1G5BA

Bacteriophage lambda ser/thr protein phosphatase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
219
Chain Sequence
MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein, hydrolase
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE
total genus 74
structure length 219
sequence length 219
chains with identical sequence B, C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2000-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1g5bA00
2Q8UA 2IE4C 3K7WC 4G9JA 1TCOA 4KBPA 1OI8A 4I5NC 4XPNA 1S8EA 1W24A 4O24A 3CK2A 4LU9A 2O8GA 3HVQA 1NNWA 3FGAC 2KKNA 4ORBA 1QFCA 4OR9A 4UT2A 4YKEA 3N5UA 2HY1A 3QG5C 1Z2XA 4FBKA 4NZVA 3C9FA 4V0VA 3KBPA 3DSCA 3EGGA 4KKZA 2A22A 2XMOA 2YVTA 2AHDA 2JOGA 4O43A 1XZWA 3H68A 3JYFA 3RL4A 4IYPC 1UTEA 1G5BA 1JK7A 3RL5A 4ZVZA 2BCDA 2WDCA 3P71C 4FBQA 4UWQA 5HPEA 3LL8A 3THOB 2WDDA 5B8IA 1M63A 4UT3A 4FCXA 4DSYA 3E7AA 2NYMC 2HYPA 2DFJA 3H62B 2R17A 4H2GA 4V0WA 4DHLA 3ZTVA 1T70A 2NXFA 2NPPC 2Z06A 3GVEA 1U32A 2WDFA 4J6OA 4O5GA 2O8AA 5F3WA 1HPUA 3PSOA 4Q7FA 4TUGA 2IE3C 4JA7A 4H2IA 1HO5A 3PSNA 3AV0A 2ZBMA 1OIEA 4HD0A 2WDEA 3C5WC 4LACC 4DT2A 4O4KA 3H67A 3EGHA 3ICFA 2IAEC 5GTUA 4H2FA 5C1VA 1MF8A 4WWLA 5IOHA 4MOYA 4IL1A 3DW8C 3H61A 1HP1A 2BQ8X 5J28A 3TGHA 1QHWA 4MP0A 1XM7A 4H2BA 1UF3A 2Z72A 2USHA 3ZU0A 3IB7A 3QFMA 1S3LA 5JPFA 1OIDA 5JPEA 1FJMA 3QFKA 4LTYA 3T1IA 3H66A 2QJCA 3QFNA 3V4YA 2QFPA 2NYLC 3H63A 4FBWA 1S95A 1WAO1 3IB8A 2GJUA 4ORAA 1II7A 4H1YP 1USHA 4F0ZA 1Z2WA 3K7VC 4TUIA 3DSDA 4UT3B 1V73A 2CV9A 1KBPA 4M0VA 3THNA 1WARA 1SU1A 5EQVA 3RL3A 3H69A 3E7BA 2BDXA 4MOVA 3IVEA 3H64A 4V0XA 4H1SA 3IVDA 4JA9A 2QFRA 5JJTA 3QFOA 1AUIA 2HYOA 3AUZA 2Z1AA 1T71A 5INBA 3H60A 4I5LC 4B2OA 2P6BA 1S70A 4ORCA 1IT6A 1S3NA 1S3MA 4ZX2A 5DNYA 3RQZA
chains in the Genus database with same CATH superfamily
2Q8UA 2IE4C 3E0JA 3K7WC 4G9JA 1TCOA 4KBPA 1OI8A 4I5NC 4XPNA 1S8EA 1W24A 4O24A 3CK2A 4LU9A 2O8GA 2DXNA 3HVQA 1NNWA 3FGAC 2KKNA 4ORBA 1QFCA 4OR9A 4UT2A 4YKEA 3N5UA 2HY1A 3QG5C 1Z2XA 4FBKA 4NZVA 3C9FA 4V0VA 3KBPA 3DSCA 3EGGA 4KKZA 2A22A 2XMOA 2YVTA 2AHDA 2JOGA 4O43A 1XZWA 3H68A 3JYFA 3RL4A 4IYPC 1UTEA 1G5BA 1JK7A 3RL5A 4ZVZA 2BCDA 2WDCA 3P71C 4FBQA 4UWQA 5HPEA 3LL8A 3THOB 2WDDA 5B8IA 3FLOA 1M63A 4UT3A 4FCXA 4DSYA 3E7AA 2NYMC 2HYPA 2DFJA 3H62B 2R17A 4H2GA 4V0WA 4DHLA 3ZTVA 1T70A 2NXFA 2NPPC 2Z06A 3GVEA 1U32A 2WDFA 4J6OA 4O5GA 2O8AA 5F3WA 2ZOAA 1HPUA 3PSOA 4Q7FA 4TUGA 2IE3C 4JA7A 4H2IA 1HO5A 3PSNA 3AV0A 2ZBMA 1OIEA 4HD0A 2WDEA 3C5WC 4LACC 4DT2A 4O4KA 3H67A 3EGHA 3ICFA 2IAEC 5GTUA 4H2FA 5C1VA 1MF8A 2ZO9B 4WWLA 5IOHA 4MOYA 2DXLA 4IL1A 3DW8C 3H61A 1HP1A 2BQ8X 5J28A 3TGHA 1QHWA 4MP0A 1XM7A 4H2BA 1UF3A 2Z72A 2USHA 3ZU0A 3IB7A 3QFMA 1S3LA 5JPFA 1OIDA 2YEQA 1FJMA 3QFKA 5JPEA 4LTYA 3T1IA 3H66A 2QJCA 3QFNA 3V4YA 2QFPA 2NYLC 3H63A 4FBWA 1S95A 1WAO1 3IB8A 2GJUA 4ORAA 1II7A 4H1YP 1USHA 4F0ZA 1Z2WA 3K7VC 4TUIA 3DSDA 4UT3B 1V73A 2CV9A 1KBPA 4M0VA 3THNA 1WARA 1SU1A 5EQVA 3RL3A 3H69A 3E7BA 2BDXA 4MOVA 3IVEA 3H64A 4V0XA 4H1SA 3IVDA 4JA9A 2QFRA 5JJTA 3QFOA 1AUIA 2HYOA 3AUZA 2Z1AA 1T71A 5INBA 3H60A 4I5LC 4B2OA 2P6BA 1S70A 4ORCA 1IT6A 1S3NA 1S3MA 3D03A 4ZX2A 5DNYA 3RQZA
chains in the Genus database with same CATH topology
2Q8UA 2IE4C 3E0JA 3K7WC 4G9JA 1TCOA 4KBPA 1OI8A 4I5NC 4XPNA 1S8EA 1W24A 4O24A 3CK2A 4LU9A 2O8GA 2DXNA 3HVQA 1NNWA 3FGAC 2KKNA 4ORBA 1QFCA 4OR9A 4UT2A 4YKEA 3N5UA 2HY1A 3QG5C 1Z2XA 4FBKA 4NZVA 3C9FA 4V0VA 3KBPA 3DSCA 3EGGA 4KKZA 2A22A 2XMOA 2YVTA 2AHDA 2JOGA 4O43A 1XZWA 3H68A 3JYFA 3RL4A 4IYPC 1UTEA 1G5BA 1JK7A 3RL5A 4ZVZA 2BCDA 2WDCA 3P71C 4FBQA 4UWQA 5HPEA 3LL8A 3THOB 2WDDA 5B8IA 3FLOA 1M63A 4UT3A 4FCXA 4DSYA 3E7AA 2NYMC 2HYPA 2DFJA 3H62B 2R17A 4H2GA 4V0WA 4DHLA 3ZTVA 1T70A 2NXFA 2NPPC 2Z06A 3GVEA 1U32A 2WDFA 4J6OA 4O5GA 2O8AA 5F3WA 2ZOAA 1HPUA 3PSOA 4Q7FA 4TUGA 2IE3C 4JA7A 4H2IA 1HO5A 3PSNA 3AV0A 2ZBMA 1OIEA 4HD0A 2WDEA 3C5WC 4LACC 4DT2A 4O4KA 3H67A 3EGHA 3ICFA 2IAEC 5GTUA 4H2FA 5C1VA 1MF8A 2ZO9B 4WWLA 5IOHA 4MOYA 2DXLA 4IL1A 3DW8C 3H61A 1HP1A 2BQ8X 5J28A 3TGHA 1QHWA 4MP0A 1XM7A 4H2BA 1UF3A 2Z72A 2USHA 3ZU0A 3IB7A 3QFMA 1S3LA 5JPFA 1OIDA 2YEQA 1FJMA 3QFKA 5JPEA 4LTYA 3T1IA 3H66A 2QJCA 3QFNA 3V4YA 2QFPA 2NYLC 3H63A 4FBWA 1S95A 1WAO1 3IB8A 2GJUA 4ORAA 1II7A 4H1YP 1USHA 4F0ZA 1Z2WA 3K7VC 4TUIA 3DSDA 4UT3B 1V73A 2CV9A 1KBPA 4M0VA 3THNA 1WARA 1SU1A 5EQVA 3RL3A 3H69A 3E7BA 2BDXA 4MOVA 3IVEA 3H64A 4V0XA 4H1SA 3IVDA 4JA9A 2QFRA 5JJTA 3QFOA 1AUIA 2HYOA 3AUZA 2Z1AA 1T71A 5INBA 3H60A 4I5LC 4B2OA 2P6BA 1S70A 4ORCA 1IT6A 1S3NA 1S3MA 3D03A 4ZX2A 5DNYA 3RQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8U A;  2IE4 C;  3K7W C;  4G9J A;  1TCO A;  4KBP A;  1OI8 A;  4I5N C;  4XPN A;  1S8E A;  1W24 A;  4O24 A;  3CK2 A;  4LU9 A;  2O8G A;  3HVQ A;  1NNW A;  3FGA C;  2KKN A;  4ORB A;  1QFC A;  4OR9 A;  4UT2 A;  4YKE A;  3N5U A;  2HY1 A;  3QG5 C;  1Z2X A;  4FBK A;  4NZV A;  3C9F A;  4V0V A;  3KBP A;  3DSC A;  3EGG A;  4KKZ A;  2A22 A;  2XMO A;  2YVT A;  2AHD A;  2JOG A;  4O43 A;  1XZW A;  3H68 A;  3JYF A;  3RL4 A;  4IYP C;  1UTE A;  1G5B A;  1JK7 A;  3RL5 A;  4ZVZ A;  2BCD A;  2WDC A;  3P71 C;  4FBQ A;  4UWQ A;  5HPE A;  3LL8 A;  3THO B;  2WDD A;  5B8I A;  1M63 A;  4UT3 A;  4FCX A;  4DSY A;  3E7A A;  2NYM C;  2HYP A;  2DFJ A;  3H62 B;  2R17 A;  4H2G A;  4V0W A;  4DHL A;  3ZTV A;  1T70 A;  2NXF A;  2NPP C;  2Z06 A;  3GVE A;  1U32 A;  2WDF A;  4J6O A;  4O5G A;  2O8A A;  5F3W A;  1HPU A;  3PSO A;  4Q7F A;  4TUG A;  2IE3 C;  4JA7 A;  4H2I A;  1HO5 A;  3PSN A;  3AV0 A;  2ZBM A;  1OIE A;  4HD0 A;  2WDE A;  3C5W C;  4LAC C;  4DT2 A;  4O4K A;  3H67 A;  3EGH A;  3ICF A;  2IAE C;  5GTU A;  4H2F A;  5C1V A;  1MF8 A;  4WWL A;  5IOH A;  4MOY A;  4IL1 A;  3DW8 C;  3H61 A;  1HP1 A;  2BQ8 X;  5J28 A;  3TGH A;  1QHW A;  4MP0 A;  1XM7 A;  4H2B A;  1UF3 A;  2Z72 A;  2USH A;  3ZU0 A;  3IB7 A;  3QFM A;  1S3L A;  5JPF A;  1OID A;  5JPE A;  1FJM A;  3QFK A;  4LTY A;  3T1I A;  3H66 A;  2QJC A;  3QFN A;  3V4Y A;  2QFP A;  2NYL C;  3H63 A;  4FBW A;  1S95 A;  1WAO 1;  3IB8 A;  2GJU A;  4ORA A;  1II7 A;  4H1Y P;  1USH A;  4F0Z A;  1Z2W A;  3K7V C;  4TUI A;  3DSD A;  4UT3 B;  1V73 A;  2CV9 A;  1KBP A;  4M0V A;  3THN A;  1WAR A;  1SU1 A;  5EQV A;  3RL3 A;  3H69 A;  3E7B A;  2BDX A;  4MOV A;  3IVE A;  3H64 A;  4V0X A;  4H1S A;  3IVD A;  4JA9 A;  2QFR A;  5JJT A;  3QFO A;  1AUI A;  2HYO A;  3AUZ A;  2Z1A A;  1T71 A;  5INB A;  3H60 A;  4I5L C;  4B2O A;  2P6B A;  1S70 A;  4ORC A;  1IT6 A;  1S3N A;  1S3M A;  4ZX2 A;  5DNY A;  3RQZ A; 
#chains in the Genus database with same CATH topology
 2Q8U A;  2IE4 C;  3E0J A;  3K7W C;  4G9J A;  1TCO A;  4KBP A;  1OI8 A;  4I5N C;  4XPN A;  1S8E A;  1W24 A;  4O24 A;  3CK2 A;  4LU9 A;  2O8G A;  2DXN A;  3HVQ A;  1NNW A;  3FGA C;  2KKN A;  4ORB A;  1QFC A;  4OR9 A;  4UT2 A;  4YKE A;  3N5U A;  2HY1 A;  3QG5 C;  1Z2X A;  4FBK A;  4NZV A;  3C9F A;  4V0V A;  3KBP A;  3DSC A;  3EGG A;  4KKZ A;  2A22 A;  2XMO A;  2YVT A;  2AHD A;  2JOG A;  4O43 A;  1XZW A;  3H68 A;  3JYF A;  3RL4 A;  4IYP C;  1UTE A;  1G5B A;  1JK7 A;  3RL5 A;  4ZVZ A;  2BCD A;  2WDC A;  3P71 C;  4FBQ A;  4UWQ A;  5HPE A;  3LL8 A;  3THO B;  2WDD A;  5B8I A;  3FLO A;  1M63 A;  4UT3 A;  4FCX A;  4DSY A;  3E7A A;  2NYM C;  2HYP A;  2DFJ A;  3H62 B;  2R17 A;  4H2G A;  4V0W A;  4DHL A;  3ZTV A;  1T70 A;  2NXF A;  2NPP C;  2Z06 A;  3GVE A;  1U32 A;  2WDF A;  4J6O A;  4O5G A;  2O8A A;  5F3W A;  2ZOA A;  1HPU A;  3PSO A;  4Q7F A;  4TUG A;  2IE3 C;  4JA7 A;  4H2I A;  1HO5 A;  3PSN A;  3AV0 A;  2ZBM A;  1OIE A;  4HD0 A;  2WDE A;  3C5W C;  4LAC C;  4DT2 A;  4O4K A;  3H67 A;  3EGH A;  3ICF A;  2IAE C;  5GTU A;  4H2F A;  5C1V A;  1MF8 A;  2ZO9 B;  4WWL A;  5IOH A;  4MOY A;  2DXL A;  4IL1 A;  3DW8 C;  3H61 A;  1HP1 A;  2BQ8 X;  5J28 A;  3TGH A;  1QHW A;  4MP0 A;  1XM7 A;  4H2B A;  1UF3 A;  2Z72 A;  2USH A;  3ZU0 A;  3IB7 A;  3QFM A;  1S3L A;  5JPF A;  1OID A;  2YEQ A;  1FJM A;  3QFK A;  5JPE A;  4LTY A;  3T1I A;  3H66 A;  2QJC A;  3QFN A;  3V4Y A;  2QFP A;  2NYL C;  3H63 A;  4FBW A;  1S95 A;  1WAO 1;  3IB8 A;  2GJU A;  4ORA A;  1II7 A;  4H1Y P;  1USH A;  4F0Z A;  1Z2W A;  3K7V C;  4TUI A;  3DSD A;  4UT3 B;  1V73 A;  2CV9 A;  1KBP A;  4M0V A;  3THN A;  1WAR A;  1SU1 A;  5EQV A;  3RL3 A;  3H69 A;  3E7B A;  2BDX A;  4MOV A;  3IVE A;  3H64 A;  4V0X A;  4H1S A;  3IVD A;  4JA9 A;  2QFR A;  5JJT A;  3QFO A;  1AUI A;  2HYO A;  3AUZ A;  2Z1A A;  1T71 A;  5INB A;  3H60 A;  4I5L C;  4B2O A;  2P6B A;  1S70 A;  4ORC A;  1IT6 A;  1S3N A;  1S3M A;  3D03 A;  4ZX2 A;  5DNY A;  3RQZ A; 
#chains in the Genus database with same CATH homology
 2Q8U A;  2IE4 C;  3E0J A;  3K7W C;  4G9J A;  1TCO A;  4KBP A;  1OI8 A;  4I5N C;  4XPN A;  1S8E A;  1W24 A;  4O24 A;  3CK2 A;  4LU9 A;  2O8G A;  2DXN A;  3HVQ A;  1NNW A;  3FGA C;  2KKN A;  4ORB A;  1QFC A;  4OR9 A;  4UT2 A;  4YKE A;  3N5U A;  2HY1 A;  3QG5 C;  1Z2X A;  4FBK A;  4NZV A;  3C9F A;  4V0V A;  3KBP A;  3DSC A;  3EGG A;  4KKZ A;  2A22 A;  2XMO A;  2YVT A;  2AHD A;  2JOG A;  4O43 A;  1XZW A;  3H68 A;  3JYF A;  3RL4 A;  4IYP C;  1UTE A;  1G5B A;  1JK7 A;  3RL5 A;  4ZVZ A;  2BCD A;  2WDC A;  3P71 C;  4FBQ A;  4UWQ A;  5HPE A;  3LL8 A;  3THO B;  2WDD A;  5B8I A;  3FLO A;  1M63 A;  4UT3 A;  4FCX A;  4DSY A;  3E7A A;  2NYM C;  2HYP A;  2DFJ A;  3H62 B;  2R17 A;  4H2G A;  4V0W A;  4DHL A;  3ZTV A;  1T70 A;  2NXF A;  2NPP C;  2Z06 A;  3GVE A;  1U32 A;  2WDF A;  4J6O A;  4O5G A;  2O8A A;  5F3W A;  2ZOA A;  1HPU A;  3PSO A;  4Q7F A;  4TUG A;  2IE3 C;  4JA7 A;  4H2I A;  1HO5 A;  3PSN A;  3AV0 A;  2ZBM A;  1OIE A;  4HD0 A;  2WDE A;  3C5W C;  4LAC C;  4DT2 A;  4O4K A;  3H67 A;  3EGH A;  3ICF A;  2IAE C;  5GTU A;  4H2F A;  5C1V A;  1MF8 A;  2ZO9 B;  4WWL A;  5IOH A;  4MOY A;  2DXL A;  4IL1 A;  3DW8 C;  3H61 A;  1HP1 A;  2BQ8 X;  5J28 A;  3TGH A;  1QHW A;  4MP0 A;  1XM7 A;  4H2B A;  1UF3 A;  2Z72 A;  2USH A;  3ZU0 A;  3IB7 A;  3QFM A;  1S3L A;  5JPF A;  1OID A;  2YEQ A;  1FJM A;  3QFK A;  5JPE A;  4LTY A;  3T1I A;  3H66 A;  2QJC A;  3QFN A;  3V4Y A;  2QFP A;  2NYL C;  3H63 A;  4FBW A;  1S95 A;  1WAO 1;  3IB8 A;  2GJU A;  4ORA A;  1II7 A;  4H1Y P;  1USH A;  4F0Z A;  1Z2W A;  3K7V C;  4TUI A;  3DSD A;  4UT3 B;  1V73 A;  2CV9 A;  1KBP A;  4M0V A;  3THN A;  1WAR A;  1SU1 A;  5EQV A;  3RL3 A;  3H69 A;  3E7B A;  2BDX A;  4MOV A;  3IVE A;  3H64 A;  4V0X A;  4H1S A;  3IVD A;  4JA9 A;  2QFR A;  5JJT A;  3QFO A;  1AUI A;  2HYO A;  3AUZ A;  2Z1A A;  1T71 A;  5INB A;  3H60 A;  4I5L C;  4B2O A;  2P6B A;  1S70 A;  4ORC A;  1IT6 A;  1S3N A;  1S3M A;  3D03 A;  4ZX2 A;  5DNY A;  3RQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...