1U32A

Crystal structure of a protein phosphatase-1: calcineurin hybrid bound to okadaic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYLDVYNNAGAMMSVDETLMCSFQILKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Mutagenesis of a Protein Phosphatase-1:Calcineurin Hybrid Elucidate the Role of the {beta}12-{beta}13 Loop in Inhibitor Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine protein phosphatase PP1-gamma catalytic sub
total genus 106
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1u32A00
4O5GA 4B2OA 4V0WA 3RQZA 1QHWA 2QFRA 3H67A 4H2BA 4LU9A 4M0VA 4DT2A 4NZVA 5GTUA 1II7A 1OIDA 4H2IA 2AHDA 1T70A 5HPEA 4G9JA 3C9FA 4JA9A 3H66A 3E7BA 3FGAC 4MOVA 5DNYA 1S8EA 1WAO1 4H2FA 4JA7A 1M63A 2IAEC 3EGHA 4ORCA 3T1IA 3THOB 4UT3B 1XM7A 1Z2XA 2Z72A 1HO5A 3ZU0A 1NNWA 4ZX2A 1Z2WA 3H68A 3THNA 4O43A 3ICFA 4DSYA 3DW8C 3C5WC 3PSNA 3QG5C 4FBKA 3RL3A 3DSCA 5IOHA 3E7AA 2BDXA 4OR9A 4MOYA 2Z06A 4H1SA 3GVEA 4FBQA 4IYPC 5EQVA 1SU1A 1KBPA 2IE3C 5B8IA 2QJCA 3KBPA 1U32A 3P71C 2BQ8X 3IVDA 4H2GA 4WWLA 2HYOA 4YKEA 3V4YA 4UT3A 2O8GA 3QFOA 3H63A 2DFJA 5JPEA 1USHA 2A22A 3H60A 4KKZA 4O24A 4TUGA 2NYLC 4TUIA 4LACC 3LL8A 3IVEA 3IB8A 2XMOA 4I5NC 1HP1A 2NXFA 2ZBMA 3PSOA 4IL1A 4ZVZA 2NYMC 3H69A 3DSDA 2QFPA 4LTYA 5INBA 1QFCA 3H64A 1G5BA 5JJTA 1XZWA 3EGGA 1FJMA 4MP0A 1AUIA 4XPNA 4UT2A 3H62B 4Q7FA 5C1VA 3RL5A 4UWQA 2HY1A 1MF8A 2CV9A 4FCXA 1TCOA 3K7VC 4KBPA 2WDDA 1HPUA 1S3NA 4ORBA 3JYFA 4J6OA 4V0VA 3TGHA 1WARA 2R17A 2WDCA 2Q8UA 4F0ZA 1UF3A 3H61A 2P6BA 4ORAA 1W24A 1S3MA 1OI8A 1UTEA 5J28A 3ZTVA 2NPPC 3IB7A 1JK7A 3AUZA 3QFKA 1S95A 4FBWA 1IT6A 2YVTA 3CK2A 3K7WC 3QFNA 4H1YP 3RL4A 2WDFA 2KKNA 1OIEA 4I5LC 2HYPA 2IE4C 5F3WA 3N5UA 3HVQA 2GJUA 4HD0A 1T71A 4V0XA 2USHA 4DHLA 3QFMA 2O8AA 2JOGA 3AV0A 1S3LA 1S70A 1V73A 2BCDA 2WDEA 4O4KA 5JPFA 2Z1AA
chains in the Genus database with same CATH superfamily
4O5GA 4B2OA 4V0WA 3RQZA 1QHWA 2QFRA 3H67A 4H2BA 4LU9A 4M0VA 4DT2A 4NZVA 5GTUA 1II7A 1OIDA 4H2IA 2AHDA 1T70A 5HPEA 4G9JA 3C9FA 4JA9A 3H66A 3E7BA 3FGAC 3FLOA 4MOVA 5DNYA 1S8EA 1WAO1 4H2FA 4JA7A 1M63A 2IAEC 3EGHA 2DXNA 4ORCA 3T1IA 3THOB 4UT3B 1XM7A 1Z2XA 2Z72A 3DSCA 1HO5A 3ZU0A 1NNWA 4ZX2A 1Z2WA 3H68A 3THNA 4O43A 3ICFA 4DSYA 3DW8C 3C5WC 3PSNA 3QG5C 2ZO9B 4FBKA 3RL3A 3D03A 3E7AA 2BDXA 4OR9A 4MOYA 2Z06A 5IOHA 2YEQA 4H1SA 3GVEA 4FBQA 4IYPC 5EQVA 1SU1A 1KBPA 2IE3C 5B8IA 2QJCA 3KBPA 1U32A 3P71C 2BQ8X 3IVDA 4H2GA 4WWLA 2HYOA 4YKEA 3V4YA 4UT3A 2O8GA 3E0JA 3QFOA 3H63A 2DFJA 5JPEA 1USHA 2A22A 3H60A 4KKZA 4O24A 4TUGA 2NYLC 4TUIA 4LACC 3LL8A 3IVEA 3IB8A 2XMOA 2ZOAA 4I5NC 1HP1A 2NXFA 2ZBMA 3PSOA 4IL1A 4ZVZA 2NYMC 3H69A 3DSDA 2QFPA 4LTYA 5INBA 1QFCA 3H64A 1G5BA 5JJTA 1XZWA 3EGGA 1FJMA 4MP0A 1AUIA 4XPNA 4UT2A 3H62B 4Q7FA 5C1VA 3RL5A 4UWQA 2HY1A 1MF8A 2CV9A 4FCXA 1TCOA 3K7VC 4KBPA 2WDDA 1HPUA 1S3NA 4ORBA 3JYFA 4J6OA 4V0VA 3TGHA 1WARA 2R17A 2WDCA 2Q8UA 2DXLA 4F0ZA 1UF3A 3H61A 2P6BA 4ORAA 1W24A 1S3MA 1OI8A 1UTEA 5J28A 3ZTVA 2NPPC 3IB7A 1JK7A 3AUZA 3QFKA 1S95A 4FBWA 1IT6A 2YVTA 3CK2A 3K7WC 3QFNA 4H1YP 3RL4A 2WDFA 2KKNA 1OIEA 4I5LC 2HYPA 2IE4C 5F3WA 3N5UA 3HVQA 2GJUA 4HD0A 1T71A 4V0XA 2USHA 4DHLA 3QFMA 2O8AA 2JOGA 3AV0A 1S3LA 1S70A 1V73A 2BCDA 2WDEA 4O4KA 5JPFA 2Z1AA
chains in the Genus database with same CATH topology
4O5GA 4B2OA 4V0WA 3RQZA 1QHWA 2QFRA 3H67A 4H2BA 4LU9A 4M0VA 4DT2A 4NZVA 5GTUA 1II7A 1OIDA 4H2IA 2AHDA 1T70A 5HPEA 4G9JA 3C9FA 4JA9A 3H66A 3E7BA 3FGAC 3FLOA 4MOVA 5DNYA 1S8EA 1WAO1 4H2FA 4JA7A 1M63A 2IAEC 3EGHA 2DXNA 4ORCA 3T1IA 3THOB 4UT3B 1XM7A 1Z2XA 2Z72A 3DSCA 1HO5A 3ZU0A 1NNWA 4ZX2A 1Z2WA 3H68A 3THNA 4O43A 3ICFA 4DSYA 3DW8C 3C5WC 3PSNA 3QG5C 2ZO9B 4FBKA 3RL3A 3D03A 3E7AA 2BDXA 4OR9A 4MOYA 2Z06A 5IOHA 2YEQA 4H1SA 3GVEA 4FBQA 4IYPC 5EQVA 1SU1A 1KBPA 2IE3C 5B8IA 2QJCA 3KBPA 1U32A 3P71C 2BQ8X 3IVDA 4H2GA 4WWLA 2HYOA 4YKEA 3V4YA 4UT3A 2O8GA 3E0JA 3QFOA 3H63A 2DFJA 5JPEA 1USHA 2A22A 3H60A 4KKZA 4O24A 4TUGA 2NYLC 4TUIA 4LACC 3LL8A 3IVEA 3IB8A 2XMOA 2ZOAA 4I5NC 1HP1A 2NXFA 2ZBMA 3PSOA 4IL1A 4ZVZA 2NYMC 3H69A 3DSDA 2QFPA 4LTYA 5INBA 1QFCA 3H64A 1G5BA 5JJTA 1XZWA 3EGGA 1FJMA 4MP0A 1AUIA 4XPNA 4UT2A 3H62B 4Q7FA 5C1VA 3RL5A 4UWQA 2HY1A 1MF8A 2CV9A 4FCXA 1TCOA 3K7VC 4KBPA 2WDDA 1HPUA 1S3NA 4ORBA 3JYFA 4J6OA 4V0VA 3TGHA 1WARA 2R17A 2WDCA 2Q8UA 2DXLA 4F0ZA 1UF3A 3H61A 2P6BA 4ORAA 1W24A 1S3MA 1OI8A 1UTEA 5J28A 3ZTVA 2NPPC 3IB7A 1JK7A 3AUZA 3QFKA 1S95A 4FBWA 1IT6A 2YVTA 3CK2A 3K7WC 3QFNA 4H1YP 3RL4A 2WDFA 2KKNA 1OIEA 4I5LC 2HYPA 2IE4C 5F3WA 3N5UA 3HVQA 2GJUA 4HD0A 1T71A 4V0XA 2USHA 4DHLA 3QFMA 2O8AA 2JOGA 3AV0A 1S3LA 1S70A 1V73A 2BCDA 2WDEA 4O4KA 5JPFA 2Z1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5G A;  4B2O A;  4V0W A;  3RQZ A;  1QHW A;  2QFR A;  3H67 A;  4H2B A;  4LU9 A;  4M0V A;  4DT2 A;  4NZV A;  5GTU A;  1II7 A;  1OID A;  4H2I A;  2AHD A;  1T70 A;  5HPE A;  4G9J A;  3C9F A;  4JA9 A;  3H66 A;  3E7B A;  3FGA C;  4MOV A;  5DNY A;  1S8E A;  1WAO 1;  4H2F A;  4JA7 A;  1M63 A;  2IAE C;  3EGH A;  4ORC A;  3T1I A;  3THO B;  4UT3 B;  1XM7 A;  1Z2X A;  2Z72 A;  1HO5 A;  3ZU0 A;  1NNW A;  4ZX2 A;  1Z2W A;  3H68 A;  3THN A;  4O43 A;  3ICF A;  4DSY A;  3DW8 C;  3C5W C;  3PSN A;  3QG5 C;  4FBK A;  3RL3 A;  3DSC A;  5IOH A;  3E7A A;  2BDX A;  4OR9 A;  4MOY A;  2Z06 A;  4H1S A;  3GVE A;  4FBQ A;  4IYP C;  5EQV A;  1SU1 A;  1KBP A;  2IE3 C;  5B8I A;  2QJC A;  3KBP A;  1U32 A;  3P71 C;  2BQ8 X;  3IVD A;  4H2G A;  4WWL A;  2HYO A;  4YKE A;  3V4Y A;  4UT3 A;  2O8G A;  3QFO A;  3H63 A;  2DFJ A;  5JPE A;  1USH A;  2A22 A;  3H60 A;  4KKZ A;  4O24 A;  4TUG A;  2NYL C;  4TUI A;  4LAC C;  3LL8 A;  3IVE A;  3IB8 A;  2XMO A;  4I5N C;  1HP1 A;  2NXF A;  2ZBM A;  3PSO A;  4IL1 A;  4ZVZ A;  2NYM C;  3H69 A;  3DSD A;  2QFP A;  4LTY A;  5INB A;  1QFC A;  3H64 A;  1G5B A;  5JJT A;  1XZW A;  3EGG A;  1FJM A;  4MP0 A;  1AUI A;  4XPN A;  4UT2 A;  3H62 B;  4Q7F A;  5C1V A;  3RL5 A;  4UWQ A;  2HY1 A;  1MF8 A;  2CV9 A;  4FCX A;  1TCO A;  3K7V C;  4KBP A;  2WDD A;  1HPU A;  1S3N A;  4ORB A;  3JYF A;  4J6O A;  4V0V A;  3TGH A;  1WAR A;  2R17 A;  2WDC A;  2Q8U A;  4F0Z A;  1UF3 A;  3H61 A;  2P6B A;  4ORA A;  1W24 A;  1S3M A;  1OI8 A;  1UTE A;  5J28 A;  3ZTV A;  2NPP C;  3IB7 A;  1JK7 A;  3AUZ A;  3QFK A;  1S95 A;  4FBW A;  1IT6 A;  2YVT A;  3CK2 A;  3K7W C;  3QFN A;  4H1Y P;  3RL4 A;  2WDF A;  2KKN A;  1OIE A;  4I5L C;  2HYP A;  2IE4 C;  5F3W A;  3N5U A;  3HVQ A;  2GJU A;  4HD0 A;  1T71 A;  4V0X A;  2USH A;  4DHL A;  3QFM A;  2O8A A;  2JOG A;  3AV0 A;  1S3L A;  1S70 A;  1V73 A;  2BCD A;  2WDE A;  4O4K A;  5JPF A;  2Z1A A; 
#chains in the Genus database with same CATH topology
 4O5G A;  4B2O A;  4V0W A;  3RQZ A;  1QHW A;  2QFR A;  3H67 A;  4H2B A;  4LU9 A;  4M0V A;  4DT2 A;  4NZV A;  5GTU A;  1II7 A;  1OID A;  4H2I A;  2AHD A;  1T70 A;  5HPE A;  4G9J A;  3C9F A;  4JA9 A;  3H66 A;  3E7B A;  3FGA C;  3FLO A;  4MOV A;  5DNY A;  1S8E A;  1WAO 1;  4H2F A;  4JA7 A;  1M63 A;  2IAE C;  3EGH A;  2DXN A;  4ORC A;  3T1I A;  3THO B;  4UT3 B;  1XM7 A;  1Z2X A;  2Z72 A;  3DSC A;  1HO5 A;  3ZU0 A;  1NNW A;  4ZX2 A;  1Z2W A;  3H68 A;  3THN A;  4O43 A;  3ICF A;  4DSY A;  3DW8 C;  3C5W C;  3PSN A;  3QG5 C;  2ZO9 B;  4FBK A;  3RL3 A;  3D03 A;  3E7A A;  2BDX A;  4OR9 A;  4MOY A;  2Z06 A;  5IOH A;  2YEQ A;  4H1S A;  3GVE A;  4FBQ A;  4IYP C;  5EQV A;  1SU1 A;  1KBP A;  2IE3 C;  5B8I A;  2QJC A;  3KBP A;  1U32 A;  3P71 C;  2BQ8 X;  3IVD A;  4H2G A;  4WWL A;  2HYO A;  4YKE A;  3V4Y A;  4UT3 A;  2O8G A;  3E0J A;  3QFO A;  3H63 A;  2DFJ A;  5JPE A;  1USH A;  2A22 A;  3H60 A;  4KKZ A;  4O24 A;  4TUG A;  2NYL C;  4TUI A;  4LAC C;  3LL8 A;  3IVE A;  3IB8 A;  2XMO A;  2ZOA A;  4I5N C;  1HP1 A;  2NXF A;  2ZBM A;  3PSO A;  4IL1 A;  4ZVZ A;  2NYM C;  3H69 A;  3DSD A;  2QFP A;  4LTY A;  5INB A;  1QFC A;  3H64 A;  1G5B A;  5JJT A;  1XZW A;  3EGG A;  1FJM A;  4MP0 A;  1AUI A;  4XPN A;  4UT2 A;  3H62 B;  4Q7F A;  5C1V A;  3RL5 A;  4UWQ A;  2HY1 A;  1MF8 A;  2CV9 A;  4FCX A;  1TCO A;  3K7V C;  4KBP A;  2WDD A;  1HPU A;  1S3N A;  4ORB A;  3JYF A;  4J6O A;  4V0V A;  3TGH A;  1WAR A;  2R17 A;  2WDC A;  2Q8U A;  2DXL A;  4F0Z A;  1UF3 A;  3H61 A;  2P6B A;  4ORA A;  1W24 A;  1S3M A;  1OI8 A;  1UTE A;  5J28 A;  3ZTV A;  2NPP C;  3IB7 A;  1JK7 A;  3AUZ A;  3QFK A;  1S95 A;  4FBW A;  1IT6 A;  2YVT A;  3CK2 A;  3K7W C;  3QFN A;  4H1Y P;  3RL4 A;  2WDF A;  2KKN A;  1OIE A;  4I5L C;  2HYP A;  2IE4 C;  5F3W A;  3N5U A;  3HVQ A;  2GJU A;  4HD0 A;  1T71 A;  4V0X A;  2USH A;  4DHL A;  3QFM A;  2O8A A;  2JOG A;  3AV0 A;  1S3L A;  1S70 A;  1V73 A;  2BCD A;  2WDE A;  4O4K A;  5JPF A;  2Z1A A; 
#chains in the Genus database with same CATH homology
 4O5G A;  4B2O A;  4V0W A;  3RQZ A;  1QHW A;  2QFR A;  3H67 A;  4H2B A;  4LU9 A;  4M0V A;  4DT2 A;  4NZV A;  5GTU A;  1II7 A;  1OID A;  4H2I A;  2AHD A;  1T70 A;  5HPE A;  4G9J A;  3C9F A;  4JA9 A;  3H66 A;  3E7B A;  3FGA C;  3FLO A;  4MOV A;  5DNY A;  1S8E A;  1WAO 1;  4H2F A;  4JA7 A;  1M63 A;  2IAE C;  3EGH A;  2DXN A;  4ORC A;  3T1I A;  3THO B;  4UT3 B;  1XM7 A;  1Z2X A;  2Z72 A;  3DSC A;  1HO5 A;  3ZU0 A;  1NNW A;  4ZX2 A;  1Z2W A;  3H68 A;  3THN A;  4O43 A;  3ICF A;  4DSY A;  3DW8 C;  3C5W C;  3PSN A;  3QG5 C;  2ZO9 B;  4FBK A;  3RL3 A;  3D03 A;  3E7A A;  2BDX A;  4OR9 A;  4MOY A;  2Z06 A;  5IOH A;  2YEQ A;  4H1S A;  3GVE A;  4FBQ A;  4IYP C;  5EQV A;  1SU1 A;  1KBP A;  2IE3 C;  5B8I A;  2QJC A;  3KBP A;  1U32 A;  3P71 C;  2BQ8 X;  3IVD A;  4H2G A;  4WWL A;  2HYO A;  4YKE A;  3V4Y A;  4UT3 A;  2O8G A;  3E0J A;  3QFO A;  3H63 A;  2DFJ A;  5JPE A;  1USH A;  2A22 A;  3H60 A;  4KKZ A;  4O24 A;  4TUG A;  2NYL C;  4TUI A;  4LAC C;  3LL8 A;  3IVE A;  3IB8 A;  2XMO A;  2ZOA A;  4I5N C;  1HP1 A;  2NXF A;  2ZBM A;  3PSO A;  4IL1 A;  4ZVZ A;  2NYM C;  3H69 A;  3DSD A;  2QFP A;  4LTY A;  5INB A;  1QFC A;  3H64 A;  1G5B A;  5JJT A;  1XZW A;  3EGG A;  1FJM A;  4MP0 A;  1AUI A;  4XPN A;  4UT2 A;  3H62 B;  4Q7F A;  5C1V A;  3RL5 A;  4UWQ A;  2HY1 A;  1MF8 A;  2CV9 A;  4FCX A;  1TCO A;  3K7V C;  4KBP A;  2WDD A;  1HPU A;  1S3N A;  4ORB A;  3JYF A;  4J6O A;  4V0V A;  3TGH A;  1WAR A;  2R17 A;  2WDC A;  2Q8U A;  2DXL A;  4F0Z A;  1UF3 A;  3H61 A;  2P6B A;  4ORA A;  1W24 A;  1S3M A;  1OI8 A;  1UTE A;  5J28 A;  3ZTV A;  2NPP C;  3IB7 A;  1JK7 A;  3AUZ A;  3QFK A;  1S95 A;  4FBW A;  1IT6 A;  2YVT A;  3CK2 A;  3K7W C;  3QFN A;  4H1Y P;  3RL4 A;  2WDF A;  2KKN A;  1OIE A;  4I5L C;  2HYP A;  2IE4 C;  5F3W A;  3N5U A;  3HVQ A;  2GJU A;  4HD0 A;  1T71 A;  4V0X A;  2USH A;  4DHL A;  3QFM A;  2O8A A;  2JOG A;  3AV0 A;  1S3L A;  1S70 A;  1V73 A;  2BCD A;  2WDE A;  4O4K A;  5JPF A;  2Z1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...