1G5BA

Bacteriophage lambda ser/thr protein phosphatase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
219
Chain Sequence
MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein, hydrolase
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE
total genus 74
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2000-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1g5bA00
4ORCA 1OI8A 2KKNA 2WDDA 4LACC 3ZTVA 1Z2XA 2NYLC 1MF8A 2XMOA 4KKZA 5GTUA 3QFNA 4ZX2A 1S3NA 3EGHA 3KBPA 3IVDA 4O5GA 4TUGA 5J28A 2QJCA 2ZBMA 3C9FA 3H61A 3K7WC 2IE4C 3EGGA 1JK7A 4O24A 2NXFA 2BQ8X 1HPUA 3THNA 2WDFA 4XPNA 4M0VA 2IE3C 3H62B 3P71C 1W24A 4LU9A 4FBKA 1HO5A 3T1IA 3PSOA 3H64A 4H1SA 3DW8C 2IAEC 2Q8UA 2CV9A 1USHA 3GVEA 5B8IA 3CK2A 1S8EA 4O4KA 1WARA 3PSNA 3H60A 4MOVA 1S3MA 1S3LA 4FBWA 4DT2A 4I5LC 4ZVZA 1OIEA 3AV0A 3QFKA 2NPPC 5INBA 1UTEA 2DFJA 3N5UA 4MOYA 2HYPA 2NYMC 2O8AA 4UWQA 5JJTA 2HY1A 2BCDA 3ICFA 2QFRA 4IYPC 3QFMA 2WDEA 1M63A 4I5NC 3H66A 2Z1AA 3RL5A 1FJMA 1T71A 3H68A 3RL3A 3IVEA 4FBQA 3FGAC 4DHLA 5JPEA 2R17A 5EQVA 5DNYA 1XM7A 5F3WA 4V0VA 4UT3B 4O43A 4H2FA 1V73A 3RQZA 5IOHA 3THOB 1G5BA 2AHDA 2WDCA 4H2IA 4V0WA 1OIDA 4F0ZA 2Z72A 4IL1A 1IT6A 1UF3A 1QFCA 2YVTA 3E7AA 3LL8A 1S70A 1U32A 3C5WC 3QFOA 5C1VA 4B2OA 4Q7FA 3RL4A 3TGHA 4ORAA 3H63A 4H1YP 1XZWA 5HPEA 2A22A 4UT2A 4FCXA 2GJUA 4YKEA 2BDXA 4G9JA 3V4YA 1T70A 1S95A 4UT3A 3AUZA 1Z2WA 1TCOA 2QFPA 3K7VC 4H2GA 1HP1A 2Z06A 3ZU0A 3DSCA 4JA9A 4H2BA 4NZVA 4WWLA 1QHWA 2P6BA 2HYOA 3H67A 4JA7A 4J6OA 1II7A 3E7BA 4MP0A 1WAO1 3JYFA 3IB8A 4OR9A 4LTYA 2USHA 2JOGA 3HVQA 1SU1A 4TUIA 5JPFA 3IB7A 4ORBA 2O8GA 3QG5C 1NNWA 4HD0A 4DSYA 1AUIA 4KBPA 1KBPA 3H69A 3DSDA 4V0XA
chains in the Genus database with same CATH superfamily
4ORCA 1OI8A 2KKNA 2WDDA 4LACC 3ZTVA 1Z2XA 2NYLC 1MF8A 2XMOA 4KKZA 5GTUA 3QFNA 4ZX2A 1S3NA 3EGHA 3KBPA 3IVDA 4O5GA 4TUGA 5J28A 2QJCA 2ZBMA 3C9FA 3H61A 3K7WC 2IE4C 3EGGA 1JK7A 4O24A 2NXFA 2BQ8X 1HPUA 3THNA 2WDFA 4XPNA 4M0VA 2IE3C 3H62B 3P71C 1W24A 4LU9A 4FBKA 1HO5A 3T1IA 3PSOA 3H64A 4H1SA 2IAEC 3DW8C 2Q8UA 2CV9A 1USHA 3GVEA 5B8IA 3CK2A 1S8EA 4O4KA 1WARA 3PSNA 3H60A 4MOVA 1S3MA 1S3LA 4FBWA 4DT2A 4I5LC 4ZVZA 1OIEA 3AV0A 3QFKA 2NPPC 5INBA 1UTEA 2DFJA 3N5UA 4MOYA 2HYPA 2NYMC 2O8AA 4UWQA 5JJTA 2HY1A 2BCDA 2DXLA 3ICFA 2QFRA 4IYPC 3QFMA 2WDEA 1M63A 4I5NC 3H66A 2Z1AA 3RL5A 1FJMA 1T71A 3H68A 3RL3A 3IVEA 4FBQA 3FGAC 4DHLA 5JPEA 2R17A 2ZO9B 5EQVA 5DNYA 1XM7A 5F3WA 4V0VA 4UT3B 4O43A 4H2FA 1V73A 3RQZA 4V0XA 3THOB 2DXNA 5IOHA 1G5BA 2AHDA 2WDCA 4H2IA 4V0WA 1OIDA 4F0ZA 2Z72A 4IL1A 1IT6A 1UF3A 1QFCA 2YVTA 3E7AA 3LL8A 1S70A 1U32A 3C5WC 3QFOA 5C1VA 4B2OA 4Q7FA 3RL4A 3TGHA 4ORAA 3H63A 4H1YP 1XZWA 5HPEA 2A22A 4UT2A 4FCXA 2GJUA 4YKEA 2BDXA 3E0JA 4G9JA 3V4YA 1T70A 1S95A 4UT3A 3AUZA 1Z2WA 1TCOA 2QFPA 2ZOAA 3K7VC 4H2GA 1HP1A 2Z06A 3FLOA 3D03A 3ZU0A 3DSCA 4JA9A 4H2BA 4NZVA 4WWLA 1QHWA 2P6BA 2HYOA 3H67A 4JA7A 4J6OA 1II7A 3E7BA 4MP0A 1WAO1 3JYFA 3IB8A 4OR9A 4LTYA 2USHA 2JOGA 3HVQA 1SU1A 4TUIA 5JPFA 3IB7A 4ORBA 2O8GA 3QG5C 1NNWA 4HD0A 4DSYA 1AUIA 4KBPA 1KBPA 3H69A 3DSDA 2YEQA
chains in the Genus database with same CATH topology
4ORCA 1OI8A 2KKNA 2WDDA 4LACC 3ZTVA 1Z2XA 2NYLC 1MF8A 2XMOA 4KKZA 5GTUA 3QFNA 4ZX2A 1S3NA 3EGHA 3KBPA 3IVDA 4O5GA 4TUGA 5J28A 2QJCA 2ZBMA 3C9FA 3H61A 3K7WC 2IE4C 3EGGA 1JK7A 4O24A 2NXFA 2BQ8X 1HPUA 3THNA 2WDFA 4XPNA 4M0VA 2IE3C 3H62B 3P71C 1W24A 4LU9A 4FBKA 1HO5A 3T1IA 3PSOA 3H64A 4H1SA 2IAEC 3DW8C 2Q8UA 2CV9A 1USHA 3GVEA 5B8IA 3CK2A 1S8EA 4O4KA 1WARA 3PSNA 3H60A 4MOVA 1S3MA 1S3LA 4FBWA 4DT2A 4I5LC 4ZVZA 1OIEA 3AV0A 3QFKA 2NPPC 5INBA 1UTEA 2DFJA 3N5UA 4MOYA 2HYPA 2NYMC 2O8AA 4UWQA 5JJTA 2HY1A 2BCDA 2DXLA 3ICFA 2QFRA 4IYPC 3QFMA 2WDEA 1M63A 4I5NC 3H66A 2Z1AA 3RL5A 1FJMA 1T71A 3H68A 3RL3A 3IVEA 4FBQA 3FGAC 4DHLA 5JPEA 2R17A 2ZO9B 5EQVA 5DNYA 1XM7A 5F3WA 4V0VA 4UT3B 4O43A 4H2FA 1V73A 3RQZA 4V0XA 3THOB 2DXNA 5IOHA 1G5BA 2AHDA 2WDCA 4H2IA 4V0WA 1OIDA 4F0ZA 2Z72A 4IL1A 1IT6A 1UF3A 1QFCA 2YVTA 3E7AA 3LL8A 1S70A 1U32A 3C5WC 3QFOA 5C1VA 4B2OA 4Q7FA 3RL4A 3TGHA 4ORAA 3H63A 4H1YP 1XZWA 5HPEA 2A22A 4UT2A 4FCXA 2GJUA 4YKEA 2BDXA 3E0JA 4G9JA 3V4YA 1T70A 1S95A 4UT3A 3AUZA 1Z2WA 1TCOA 2QFPA 2ZOAA 3K7VC 4H2GA 1HP1A 2Z06A 3FLOA 3D03A 3ZU0A 3DSCA 4JA9A 4H2BA 4NZVA 4WWLA 1QHWA 2P6BA 2HYOA 3H67A 4JA7A 4J6OA 1II7A 3E7BA 4MP0A 1WAO1 3JYFA 3IB8A 4OR9A 4LTYA 2USHA 2JOGA 3HVQA 1SU1A 4TUIA 5JPFA 3IB7A 4ORBA 2O8GA 3QG5C 1NNWA 4HD0A 4DSYA 1AUIA 4KBPA 1KBPA 3H69A 3DSDA 2YEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORC A;  1OI8 A;  2KKN A;  2WDD A;  4LAC C;  3ZTV A;  1Z2X A;  2NYL C;  1MF8 A;  2XMO A;  4KKZ A;  5GTU A;  3QFN A;  4ZX2 A;  1S3N A;  3EGH A;  3KBP A;  3IVD A;  4O5G A;  4TUG A;  5J28 A;  2QJC A;  2ZBM A;  3C9F A;  3H61 A;  3K7W C;  2IE4 C;  3EGG A;  1JK7 A;  4O24 A;  2NXF A;  2BQ8 X;  1HPU A;  3THN A;  2WDF A;  4XPN A;  4M0V A;  2IE3 C;  3H62 B;  3P71 C;  1W24 A;  4LU9 A;  4FBK A;  1HO5 A;  3T1I A;  3PSO A;  3H64 A;  4H1S A;  3DW8 C;  2IAE C;  2Q8U A;  2CV9 A;  1USH A;  3GVE A;  5B8I A;  3CK2 A;  1S8E A;  4O4K A;  1WAR A;  3PSN A;  3H60 A;  4MOV A;  1S3M A;  1S3L A;  4FBW A;  4DT2 A;  4I5L C;  4ZVZ A;  1OIE A;  3AV0 A;  3QFK A;  2NPP C;  5INB A;  1UTE A;  2DFJ A;  3N5U A;  4MOY A;  2HYP A;  2NYM C;  2O8A A;  4UWQ A;  5JJT A;  2HY1 A;  2BCD A;  3ICF A;  2QFR A;  4IYP C;  3QFM A;  2WDE A;  1M63 A;  4I5N C;  3H66 A;  2Z1A A;  3RL5 A;  1FJM A;  1T71 A;  3H68 A;  3RL3 A;  3IVE A;  4FBQ A;  3FGA C;  4DHL A;  5JPE A;  2R17 A;  5EQV A;  5DNY A;  1XM7 A;  5F3W A;  4V0V A;  4UT3 B;  4O43 A;  4H2F A;  1V73 A;  3RQZ A;  5IOH A;  3THO B;  1G5B A;  2AHD A;  2WDC A;  4H2I A;  4V0W A;  1OID A;  4F0Z A;  2Z72 A;  4IL1 A;  1IT6 A;  1UF3 A;  1QFC A;  2YVT A;  3E7A A;  3LL8 A;  1S70 A;  1U32 A;  3C5W C;  3QFO A;  5C1V A;  4B2O A;  4Q7F A;  3RL4 A;  3TGH A;  4ORA A;  3H63 A;  4H1Y P;  1XZW A;  5HPE A;  2A22 A;  4UT2 A;  4FCX A;  2GJU A;  4YKE A;  2BDX A;  4G9J A;  3V4Y A;  1T70 A;  1S95 A;  4UT3 A;  3AUZ A;  1Z2W A;  1TCO A;  2QFP A;  3K7V C;  4H2G A;  1HP1 A;  2Z06 A;  3ZU0 A;  3DSC A;  4JA9 A;  4H2B A;  4NZV A;  4WWL A;  1QHW A;  2P6B A;  2HYO A;  3H67 A;  4JA7 A;  4J6O A;  1II7 A;  3E7B A;  4MP0 A;  1WAO 1;  3JYF A;  3IB8 A;  4OR9 A;  4LTY A;  2USH A;  2JOG A;  3HVQ A;  1SU1 A;  4TUI A;  5JPF A;  3IB7 A;  4ORB A;  2O8G A;  3QG5 C;  1NNW A;  4HD0 A;  4DSY A;  1AUI A;  4KBP A;  1KBP A;  3H69 A;  3DSD A;  4V0X A; 
#chains in the Genus database with same CATH topology
 4ORC A;  1OI8 A;  2KKN A;  2WDD A;  4LAC C;  3ZTV A;  1Z2X A;  2NYL C;  1MF8 A;  2XMO A;  4KKZ A;  5GTU A;  3QFN A;  4ZX2 A;  1S3N A;  3EGH A;  3KBP A;  3IVD A;  4O5G A;  4TUG A;  5J28 A;  2QJC A;  2ZBM A;  3C9F A;  3H61 A;  3K7W C;  2IE4 C;  3EGG A;  1JK7 A;  4O24 A;  2NXF A;  2BQ8 X;  1HPU A;  3THN A;  2WDF A;  4XPN A;  4M0V A;  2IE3 C;  3H62 B;  3P71 C;  1W24 A;  4LU9 A;  4FBK A;  1HO5 A;  3T1I A;  3PSO A;  3H64 A;  4H1S A;  2IAE C;  3DW8 C;  2Q8U A;  2CV9 A;  1USH A;  3GVE A;  5B8I A;  3CK2 A;  1S8E A;  4O4K A;  1WAR A;  3PSN A;  3H60 A;  4MOV A;  1S3M A;  1S3L A;  4FBW A;  4DT2 A;  4I5L C;  4ZVZ A;  1OIE A;  3AV0 A;  3QFK A;  2NPP C;  5INB A;  1UTE A;  2DFJ A;  3N5U A;  4MOY A;  2HYP A;  2NYM C;  2O8A A;  4UWQ A;  5JJT A;  2HY1 A;  2BCD A;  2DXL A;  3ICF A;  2QFR A;  4IYP C;  3QFM A;  2WDE A;  1M63 A;  4I5N C;  3H66 A;  2Z1A A;  3RL5 A;  1FJM A;  1T71 A;  3H68 A;  3RL3 A;  3IVE A;  4FBQ A;  3FGA C;  4DHL A;  5JPE A;  2R17 A;  2ZO9 B;  5EQV A;  5DNY A;  1XM7 A;  5F3W A;  4V0V A;  4UT3 B;  4O43 A;  4H2F A;  1V73 A;  3RQZ A;  4V0X A;  3THO B;  2DXN A;  5IOH A;  1G5B A;  2AHD A;  2WDC A;  4H2I A;  4V0W A;  1OID A;  4F0Z A;  2Z72 A;  4IL1 A;  1IT6 A;  1UF3 A;  1QFC A;  2YVT A;  3E7A A;  3LL8 A;  1S70 A;  1U32 A;  3C5W C;  3QFO A;  5C1V A;  4B2O A;  4Q7F A;  3RL4 A;  3TGH A;  4ORA A;  3H63 A;  4H1Y P;  1XZW A;  5HPE A;  2A22 A;  4UT2 A;  4FCX A;  2GJU A;  4YKE A;  2BDX A;  3E0J A;  4G9J A;  3V4Y A;  1T70 A;  1S95 A;  4UT3 A;  3AUZ A;  1Z2W A;  1TCO A;  2QFP A;  2ZOA A;  3K7V C;  4H2G A;  1HP1 A;  2Z06 A;  3FLO A;  3D03 A;  3ZU0 A;  3DSC A;  4JA9 A;  4H2B A;  4NZV A;  4WWL A;  1QHW A;  2P6B A;  2HYO A;  3H67 A;  4JA7 A;  4J6O A;  1II7 A;  3E7B A;  4MP0 A;  1WAO 1;  3JYF A;  3IB8 A;  4OR9 A;  4LTY A;  2USH A;  2JOG A;  3HVQ A;  1SU1 A;  4TUI A;  5JPF A;  3IB7 A;  4ORB A;  2O8G A;  3QG5 C;  1NNW A;  4HD0 A;  4DSY A;  1AUI A;  4KBP A;  1KBP A;  3H69 A;  3DSD A;  2YEQ A; 
#chains in the Genus database with same CATH homology
 4ORC A;  1OI8 A;  2KKN A;  2WDD A;  4LAC C;  3ZTV A;  1Z2X A;  2NYL C;  1MF8 A;  2XMO A;  4KKZ A;  5GTU A;  3QFN A;  4ZX2 A;  1S3N A;  3EGH A;  3KBP A;  3IVD A;  4O5G A;  4TUG A;  5J28 A;  2QJC A;  2ZBM A;  3C9F A;  3H61 A;  3K7W C;  2IE4 C;  3EGG A;  1JK7 A;  4O24 A;  2NXF A;  2BQ8 X;  1HPU A;  3THN A;  2WDF A;  4XPN A;  4M0V A;  2IE3 C;  3H62 B;  3P71 C;  1W24 A;  4LU9 A;  4FBK A;  1HO5 A;  3T1I A;  3PSO A;  3H64 A;  4H1S A;  2IAE C;  3DW8 C;  2Q8U A;  2CV9 A;  1USH A;  3GVE A;  5B8I A;  3CK2 A;  1S8E A;  4O4K A;  1WAR A;  3PSN A;  3H60 A;  4MOV A;  1S3M A;  1S3L A;  4FBW A;  4DT2 A;  4I5L C;  4ZVZ A;  1OIE A;  3AV0 A;  3QFK A;  2NPP C;  5INB A;  1UTE A;  2DFJ A;  3N5U A;  4MOY A;  2HYP A;  2NYM C;  2O8A A;  4UWQ A;  5JJT A;  2HY1 A;  2BCD A;  2DXL A;  3ICF A;  2QFR A;  4IYP C;  3QFM A;  2WDE A;  1M63 A;  4I5N C;  3H66 A;  2Z1A A;  3RL5 A;  1FJM A;  1T71 A;  3H68 A;  3RL3 A;  3IVE A;  4FBQ A;  3FGA C;  4DHL A;  5JPE A;  2R17 A;  2ZO9 B;  5EQV A;  5DNY A;  1XM7 A;  5F3W A;  4V0V A;  4UT3 B;  4O43 A;  4H2F A;  1V73 A;  3RQZ A;  4V0X A;  3THO B;  2DXN A;  5IOH A;  1G5B A;  2AHD A;  2WDC A;  4H2I A;  4V0W A;  1OID A;  4F0Z A;  2Z72 A;  4IL1 A;  1IT6 A;  1UF3 A;  1QFC A;  2YVT A;  3E7A A;  3LL8 A;  1S70 A;  1U32 A;  3C5W C;  3QFO A;  5C1V A;  4B2O A;  4Q7F A;  3RL4 A;  3TGH A;  4ORA A;  3H63 A;  4H1Y P;  1XZW A;  5HPE A;  2A22 A;  4UT2 A;  4FCX A;  2GJU A;  4YKE A;  2BDX A;  3E0J A;  4G9J A;  3V4Y A;  1T70 A;  1S95 A;  4UT3 A;  3AUZ A;  1Z2W A;  1TCO A;  2QFP A;  2ZOA A;  3K7V C;  4H2G A;  1HP1 A;  2Z06 A;  3FLO A;  3D03 A;  3ZU0 A;  3DSC A;  4JA9 A;  4H2B A;  4NZV A;  4WWL A;  1QHW A;  2P6B A;  2HYO A;  3H67 A;  4JA7 A;  4J6O A;  1II7 A;  3E7B A;  4MP0 A;  1WAO 1;  3JYF A;  3IB8 A;  4OR9 A;  4LTY A;  2USH A;  2JOG A;  3HVQ A;  1SU1 A;  4TUI A;  5JPF A;  3IB7 A;  4ORB A;  2O8G A;  3QG5 C;  1NNW A;  4HD0 A;  4DSY A;  1AUI A;  4KBP A;  1KBP A;  3H69 A;  3DSD A;  2YEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...