3CK2A

Crystal structure of conserved uncharacterized protein (predicted phosphoesterase cog0622) from streptococcus pneumoniae tigr4
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
174
Chain Sequence
AMAKQTIIVMSDSHGDSLIVEEVRDRYVGKVDAVFHNGDSELRPDSPLWEGIRVVKGNMDFYAGYPERLVTELGSTKIIQTHGHLFDINFNFQKLDYWAQEEEAAICLYGHLHVPSAWLEGKILFLNPGSISQPRGTIRECLYARVEIDDSYFKVDFLTRDHEVYPGLSKEFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved uncharacterized protein (predicted phosphoesterase
publication title Crystal structure of conserved uncharacterized protein (predicted phosphoesterase COG0622) from Streptococcus pneumoniae TIGR4.
rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 45
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3ck2A00
5INBA 1OI8A 1W24A 2AHDA 2ZBMA 1OIEA 3TGHA 3GVEA 2NYLC 1M63A 2GJUA 2WDEA 4NZVA 5B8IA 4OR9A 3CK2A 1T70A 4UWQA 2R17A 1WAO1 4H1SA 4H2IA 1HO5A 1HP1A 1IT6A 1UF3A 3H61A 1G5BA 2IAEC 4LACC 1S8EA 5JJTA 4J6OA 4JA7A 1UTEA 1XZWA 4UT3B 1JK7A 3C9FA 3E7AA 4IYPC 4H2GA 3AV0A 3IVDA 3THNA 1USHA 2NYMC 4ORAA 1TCOA 2O8AA 2Q8UA 1S70A 2P6BA 3RL5A 3H63A 1S3LA 3H69A 3E7BA 2CV9A 4UT3A 2Z06A 1S3NA 1FJMA 4O24A 1QFCA 1II7A 1U32A 4MP0A 3PSOA 5GTUA 2KKNA 1MF8A 3AUZA 3PSNA 2HYOA 2DFJA 2Z1AA 3RL4A 4I5NC 4M0VA 2WDFA 2WDDA 4HD0A 3V4YA 3IB8A 3ICFA 4FBKA 4KKZA 4UT2A 3QFKA 3RQZA 3FGAC 1V73A 2NPPC 1T71A 2NXFA 5IOHA 3ZU0A 4KBPA 4H2FA 4LU9A 2QJCA 3K7VC 3P71C 3DSCA 5DNYA 4H2BA 1S3MA 1Z2WA 5JPFA 2QFRA 3EGGA 3IB7A 3IVEA 4O4KA 2O8GA 4DT2A 2IE4C 4I5LC 3T1IA 4DHLA 4IL1A 3H68A 1SU1A 1XM7A 4V0XA 3QFOA 1QHWA 2HY1A 4V0VA 3JYFA 5J28A 3N5UA 4FBWA 2IE3C 1AUIA 4FCXA 1KBPA 4LTYA 2BCDA 4JA9A 4Q7FA 3QFNA 1OIDA 3ZTVA 5F3WA 4YKEA 3QG5C 4H1YP 4XPNA 2Z72A 4ZX2A 2HYPA 4TUGA 3H64A 3KBPA 3QFMA 4TUIA 3C5WC 3LL8A 1S95A 3THOB 2BDXA 4FBQA 3DSDA 2WDCA 4ORCA 4MOYA 1Z2XA 3K7WC 4O43A 1NNWA 3H60A 4ZVZA 3HVQA 4WWLA 1HPUA 3H62B 2A22A 3H66A 4B2OA 5JPEA 4DSYA 4MOVA 5C1VA 4V0WA 2BQ8X 2XMOA 4ORBA 5EQVA 4F0ZA 2QFPA 3EGHA 3DW8C 3RL3A 5HPEA 3H67A 2JOGA 2USHA 4G9JA 1WARA 2YVTA 4O5GA
chains in the Genus database with same CATH superfamily
5INBA 1OI8A 1W24A 2AHDA 2ZBMA 1OIEA 3TGHA 3GVEA 2NYLC 1M63A 2GJUA 2WDEA 4NZVA 5B8IA 4OR9A 2ZOAA 2YEQA 2DXLA 3CK2A 1T70A 4UWQA 2R17A 1WAO1 4H1SA 4H2IA 1HO5A 1HP1A 1IT6A 1UF3A 3H61A 1G5BA 2IAEC 4LACC 1S8EA 5JJTA 4J6OA 4JA7A 1UTEA 1XZWA 4UT3B 1JK7A 3C9FA 3E7AA 4IYPC 4H2GA 3AV0A 3IVDA 3THNA 1USHA 2NYMC 4ORAA 1TCOA 2O8AA 2Q8UA 1S70A 2P6BA 3RL5A 3H63A 1S3LA 3H69A 3E7BA 2CV9A 4UT3A 2Z06A 1S3NA 1FJMA 4O24A 1QFCA 3FLOA 1II7A 1U32A 4MP0A 3PSOA 5GTUA 2KKNA 1MF8A 2ZO9B 3AUZA 2HYOA 2DFJA 2Z1AA 3PSNA 3RL4A 2DXNA 3E0JA 4I5NC 4M0VA 2WDFA 2WDDA 4HD0A 3V4YA 3IB8A 3ICFA 4FBKA 4KKZA 4UT2A 3QFKA 3RQZA 3FGAC 1V73A 2NPPC 1T71A 2NXFA 5IOHA 3ZU0A 4KBPA 4H2FA 4LU9A 2QJCA 3K7VC 3P71C 3DSCA 5DNYA 4H2BA 1S3MA 1Z2WA 5JPFA 2QFRA 3EGGA 3D03A 3IB7A 3IVEA 4O4KA 2O8GA 4DT2A 2IE4C 4I5LC 3T1IA 4DHLA 4IL1A 3H68A 1SU1A 1XM7A 4V0XA 3QFOA 1QHWA 2HY1A 4V0VA 3JYFA 5J28A 3N5UA 4FBWA 2IE3C 1AUIA 4FCXA 1KBPA 4LTYA 2BCDA 4JA9A 4Q7FA 3QFNA 1OIDA 3ZTVA 5F3WA 4YKEA 3QG5C 4H1YP 4XPNA 2Z72A 4ZX2A 2HYPA 4TUGA 3H64A 3KBPA 3QFMA 4TUIA 3C5WC 3LL8A 1S95A 3THOB 2BDXA 4FBQA 3DSDA 2WDCA 4ORCA 4MOYA 1Z2XA 3K7WC 4O43A 1NNWA 3H60A 4ZVZA 3HVQA 4WWLA 1HPUA 3H62B 2A22A 3H66A 4B2OA 5JPEA 4DSYA 4MOVA 5C1VA 4V0WA 2BQ8X 2XMOA 4ORBA 5EQVA 4F0ZA 2QFPA 3EGHA 3DW8C 3RL3A 5HPEA 3H67A 2JOGA 2USHA 4G9JA 1WARA 2YVTA 4O5GA
chains in the Genus database with same CATH topology
5INBA 1OI8A 1W24A 2AHDA 2ZBMA 1OIEA 3TGHA 3GVEA 2NYLC 1M63A 2GJUA 2WDEA 4NZVA 5B8IA 4OR9A 2ZOAA 2YEQA 2DXLA 3CK2A 1T70A 4UWQA 2R17A 1WAO1 4H1SA 4H2IA 1HO5A 1HP1A 1IT6A 1UF3A 3H61A 1G5BA 2IAEC 4LACC 1S8EA 5JJTA 4J6OA 4JA7A 1UTEA 1XZWA 4UT3B 1JK7A 3C9FA 3E7AA 4IYPC 4H2GA 3AV0A 3IVDA 3THNA 1USHA 2NYMC 4ORAA 1TCOA 2O8AA 2Q8UA 1S70A 2P6BA 3RL5A 3H63A 1S3LA 3H69A 3E7BA 2CV9A 4UT3A 2Z06A 1S3NA 1FJMA 4O24A 1QFCA 3FLOA 1II7A 1U32A 4MP0A 3PSOA 5GTUA 2KKNA 1MF8A 2ZO9B 3AUZA 2HYOA 2DFJA 2Z1AA 3PSNA 3RL4A 2DXNA 3E0JA 4I5NC 4M0VA 2WDFA 2WDDA 4HD0A 3V4YA 3IB8A 3ICFA 4FBKA 4KKZA 4UT2A 3QFKA 3RQZA 3FGAC 1V73A 2NPPC 1T71A 2NXFA 5IOHA 3ZU0A 4KBPA 4H2FA 4LU9A 2QJCA 3K7VC 3P71C 3DSCA 5DNYA 4H2BA 1S3MA 1Z2WA 5JPFA 2QFRA 3EGGA 3D03A 3IB7A 3IVEA 4O4KA 2O8GA 4DT2A 2IE4C 4I5LC 3T1IA 4DHLA 4IL1A 3H68A 1SU1A 1XM7A 4V0XA 3QFOA 1QHWA 2HY1A 4V0VA 3JYFA 5J28A 3N5UA 4FBWA 2IE3C 1AUIA 4FCXA 1KBPA 4LTYA 2BCDA 4JA9A 4Q7FA 3QFNA 1OIDA 3ZTVA 5F3WA 4YKEA 3QG5C 4H1YP 4XPNA 2Z72A 4ZX2A 2HYPA 4TUGA 3H64A 3KBPA 3QFMA 4TUIA 3C5WC 3LL8A 1S95A 3THOB 2BDXA 4FBQA 3DSDA 2WDCA 4ORCA 4MOYA 1Z2XA 3K7WC 4O43A 1NNWA 3H60A 4ZVZA 3HVQA 4WWLA 1HPUA 3H62B 2A22A 3H66A 4B2OA 5JPEA 4DSYA 4MOVA 5C1VA 4V0WA 2BQ8X 2XMOA 4ORBA 5EQVA 4F0ZA 2QFPA 3EGHA 3DW8C 3RL3A 5HPEA 3H67A 2JOGA 2USHA 4G9JA 1WARA 2YVTA 4O5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5INB A;  1OI8 A;  1W24 A;  2AHD A;  2ZBM A;  1OIE A;  3TGH A;  3GVE A;  2NYL C;  1M63 A;  2GJU A;  2WDE A;  4NZV A;  5B8I A;  4OR9 A;  3CK2 A;  1T70 A;  4UWQ A;  2R17 A;  1WAO 1;  4H1S A;  4H2I A;  1HO5 A;  1HP1 A;  1IT6 A;  1UF3 A;  3H61 A;  1G5B A;  2IAE C;  4LAC C;  1S8E A;  5JJT A;  4J6O A;  4JA7 A;  1UTE A;  1XZW A;  4UT3 B;  1JK7 A;  3C9F A;  3E7A A;  4IYP C;  4H2G A;  3AV0 A;  3IVD A;  3THN A;  1USH A;  2NYM C;  4ORA A;  1TCO A;  2O8A A;  2Q8U A;  1S70 A;  2P6B A;  3RL5 A;  3H63 A;  1S3L A;  3H69 A;  3E7B A;  2CV9 A;  4UT3 A;  2Z06 A;  1S3N A;  1FJM A;  4O24 A;  1QFC A;  1II7 A;  1U32 A;  4MP0 A;  3PSO A;  5GTU A;  2KKN A;  1MF8 A;  3AUZ A;  3PSN A;  2HYO A;  2DFJ A;  2Z1A A;  3RL4 A;  4I5N C;  4M0V A;  2WDF A;  2WDD A;  4HD0 A;  3V4Y A;  3IB8 A;  3ICF A;  4FBK A;  4KKZ A;  4UT2 A;  3QFK A;  3RQZ A;  3FGA C;  1V73 A;  2NPP C;  1T71 A;  2NXF A;  5IOH A;  3ZU0 A;  4KBP A;  4H2F A;  4LU9 A;  2QJC A;  3K7V C;  3P71 C;  3DSC A;  5DNY A;  4H2B A;  1S3M A;  1Z2W A;  5JPF A;  2QFR A;  3EGG A;  3IB7 A;  3IVE A;  4O4K A;  2O8G A;  4DT2 A;  2IE4 C;  4I5L C;  3T1I A;  4DHL A;  4IL1 A;  3H68 A;  1SU1 A;  1XM7 A;  4V0X A;  3QFO A;  1QHW A;  2HY1 A;  4V0V A;  3JYF A;  5J28 A;  3N5U A;  4FBW A;  2IE3 C;  1AUI A;  4FCX A;  1KBP A;  4LTY A;  2BCD A;  4JA9 A;  4Q7F A;  3QFN A;  1OID A;  3ZTV A;  5F3W A;  4YKE A;  3QG5 C;  4H1Y P;  4XPN A;  2Z72 A;  4ZX2 A;  2HYP A;  4TUG A;  3H64 A;  3KBP A;  3QFM A;  4TUI A;  3C5W C;  3LL8 A;  1S95 A;  3THO B;  2BDX A;  4FBQ A;  3DSD A;  2WDC A;  4ORC A;  4MOY A;  1Z2X A;  3K7W C;  4O43 A;  1NNW A;  3H60 A;  4ZVZ A;  3HVQ A;  4WWL A;  1HPU A;  3H62 B;  2A22 A;  3H66 A;  4B2O A;  5JPE A;  4DSY A;  4MOV A;  5C1V A;  4V0W A;  2BQ8 X;  2XMO A;  4ORB A;  5EQV A;  4F0Z A;  2QFP A;  3EGH A;  3DW8 C;  3RL3 A;  5HPE A;  3H67 A;  2JOG A;  2USH A;  4G9J A;  1WAR A;  2YVT A;  4O5G A; 
#chains in the Genus database with same CATH topology
 5INB A;  1OI8 A;  1W24 A;  2AHD A;  2ZBM A;  1OIE A;  3TGH A;  3GVE A;  2NYL C;  1M63 A;  2GJU A;  2WDE A;  4NZV A;  5B8I A;  4OR9 A;  2ZOA A;  2YEQ A;  2DXL A;  3CK2 A;  1T70 A;  4UWQ A;  2R17 A;  1WAO 1;  4H1S A;  4H2I A;  1HO5 A;  1HP1 A;  1IT6 A;  1UF3 A;  3H61 A;  1G5B A;  2IAE C;  4LAC C;  1S8E A;  5JJT A;  4J6O A;  4JA7 A;  1UTE A;  1XZW A;  4UT3 B;  1JK7 A;  3C9F A;  3E7A A;  4IYP C;  4H2G A;  3AV0 A;  3IVD A;  3THN A;  1USH A;  2NYM C;  4ORA A;  1TCO A;  2O8A A;  2Q8U A;  1S70 A;  2P6B A;  3RL5 A;  3H63 A;  1S3L A;  3H69 A;  3E7B A;  2CV9 A;  4UT3 A;  2Z06 A;  1S3N A;  1FJM A;  4O24 A;  1QFC A;  3FLO A;  1II7 A;  1U32 A;  4MP0 A;  3PSO A;  5GTU A;  2KKN A;  1MF8 A;  2ZO9 B;  3AUZ A;  2HYO A;  2DFJ A;  2Z1A A;  3PSN A;  3RL4 A;  2DXN A;  3E0J A;  4I5N C;  4M0V A;  2WDF A;  2WDD A;  4HD0 A;  3V4Y A;  3IB8 A;  3ICF A;  4FBK A;  4KKZ A;  4UT2 A;  3QFK A;  3RQZ A;  3FGA C;  1V73 A;  2NPP C;  1T71 A;  2NXF A;  5IOH A;  3ZU0 A;  4KBP A;  4H2F A;  4LU9 A;  2QJC A;  3K7V C;  3P71 C;  3DSC A;  5DNY A;  4H2B A;  1S3M A;  1Z2W A;  5JPF A;  2QFR A;  3EGG A;  3D03 A;  3IB7 A;  3IVE A;  4O4K A;  2O8G A;  4DT2 A;  2IE4 C;  4I5L C;  3T1I A;  4DHL A;  4IL1 A;  3H68 A;  1SU1 A;  1XM7 A;  4V0X A;  3QFO A;  1QHW A;  2HY1 A;  4V0V A;  3JYF A;  5J28 A;  3N5U A;  4FBW A;  2IE3 C;  1AUI A;  4FCX A;  1KBP A;  4LTY A;  2BCD A;  4JA9 A;  4Q7F A;  3QFN A;  1OID A;  3ZTV A;  5F3W A;  4YKE A;  3QG5 C;  4H1Y P;  4XPN A;  2Z72 A;  4ZX2 A;  2HYP A;  4TUG A;  3H64 A;  3KBP A;  3QFM A;  4TUI A;  3C5W C;  3LL8 A;  1S95 A;  3THO B;  2BDX A;  4FBQ A;  3DSD A;  2WDC A;  4ORC A;  4MOY A;  1Z2X A;  3K7W C;  4O43 A;  1NNW A;  3H60 A;  4ZVZ A;  3HVQ A;  4WWL A;  1HPU A;  3H62 B;  2A22 A;  3H66 A;  4B2O A;  5JPE A;  4DSY A;  4MOV A;  5C1V A;  4V0W A;  2BQ8 X;  2XMO A;  4ORB A;  5EQV A;  4F0Z A;  2QFP A;  3EGH A;  3DW8 C;  3RL3 A;  5HPE A;  3H67 A;  2JOG A;  2USH A;  4G9J A;  1WAR A;  2YVT A;  4O5G A; 
#chains in the Genus database with same CATH homology
 5INB A;  1OI8 A;  1W24 A;  2AHD A;  2ZBM A;  1OIE A;  3TGH A;  3GVE A;  2NYL C;  1M63 A;  2GJU A;  2WDE A;  4NZV A;  5B8I A;  4OR9 A;  2ZOA A;  2YEQ A;  2DXL A;  3CK2 A;  1T70 A;  4UWQ A;  2R17 A;  1WAO 1;  4H1S A;  4H2I A;  1HO5 A;  1HP1 A;  1IT6 A;  1UF3 A;  3H61 A;  1G5B A;  2IAE C;  4LAC C;  1S8E A;  5JJT A;  4J6O A;  4JA7 A;  1UTE A;  1XZW A;  4UT3 B;  1JK7 A;  3C9F A;  3E7A A;  4IYP C;  4H2G A;  3AV0 A;  3IVD A;  3THN A;  1USH A;  2NYM C;  4ORA A;  1TCO A;  2O8A A;  2Q8U A;  1S70 A;  2P6B A;  3RL5 A;  3H63 A;  1S3L A;  3H69 A;  3E7B A;  2CV9 A;  4UT3 A;  2Z06 A;  1S3N A;  1FJM A;  4O24 A;  1QFC A;  3FLO A;  1II7 A;  1U32 A;  4MP0 A;  3PSO A;  5GTU A;  2KKN A;  1MF8 A;  2ZO9 B;  3AUZ A;  2HYO A;  2DFJ A;  2Z1A A;  3PSN A;  3RL4 A;  2DXN A;  3E0J A;  4I5N C;  4M0V A;  2WDF A;  2WDD A;  4HD0 A;  3V4Y A;  3IB8 A;  3ICF A;  4FBK A;  4KKZ A;  4UT2 A;  3QFK A;  3RQZ A;  3FGA C;  1V73 A;  2NPP C;  1T71 A;  2NXF A;  5IOH A;  3ZU0 A;  4KBP A;  4H2F A;  4LU9 A;  2QJC A;  3K7V C;  3P71 C;  3DSC A;  5DNY A;  4H2B A;  1S3M A;  1Z2W A;  5JPF A;  2QFR A;  3EGG A;  3D03 A;  3IB7 A;  3IVE A;  4O4K A;  2O8G A;  4DT2 A;  2IE4 C;  4I5L C;  3T1I A;  4DHL A;  4IL1 A;  3H68 A;  1SU1 A;  1XM7 A;  4V0X A;  3QFO A;  1QHW A;  2HY1 A;  4V0V A;  3JYF A;  5J28 A;  3N5U A;  4FBW A;  2IE3 C;  1AUI A;  4FCX A;  1KBP A;  4LTY A;  2BCD A;  4JA9 A;  4Q7F A;  3QFN A;  1OID A;  3ZTV A;  5F3W A;  4YKE A;  3QG5 C;  4H1Y P;  4XPN A;  2Z72 A;  4ZX2 A;  2HYP A;  4TUG A;  3H64 A;  3KBP A;  3QFM A;  4TUI A;  3C5W C;  3LL8 A;  1S95 A;  3THO B;  2BDX A;  4FBQ A;  3DSD A;  2WDC A;  4ORC A;  4MOY A;  1Z2X A;  3K7W C;  4O43 A;  1NNW A;  3H60 A;  4ZVZ A;  3HVQ A;  4WWL A;  1HPU A;  3H62 B;  2A22 A;  3H66 A;  4B2O A;  5JPE A;  4DSY A;  4MOV A;  5C1V A;  4V0W A;  2BQ8 X;  2XMO A;  4ORB A;  5EQV A;  4F0Z A;  2QFP A;  3EGH A;  3DW8 C;  3RL3 A;  5HPE A;  3H67 A;  2JOG A;  2USH A;  4G9J A;  1WAR A;  2YVT A;  4O5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...