1U32A

Crystal structure of a protein phosphatase-1: calcineurin hybrid bound to okadaic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYLDVYNNAGAMMSVDETLMCSFQILKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Mutagenesis of a Protein Phosphatase-1:Calcineurin Hybrid Elucidate the Role of the {beta}12-{beta}13 Loop in Inhibitor Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine protein phosphatase PP1-gamma catalytic sub
total genus 106
structure length 293
sequence length 293
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1u32A00
2O8AA 2R17A 3LL8A 3KBPA 4H1SA 5GTUA 4IYPC 2HYPA 2NYLC 4MOYA 4H2BA 4O5GA 4V0XA 5J28A 3H69A 3DSDA 5C1VA 5JPFA 4O4KA 3IVEA 4LU9A 4MP0A 3RL4A 4UT3A 1T70A 3DW8C 1AUIA 3H68A 3E7AA 2QFRA 4B2OA 4V0WA 4H2IA 1XM7A 4FBQA 5EQVA 5IOHA 1UTEA 2IE4C 2QJCA 3N5UA 2P6BA 1XZWA 5INBA 1KBPA 2IAEC 2Z06A 2WDEA 4OR9A 1FJMA 4V0VA 4MOVA 4Q7FA 3T1IA 5HPEA 3H67A 1S70A 3QFNA 3AV0A 4H1YP 2O8GA 4TUGA 1V73A 1WARA 1OIEA 1HP1A 1TCOA 4O24A 4UWQA 3E7BA 3IB8A 4ZX2A 2QFPA 2CV9A 2A22A 3AUZA 3CK2A 1S95A 1S3LA 1W24A 3TGHA 2ZBMA 4JA9A 2Z1AA 3H63A 1MF8A 3THNA 2NYMC 4TUIA 1U32A 4IL1A 4LACC 4G9JA 4I5LC 3FGAC 4FCXA 4XPNA 3P71C 1QHWA 3GVEA 2IE3C 3THOB 4H2FA 2NPPC 1M63A 3QFOA 4KBPA 4NZVA 2Q8UA 3RL3A 3H66A 4UT3B 3H61A 3HVQA 3RQZA 1QFCA 3RL5A 2DFJA 3DSCA 4O43A 4DT2A 3C9FA 1HO5A 3JYFA 4I5NC 2JOGA 4DHLA 4KKZA 5B8IA 4ORAA 3V4YA 4UT2A 1II7A 2WDFA 3H62B 3ICFA 1OIDA 5JJTA 3IB7A 2BQ8X 1G5BA 2HYOA 1Z2XA 1OI8A 1USHA 2KKNA 2Z72A 1T71A 3K7VC 3PSNA 3PSOA 4DSYA 4F0ZA 4JA7A 4ORBA 4ORCA 4LTYA 4YKEA 3ZTVA 4J6OA 1HPUA 2BCDA 2USHA 1SU1A 4H2GA 5JPEA 1UF3A 3EGGA 2BDXA 3K7WC 1S8EA 1S3MA 1WAO1 2YVTA 4M0VA 3QG5C 2XMOA 3C5WC 4FBKA 3H64A 3QFMA 4HD0A 4ZVZA 5F3WA 2GJUA 2WDDA 3H60A 3QFKA 4WWLA 5DNYA 2WDCA 3IVDA 1NNWA 3ZU0A 1Z2WA 2NXFA 2HY1A 4FBWA 1IT6A 3EGHA 1JK7A 1S3NA 2AHDA
chains in the Genus database with same CATH superfamily
2O8AA 2R17A 3LL8A 3KBPA 4H1SA 5GTUA 4IYPC 2HYPA 2NYLC 4MOYA 4H2BA 4O5GA 4V0XA 5J28A 3D03A 3H69A 3FLOA 3DSDA 5C1VA 5JPFA 4O4KA 3IVEA 4LU9A 4MP0A 3RL4A 4UT3A 1T70A 3DW8C 1AUIA 3H68A 3E7AA 2QFRA 4B2OA 4V0WA 4H2IA 1XM7A 4FBQA 5EQVA 2DXLA 5IOHA 1UTEA 2IE4C 2QJCA 3N5UA 2P6BA 1XZWA 5INBA 1KBPA 2IAEC 2Z06A 2WDEA 4OR9A 1FJMA 4V0VA 4MOVA 4Q7FA 3T1IA 5HPEA 3H67A 1S70A 3QFNA 3AV0A 4H1YP 2O8GA 4TUGA 1V73A 1WARA 1OIEA 1HP1A 1TCOA 4O24A 4UWQA 3E7BA 3IB8A 4ZX2A 2QFPA 2CV9A 2A22A 3AUZA 2ZO9B 3CK2A 1S95A 1S3LA 1W24A 3TGHA 2ZBMA 4JA9A 2Z1AA 3H63A 1MF8A 3THNA 2NYMC 4TUIA 1U32A 4IL1A 4LACC 4G9JA 4I5LC 3FGAC 4FCXA 4XPNA 3P71C 1QHWA 3GVEA 2IE3C 3THOB 4H2FA 2NPPC 1M63A 3QFOA 4KBPA 4NZVA 2Q8UA 3RL3A 3H66A 4UT3B 3H61A 3HVQA 3RQZA 1QFCA 3RL5A 3E0JA 2DFJA 3DSCA 4O43A 4DT2A 3C9FA 1HO5A 3JYFA 4I5NC 2JOGA 4DHLA 4KKZA 5B8IA 4ORAA 3V4YA 4UT2A 1II7A 2WDFA 2YEQA 3H62B 2DXNA 3ICFA 1OIDA 5JJTA 3IB7A 2BQ8X 1G5BA 2HYOA 1Z2XA 1OI8A 1USHA 2KKNA 2Z72A 1T71A 3K7VC 3PSNA 3PSOA 4DSYA 4F0ZA 4JA7A 4ORBA 4ORCA 4LTYA 4YKEA 3ZTVA 2ZOAA 1HPUA 4J6OA 2BCDA 2USHA 1SU1A 4H2GA 5JPEA 1UF3A 3EGGA 2BDXA 3K7WC 1S8EA 1S3MA 1WAO1 2YVTA 4M0VA 3QG5C 2XMOA 3C5WC 4FBKA 3H64A 3QFMA 4HD0A 4ZVZA 5F3WA 2GJUA 2WDDA 3H60A 3QFKA 4WWLA 5DNYA 2WDCA 3IVDA 1NNWA 3ZU0A 1Z2WA 2NXFA 2HY1A 4FBWA 1IT6A 3EGHA 1JK7A 1S3NA 2AHDA
chains in the Genus database with same CATH topology
2O8AA 2R17A 3LL8A 3KBPA 4H1SA 5GTUA 4IYPC 2HYPA 2NYLC 4MOYA 4H2BA 4O5GA 4V0XA 5J28A 3D03A 3H69A 3FLOA 3DSDA 5C1VA 5JPFA 4O4KA 3IVEA 4LU9A 4MP0A 3RL4A 4UT3A 1T70A 3DW8C 1AUIA 3H68A 3E7AA 2QFRA 4B2OA 4V0WA 4H2IA 1XM7A 4FBQA 5EQVA 2DXLA 5IOHA 1UTEA 2IE4C 2QJCA 3N5UA 2P6BA 1XZWA 5INBA 1KBPA 2IAEC 2Z06A 2WDEA 4OR9A 1FJMA 4V0VA 4MOVA 4Q7FA 3T1IA 5HPEA 3H67A 1S70A 3QFNA 3AV0A 4H1YP 2O8GA 4TUGA 1V73A 1WARA 1OIEA 1HP1A 1TCOA 4O24A 4UWQA 3E7BA 3IB8A 4ZX2A 2QFPA 2CV9A 2A22A 3AUZA 2ZO9B 3CK2A 1S95A 1S3LA 1W24A 3TGHA 2ZBMA 4JA9A 2Z1AA 3H63A 1MF8A 3THNA 2NYMC 4TUIA 1U32A 4IL1A 4LACC 4G9JA 4I5LC 3FGAC 4FCXA 4XPNA 3P71C 1QHWA 3GVEA 2IE3C 3THOB 4H2FA 2NPPC 1M63A 3QFOA 4KBPA 4NZVA 2Q8UA 3RL3A 3H66A 4UT3B 3H61A 3HVQA 3RQZA 1QFCA 3RL5A 3E0JA 2DFJA 3DSCA 4O43A 4DT2A 3C9FA 1HO5A 3JYFA 4I5NC 2JOGA 4DHLA 4KKZA 5B8IA 4ORAA 3V4YA 4UT2A 1II7A 2WDFA 2YEQA 3H62B 2DXNA 3ICFA 1OIDA 5JJTA 3IB7A 2BQ8X 1G5BA 2HYOA 1Z2XA 1OI8A 1USHA 2KKNA 2Z72A 1T71A 3K7VC 3PSNA 3PSOA 4DSYA 4F0ZA 4JA7A 4ORBA 4ORCA 4LTYA 4YKEA 3ZTVA 2ZOAA 1HPUA 4J6OA 2BCDA 2USHA 1SU1A 4H2GA 5JPEA 1UF3A 3EGGA 2BDXA 3K7WC 1S8EA 1S3MA 1WAO1 2YVTA 4M0VA 3QG5C 2XMOA 3C5WC 4FBKA 3H64A 3QFMA 4HD0A 4ZVZA 5F3WA 2GJUA 2WDDA 3H60A 3QFKA 4WWLA 5DNYA 2WDCA 3IVDA 1NNWA 3ZU0A 1Z2WA 2NXFA 2HY1A 4FBWA 1IT6A 3EGHA 1JK7A 1S3NA 2AHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8A A;  2R17 A;  3LL8 A;  3KBP A;  4H1S A;  5GTU A;  4IYP C;  2HYP A;  2NYL C;  4MOY A;  4H2B A;  4O5G A;  4V0X A;  5J28 A;  3H69 A;  3DSD A;  5C1V A;  5JPF A;  4O4K A;  3IVE A;  4LU9 A;  4MP0 A;  3RL4 A;  4UT3 A;  1T70 A;  3DW8 C;  1AUI A;  3H68 A;  3E7A A;  2QFR A;  4B2O A;  4V0W A;  4H2I A;  1XM7 A;  4FBQ A;  5EQV A;  5IOH A;  1UTE A;  2IE4 C;  2QJC A;  3N5U A;  2P6B A;  1XZW A;  5INB A;  1KBP A;  2IAE C;  2Z06 A;  2WDE A;  4OR9 A;  1FJM A;  4V0V A;  4MOV A;  4Q7F A;  3T1I A;  5HPE A;  3H67 A;  1S70 A;  3QFN A;  3AV0 A;  4H1Y P;  2O8G A;  4TUG A;  1V73 A;  1WAR A;  1OIE A;  1HP1 A;  1TCO A;  4O24 A;  4UWQ A;  3E7B A;  3IB8 A;  4ZX2 A;  2QFP A;  2CV9 A;  2A22 A;  3AUZ A;  3CK2 A;  1S95 A;  1S3L A;  1W24 A;  3TGH A;  2ZBM A;  4JA9 A;  2Z1A A;  3H63 A;  1MF8 A;  3THN A;  2NYM C;  4TUI A;  1U32 A;  4IL1 A;  4LAC C;  4G9J A;  4I5L C;  3FGA C;  4FCX A;  4XPN A;  3P71 C;  1QHW A;  3GVE A;  2IE3 C;  3THO B;  4H2F A;  2NPP C;  1M63 A;  3QFO A;  4KBP A;  4NZV A;  2Q8U A;  3RL3 A;  3H66 A;  4UT3 B;  3H61 A;  3HVQ A;  3RQZ A;  1QFC A;  3RL5 A;  2DFJ A;  3DSC A;  4O43 A;  4DT2 A;  3C9F A;  1HO5 A;  3JYF A;  4I5N C;  2JOG A;  4DHL A;  4KKZ A;  5B8I A;  4ORA A;  3V4Y A;  4UT2 A;  1II7 A;  2WDF A;  3H62 B;  3ICF A;  1OID A;  5JJT A;  3IB7 A;  2BQ8 X;  1G5B A;  2HYO A;  1Z2X A;  1OI8 A;  1USH A;  2KKN A;  2Z72 A;  1T71 A;  3K7V C;  3PSN A;  3PSO A;  4DSY A;  4F0Z A;  4JA7 A;  4ORB A;  4ORC A;  4LTY A;  4YKE A;  3ZTV A;  4J6O A;  1HPU A;  2BCD A;  2USH A;  1SU1 A;  4H2G A;  5JPE A;  1UF3 A;  3EGG A;  2BDX A;  3K7W C;  1S8E A;  1S3M A;  1WAO 1;  2YVT A;  4M0V A;  3QG5 C;  2XMO A;  3C5W C;  4FBK A;  3H64 A;  3QFM A;  4HD0 A;  4ZVZ A;  5F3W A;  2GJU A;  2WDD A;  3H60 A;  3QFK A;  4WWL A;  5DNY A;  2WDC A;  3IVD A;  1NNW A;  3ZU0 A;  1Z2W A;  2NXF A;  2HY1 A;  4FBW A;  1IT6 A;  3EGH A;  1JK7 A;  1S3N A;  2AHD A; 
#chains in the Genus database with same CATH topology
 2O8A A;  2R17 A;  3LL8 A;  3KBP A;  4H1S A;  5GTU A;  4IYP C;  2HYP A;  2NYL C;  4MOY A;  4H2B A;  4O5G A;  4V0X A;  5J28 A;  3D03 A;  3H69 A;  3FLO A;  3DSD A;  5C1V A;  5JPF A;  4O4K A;  3IVE A;  4LU9 A;  4MP0 A;  3RL4 A;  4UT3 A;  1T70 A;  3DW8 C;  1AUI A;  3H68 A;  3E7A A;  2QFR A;  4B2O A;  4V0W A;  4H2I A;  1XM7 A;  4FBQ A;  5EQV A;  2DXL A;  5IOH A;  1UTE A;  2IE4 C;  2QJC A;  3N5U A;  2P6B A;  1XZW A;  5INB A;  1KBP A;  2IAE C;  2Z06 A;  2WDE A;  4OR9 A;  1FJM A;  4V0V A;  4MOV A;  4Q7F A;  3T1I A;  5HPE A;  3H67 A;  1S70 A;  3QFN A;  3AV0 A;  4H1Y P;  2O8G A;  4TUG A;  1V73 A;  1WAR A;  1OIE A;  1HP1 A;  1TCO A;  4O24 A;  4UWQ A;  3E7B A;  3IB8 A;  4ZX2 A;  2QFP A;  2CV9 A;  2A22 A;  3AUZ A;  2ZO9 B;  3CK2 A;  1S95 A;  1S3L A;  1W24 A;  3TGH A;  2ZBM A;  4JA9 A;  2Z1A A;  3H63 A;  1MF8 A;  3THN A;  2NYM C;  4TUI A;  1U32 A;  4IL1 A;  4LAC C;  4G9J A;  4I5L C;  3FGA C;  4FCX A;  4XPN A;  3P71 C;  1QHW A;  3GVE A;  2IE3 C;  3THO B;  4H2F A;  2NPP C;  1M63 A;  3QFO A;  4KBP A;  4NZV A;  2Q8U A;  3RL3 A;  3H66 A;  4UT3 B;  3H61 A;  3HVQ A;  3RQZ A;  1QFC A;  3RL5 A;  3E0J A;  2DFJ A;  3DSC A;  4O43 A;  4DT2 A;  3C9F A;  1HO5 A;  3JYF A;  4I5N C;  2JOG A;  4DHL A;  4KKZ A;  5B8I A;  4ORA A;  3V4Y A;  4UT2 A;  1II7 A;  2WDF A;  2YEQ A;  3H62 B;  2DXN A;  3ICF A;  1OID A;  5JJT A;  3IB7 A;  2BQ8 X;  1G5B A;  2HYO A;  1Z2X A;  1OI8 A;  1USH A;  2KKN A;  2Z72 A;  1T71 A;  3K7V C;  3PSN A;  3PSO A;  4DSY A;  4F0Z A;  4JA7 A;  4ORB A;  4ORC A;  4LTY A;  4YKE A;  3ZTV A;  2ZOA A;  1HPU A;  4J6O A;  2BCD A;  2USH A;  1SU1 A;  4H2G A;  5JPE A;  1UF3 A;  3EGG A;  2BDX A;  3K7W C;  1S8E A;  1S3M A;  1WAO 1;  2YVT A;  4M0V A;  3QG5 C;  2XMO A;  3C5W C;  4FBK A;  3H64 A;  3QFM A;  4HD0 A;  4ZVZ A;  5F3W A;  2GJU A;  2WDD A;  3H60 A;  3QFK A;  4WWL A;  5DNY A;  2WDC A;  3IVD A;  1NNW A;  3ZU0 A;  1Z2W A;  2NXF A;  2HY1 A;  4FBW A;  1IT6 A;  3EGH A;  1JK7 A;  1S3N A;  2AHD A; 
#chains in the Genus database with same CATH homology
 2O8A A;  2R17 A;  3LL8 A;  3KBP A;  4H1S A;  5GTU A;  4IYP C;  2HYP A;  2NYL C;  4MOY A;  4H2B A;  4O5G A;  4V0X A;  5J28 A;  3D03 A;  3H69 A;  3FLO A;  3DSD A;  5C1V A;  5JPF A;  4O4K A;  3IVE A;  4LU9 A;  4MP0 A;  3RL4 A;  4UT3 A;  1T70 A;  3DW8 C;  1AUI A;  3H68 A;  3E7A A;  2QFR A;  4B2O A;  4V0W A;  4H2I A;  1XM7 A;  4FBQ A;  5EQV A;  2DXL A;  5IOH A;  1UTE A;  2IE4 C;  2QJC A;  3N5U A;  2P6B A;  1XZW A;  5INB A;  1KBP A;  2IAE C;  2Z06 A;  2WDE A;  4OR9 A;  1FJM A;  4V0V A;  4MOV A;  4Q7F A;  3T1I A;  5HPE A;  3H67 A;  1S70 A;  3QFN A;  3AV0 A;  4H1Y P;  2O8G A;  4TUG A;  1V73 A;  1WAR A;  1OIE A;  1HP1 A;  1TCO A;  4O24 A;  4UWQ A;  3E7B A;  3IB8 A;  4ZX2 A;  2QFP A;  2CV9 A;  2A22 A;  3AUZ A;  2ZO9 B;  3CK2 A;  1S95 A;  1S3L A;  1W24 A;  3TGH A;  2ZBM A;  4JA9 A;  2Z1A A;  3H63 A;  1MF8 A;  3THN A;  2NYM C;  4TUI A;  1U32 A;  4IL1 A;  4LAC C;  4G9J A;  4I5L C;  3FGA C;  4FCX A;  4XPN A;  3P71 C;  1QHW A;  3GVE A;  2IE3 C;  3THO B;  4H2F A;  2NPP C;  1M63 A;  3QFO A;  4KBP A;  4NZV A;  2Q8U A;  3RL3 A;  3H66 A;  4UT3 B;  3H61 A;  3HVQ A;  3RQZ A;  1QFC A;  3RL5 A;  3E0J A;  2DFJ A;  3DSC A;  4O43 A;  4DT2 A;  3C9F A;  1HO5 A;  3JYF A;  4I5N C;  2JOG A;  4DHL A;  4KKZ A;  5B8I A;  4ORA A;  3V4Y A;  4UT2 A;  1II7 A;  2WDF A;  2YEQ A;  3H62 B;  2DXN A;  3ICF A;  1OID A;  5JJT A;  3IB7 A;  2BQ8 X;  1G5B A;  2HYO A;  1Z2X A;  1OI8 A;  1USH A;  2KKN A;  2Z72 A;  1T71 A;  3K7V C;  3PSN A;  3PSO A;  4DSY A;  4F0Z A;  4JA7 A;  4ORB A;  4ORC A;  4LTY A;  4YKE A;  3ZTV A;  2ZOA A;  1HPU A;  4J6O A;  2BCD A;  2USH A;  1SU1 A;  4H2G A;  5JPE A;  1UF3 A;  3EGG A;  2BDX A;  3K7W C;  1S8E A;  1S3M A;  1WAO 1;  2YVT A;  4M0V A;  3QG5 C;  2XMO A;  3C5W C;  4FBK A;  3H64 A;  3QFM A;  4HD0 A;  4ZVZ A;  5F3W A;  2GJU A;  2WDD A;  3H60 A;  3QFK A;  4WWL A;  5DNY A;  2WDC A;  3IVD A;  1NNW A;  3ZU0 A;  1Z2W A;  2NXF A;  2HY1 A;  4FBW A;  1IT6 A;  3EGH A;  1JK7 A;  1S3N A;  2AHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...