1HO5A

5'-nucleotidase (e. coli) in complex with adenosine and phosphate
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
525
structure length
525
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 5'-NUCLEOTIDASE
publication title Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
pubmed doi rcsb
source organism Escherichia coli
total genus 168
structure length 525
sequence length 525
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1ho5A01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1ho5A02
3H61A 3QFMA 1FJMA 3K7WC 3IB7A 4TUGA 1U32A 4ORCA 1II7A 3RQZA 1T71A 3H69A 4IYPC 1S8EA 4JA9A 3ZU0A 5INBA 1KBPA 1S3NA 1XZWA 2NYMC 4LACC 1SU1A 1UTEA 4DHLA 3TGHA 1S95A 1Z2WA 2BCDA 3AV0A 4H2BA 4LU9A 3THOB 2HYPA 1UF3A 3LL8A 3DSCA 2NYLC 4O4KA 4UWQA 2JOGA 3H62B 4H2FA 3H66A 2IE3C 2BDXA 1WAO1 2Z06A 3IVEA 5GTUA 1W24A 4YKEA 4TUIA 2P6BA 2AHDA 2USHA 3E7AA 3GVEA 2NXFA 2O8GA 3EGGA 2Z1AA 5DNYA 3E7BA 2YVTA 4ORAA 3H68A 5J28A 2XMOA 3PSNA 3C9FA 3H64A 3RL5A 2BQ8X 4M0VA 4FBWA 4O43A 3RL4A 4B2OA 3JYFA 4ZX2A 2KKNA 3FGAC 5HPEA 2WDFA 1HPUA 1T70A 4JA7A 4MP0A 1V73A 3QFOA 1QHWA 1JK7A 4OR9A 4KBPA 3DW8C 3THNA 4F0ZA 3AUZA 4DSYA 4V0XA 4V0WA 2GJUA 2QFRA 4I5LC 1QFCA 2QFPA 5B8IA 3HVQA 3EGHA 5JPFA 3K7VC 3ZTVA 1NNWA 2CV9A 3H67A 4NZVA 4UT2A 4V0VA 5JJTA 1WARA 2IAEC 4LTYA 4ORBA 5F3WA 1S70A 3IB8A 4MOVA 1HP1A 4MOYA 3RL3A 4UT3B 3N5UA 4H2IA 4UT3A 4Q7FA 2WDCA 2WDDA 2HYOA 2NPPC 4O24A 1OIDA 4O5GA 3KBPA 4H1YP 4H2GA 2R17A 3QFKA 2Q8UA 4KKZA 2DFJA 4HD0A 3IVDA 4FCXA 1AUIA 1XM7A 2Z72A 3DSDA 5C1VA 1IT6A 4IL1A 1Z2XA 2HY1A 2WDEA 2A22A 1OIEA 1OI8A 2ZBMA 4FBKA 1S3MA 1G5BA 3H63A 1TCOA 1USHA 4FBQA 4G9JA 5JPEA 3C5WC 3P71C 3QG5C 3ICFA 2IE4C 4J6OA 2O8AA 2QJCA 1HO5A 3H60A 5EQVA 4ZVZA 4DT2A 4WWLA 1MF8A 3CK2A 1S3LA 4H1SA 4I5NC 3PSOA 4XPNA 3T1IA 5IOHA 3QFNA 3V4YA 1M63A
chains in the Genus database with same CATH superfamily
3H61A 3QFMA 1FJMA 3K7WC 3IB7A 4TUGA 3FLOA 2YEQA 1U32A 4ORCA 1II7A 3RQZA 1T71A 3H69A 4IYPC 1S8EA 4JA9A 3ZU0A 5INBA 1KBPA 1S3NA 1XZWA 2NYMC 3D03A 4LACC 1SU1A 1UTEA 4DHLA 3TGHA 1S95A 1Z2WA 2BCDA 3AV0A 4H2BA 4LU9A 3THOB 2HYPA 1UF3A 3LL8A 3DSCA 2NYLC 2ZOAA 4O4KA 4UWQA 2JOGA 3H62B 4H2FA 3H66A 2IE3C 2BDXA 1WAO1 2Z06A 3IVEA 5GTUA 1W24A 4YKEA 4TUIA 2P6BA 2AHDA 2USHA 3E7AA 2DXNA 3GVEA 2NXFA 2O8GA 3EGGA 2Z1AA 5DNYA 3E7BA 2YVTA 4ORAA 3H68A 5J28A 2XMOA 3PSNA 3C9FA 3H64A 2DXLA 3RL5A 2BQ8X 4M0VA 4FBWA 4O43A 3RL4A 4B2OA 3JYFA 4ZX2A 2KKNA 3FGAC 5HPEA 2WDFA 1HPUA 1T70A 4JA7A 4MP0A 1V73A 3QFOA 1QHWA 1JK7A 4OR9A 4KBPA 3DW8C 3THNA 4F0ZA 3AUZA 4DSYA 4V0XA 4V0WA 2GJUA 2QFRA 4I5LC 1QFCA 2QFPA 5B8IA 3HVQA 3EGHA 5JPFA 3K7VC 3ZTVA 1NNWA 2CV9A 3H67A 4NZVA 4UT2A 4V0VA 5JJTA 1WARA 2IAEC 4LTYA 2ZO9B 4ORBA 5F3WA 1S70A 3IB8A 4MOVA 1HP1A 4MOYA 3RL3A 4UT3B 3N5UA 4H2IA 4UT3A 4Q7FA 2WDCA 2WDDA 2HYOA 2NPPC 4O24A 1OIDA 4O5GA 3KBPA 4H1YP 4H2GA 2R17A 3QFKA 2Q8UA 4KKZA 2DFJA 4HD0A 3IVDA 4FCXA 1AUIA 1XM7A 2Z72A 3DSDA 5C1VA 1IT6A 4IL1A 1Z2XA 2HY1A 2WDEA 2A22A 1OIEA 1OI8A 2ZBMA 4FBKA 1S3MA 1G5BA 3H63A 1TCOA 1USHA 4FBQA 4G9JA 5JPEA 3C5WC 3P71C 3QG5C 3ICFA 2IE4C 4J6OA 2O8AA 2QJCA 1HO5A 3H60A 5EQVA 4ZVZA 4DT2A 4WWLA 1MF8A 3CK2A 1S3LA 3E0JA 4H1SA 4I5NC 3PSOA 4XPNA 3T1IA 5IOHA 3QFNA 3V4YA 1M63A
chains in the Genus database with same CATH topology
3H61A 3QFMA 1FJMA 3K7WC 3IB7A 4TUGA 3FLOA 2YEQA 1U32A 4ORCA 1II7A 3RQZA 1T71A 3H69A 4IYPC 1S8EA 4JA9A 3ZU0A 5INBA 1KBPA 1S3NA 1XZWA 2NYMC 3D03A 4LACC 1SU1A 1UTEA 4DHLA 3TGHA 1S95A 1Z2WA 2BCDA 3AV0A 4H2BA 4LU9A 3THOB 2HYPA 1UF3A 3LL8A 3DSCA 2NYLC 2ZOAA 4O4KA 4UWQA 2JOGA 3H62B 4H2FA 3H66A 2IE3C 2BDXA 1WAO1 2Z06A 3IVEA 5GTUA 1W24A 4YKEA 4TUIA 2P6BA 2AHDA 2USHA 3E7AA 2DXNA 3GVEA 2NXFA 2O8GA 3EGGA 2Z1AA 5DNYA 3E7BA 2YVTA 4ORAA 3H68A 5J28A 2XMOA 3PSNA 3C9FA 3H64A 2DXLA 3RL5A 2BQ8X 4M0VA 4FBWA 4O43A 3RL4A 4B2OA 3JYFA 4ZX2A 2KKNA 3FGAC 5HPEA 2WDFA 1HPUA 1T70A 4JA7A 4MP0A 1V73A 3QFOA 1QHWA 1JK7A 4OR9A 4KBPA 3DW8C 3THNA 4F0ZA 3AUZA 4DSYA 4V0XA 4V0WA 2GJUA 2QFRA 4I5LC 1QFCA 2QFPA 5B8IA 3HVQA 3EGHA 5JPFA 3K7VC 3ZTVA 1NNWA 2CV9A 3H67A 4NZVA 4UT2A 4V0VA 5JJTA 1WARA 2IAEC 4LTYA 2ZO9B 4ORBA 5F3WA 1S70A 3IB8A 4MOVA 1HP1A 4MOYA 3RL3A 4UT3B 3N5UA 4H2IA 4UT3A 4Q7FA 2WDCA 2WDDA 2HYOA 2NPPC 4O24A 1OIDA 4O5GA 3KBPA 4H1YP 4H2GA 2R17A 3QFKA 2Q8UA 4KKZA 2DFJA 4HD0A 3IVDA 4FCXA 1AUIA 1XM7A 2Z72A 3DSDA 5C1VA 1IT6A 4IL1A 1Z2XA 2HY1A 2WDEA 2A22A 1OIEA 1OI8A 2ZBMA 4FBKA 1S3MA 1G5BA 3H63A 1TCOA 1USHA 4FBQA 4G9JA 5JPEA 3C5WC 3P71C 3QG5C 3ICFA 2IE4C 4J6OA 2O8AA 2QJCA 1HO5A 3H60A 5EQVA 4ZVZA 4DT2A 4WWLA 1MF8A 3CK2A 1S3LA 3E0JA 4H1SA 4I5NC 3PSOA 4XPNA 3T1IA 5IOHA 3QFNA 3V4YA 1M63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H61 A;  3QFM A;  1FJM A;  3K7W C;  3IB7 A;  4TUG A;  1U32 A;  4ORC A;  1II7 A;  3RQZ A;  1T71 A;  3H69 A;  4IYP C;  1S8E A;  4JA9 A;  3ZU0 A;  5INB A;  1KBP A;  1S3N A;  1XZW A;  2NYM C;  4LAC C;  1SU1 A;  1UTE A;  4DHL A;  3TGH A;  1S95 A;  1Z2W A;  2BCD A;  3AV0 A;  4H2B A;  4LU9 A;  3THO B;  2HYP A;  1UF3 A;  3LL8 A;  3DSC A;  2NYL C;  4O4K A;  4UWQ A;  2JOG A;  3H62 B;  4H2F A;  3H66 A;  2IE3 C;  2BDX A;  1WAO 1;  2Z06 A;  3IVE A;  5GTU A;  1W24 A;  4YKE A;  4TUI A;  2P6B A;  2AHD A;  2USH A;  3E7A A;  3GVE A;  2NXF A;  2O8G A;  3EGG A;  2Z1A A;  5DNY A;  3E7B A;  2YVT A;  4ORA A;  3H68 A;  5J28 A;  2XMO A;  3PSN A;  3C9F A;  3H64 A;  3RL5 A;  2BQ8 X;  4M0V A;  4FBW A;  4O43 A;  3RL4 A;  4B2O A;  3JYF A;  4ZX2 A;  2KKN A;  3FGA C;  5HPE A;  2WDF A;  1HPU A;  1T70 A;  4JA7 A;  4MP0 A;  1V73 A;  3QFO A;  1QHW A;  1JK7 A;  4OR9 A;  4KBP A;  3DW8 C;  3THN A;  4F0Z A;  3AUZ A;  4DSY A;  4V0X A;  4V0W A;  2GJU A;  2QFR A;  4I5L C;  1QFC A;  2QFP A;  5B8I A;  3HVQ A;  3EGH A;  5JPF A;  3K7V C;  3ZTV A;  1NNW A;  2CV9 A;  3H67 A;  4NZV A;  4UT2 A;  4V0V A;  5JJT A;  1WAR A;  2IAE C;  4LTY A;  4ORB A;  5F3W A;  1S70 A;  3IB8 A;  4MOV A;  1HP1 A;  4MOY A;  3RL3 A;  4UT3 B;  3N5U A;  4H2I A;  4UT3 A;  4Q7F A;  2WDC A;  2WDD A;  2HYO A;  2NPP C;  4O24 A;  1OID A;  4O5G A;  3KBP A;  4H1Y P;  4H2G A;  2R17 A;  3QFK A;  2Q8U A;  4KKZ A;  2DFJ A;  4HD0 A;  3IVD A;  4FCX A;  1AUI A;  1XM7 A;  2Z72 A;  3DSD A;  5C1V A;  1IT6 A;  4IL1 A;  1Z2X A;  2HY1 A;  2WDE A;  2A22 A;  1OIE A;  1OI8 A;  2ZBM A;  4FBK A;  1S3M A;  1G5B A;  3H63 A;  1TCO A;  1USH A;  4FBQ A;  4G9J A;  5JPE A;  3C5W C;  3P71 C;  3QG5 C;  3ICF A;  2IE4 C;  4J6O A;  2O8A A;  2QJC A;  1HO5 A;  3H60 A;  5EQV A;  4ZVZ A;  4DT2 A;  4WWL A;  1MF8 A;  3CK2 A;  1S3L A;  4H1S A;  4I5N C;  3PSO A;  4XPN A;  3T1I A;  5IOH A;  3QFN A;  3V4Y A;  1M63 A; 
#chains in the Genus database with same CATH topology
 3H61 A;  3QFM A;  1FJM A;  3K7W C;  3IB7 A;  4TUG A;  3FLO A;  2YEQ A;  1U32 A;  4ORC A;  1II7 A;  3RQZ A;  1T71 A;  3H69 A;  4IYP C;  1S8E A;  4JA9 A;  3ZU0 A;  5INB A;  1KBP A;  1S3N A;  1XZW A;  2NYM C;  3D03 A;  4LAC C;  1SU1 A;  1UTE A;  4DHL A;  3TGH A;  1S95 A;  1Z2W A;  2BCD A;  3AV0 A;  4H2B A;  4LU9 A;  3THO B;  2HYP A;  1UF3 A;  3LL8 A;  3DSC A;  2NYL C;  2ZOA A;  4O4K A;  4UWQ A;  2JOG A;  3H62 B;  4H2F A;  3H66 A;  2IE3 C;  2BDX A;  1WAO 1;  2Z06 A;  3IVE A;  5GTU A;  1W24 A;  4YKE A;  4TUI A;  2P6B A;  2AHD A;  2USH A;  3E7A A;  2DXN A;  3GVE A;  2NXF A;  2O8G A;  3EGG A;  2Z1A A;  5DNY A;  3E7B A;  2YVT A;  4ORA A;  3H68 A;  5J28 A;  2XMO A;  3PSN A;  3C9F A;  3H64 A;  2DXL A;  3RL5 A;  2BQ8 X;  4M0V A;  4FBW A;  4O43 A;  3RL4 A;  4B2O A;  3JYF A;  4ZX2 A;  2KKN A;  3FGA C;  5HPE A;  2WDF A;  1HPU A;  1T70 A;  4JA7 A;  4MP0 A;  1V73 A;  3QFO A;  1QHW A;  1JK7 A;  4OR9 A;  4KBP A;  3DW8 C;  3THN A;  4F0Z A;  3AUZ A;  4DSY A;  4V0X A;  4V0W A;  2GJU A;  2QFR A;  4I5L C;  1QFC A;  2QFP A;  5B8I A;  3HVQ A;  3EGH A;  5JPF A;  3K7V C;  3ZTV A;  1NNW A;  2CV9 A;  3H67 A;  4NZV A;  4UT2 A;  4V0V A;  5JJT A;  1WAR A;  2IAE C;  4LTY A;  2ZO9 B;  4ORB A;  5F3W A;  1S70 A;  3IB8 A;  4MOV A;  1HP1 A;  4MOY A;  3RL3 A;  4UT3 B;  3N5U A;  4H2I A;  4UT3 A;  4Q7F A;  2WDC A;  2WDD A;  2HYO A;  2NPP C;  4O24 A;  1OID A;  4O5G A;  3KBP A;  4H1Y P;  4H2G A;  2R17 A;  3QFK A;  2Q8U A;  4KKZ A;  2DFJ A;  4HD0 A;  3IVD A;  4FCX A;  1AUI A;  1XM7 A;  2Z72 A;  3DSD A;  5C1V A;  1IT6 A;  4IL1 A;  1Z2X A;  2HY1 A;  2WDE A;  2A22 A;  1OIE A;  1OI8 A;  2ZBM A;  4FBK A;  1S3M A;  1G5B A;  3H63 A;  1TCO A;  1USH A;  4FBQ A;  4G9J A;  5JPE A;  3C5W C;  3P71 C;  3QG5 C;  3ICF A;  2IE4 C;  4J6O A;  2O8A A;  2QJC A;  1HO5 A;  3H60 A;  5EQV A;  4ZVZ A;  4DT2 A;  4WWL A;  1MF8 A;  3CK2 A;  1S3L A;  3E0J A;  4H1S A;  4I5N C;  3PSO A;  4XPN A;  3T1I A;  5IOH A;  3QFN A;  3V4Y A;  1M63 A; 
#chains in the Genus database with same CATH homology
 3H61 A;  3QFM A;  1FJM A;  3K7W C;  3IB7 A;  4TUG A;  3FLO A;  2YEQ A;  1U32 A;  4ORC A;  1II7 A;  3RQZ A;  1T71 A;  3H69 A;  4IYP C;  1S8E A;  4JA9 A;  3ZU0 A;  5INB A;  1KBP A;  1S3N A;  1XZW A;  2NYM C;  3D03 A;  4LAC C;  1SU1 A;  1UTE A;  4DHL A;  3TGH A;  1S95 A;  1Z2W A;  2BCD A;  3AV0 A;  4H2B A;  4LU9 A;  3THO B;  2HYP A;  1UF3 A;  3LL8 A;  3DSC A;  2NYL C;  2ZOA A;  4O4K A;  4UWQ A;  2JOG A;  3H62 B;  4H2F A;  3H66 A;  2IE3 C;  2BDX A;  1WAO 1;  2Z06 A;  3IVE A;  5GTU A;  1W24 A;  4YKE A;  4TUI A;  2P6B A;  2AHD A;  2USH A;  3E7A A;  2DXN A;  3GVE A;  2NXF A;  2O8G A;  3EGG A;  2Z1A A;  5DNY A;  3E7B A;  2YVT A;  4ORA A;  3H68 A;  5J28 A;  2XMO A;  3PSN A;  3C9F A;  3H64 A;  2DXL A;  3RL5 A;  2BQ8 X;  4M0V A;  4FBW A;  4O43 A;  3RL4 A;  4B2O A;  3JYF A;  4ZX2 A;  2KKN A;  3FGA C;  5HPE A;  2WDF A;  1HPU A;  1T70 A;  4JA7 A;  4MP0 A;  1V73 A;  3QFO A;  1QHW A;  1JK7 A;  4OR9 A;  4KBP A;  3DW8 C;  3THN A;  4F0Z A;  3AUZ A;  4DSY A;  4V0X A;  4V0W A;  2GJU A;  2QFR A;  4I5L C;  1QFC A;  2QFP A;  5B8I A;  3HVQ A;  3EGH A;  5JPF A;  3K7V C;  3ZTV A;  1NNW A;  2CV9 A;  3H67 A;  4NZV A;  4UT2 A;  4V0V A;  5JJT A;  1WAR A;  2IAE C;  4LTY A;  2ZO9 B;  4ORB A;  5F3W A;  1S70 A;  3IB8 A;  4MOV A;  1HP1 A;  4MOY A;  3RL3 A;  4UT3 B;  3N5U A;  4H2I A;  4UT3 A;  4Q7F A;  2WDC A;  2WDD A;  2HYO A;  2NPP C;  4O24 A;  1OID A;  4O5G A;  3KBP A;  4H1Y P;  4H2G A;  2R17 A;  3QFK A;  2Q8U A;  4KKZ A;  2DFJ A;  4HD0 A;  3IVD A;  4FCX A;  1AUI A;  1XM7 A;  2Z72 A;  3DSD A;  5C1V A;  1IT6 A;  4IL1 A;  1Z2X A;  2HY1 A;  2WDE A;  2A22 A;  1OIE A;  1OI8 A;  2ZBM A;  4FBK A;  1S3M A;  1G5B A;  3H63 A;  1TCO A;  1USH A;  4FBQ A;  4G9J A;  5JPE A;  3C5W C;  3P71 C;  3QG5 C;  3ICF A;  2IE4 C;  4J6O A;  2O8A A;  2QJC A;  1HO5 A;  3H60 A;  5EQV A;  4ZVZ A;  4DT2 A;  4WWL A;  1MF8 A;  3CK2 A;  1S3L A;  3E0J A;  4H1S A;  4I5N C;  3PSO A;  4XPN A;  3T1I A;  5IOH A;  3QFN A;  3V4Y A;  1M63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...