1U32A

Crystal structure of a protein phosphatase-1: calcineurin hybrid bound to okadaic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYLDVYNNAGAMMSVDETLMCSFQILKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine protein phosphatase PP1-gamma catalytic sub
publication title Crystal Structure and Mutagenesis of a Protein Phosphatase-1:Calcineurin Hybrid Elucidate the Role of the {beta}12-{beta}13 Loop in Inhibitor Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1u32A00
5JJTA 5JPFA 5JPEA 3AV0A 3QFOA 2QJCA 5GTUA 1WARA 5EQVA 1TCOA 1AUIA 3QG5C 4MOVA 4F0ZA 2BDXA 3C9FA 3IVEA 3PSNA 3RQZA 4WWLA 3QFNA 2WDFA 2JOGA 4NZVA 4IYPC 4YKEA 3IB8A 4J6OA 1XZWA 4FBQA 4LTYA 4DSYA 2O8AA 1UTEA 2WDCA 3AUZA 3N5UA 4OR9A 2HYOA 4UWQA 5DNYA 3THOB 1S3MA 4JA7A 1KBPA 4MP0A 1S70A 1HP1A 3HVQA 4O5GA 3ZU0A 4KKZA 3DSCA 2HY1A 2P6BA 1T71A 2AHDA 2NYLC 1S3LA 3H60A 3EGHA 4H1SA 4MOYA 3QFKA 1S8EA 4UT3A 5INBA 1USHA 3DW8C 4ORCA 2QFPA 2ZBMA 4XPNA 3ZTVA 1WAO1 3P71C 3H61A 4HD0A 3IB7A 2NPPC 2YVTA 3JYFA 3GVEA 3K7VC 3V4YA 2A22A 1V73A 3FGAC 4H1YP 4IL1A 3RL3A 4DT2A 4H2FA 4ORAA 5HPEA 3PSOA 5F3WA 1MF8A 3E7BA 1G5BA 5IOHA 2Z06A 3RL4A 2GJUA 2BQ8X 3IVDA 2QFRA 2NXFA 1Z2XA 1OI8A 1U32A 2IE3C 2DFJA 4V0WA 4Q7FA 4O4KA 1FJMA 2CV9A 3K7WC 3C5WC 4O24A 3QFMA 1Z2WA 2USHA 3H64A 4H2IA 3E7AA 4TUGA 1XM7A 4V0XA 1UF3A 3LL8A 1QFCA 2BCDA 1T70A 1IT6A 4FBWA 4ORBA 3TGHA 5J28A 4JA9A 3KBPA 1W24A 4ZX2A 3ICFA 5C1VA 3T1IA 4M0VA 3H67A 3RL5A 3EGGA 4LU9A 2WDEA 4TUIA 2KKNA 4DHLA 3CK2A 4LACC 4UT3B 4O43A 1HO5A 3H66A 1NNWA 3THNA 4FCXA 4H2BA 4H2GA 3H69A 1II7A 2Z1AA 4G9JA 1OIDA 2IE4C 1S95A 3H63A 4I5NC 4V0VA 2WDDA 2Q8UA 1SU1A 5B8IA 2XMOA 1QHWA 2HYPA 4I5LC 4B2OA 4FBKA 1JK7A 4KBPA 1M63A 1S3NA 2R17A 1OIEA 3H68A 4UT2A 3DSDA 2Z72A 4ZVZA 2O8GA 1HPUA 2NYMC 2IAEC 3H62B
chains in the Genus database with same CATH superfamily
5JJTA 5JPFA 5JPEA 3AV0A 3QFOA 2QJCA 5GTUA 1WARA 5EQVA 1TCOA 1AUIA 3QG5C 4MOVA 4F0ZA 2BDXA 3FLOA 3C9FA 3IVEA 3PSNA 3RQZA 4WWLA 3QFNA 2WDFA 2JOGA 4NZVA 2YEQA 4IYPC 4YKEA 3IB8A 4J6OA 1XZWA 4FBQA 4LTYA 4DSYA 2O8AA 1UTEA 2WDCA 3AUZA 3N5UA 4OR9A 2HYOA 4UWQA 5DNYA 3THOB 1S3MA 4JA7A 1KBPA 4MP0A 1S70A 1HP1A 3HVQA 2DXNA 4O5GA 3ZU0A 4KKZA 3DSCA 2HY1A 2P6BA 1T71A 2AHDA 2NYLC 1S3LA 3H60A 3EGHA 4H1SA 4MOYA 3QFKA 1S8EA 4UT3A 5INBA 1USHA 2DXLA 3DW8C 4ORCA 2QFPA 2ZBMA 4XPNA 3ZTVA 1WAO1 3P71C 3H61A 4HD0A 3IB7A 2NPPC 2YVTA 3JYFA 3GVEA 3K7VC 3V4YA 2A22A 1V73A 3FGAC 4H1YP 4IL1A 3RL3A 4DT2A 4H2FA 4ORAA 5HPEA 3PSOA 5F3WA 1MF8A 3E7BA 1G5BA 5IOHA 2Z06A 3RL4A 2GJUA 2BQ8X 3IVDA 2QFRA 2NXFA 1Z2XA 1OI8A 1U32A 2IE3C 2DFJA 4V0WA 4Q7FA 4O4KA 1FJMA 2ZOAA 2CV9A 3K7WC 3C5WC 4O24A 3QFMA 1Z2WA 2USHA 3H64A 4H2IA 3E7AA 4TUGA 1XM7A 4V0XA 1UF3A 3LL8A 1QFCA 2BCDA 1T70A 1IT6A 4FBWA 4ORBA 3TGHA 5J28A 3E0JA 4JA9A 3KBPA 1W24A 4ZX2A 3ICFA 5C1VA 3T1IA 4M0VA 3H67A 3RL5A 3EGGA 2ZO9B 4LU9A 2WDEA 4TUIA 2KKNA 4DHLA 3CK2A 4LACC 4UT3B 4O43A 1HO5A 3H66A 1NNWA 3THNA 4FCXA 4H2BA 4H2GA 3H69A 1II7A 2Z1AA 4G9JA 1OIDA 2IE4C 1S95A 3H63A 4I5NC 4V0VA 2WDDA 2Q8UA 1SU1A 5B8IA 2XMOA 1QHWA 2HYPA 4I5LC 4B2OA 3D03A 4FBKA 1JK7A 4KBPA 1M63A 1S3NA 2R17A 1OIEA 3H68A 4UT2A 3DSDA 2Z72A 4ZVZA 2O8GA 1HPUA 2NYMC 2IAEC 3H62B
chains in the Genus database with same CATH topology
5JJTA 5JPFA 5JPEA 3AV0A 3QFOA 2QJCA 5GTUA 1WARA 5EQVA 1TCOA 1AUIA 3QG5C 4MOVA 4F0ZA 2BDXA 3FLOA 3C9FA 3IVEA 3PSNA 3RQZA 4WWLA 3QFNA 2WDFA 2JOGA 4NZVA 2YEQA 4IYPC 4YKEA 3IB8A 4J6OA 1XZWA 4FBQA 4LTYA 4DSYA 2O8AA 1UTEA 2WDCA 3AUZA 3N5UA 4OR9A 2HYOA 4UWQA 5DNYA 3THOB 1S3MA 4JA7A 1KBPA 4MP0A 1S70A 1HP1A 3HVQA 2DXNA 4O5GA 3ZU0A 4KKZA 3DSCA 2HY1A 2P6BA 1T71A 2AHDA 2NYLC 1S3LA 3H60A 3EGHA 4H1SA 4MOYA 3QFKA 1S8EA 4UT3A 5INBA 1USHA 2DXLA 3DW8C 4ORCA 2QFPA 2ZBMA 4XPNA 3ZTVA 1WAO1 3P71C 3H61A 4HD0A 3IB7A 2NPPC 2YVTA 3JYFA 3GVEA 3K7VC 3V4YA 2A22A 1V73A 3FGAC 4H1YP 4IL1A 3RL3A 4DT2A 4H2FA 4ORAA 5HPEA 3PSOA 5F3WA 1MF8A 3E7BA 1G5BA 5IOHA 2Z06A 3RL4A 2GJUA 2BQ8X 3IVDA 2QFRA 2NXFA 1Z2XA 1OI8A 1U32A 2IE3C 2DFJA 4V0WA 4Q7FA 4O4KA 1FJMA 2ZOAA 2CV9A 3K7WC 3C5WC 4O24A 3QFMA 1Z2WA 2USHA 3H64A 4H2IA 3E7AA 4TUGA 1XM7A 4V0XA 1UF3A 3LL8A 1QFCA 2BCDA 1T70A 1IT6A 4FBWA 4ORBA 3TGHA 5J28A 3E0JA 4JA9A 3KBPA 1W24A 4ZX2A 3ICFA 5C1VA 3T1IA 4M0VA 3H67A 3RL5A 3EGGA 2ZO9B 4LU9A 2WDEA 4TUIA 2KKNA 4DHLA 3CK2A 4LACC 4UT3B 4O43A 1HO5A 3H66A 1NNWA 3THNA 4FCXA 4H2BA 4H2GA 3H69A 1II7A 2Z1AA 4G9JA 1OIDA 2IE4C 1S95A 3H63A 4I5NC 4V0VA 2WDDA 2Q8UA 1SU1A 5B8IA 2XMOA 1QHWA 2HYPA 4I5LC 4B2OA 3D03A 4FBKA 1JK7A 4KBPA 1M63A 1S3NA 2R17A 1OIEA 3H68A 4UT2A 3DSDA 2Z72A 4ZVZA 2O8GA 1HPUA 2NYMC 2IAEC 3H62B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJT A;  5JPF A;  5JPE A;  3AV0 A;  3QFO A;  2QJC A;  5GTU A;  1WAR A;  5EQV A;  1TCO A;  1AUI A;  3QG5 C;  4MOV A;  4F0Z A;  2BDX A;  3C9F A;  3IVE A;  3PSN A;  3RQZ A;  4WWL A;  3QFN A;  2WDF A;  2JOG A;  4NZV A;  4IYP C;  4YKE A;  3IB8 A;  4J6O A;  1XZW A;  4FBQ A;  4LTY A;  4DSY A;  2O8A A;  1UTE A;  2WDC A;  3AUZ A;  3N5U A;  4OR9 A;  2HYO A;  4UWQ A;  5DNY A;  3THO B;  1S3M A;  4JA7 A;  1KBP A;  4MP0 A;  1S70 A;  1HP1 A;  3HVQ A;  4O5G A;  3ZU0 A;  4KKZ A;  3DSC A;  2HY1 A;  2P6B A;  1T71 A;  2AHD A;  2NYL C;  1S3L A;  3H60 A;  3EGH A;  4H1S A;  4MOY A;  3QFK A;  1S8E A;  4UT3 A;  5INB A;  1USH A;  3DW8 C;  4ORC A;  2QFP A;  2ZBM A;  4XPN A;  3ZTV A;  1WAO 1;  3P71 C;  3H61 A;  4HD0 A;  3IB7 A;  2NPP C;  2YVT A;  3JYF A;  3GVE A;  3K7V C;  3V4Y A;  2A22 A;  1V73 A;  3FGA C;  4H1Y P;  4IL1 A;  3RL3 A;  4DT2 A;  4H2F A;  4ORA A;  5HPE A;  3PSO A;  5F3W A;  1MF8 A;  3E7B A;  1G5B A;  5IOH A;  2Z06 A;  3RL4 A;  2GJU A;  2BQ8 X;  3IVD A;  2QFR A;  2NXF A;  1Z2X A;  1OI8 A;  1U32 A;  2IE3 C;  2DFJ A;  4V0W A;  4Q7F A;  4O4K A;  1FJM A;  2CV9 A;  3K7W C;  3C5W C;  4O24 A;  3QFM A;  1Z2W A;  2USH A;  3H64 A;  4H2I A;  3E7A A;  4TUG A;  1XM7 A;  4V0X A;  1UF3 A;  3LL8 A;  1QFC A;  2BCD A;  1T70 A;  1IT6 A;  4FBW A;  4ORB A;  3TGH A;  5J28 A;  4JA9 A;  3KBP A;  1W24 A;  4ZX2 A;  3ICF A;  5C1V A;  3T1I A;  4M0V A;  3H67 A;  3RL5 A;  3EGG A;  4LU9 A;  2WDE A;  4TUI A;  2KKN A;  4DHL A;  3CK2 A;  4LAC C;  4UT3 B;  4O43 A;  1HO5 A;  3H66 A;  1NNW A;  3THN A;  4FCX A;  4H2B A;  4H2G A;  3H69 A;  1II7 A;  2Z1A A;  4G9J A;  1OID A;  2IE4 C;  1S95 A;  3H63 A;  4I5N C;  4V0V A;  2WDD A;  2Q8U A;  1SU1 A;  5B8I A;  2XMO A;  1QHW A;  2HYP A;  4I5L C;  4B2O A;  4FBK A;  1JK7 A;  4KBP A;  1M63 A;  1S3N A;  2R17 A;  1OIE A;  3H68 A;  4UT2 A;  3DSD A;  2Z72 A;  4ZVZ A;  2O8G A;  1HPU A;  2NYM C;  2IAE C;  3H62 B; 
#chains in the Genus database with same CATH topology
 5JJT A;  5JPF A;  5JPE A;  3AV0 A;  3QFO A;  2QJC A;  5GTU A;  1WAR A;  5EQV A;  1TCO A;  1AUI A;  3QG5 C;  4MOV A;  4F0Z A;  2BDX A;  3FLO A;  3C9F A;  3IVE A;  3PSN A;  3RQZ A;  4WWL A;  3QFN A;  2WDF A;  2JOG A;  4NZV A;  2YEQ A;  4IYP C;  4YKE A;  3IB8 A;  4J6O A;  1XZW A;  4FBQ A;  4LTY A;  4DSY A;  2O8A A;  1UTE A;  2WDC A;  3AUZ A;  3N5U A;  4OR9 A;  2HYO A;  4UWQ A;  5DNY A;  3THO B;  1S3M A;  4JA7 A;  1KBP A;  4MP0 A;  1S70 A;  1HP1 A;  3HVQ A;  2DXN A;  4O5G A;  3ZU0 A;  4KKZ A;  3DSC A;  2HY1 A;  2P6B A;  1T71 A;  2AHD A;  2NYL C;  1S3L A;  3H60 A;  3EGH A;  4H1S A;  4MOY A;  3QFK A;  1S8E A;  4UT3 A;  5INB A;  1USH A;  2DXL A;  3DW8 C;  4ORC A;  2QFP A;  2ZBM A;  4XPN A;  3ZTV A;  1WAO 1;  3P71 C;  3H61 A;  4HD0 A;  3IB7 A;  2NPP C;  2YVT A;  3JYF A;  3GVE A;  3K7V C;  3V4Y A;  2A22 A;  1V73 A;  3FGA C;  4H1Y P;  4IL1 A;  3RL3 A;  4DT2 A;  4H2F A;  4ORA A;  5HPE A;  3PSO A;  5F3W A;  1MF8 A;  3E7B A;  1G5B A;  5IOH A;  2Z06 A;  3RL4 A;  2GJU A;  2BQ8 X;  3IVD A;  2QFR A;  2NXF A;  1Z2X A;  1OI8 A;  1U32 A;  2IE3 C;  2DFJ A;  4V0W A;  4Q7F A;  4O4K A;  1FJM A;  2ZOA A;  2CV9 A;  3K7W C;  3C5W C;  4O24 A;  3QFM A;  1Z2W A;  2USH A;  3H64 A;  4H2I A;  3E7A A;  4TUG A;  1XM7 A;  4V0X A;  1UF3 A;  3LL8 A;  1QFC A;  2BCD A;  1T70 A;  1IT6 A;  4FBW A;  4ORB A;  3TGH A;  5J28 A;  3E0J A;  4JA9 A;  3KBP A;  1W24 A;  4ZX2 A;  3ICF A;  5C1V A;  3T1I A;  4M0V A;  3H67 A;  3RL5 A;  3EGG A;  2ZO9 B;  4LU9 A;  2WDE A;  4TUI A;  2KKN A;  4DHL A;  3CK2 A;  4LAC C;  4UT3 B;  4O43 A;  1HO5 A;  3H66 A;  1NNW A;  3THN A;  4FCX A;  4H2B A;  4H2G A;  3H69 A;  1II7 A;  2Z1A A;  4G9J A;  1OID A;  2IE4 C;  1S95 A;  3H63 A;  4I5N C;  4V0V A;  2WDD A;  2Q8U A;  1SU1 A;  5B8I A;  2XMO A;  1QHW A;  2HYP A;  4I5L C;  4B2O A;  3D03 A;  4FBK A;  1JK7 A;  4KBP A;  1M63 A;  1S3N A;  2R17 A;  1OIE A;  3H68 A;  4UT2 A;  3DSD A;  2Z72 A;  4ZVZ A;  2O8G A;  1HPU A;  2NYM C;  2IAE C;  3H62 B; 
#chains in the Genus database with same CATH homology
 5JJT A;  5JPF A;  5JPE A;  3AV0 A;  3QFO A;  2QJC A;  5GTU A;  1WAR A;  5EQV A;  1TCO A;  1AUI A;  3QG5 C;  4MOV A;  4F0Z A;  2BDX A;  3FLO A;  3C9F A;  3IVE A;  3PSN A;  3RQZ A;  4WWL A;  3QFN A;  2WDF A;  2JOG A;  4NZV A;  2YEQ A;  4IYP C;  4YKE A;  3IB8 A;  4J6O A;  1XZW A;  4FBQ A;  4LTY A;  4DSY A;  2O8A A;  1UTE A;  2WDC A;  3AUZ A;  3N5U A;  4OR9 A;  2HYO A;  4UWQ A;  5DNY A;  3THO B;  1S3M A;  4JA7 A;  1KBP A;  4MP0 A;  1S70 A;  1HP1 A;  3HVQ A;  2DXN A;  4O5G A;  3ZU0 A;  4KKZ A;  3DSC A;  2HY1 A;  2P6B A;  1T71 A;  2AHD A;  2NYL C;  1S3L A;  3H60 A;  3EGH A;  4H1S A;  4MOY A;  3QFK A;  1S8E A;  4UT3 A;  5INB A;  1USH A;  2DXL A;  3DW8 C;  4ORC A;  2QFP A;  2ZBM A;  4XPN A;  3ZTV A;  1WAO 1;  3P71 C;  3H61 A;  4HD0 A;  3IB7 A;  2NPP C;  2YVT A;  3JYF A;  3GVE A;  3K7V C;  3V4Y A;  2A22 A;  1V73 A;  3FGA C;  4H1Y P;  4IL1 A;  3RL3 A;  4DT2 A;  4H2F A;  4ORA A;  5HPE A;  3PSO A;  5F3W A;  1MF8 A;  3E7B A;  1G5B A;  5IOH A;  2Z06 A;  3RL4 A;  2GJU A;  2BQ8 X;  3IVD A;  2QFR A;  2NXF A;  1Z2X A;  1OI8 A;  1U32 A;  2IE3 C;  2DFJ A;  4V0W A;  4Q7F A;  4O4K A;  1FJM A;  2ZOA A;  2CV9 A;  3K7W C;  3C5W C;  4O24 A;  3QFM A;  1Z2W A;  2USH A;  3H64 A;  4H2I A;  3E7A A;  4TUG A;  1XM7 A;  4V0X A;  1UF3 A;  3LL8 A;  1QFC A;  2BCD A;  1T70 A;  1IT6 A;  4FBW A;  4ORB A;  3TGH A;  5J28 A;  3E0J A;  4JA9 A;  3KBP A;  1W24 A;  4ZX2 A;  3ICF A;  5C1V A;  3T1I A;  4M0V A;  3H67 A;  3RL5 A;  3EGG A;  2ZO9 B;  4LU9 A;  2WDE A;  4TUI A;  2KKN A;  4DHL A;  3CK2 A;  4LAC C;  4UT3 B;  4O43 A;  1HO5 A;  3H66 A;  1NNW A;  3THN A;  4FCX A;  4H2B A;  4H2G A;  3H69 A;  1II7 A;  2Z1A A;  4G9J A;  1OID A;  2IE4 C;  1S95 A;  3H63 A;  4I5N C;  4V0V A;  2WDD A;  2Q8U A;  1SU1 A;  5B8I A;  2XMO A;  1QHW A;  2HYP A;  4I5L C;  4B2O A;  3D03 A;  4FBK A;  1JK7 A;  4KBP A;  1M63 A;  1S3N A;  2R17 A;  1OIE A;  3H68 A;  4UT2 A;  3DSD A;  2Z72 A;  4ZVZ A;  2O8G A;  1HPU A;  2NYM C;  2IAE C;  3H62 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...