 4I5LC 3GVEA 4B2OA 1S3LA 3H61A 3N5UA 5HPEA 4DT2A 4UT3B 3RQZA 1MF8A 4IYPC 4OR9A 2P6BA 1U32A 2HYOA 4Q7FA 2NYLC 1HO5A 2WDDA 1II7A 1TCOA 4KKZA 4XPNA 4LU9A 4V0VA 4ZVZA 5JPFA 1HP1A 2YEQA 2XMOA 4ZX2A 2ZOAA 3QFKA 1KBPA 3QFNA 3E7BA 3K7VC 4V0WA 1SU1A 4G9JA 4HD0A 4LTYA 4ORBA 4YKEA 2AHDA 3IVEA 3AV0A 4H1YP 5INBA 3RL4A 4FBWA 2Z72A 1S70A 4UT3A 3JYFA 2JOGA 1OIEA 3H69A 4TUGA 3RL3A 1S3MA 2DXLA 4WWLA 3H68A 1USHA 2DFJA 4LACC 1WAO1 1V73A 1NNWA 4O24A 4I5NC 3EGGA 1T70A 2NPPC 4FCXA 4ORCA 2YVTA 1G5BA 4V0XA 2IE3C 5J28A 4J6OA 5JJTA 3H60A 1JK7A 4IL1A 4O4KA 2QFPA 3ZU0A 1QHWA 1Z2XA 2HY1A 2GJUA 3T1IA 3D03A 4FBKA 1S8EA 1UF3A 3H66A 3PSOA 2WDCA 3CK2A 2QJCA 2KKNA 3IVDA 3EGHA 2A22A 5IOHA 2HYPA 1FJMA 5C1VA 2BCDA 1Z2WA 1IT6A 3FGAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZW A;  3LL8 A;  2O8G A;  2BDX A;  2O8A A;  1W24 A;  2IAE C;  2NXF A;  4JA7 A;  2IE4 C;  3C5W C;  3H62 B;  4DHL A;  4MOY A;  1M63 A;  4TUI A;  4NZV A;  4MP0 A;  2CV9 A;  2USH A;  2Z1A A;  4MOV A;  4UT2 A;  1T71 A;  4KBP A;  4O5G A;  3H64 A;  4O43 A;  3H67 A;  3E7A A;  5GTU A;  1AUI A;  1S3N A;  1OID A;  2WDE A;  2ZBM A;  4FBQ A;  5B8I A;  1XM7 A;  2QFR A;  3PSN A;  4F0Z A;  4H2F A;  4ORA A;  3C9F A;  4H1S A;  5JPE A;  3QFM A;  5F3W A;  2Z06 A;  3QFO A;  3DSD A;  1QFC A;  4H2B A;  4H2G A;  1S95 A;  3IB7 A;  2WDF A;  3ICF A;  5EQV A;  5DNY A;  2BQ8 X;  4DSY A;  4M0V A;  3H63 A;  4H2I A;  3QG5 C;  1HPU A;  3DW8 C;  2R17 A;  3THN A;  3ZTV A;  1WAR A;  1UTE A;  3IB8 A;  3K7W C;  4UWQ A;  3TGH A;  1OI8 A;  2Q8U A;  3HVQ A;  2NYM C;  3P71 C;  3AUZ A;  3KBP A;  4JA9 A;  3RL5 A;  3V4Y A;  3THO B;  3DSC A;  4I5L C;  5HPE A;  3GVE A;  4B2O A;  1S3L A;  3H61 A;  3N5U A;  4DT2 A;  4UT3 B;  3RQZ A;  1MF8 A;  4IYP C;  4OR9 A;  2P6B A;  1U32 A;  2HYO A;  4Q7F A;  2NYL C;  1HO5 A;  2WDD A;  1II7 A;  1TCO A;  4KKZ A;  4XPN A;  4LU9 A;  4V0V A;  4ZVZ A;  5JPF A;  1HP1 A;  2XMO A;  4ZX2 A;  3QFK A;  1KBP A;  3QFN A;  3E7B A;  3K7V C;  4V0W A;  1SU1 A;  4G9J A;  4HD0 A;  4LTY A;  4ORB A;  4YKE A;  2AHD A;  3IVE A;  3AV0 A;  4H1Y P;  5INB A;  3RL4 A;  4FBW A;  2Z72 A;  1S70 A;  4UT3 A;  3JYF A;  2JOG A;  1OIE A;  3H69 A;  4TUG A;  3RL3 A;  1S3M A;  4WWL A;  3H68 A;  1USH A;  2DFJ A;  4LAC C;  1WAO 1;  1V73 A;  1NNW A;  4O24 A;  4I5N C;  3EGG A;  1T70 A;  2NPP C;  4FCX A;  4ORC A;  2YVT A;  1G5B A;  4V0X A;  2IE3 C;  5J28 A;  4J6O A;  5JJT A;  3H60 A;  1JK7 A;  4IL1 A;  4O4K A;  2QFP A;  3ZU0 A;  1QHW A;  1Z2X A;  2HY1 A;  2GJU A;  3T1I A;  4FBK A;  1S8E A;  1UF3 A;  3H66 A;  3PSO A;  2WDC A;  3CK2 A;  2QJC A;  2KKN A;  3IVD A;  3EGH A;  2A22 A;  5IOH A;  2HYP A;  1FJM A;  5C1V A;  2BCD A;  1Z2W A;  1IT6 A;  3FGA C; 
#chains in the Genus database with same CATH topology
 1XZW A;  3LL8 A;  2O8G A;  2BDX A;  2O8A A;  1W24 A;  2IAE C;  2NXF A;  4JA7 A;  2IE4 C;  3C5W C;  3H62 B;  4DHL A;  4MOY A;  1M63 A;  4TUI A;  4NZV A;  4MP0 A;  2CV9 A;  2USH A;  2Z1A A;  4MOV A;  4UT2 A;  1T71 A;  4KBP A;  4O5G A;  3H64 A;  4O43 A;  3H67 A;  2ZO9 B;  3E7A A;  5GTU A;  1AUI A;  1S3N A;  1OID A;  2WDE A;  2ZBM A;  4FBQ A;  5B8I A;  1XM7 A;  2QFR A;  3PSN A;  4F0Z A;  4H2F A;  4ORA A;  3C9F A;  4H1S A;  5JPE A;  3QFM A;  5F3W A;  2Z06 A;  3QFO A;  3DSD A;  1QFC A;  4H2B A;  4H2G A;  1S95 A;  2DXN A;  3IB7 A;  2WDF A;  3ICF A;  5EQV A;  5DNY A;  2BQ8 X;  4DSY A;  4M0V A;  3H63 A;  4H2I A;  3E0J A;  3QG5 C;  1HPU A;  3DW8 C;  2R17 A;  3THN A;  3ZTV A;  1WAR A;  1UTE A;  3IB8 A;  3K7W C;  4UWQ A;  3TGH A;  1OI8 A;  2Q8U A;  3HVQ A;  2NYM C;  3P71 C;  3AUZ A;  3KBP A;  4JA9 A;  3RL5 A;  3V4Y A;  3THO B;  3DSC A;  3FLO A;  4I5L C;  3GVE A;  4B2O A;  1S3L A;  3H61 A;  3N5U A;  5HPE A;  4DT2 A;  4UT3 B;  3RQZ A;  1MF8 A;  4IYP C;  4OR9 A;  2P6B A;  1U32 A;  2HYO A;  4Q7F A;  2NYL C;  1HO5 A;  2WDD A;  1II7 A;  1TCO A;  4KKZ A;  4XPN A;  4LU9 A;  4V0V A;  4ZVZ A;  5JPF A;  1HP1 A;  2YEQ A;  2XMO A;  4ZX2 A;  2ZOA A;  3QFK A;  1KBP A;  3QFN A;  3E7B A;  3K7V C;  4V0W A;  1SU1 A;  4G9J A;  4HD0 A;  4LTY A;  4ORB A;  4YKE A;  2AHD A;  3IVE A;  3AV0 A;  4H1Y P;  5INB A;  3RL4 A;  4FBW A;  2Z72 A;  1S70 A;  4UT3 A;  3JYF A;  2JOG A;  1OIE A;  3H69 A;  4TUG A;  3RL3 A;  1S3M A;  2DXL A;  4WWL A;  3H68 A;  1USH A;  2DFJ A;  4LAC C;  1WAO 1;  1V73 A;  1NNW A;  4O24 A;  4I5N C;  3EGG A;  1T70 A;  2NPP C;  4FCX A;  4ORC A;  2YVT A;  1G5B A;  4V0X A;  2IE3 C;  5J28 A;  4J6O A;  5JJT A;  3H60 A;  1JK7 A;  4IL1 A;  4O4K A;  2QFP A;  3ZU0 A;  1QHW A;  1Z2X A;  2HY1 A;  2GJU A;  3T1I A;  3D03 A;  4FBK A;  1S8E A;  1UF3 A;  3H66 A;  3PSO A;  2WDC A;  3CK2 A;  2QJC A;  2KKN A;  3IVD A;  3EGH A;  2A22 A;  5IOH A;  2HYP A;  1FJM A;  5C1V A;  2BCD A;  1Z2W A;  1IT6 A;  3FGA C; 
#chains in the Genus database with same CATH homology
 1XZW A;  3LL8 A;  2O8G A;  2BDX A;  2O8A A;  1W24 A;  2IAE C;  2NXF A;  4JA7 A;  2IE4 C;  3C5W C;  3H62 B;  4DHL A;  4MOY A;  1M63 A;  4TUI A;  4NZV A;  4MP0 A;  2CV9 A;  2USH A;  2Z1A A;  4MOV A;  4UT2 A;  1T71 A;  4KBP A;  4O5G A;  3H64 A;  4O43 A;  3H67 A;  2ZO9 B;  3E7A A;  5GTU A;  1AUI A;  1S3N A;  1OID A;  2WDE A;  2ZBM A;  4FBQ A;  5B8I A;  1XM7 A;  2QFR A;  3PSN A;  4F0Z A;  4H2F A;  4ORA A;  3C9F A;  4H1S A;  5JPE A;  3QFM A;  5F3W A;  2Z06 A;  3QFO A;  3DSD A;  1QFC A;  4H2B A;  4H2G A;  1S95 A;  2DXN A;  3IB7 A;  2WDF A;  3ICF A;  5EQV A;  5DNY A;  2BQ8 X;  4DSY A;  4M0V A;  3H63 A;  4H2I A;  3E0J A;  3QG5 C;  1HPU A;  3DW8 C;  2R17 A;  3THN A;  3ZTV A;  1WAR A;  1UTE A;  3IB8 A;  3K7W C;  4UWQ A;  3TGH A;  1OI8 A;  2Q8U A;  3HVQ A;  2NYM C;  3P71 C;  3AUZ A;  3KBP A;  4JA9 A;  3RL5 A;  3V4Y A;  3THO B;  3DSC A;  3FLO A;  4I5L C;  3GVE A;  4B2O A;  1S3L A;  3H61 A;  3N5U A;  5HPE A;  4DT2 A;  4UT3 B;  3RQZ A;  1MF8 A;  4IYP C;  4OR9 A;  2P6B A;  1U32 A;  2HYO A;  4Q7F A;  2NYL C;  1HO5 A;  2WDD A;  1II7 A;  1TCO A;  4KKZ A;  4XPN A;  4LU9 A;  4V0V A;  4ZVZ A;  5JPF A;  1HP1 A;  2YEQ A;  2XMO A;  4ZX2 A;  2ZOA A;  3QFK A;  1KBP A;  3QFN A;  3E7B A;  3K7V C;  4V0W A;  1SU1 A;  4G9J A;  4HD0 A;  4LTY A;  4ORB A;  4YKE A;  2AHD A;  3IVE A;  3AV0 A;  4H1Y P;  5INB A;  3RL4 A;  4FBW A;  2Z72 A;  1S70 A;  4UT3 A;  3JYF A;  2JOG A;  1OIE A;  3H69 A;  4TUG A;  3RL3 A;  1S3M A;  2DXL A;  4WWL A;  3H68 A;  1USH A;  2DFJ A;  4LAC C;  1WAO 1;  1V73 A;  1NNW A;  4O24 A;  4I5N C;  3EGG A;  1T70 A;  2NPP C;  4FCX A;  4ORC A;  2YVT A;  1G5B A;  4V0X A;  2IE3 C;  5J28 A;  4J6O A;  5JJT A;  3H60 A;  1JK7 A;  4IL1 A;  4O4K A;  2QFP A;  3ZU0 A;  1QHW A;  1Z2X A;  2HY1 A;  2GJU A;  3T1I A;  3D03 A;  4FBK A;  1S8E A;  1UF3 A;  3H66 A;  3PSO A;  2WDC A;  3CK2 A;  2QJC A;  2KKN A;  3IVD A;  3EGH A;  2A22 A;  5IOH A;  2HYP A;  1FJM A;  5C1V A;  2BCD A;  1Z2W A;  1IT6 A;  3FGA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...