1U32A

Crystal structure of a protein phosphatase-1: calcineurin hybrid bound to okadaic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYLDVYNNAGAMMSVDETLMCSFQILKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine protein phosphatase PP1-gamma catalytic sub
publication title Crystal Structure and Mutagenesis of a Protein Phosphatase-1:Calcineurin Hybrid Elucidate the Role of the {beta}12-{beta}13 Loop in Inhibitor Binding
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1u32A00
4DHLA 3FGAC 5F3WA 3C5WC 3C9FA 1Z2XA 2Z1AA 1NNWA 3PSNA 5EQVA 2ZBMA 4ZVZA 4H2BA 3P71C 2AHDA 3QFKA 1M63A 3E7AA 4TUGA 4ORBA 2USHA 2GJUA 1KBPA 4O43A 4V0WA 3IB7A 1OIEA 1S95A 3K7WC 4DT2A 3N5UA 3JYFA 4FBWA 3H68A 5C1VA 2O8GA 4Q7FA 2WDCA 2DFJA 4MP0A 3EGGA 3KBPA 2QFPA 2R17A 4HD0A 1QHWA 3ZTVA 1Z2WA 4KBPA 1S70A 2WDEA 3DSCA 4FBKA 2CV9A 1SU1A 4FBQA 4WWLA 4XPNA 4O5GA 4I5NC 4F0ZA 1OI8A 4LTYA 1XM7A 2BCDA 2HYPA 2NPPC 4YKEA 1S3NA 3IVEA 4MOYA 4UT3A 4B2OA 2WDDA 5JJTA 2Z06A 2YVTA 3QFOA 3TGHA 3H60A 5HPEA 1G5BA 5DNYA 2IAEC 3DSDA 4LU9A 1S3MA 2Q8UA 4JA7A 3HVQA 1II7A 2QFRA 4IYPC 4UT2A 3IVDA 2BDXA 3RQZA 3T1IA 2QJCA 2JOGA 3QFNA 3E7BA 3V4YA 1HP1A 4O4KA 3H61A 1QFCA 2HY1A 4LACC 3K7VC 4H1YP 1MF8A 1HO5A 4UT3B 1UF3A 4ORAA 1JK7A 4TUIA 2BQ8X 4H2IA 4J6OA 1WAO1 1T71A 2XMOA 2O8AA 4I5LC 4MOVA 1S8EA 4V0VA 1U32A 2NXFA 3THOB 1TCOA 3IB8A 2NYLC 4UWQA 3RL4A 3H62B 4H2FA 3RL5A 4H1SA 3H66A 4V0XA 4ZX2A 3H63A 5GTUA 5IOHA 1HPUA 4FCXA 1IT6A 3QG5C 5B8IA 4DSYA 1FJMA 4M0VA 4ORCA 2IE4C 5J28A 3CK2A 3QFMA 5JPEA 2KKNA 2NYMC 1WARA 4NZVA 1XZWA 5JPFA 3H67A 3ICFA 4O24A 4OR9A 5INBA 2Z72A 3PSOA 3THNA 1T70A 2IE3C 1OIDA 1S3LA 4JA9A 3AV0A 2HYOA 4G9JA 1UTEA 4KKZA 4IL1A 3DW8C 3LL8A 3AUZA 1AUIA 1USHA 4H2GA 3ZU0A 3GVEA 2A22A 3EGHA 2WDFA 1W24A 3H69A 3RL3A 3H64A 2P6BA 1V73A
chains in the Genus database with same CATH superfamily
4DHLA 3FGAC 5F3WA 3C5WC 3C9FA 1Z2XA 2Z1AA 1NNWA 3PSNA 5EQVA 2ZBMA 4ZVZA 4H2BA 3P71C 2AHDA 3QFKA 1M63A 3E7AA 4TUGA 4ORBA 2USHA 2GJUA 1KBPA 4O43A 4V0WA 3IB7A 1OIEA 1S95A 3K7WC 4DT2A 3N5UA 3JYFA 4FBWA 3H68A 2ZO9B 3FLOA 2O8GA 4Q7FA 5C1VA 2WDCA 2DFJA 4MP0A 3EGGA 3KBPA 2QFPA 2R17A 2YEQA 1QHWA 4HD0A 3ZTVA 1Z2WA 4KBPA 1S70A 2WDEA 3DSCA 4FBKA 2CV9A 1SU1A 4FBQA 4WWLA 4XPNA 4O5GA 2ZOAA 4I5NC 4F0ZA 2DXLA 1OI8A 4LTYA 1XM7A 2BCDA 2HYPA 2NPPC 4YKEA 1S3NA 3IVEA 4MOYA 4UT3A 4B2OA 2WDDA 5JJTA 2Z06A 2YVTA 3QFOA 3TGHA 3H60A 5HPEA 1G5BA 5DNYA 2IAEC 3DSDA 4LU9A 1S3MA 2Q8UA 4JA7A 3HVQA 1II7A 2QFRA 4IYPC 3D03A 4UT2A 2DXNA 2BDXA 3IVDA 3RQZA 2QJCA 3E0JA 3T1IA 2JOGA 3QFNA 3E7BA 3V4YA 1HP1A 4O4KA 3H61A 1QFCA 2HY1A 4LACC 3K7VC 4H1YP 1MF8A 1HO5A 4UT3B 1UF3A 4ORAA 1JK7A 4TUIA 2BQ8X 4H2IA 4J6OA 1WAO1 1T71A 2XMOA 2O8AA 4I5LC 4MOVA 1S8EA 4V0VA 1U32A 2NXFA 3THOB 1TCOA 3IB8A 2NYLC 4UWQA 3RL4A 3H62B 4H2FA 3RL5A 4H1SA 3H66A 4V0XA 4ZX2A 3H63A 5GTUA 5IOHA 1HPUA 4FCXA 1IT6A 3QG5C 5B8IA 4DSYA 1FJMA 4M0VA 4ORCA 2IE4C 5J28A 3CK2A 3QFMA 5JPEA 2KKNA 2NYMC 1WARA 4NZVA 1XZWA 5JPFA 3H67A 3ICFA 4O24A 4OR9A 5INBA 2Z72A 3PSOA 3THNA 1T70A 2IE3C 1OIDA 1S3LA 4JA9A 3AV0A 2HYOA 4G9JA 1UTEA 4KKZA 4IL1A 3DW8C 3LL8A 3AUZA 1AUIA 1USHA 4H2GA 3ZU0A 3GVEA 2A22A 3EGHA 2WDFA 1W24A 3H69A 3RL3A 3H64A 2P6BA 1V73A
chains in the Genus database with same CATH topology
4DHLA 3FGAC 5F3WA 3C5WC 3C9FA 1Z2XA 2Z1AA 1NNWA 3PSNA 5EQVA 2ZBMA 4ZVZA 4H2BA 3P71C 2AHDA 3QFKA 1M63A 3E7AA 4TUGA 4ORBA 2USHA 2GJUA 1KBPA 4O43A 4V0WA 3IB7A 1OIEA 1S95A 3K7WC 4DT2A 3N5UA 3JYFA 4FBWA 3H68A 2ZO9B 3FLOA 2O8GA 4Q7FA 5C1VA 2WDCA 2DFJA 4MP0A 3EGGA 3KBPA 2QFPA 2R17A 2YEQA 1QHWA 4HD0A 3ZTVA 1Z2WA 4KBPA 1S70A 2WDEA 3DSCA 4FBKA 2CV9A 1SU1A 4FBQA 4WWLA 4XPNA 4O5GA 2ZOAA 4I5NC 4F0ZA 2DXLA 1OI8A 4LTYA 1XM7A 2BCDA 2HYPA 2NPPC 4YKEA 1S3NA 3IVEA 4MOYA 4UT3A 4B2OA 2WDDA 5JJTA 2Z06A 2YVTA 3QFOA 3TGHA 3H60A 5HPEA 1G5BA 5DNYA 2IAEC 3DSDA 4LU9A 1S3MA 2Q8UA 4JA7A 3HVQA 1II7A 2QFRA 4IYPC 3D03A 4UT2A 2DXNA 2BDXA 3IVDA 3RQZA 2QJCA 3E0JA 3T1IA 2JOGA 3QFNA 3E7BA 3V4YA 1HP1A 4O4KA 3H61A 1QFCA 2HY1A 4LACC 3K7VC 4H1YP 1MF8A 1HO5A 4UT3B 1UF3A 4ORAA 1JK7A 4TUIA 2BQ8X 4H2IA 4J6OA 1WAO1 1T71A 2XMOA 2O8AA 4I5LC 4MOVA 1S8EA 4V0VA 1U32A 2NXFA 3THOB 1TCOA 3IB8A 2NYLC 4UWQA 3RL4A 3H62B 4H2FA 3RL5A 4H1SA 3H66A 4V0XA 4ZX2A 3H63A 5GTUA 5IOHA 1HPUA 4FCXA 1IT6A 3QG5C 5B8IA 4DSYA 1FJMA 4M0VA 4ORCA 2IE4C 5J28A 3CK2A 3QFMA 5JPEA 2KKNA 2NYMC 1WARA 4NZVA 1XZWA 5JPFA 3H67A 3ICFA 4O24A 4OR9A 5INBA 2Z72A 3PSOA 3THNA 1T70A 2IE3C 1OIDA 1S3LA 4JA9A 3AV0A 2HYOA 4G9JA 1UTEA 4KKZA 4IL1A 3DW8C 3LL8A 3AUZA 1AUIA 1USHA 4H2GA 3ZU0A 3GVEA 2A22A 3EGHA 2WDFA 1W24A 3H69A 3RL3A 3H64A 2P6BA 1V73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHL A;  3FGA C;  5F3W A;  3C5W C;  3C9F A;  1Z2X A;  2Z1A A;  1NNW A;  3PSN A;  5EQV A;  2ZBM A;  4ZVZ A;  4H2B A;  3P71 C;  2AHD A;  3QFK A;  1M63 A;  3E7A A;  4TUG A;  4ORB A;  2USH A;  2GJU A;  1KBP A;  4O43 A;  4V0W A;  3IB7 A;  1OIE A;  1S95 A;  3K7W C;  4DT2 A;  3N5U A;  3JYF A;  4FBW A;  3H68 A;  5C1V A;  2O8G A;  4Q7F A;  2WDC A;  2DFJ A;  4MP0 A;  3EGG A;  3KBP A;  2QFP A;  2R17 A;  4HD0 A;  1QHW A;  3ZTV A;  1Z2W A;  4KBP A;  1S70 A;  2WDE A;  3DSC A;  4FBK A;  2CV9 A;  1SU1 A;  4FBQ A;  4WWL A;  4XPN A;  4O5G A;  4I5N C;  4F0Z A;  1OI8 A;  4LTY A;  1XM7 A;  2BCD A;  2HYP A;  2NPP C;  4YKE A;  1S3N A;  3IVE A;  4MOY A;  4UT3 A;  4B2O A;  2WDD A;  5JJT A;  2Z06 A;  2YVT A;  3QFO A;  3TGH A;  3H60 A;  5HPE A;  1G5B A;  5DNY A;  2IAE C;  3DSD A;  4LU9 A;  1S3M A;  2Q8U A;  4JA7 A;  3HVQ A;  1II7 A;  2QFR A;  4IYP C;  4UT2 A;  3IVD A;  2BDX A;  3RQZ A;  3T1I A;  2QJC A;  2JOG A;  3QFN A;  3E7B A;  3V4Y A;  1HP1 A;  4O4K A;  3H61 A;  1QFC A;  2HY1 A;  4LAC C;  3K7V C;  4H1Y P;  1MF8 A;  1HO5 A;  4UT3 B;  1UF3 A;  4ORA A;  1JK7 A;  4TUI A;  2BQ8 X;  4H2I A;  4J6O A;  1WAO 1;  1T71 A;  2XMO A;  2O8A A;  4I5L C;  4MOV A;  1S8E A;  4V0V A;  1U32 A;  2NXF A;  3THO B;  1TCO A;  3IB8 A;  2NYL C;  4UWQ A;  3RL4 A;  3H62 B;  4H2F A;  3RL5 A;  4H1S A;  3H66 A;  4V0X A;  4ZX2 A;  3H63 A;  5GTU A;  5IOH A;  1HPU A;  4FCX A;  1IT6 A;  3QG5 C;  5B8I A;  4DSY A;  1FJM A;  4M0V A;  4ORC A;  2IE4 C;  5J28 A;  3CK2 A;  3QFM A;  5JPE A;  2KKN A;  2NYM C;  1WAR A;  4NZV A;  1XZW A;  5JPF A;  3H67 A;  3ICF A;  4O24 A;  4OR9 A;  5INB A;  2Z72 A;  3PSO A;  3THN A;  1T70 A;  2IE3 C;  1OID A;  1S3L A;  4JA9 A;  3AV0 A;  2HYO A;  4G9J A;  1UTE A;  4KKZ A;  4IL1 A;  3DW8 C;  3LL8 A;  3AUZ A;  1AUI A;  1USH A;  4H2G A;  3ZU0 A;  3GVE A;  2A22 A;  3EGH A;  2WDF A;  1W24 A;  3H69 A;  3RL3 A;  3H64 A;  2P6B A;  1V73 A; 
#chains in the Genus database with same CATH topology
 4DHL A;  3FGA C;  5F3W A;  3C5W C;  3C9F A;  1Z2X A;  2Z1A A;  1NNW A;  3PSN A;  5EQV A;  2ZBM A;  4ZVZ A;  4H2B A;  3P71 C;  2AHD A;  3QFK A;  1M63 A;  3E7A A;  4TUG A;  4ORB A;  2USH A;  2GJU A;  1KBP A;  4O43 A;  4V0W A;  3IB7 A;  1OIE A;  1S95 A;  3K7W C;  4DT2 A;  3N5U A;  3JYF A;  4FBW A;  3H68 A;  2ZO9 B;  3FLO A;  2O8G A;  4Q7F A;  5C1V A;  2WDC A;  2DFJ A;  4MP0 A;  3EGG A;  3KBP A;  2QFP A;  2R17 A;  2YEQ A;  1QHW A;  4HD0 A;  3ZTV A;  1Z2W A;  4KBP A;  1S70 A;  2WDE A;  3DSC A;  4FBK A;  2CV9 A;  1SU1 A;  4FBQ A;  4WWL A;  4XPN A;  4O5G A;  2ZOA A;  4I5N C;  4F0Z A;  2DXL A;  1OI8 A;  4LTY A;  1XM7 A;  2BCD A;  2HYP A;  2NPP C;  4YKE A;  1S3N A;  3IVE A;  4MOY A;  4UT3 A;  4B2O A;  2WDD A;  5JJT A;  2Z06 A;  2YVT A;  3QFO A;  3TGH A;  3H60 A;  5HPE A;  1G5B A;  5DNY A;  2IAE C;  3DSD A;  4LU9 A;  1S3M A;  2Q8U A;  4JA7 A;  3HVQ A;  1II7 A;  2QFR A;  4IYP C;  3D03 A;  4UT2 A;  2DXN A;  2BDX A;  3IVD A;  3RQZ A;  2QJC A;  3E0J A;  3T1I A;  2JOG A;  3QFN A;  3E7B A;  3V4Y A;  1HP1 A;  4O4K A;  3H61 A;  1QFC A;  2HY1 A;  4LAC C;  3K7V C;  4H1Y P;  1MF8 A;  1HO5 A;  4UT3 B;  1UF3 A;  4ORA A;  1JK7 A;  4TUI A;  2BQ8 X;  4H2I A;  4J6O A;  1WAO 1;  1T71 A;  2XMO A;  2O8A A;  4I5L C;  4MOV A;  1S8E A;  4V0V A;  1U32 A;  2NXF A;  3THO B;  1TCO A;  3IB8 A;  2NYL C;  4UWQ A;  3RL4 A;  3H62 B;  4H2F A;  3RL5 A;  4H1S A;  3H66 A;  4V0X A;  4ZX2 A;  3H63 A;  5GTU A;  5IOH A;  1HPU A;  4FCX A;  1IT6 A;  3QG5 C;  5B8I A;  4DSY A;  1FJM A;  4M0V A;  4ORC A;  2IE4 C;  5J28 A;  3CK2 A;  3QFM A;  5JPE A;  2KKN A;  2NYM C;  1WAR A;  4NZV A;  1XZW A;  5JPF A;  3H67 A;  3ICF A;  4O24 A;  4OR9 A;  5INB A;  2Z72 A;  3PSO A;  3THN A;  1T70 A;  2IE3 C;  1OID A;  1S3L A;  4JA9 A;  3AV0 A;  2HYO A;  4G9J A;  1UTE A;  4KKZ A;  4IL1 A;  3DW8 C;  3LL8 A;  3AUZ A;  1AUI A;  1USH A;  4H2G A;  3ZU0 A;  3GVE A;  2A22 A;  3EGH A;  2WDF A;  1W24 A;  3H69 A;  3RL3 A;  3H64 A;  2P6B A;  1V73 A; 
#chains in the Genus database with same CATH homology
 4DHL A;  3FGA C;  5F3W A;  3C5W C;  3C9F A;  1Z2X A;  2Z1A A;  1NNW A;  3PSN A;  5EQV A;  2ZBM A;  4ZVZ A;  4H2B A;  3P71 C;  2AHD A;  3QFK A;  1M63 A;  3E7A A;  4TUG A;  4ORB A;  2USH A;  2GJU A;  1KBP A;  4O43 A;  4V0W A;  3IB7 A;  1OIE A;  1S95 A;  3K7W C;  4DT2 A;  3N5U A;  3JYF A;  4FBW A;  3H68 A;  2ZO9 B;  3FLO A;  2O8G A;  4Q7F A;  5C1V A;  2WDC A;  2DFJ A;  4MP0 A;  3EGG A;  3KBP A;  2QFP A;  2R17 A;  2YEQ A;  1QHW A;  4HD0 A;  3ZTV A;  1Z2W A;  4KBP A;  1S70 A;  2WDE A;  3DSC A;  4FBK A;  2CV9 A;  1SU1 A;  4FBQ A;  4WWL A;  4XPN A;  4O5G A;  2ZOA A;  4I5N C;  4F0Z A;  2DXL A;  1OI8 A;  4LTY A;  1XM7 A;  2BCD A;  2HYP A;  2NPP C;  4YKE A;  1S3N A;  3IVE A;  4MOY A;  4UT3 A;  4B2O A;  2WDD A;  5JJT A;  2Z06 A;  2YVT A;  3QFO A;  3TGH A;  3H60 A;  5HPE A;  1G5B A;  5DNY A;  2IAE C;  3DSD A;  4LU9 A;  1S3M A;  2Q8U A;  4JA7 A;  3HVQ A;  1II7 A;  2QFR A;  4IYP C;  3D03 A;  4UT2 A;  2DXN A;  2BDX A;  3IVD A;  3RQZ A;  2QJC A;  3E0J A;  3T1I A;  2JOG A;  3QFN A;  3E7B A;  3V4Y A;  1HP1 A;  4O4K A;  3H61 A;  1QFC A;  2HY1 A;  4LAC C;  3K7V C;  4H1Y P;  1MF8 A;  1HO5 A;  4UT3 B;  1UF3 A;  4ORA A;  1JK7 A;  4TUI A;  2BQ8 X;  4H2I A;  4J6O A;  1WAO 1;  1T71 A;  2XMO A;  2O8A A;  4I5L C;  4MOV A;  1S8E A;  4V0V A;  1U32 A;  2NXF A;  3THO B;  1TCO A;  3IB8 A;  2NYL C;  4UWQ A;  3RL4 A;  3H62 B;  4H2F A;  3RL5 A;  4H1S A;  3H66 A;  4V0X A;  4ZX2 A;  3H63 A;  5GTU A;  5IOH A;  1HPU A;  4FCX A;  1IT6 A;  3QG5 C;  5B8I A;  4DSY A;  1FJM A;  4M0V A;  4ORC A;  2IE4 C;  5J28 A;  3CK2 A;  3QFM A;  5JPE A;  2KKN A;  2NYM C;  1WAR A;  4NZV A;  1XZW A;  5JPF A;  3H67 A;  3ICF A;  4O24 A;  4OR9 A;  5INB A;  2Z72 A;  3PSO A;  3THN A;  1T70 A;  2IE3 C;  1OID A;  1S3L A;  4JA9 A;  3AV0 A;  2HYO A;  4G9J A;  1UTE A;  4KKZ A;  4IL1 A;  3DW8 C;  3LL8 A;  3AUZ A;  1AUI A;  1USH A;  4H2G A;  3ZU0 A;  3GVE A;  2A22 A;  3EGH A;  2WDF A;  1W24 A;  3H69 A;  3RL3 A;  3H64 A;  2P6B A;  1V73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...