3CK2A

Crystal structure of conserved uncharacterized protein (predicted phosphoesterase cog0622) from streptococcus pneumoniae tigr4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
174
Chain Sequence
AMAKQTIIVMSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNMDFYAGYPERLVTELGSTKIIQTHGHLFDINFNFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFKVDFLTRDHEVYPGLSKEFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Conserved uncharacterized protein (predicted phosphoesterase
publication title Crystal structure of conserved uncharacterized protein (predicted phosphoesterase COG0622) from Streptococcus pneumoniae TIGR4.
rcsb
source organism Streptococcus pneumoniae
total genus 45
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ck2A00
1S3NA 1U32A 5JJTA 4V0WA 4IYPC 3C5WC 2O8AA 3H69A 4F0ZA 2USHA 2BCDA 4O43A 3RQZA 4H2BA 5B8IA 1HPUA 3EGHA 4M0VA 1G5BA 1M63A 4JA7A 5EQVA 4I5NC 3H68A 4I5LC 2Z06A 1HP1A 4G9JA 2IE4C 3ICFA 1OI8A 2NXFA 4ZX2A 1S3LA 1UTEA 3QFMA 3E7AA 1MF8A 2BDXA 3QG5C 4UT2A 3EGGA 3H62B 1T71A 3H64A 1AUIA 3RL5A 4B2OA 4H2IA 1TCOA 2NPPC 2NYLC 3H60A 4LU9A 4ORAA 5HPEA 3K7WC 3H61A 3HVQA 2ZBMA 3QFNA 3JYFA 4O24A 4ORCA 4TUGA 4YKEA 3RL3A 1FJMA 1S3MA 3PSOA 3P71C 1Z2WA 4UWQA 4V0XA 4FBKA 3DSDA 2Z72A 3GVEA 2GJUA 3QFKA 1JK7A 2WDFA 2QFPA 3V4YA 4MOVA 3E7BA 4DT2A 1QHWA 1UF3A 5JPFA 1USHA 3DSCA 3IVEA 2WDEA 5JPEA 2IAEC 3K7VC 1XZWA 5C1VA 2BQ8X 4FBQA 4ZVZA 3N5UA 4LTYA 1T70A 2HYPA 1W24A 1WAO1 4UT3B 3H67A 1QFCA 4UT3A 3RL4A 3CK2A 5J28A 5IOHA 3THOB 1KBPA 2R17A 3DW8C 2AHDA 2WDDA 2IE3C 3C9FA 3T1IA 3FGAC 4HD0A 4NZVA 5GTUA 1WARA 1S8EA 2CV9A 1HO5A 1V73A 2Q8UA 3ZTVA 4H2GA 2JOGA 3IB7A 4XPNA 4O4KA 3IVDA 3H66A 4KBPA 2KKNA 2Z1AA 1OIEA 2QJCA 2HYOA 3TGHA 4J6OA 4LACC 2XMOA 3KBPA 4Q7FA 1II7A 1S70A 4H2FA 5F3WA 5DNYA 3LL8A 4JA9A 4FBWA 1NNWA 4FCXA 4IL1A 4O5GA 3THNA 1SU1A 4DHLA 2HY1A 3IB8A 4H1YP 1XM7A 3PSNA 4WWLA 2O8GA 4ORBA 5INBA 1Z2XA 2YVTA 4H1SA 3QFOA 1IT6A 4TUIA 3AUZA 1OIDA 2P6BA 3H63A 4OR9A 3AV0A 2WDCA 3ZU0A 2A22A 2QFRA 4MP0A 4KKZA 4V0VA 4DSYA 4MOYA 2DFJA 2NYMC 1S95A
chains in the Genus database with same CATH superfamily
1S3NA 2YEQA 1U32A 5JJTA 4V0WA 4IYPC 3C5WC 2O8AA 3H69A 4F0ZA 2USHA 2BCDA 3E0JA 4O43A 3RQZA 4H2BA 5B8IA 1HPUA 3EGHA 4M0VA 1G5BA 1M63A 4JA7A 5EQVA 4I5NC 3H68A 4I5LC 2Z06A 1HP1A 4G9JA 2IE4C 3ICFA 1OI8A 2NXFA 4ZX2A 1S3LA 1UTEA 3QFMA 3E7AA 1MF8A 2BDXA 3QG5C 4UT2A 3EGGA 3H62B 1T71A 3H64A 1AUIA 3RL5A 4B2OA 4H2IA 1TCOA 2NPPC 2NYLC 3H60A 4LU9A 4ORAA 5HPEA 3K7WC 3H61A 3HVQA 2ZBMA 3QFNA 3JYFA 4O24A 4ORCA 4TUGA 4YKEA 3RL3A 1FJMA 3D03A 1S3MA 3PSOA 3P71C 1Z2WA 4UWQA 4V0XA 4FBKA 3DSDA 2Z72A 3GVEA 2GJUA 3QFKA 2ZO9B 1JK7A 2WDFA 2QFPA 3V4YA 4MOVA 3E7BA 4DT2A 1QHWA 1UF3A 5JPFA 1USHA 3DSCA 3IVEA 2WDEA 5JPEA 2IAEC 3K7VC 1XZWA 5C1VA 2BQ8X 4FBQA 4ZVZA 3N5UA 4LTYA 1T70A 2HYPA 1W24A 1WAO1 4UT3B 3H67A 1QFCA 4UT3A 3RL4A 3CK2A 5J28A 5IOHA 3THOB 1KBPA 2R17A 3DW8C 2AHDA 2WDDA 2IE3C 3C9FA 3T1IA 3FGAC 4HD0A 4NZVA 5GTUA 1WARA 1S8EA 2CV9A 1HO5A 1V73A 2Q8UA 3ZTVA 4H2GA 2JOGA 3IB7A 4XPNA 4O4KA 3IVDA 3H66A 4KBPA 2ZOAA 2KKNA 2Z1AA 1OIEA 2QJCA 2DXLA 2HYOA 4J6OA 3TGHA 4LACC 2XMOA 3KBPA 4Q7FA 1II7A 1S70A 4H2FA 5F3WA 5DNYA 3LL8A 4JA9A 4FBWA 1NNWA 4FCXA 4IL1A 4O5GA 3THNA 1SU1A 4DHLA 2HY1A 3IB8A 4H1YP 1XM7A 3PSNA 4WWLA 2O8GA 4ORBA 5INBA 1Z2XA 2YVTA 4H1SA 3QFOA 1IT6A 4TUIA 3AUZA 1OIDA 2P6BA 3H63A 4OR9A 3AV0A 2WDCA 3ZU0A 2A22A 2QFRA 4MP0A 4KKZA 4V0VA 4DSYA 4MOYA 2DXNA 3FLOA 2DFJA 2NYMC 1S95A
chains in the Genus database with same CATH topology
1S3NA 2YEQA 1U32A 5JJTA 4V0WA 4IYPC 3C5WC 2O8AA 3H69A 4F0ZA 2USHA 2BCDA 3E0JA 4O43A 3RQZA 4H2BA 5B8IA 1HPUA 3EGHA 4M0VA 1G5BA 1M63A 4JA7A 5EQVA 4I5NC 3H68A 4I5LC 2Z06A 1HP1A 4G9JA 2IE4C 3ICFA 1OI8A 2NXFA 4ZX2A 1S3LA 1UTEA 3QFMA 3E7AA 1MF8A 2BDXA 3QG5C 4UT2A 3EGGA 3H62B 1T71A 3H64A 1AUIA 3RL5A 4B2OA 4H2IA 1TCOA 2NPPC 2NYLC 3H60A 4LU9A 4ORAA 5HPEA 3K7WC 3H61A 3HVQA 2ZBMA 3QFNA 3JYFA 4O24A 4ORCA 4TUGA 4YKEA 3RL3A 1FJMA 3D03A 1S3MA 3PSOA 3P71C 1Z2WA 4UWQA 4V0XA 4FBKA 3DSDA 2Z72A 3GVEA 2GJUA 3QFKA 2ZO9B 1JK7A 2WDFA 2QFPA 3V4YA 4MOVA 3E7BA 4DT2A 1QHWA 1UF3A 5JPFA 1USHA 3DSCA 3IVEA 2WDEA 5JPEA 2IAEC 3K7VC 1XZWA 5C1VA 2BQ8X 4FBQA 4ZVZA 3N5UA 4LTYA 1T70A 2HYPA 1W24A 1WAO1 4UT3B 3H67A 1QFCA 4UT3A 3RL4A 3CK2A 5J28A 5IOHA 3THOB 1KBPA 2R17A 3DW8C 2AHDA 2WDDA 2IE3C 3C9FA 3T1IA 3FGAC 4HD0A 4NZVA 5GTUA 1WARA 1S8EA 2CV9A 1HO5A 1V73A 2Q8UA 3ZTVA 4H2GA 2JOGA 3IB7A 4XPNA 4O4KA 3IVDA 3H66A 4KBPA 2ZOAA 2KKNA 2Z1AA 1OIEA 2QJCA 2DXLA 2HYOA 4J6OA 3TGHA 4LACC 2XMOA 3KBPA 4Q7FA 1II7A 1S70A 4H2FA 5F3WA 5DNYA 3LL8A 4JA9A 4FBWA 1NNWA 4FCXA 4IL1A 4O5GA 3THNA 1SU1A 4DHLA 2HY1A 3IB8A 4H1YP 1XM7A 3PSNA 4WWLA 2O8GA 4ORBA 5INBA 1Z2XA 2YVTA 4H1SA 3QFOA 1IT6A 4TUIA 3AUZA 1OIDA 2P6BA 3H63A 4OR9A 3AV0A 2WDCA 3ZU0A 2A22A 2QFRA 4MP0A 4KKZA 4V0VA 4DSYA 4MOYA 2DXNA 3FLOA 2DFJA 2NYMC 1S95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3N A;  1U32 A;  5JJT A;  4V0W A;  4IYP C;  3C5W C;  2O8A A;  3H69 A;  4F0Z A;  2USH A;  2BCD A;  4O43 A;  3RQZ A;  4H2B A;  5B8I A;  1HPU A;  3EGH A;  4M0V A;  1G5B A;  1M63 A;  4JA7 A;  5EQV A;  4I5N C;  3H68 A;  4I5L C;  2Z06 A;  1HP1 A;  4G9J A;  2IE4 C;  3ICF A;  1OI8 A;  2NXF A;  4ZX2 A;  1S3L A;  1UTE A;  3QFM A;  3E7A A;  1MF8 A;  2BDX A;  3QG5 C;  4UT2 A;  3EGG A;  3H62 B;  1T71 A;  3H64 A;  1AUI A;  3RL5 A;  4B2O A;  4H2I A;  1TCO A;  2NPP C;  2NYL C;  3H60 A;  4LU9 A;  4ORA A;  5HPE A;  3K7W C;  3H61 A;  3HVQ A;  2ZBM A;  3QFN A;  3JYF A;  4O24 A;  4ORC A;  4TUG A;  4YKE A;  3RL3 A;  1FJM A;  1S3M A;  3PSO A;  3P71 C;  1Z2W A;  4UWQ A;  4V0X A;  4FBK A;  3DSD A;  2Z72 A;  3GVE A;  2GJU A;  3QFK A;  1JK7 A;  2WDF A;  2QFP A;  3V4Y A;  4MOV A;  3E7B A;  4DT2 A;  1QHW A;  1UF3 A;  5JPF A;  1USH A;  3DSC A;  3IVE A;  2WDE A;  5JPE A;  2IAE C;  3K7V C;  1XZW A;  5C1V A;  2BQ8 X;  4FBQ A;  4ZVZ A;  3N5U A;  4LTY A;  1T70 A;  2HYP A;  1W24 A;  1WAO 1;  4UT3 B;  3H67 A;  1QFC A;  4UT3 A;  3RL4 A;  3CK2 A;  5J28 A;  5IOH A;  3THO B;  1KBP A;  2R17 A;  3DW8 C;  2AHD A;  2WDD A;  2IE3 C;  3C9F A;  3T1I A;  3FGA C;  4HD0 A;  4NZV A;  5GTU A;  1WAR A;  1S8E A;  2CV9 A;  1HO5 A;  1V73 A;  2Q8U A;  3ZTV A;  4H2G A;  2JOG A;  3IB7 A;  4XPN A;  4O4K A;  3IVD A;  3H66 A;  4KBP A;  2KKN A;  2Z1A A;  1OIE A;  2QJC A;  2HYO A;  3TGH A;  4J6O A;  4LAC C;  2XMO A;  3KBP A;  4Q7F A;  1II7 A;  1S70 A;  4H2F A;  5F3W A;  5DNY A;  3LL8 A;  4JA9 A;  4FBW A;  1NNW A;  4FCX A;  4IL1 A;  4O5G A;  3THN A;  1SU1 A;  4DHL A;  2HY1 A;  3IB8 A;  4H1Y P;  1XM7 A;  3PSN A;  4WWL A;  2O8G A;  4ORB A;  5INB A;  1Z2X A;  2YVT A;  4H1S A;  3QFO A;  1IT6 A;  4TUI A;  3AUZ A;  1OID A;  2P6B A;  3H63 A;  4OR9 A;  3AV0 A;  2WDC A;  3ZU0 A;  2A22 A;  2QFR A;  4MP0 A;  4KKZ A;  4V0V A;  4DSY A;  4MOY A;  2DFJ A;  2NYM C;  1S95 A; 
#chains in the Genus database with same CATH topology
 1S3N A;  2YEQ A;  1U32 A;  5JJT A;  4V0W A;  4IYP C;  3C5W C;  2O8A A;  3H69 A;  4F0Z A;  2USH A;  2BCD A;  3E0J A;  4O43 A;  3RQZ A;  4H2B A;  5B8I A;  1HPU A;  3EGH A;  4M0V A;  1G5B A;  1M63 A;  4JA7 A;  5EQV A;  4I5N C;  3H68 A;  4I5L C;  2Z06 A;  1HP1 A;  4G9J A;  2IE4 C;  3ICF A;  1OI8 A;  2NXF A;  4ZX2 A;  1S3L A;  1UTE A;  3QFM A;  3E7A A;  1MF8 A;  2BDX A;  3QG5 C;  4UT2 A;  3EGG A;  3H62 B;  1T71 A;  3H64 A;  1AUI A;  3RL5 A;  4B2O A;  4H2I A;  1TCO A;  2NPP C;  2NYL C;  3H60 A;  4LU9 A;  4ORA A;  5HPE A;  3K7W C;  3H61 A;  3HVQ A;  2ZBM A;  3QFN A;  3JYF A;  4O24 A;  4ORC A;  4TUG A;  4YKE A;  3RL3 A;  1FJM A;  3D03 A;  1S3M A;  3PSO A;  3P71 C;  1Z2W A;  4UWQ A;  4V0X A;  4FBK A;  3DSD A;  2Z72 A;  3GVE A;  2GJU A;  3QFK A;  2ZO9 B;  1JK7 A;  2WDF A;  2QFP A;  3V4Y A;  4MOV A;  3E7B A;  4DT2 A;  1QHW A;  1UF3 A;  5JPF A;  1USH A;  3DSC A;  3IVE A;  2WDE A;  5JPE A;  2IAE C;  3K7V C;  1XZW A;  5C1V A;  2BQ8 X;  4FBQ A;  4ZVZ A;  3N5U A;  4LTY A;  1T70 A;  2HYP A;  1W24 A;  1WAO 1;  4UT3 B;  3H67 A;  1QFC A;  4UT3 A;  3RL4 A;  3CK2 A;  5J28 A;  5IOH A;  3THO B;  1KBP A;  2R17 A;  3DW8 C;  2AHD A;  2WDD A;  2IE3 C;  3C9F A;  3T1I A;  3FGA C;  4HD0 A;  4NZV A;  5GTU A;  1WAR A;  1S8E A;  2CV9 A;  1HO5 A;  1V73 A;  2Q8U A;  3ZTV A;  4H2G A;  2JOG A;  3IB7 A;  4XPN A;  4O4K A;  3IVD A;  3H66 A;  4KBP A;  2ZOA A;  2KKN A;  2Z1A A;  1OIE A;  2QJC A;  2DXL A;  2HYO A;  4J6O A;  3TGH A;  4LAC C;  2XMO A;  3KBP A;  4Q7F A;  1II7 A;  1S70 A;  4H2F A;  5F3W A;  5DNY A;  3LL8 A;  4JA9 A;  4FBW A;  1NNW A;  4FCX A;  4IL1 A;  4O5G A;  3THN A;  1SU1 A;  4DHL A;  2HY1 A;  3IB8 A;  4H1Y P;  1XM7 A;  3PSN A;  4WWL A;  2O8G A;  4ORB A;  5INB A;  1Z2X A;  2YVT A;  4H1S A;  3QFO A;  1IT6 A;  4TUI A;  3AUZ A;  1OID A;  2P6B A;  3H63 A;  4OR9 A;  3AV0 A;  2WDC A;  3ZU0 A;  2A22 A;  2QFR A;  4MP0 A;  4KKZ A;  4V0V A;  4DSY A;  4MOY A;  2DXN A;  3FLO A;  2DFJ A;  2NYM C;  1S95 A; 
#chains in the Genus database with same CATH homology
 1S3N A;  2YEQ A;  1U32 A;  5JJT A;  4V0W A;  4IYP C;  3C5W C;  2O8A A;  3H69 A;  4F0Z A;  2USH A;  2BCD A;  3E0J A;  4O43 A;  3RQZ A;  4H2B A;  5B8I A;  1HPU A;  3EGH A;  4M0V A;  1G5B A;  1M63 A;  4JA7 A;  5EQV A;  4I5N C;  3H68 A;  4I5L C;  2Z06 A;  1HP1 A;  4G9J A;  2IE4 C;  3ICF A;  1OI8 A;  2NXF A;  4ZX2 A;  1S3L A;  1UTE A;  3QFM A;  3E7A A;  1MF8 A;  2BDX A;  3QG5 C;  4UT2 A;  3EGG A;  3H62 B;  1T71 A;  3H64 A;  1AUI A;  3RL5 A;  4B2O A;  4H2I A;  1TCO A;  2NPP C;  2NYL C;  3H60 A;  4LU9 A;  4ORA A;  5HPE A;  3K7W C;  3H61 A;  3HVQ A;  2ZBM A;  3QFN A;  3JYF A;  4O24 A;  4ORC A;  4TUG A;  4YKE A;  3RL3 A;  1FJM A;  3D03 A;  1S3M A;  3PSO A;  3P71 C;  1Z2W A;  4UWQ A;  4V0X A;  4FBK A;  3DSD A;  2Z72 A;  3GVE A;  2GJU A;  3QFK A;  2ZO9 B;  1JK7 A;  2WDF A;  2QFP A;  3V4Y A;  4MOV A;  3E7B A;  4DT2 A;  1QHW A;  1UF3 A;  5JPF A;  1USH A;  3DSC A;  3IVE A;  2WDE A;  5JPE A;  2IAE C;  3K7V C;  1XZW A;  5C1V A;  2BQ8 X;  4FBQ A;  4ZVZ A;  3N5U A;  4LTY A;  1T70 A;  2HYP A;  1W24 A;  1WAO 1;  4UT3 B;  3H67 A;  1QFC A;  4UT3 A;  3RL4 A;  3CK2 A;  5J28 A;  5IOH A;  3THO B;  1KBP A;  2R17 A;  3DW8 C;  2AHD A;  2WDD A;  2IE3 C;  3C9F A;  3T1I A;  3FGA C;  4HD0 A;  4NZV A;  5GTU A;  1WAR A;  1S8E A;  2CV9 A;  1HO5 A;  1V73 A;  2Q8U A;  3ZTV A;  4H2G A;  2JOG A;  3IB7 A;  4XPN A;  4O4K A;  3IVD A;  3H66 A;  4KBP A;  2ZOA A;  2KKN A;  2Z1A A;  1OIE A;  2QJC A;  2DXL A;  2HYO A;  4J6O A;  3TGH A;  4LAC C;  2XMO A;  3KBP A;  4Q7F A;  1II7 A;  1S70 A;  4H2F A;  5F3W A;  5DNY A;  3LL8 A;  4JA9 A;  4FBW A;  1NNW A;  4FCX A;  4IL1 A;  4O5G A;  3THN A;  1SU1 A;  4DHL A;  2HY1 A;  3IB8 A;  4H1Y P;  1XM7 A;  3PSN A;  4WWL A;  2O8G A;  4ORB A;  5INB A;  1Z2X A;  2YVT A;  4H1S A;  3QFO A;  1IT6 A;  4TUI A;  3AUZ A;  1OID A;  2P6B A;  3H63 A;  4OR9 A;  3AV0 A;  2WDC A;  3ZU0 A;  2A22 A;  2QFR A;  4MP0 A;  4KKZ A;  4V0V A;  4DSY A;  4MOY A;  2DXN A;  3FLO A;  2DFJ A;  2NYM C;  1S95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...