1HO5A

5'-nucleotidase (e. coli) in complex with adenosine and phosphate
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
525
structure length
525
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords 5'-NUCLEOTIDASE
total genus 168
structure length 525
sequence length 525
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1ho5A01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1ho5A02
1QHWA 3H66A 1G5BA 2JOGA 2NYMC 1JK7A 2DFJA 1HP1A 4I5NC 4V0WA 2IAEC 4FBQA 4O43A 3KBPA 2YVTA 2Z72A 4MOYA 3RL3A 4UT3B 4XPNA 3EGHA 5DNYA 1MF8A 1UTEA 4TUIA 4KKZA 3CK2A 1UF3A 4MP0A 4ORBA 3THNA 3DSDA 2GJUA 4FBKA 5EQVA 3V4YA 1S3LA 3N5UA 2USHA 3LL8A 2O8AA 3H68A 1NNWA 5GTUA 1FJMA 3H61A 1XZWA 3QFOA 2HYOA 4LTYA 4O24A 4ORAA 5C1VA 5IOHA 3P71C 3ZU0A 5JPFA 4H1SA 3DW8C 4JA9A 4LU9A 4TUGA 1S8EA 4UT3A 3T1IA 1USHA 2NPPC 2R17A 3RQZA 2ZBMA 4J6OA 1HPUA 1TCOA 4FBWA 1M63A 3RL5A 4ZX2A 1S70A 3DSCA 1OIDA 2Q8UA 4WWLA 1S3MA 2NYLC 1S95A 2WDCA 4JA7A 2HY1A 3IB8A 1Z2XA 3IVDA 3IVEA 4MOVA 3ZTVA 1OIEA 1W24A 3HVQA 4UT2A 4UWQA 4H2GA 3TGHA 2BQ8X 4LACC 4KBPA 4Q7FA 4B2OA 2IE4C 1AUIA 2IE3C 3C5WC 3GVEA 1Z2WA 4NZVA 3H60A 4ORCA 3JYFA 3E7BA 3K7VC 1HO5A 4YKEA 2QFRA 3PSOA 2QJCA 3AUZA 3C9FA 1OI8A 3H62B 3K7WC 4FCXA 2WDDA 3PSNA 1WARA 2AHDA 4DSYA 2WDFA 3QG5C 4IYPC 4ZVZA 3H69A 4OR9A 1II7A 2P6BA 3H67A 1SU1A 3H64A 3QFMA 4G9JA 1XM7A 3AV0A 4IL1A 5INBA 5J28A 2A22A 4HD0A 1U32A 3THOB 5F3WA 4V0VA 4I5LC 1QFCA 4M0VA 2BDXA 2CV9A 1T71A 4DHLA 4V0XA 2KKNA 5JPEA 2Z06A 2NXFA 3E7AA 2WDEA 3QFNA 3QFKA 1KBPA 4F0ZA 2XMOA 2Z1AA 4DT2A 2HYPA 4O5GA 1T70A 3IB7A 1WAO1 2O8GA 3EGGA 4H2IA 4H2BA 5B8IA 3RL4A 3ICFA 1V73A 1S3NA 1IT6A 4H1YP 5HPEA 3H63A 4H2FA 5JJTA 4O4KA 2QFPA 2BCDA 3FGAC
chains in the Genus database with same CATH superfamily
1QHWA 3H66A 1G5BA 2JOGA 2NYMC 1JK7A 2DFJA 1HP1A 4I5NC 4V0WA 2IAEC 4FBQA 4O43A 3KBPA 2YVTA 2Z72A 4MOYA 3RL3A 4UT3B 4XPNA 3EGHA 5DNYA 1MF8A 1UTEA 4TUIA 4KKZA 3CK2A 1UF3A 4MP0A 4ORBA 3THNA 3DSDA 2GJUA 4FBKA 5EQVA 3V4YA 1S3LA 3N5UA 2USHA 3LL8A 2O8AA 3H68A 1NNWA 5GTUA 1FJMA 3H61A 1XZWA 3QFOA 2HYOA 4LTYA 4O24A 4ORAA 5C1VA 5IOHA 3P71C 3FLOA 3ZU0A 5JPFA 4H1SA 3DW8C 4JA9A 4LU9A 4TUGA 1S8EA 4UT3A 3T1IA 1USHA 2NPPC 2R17A 3RQZA 2ZBMA 4J6OA 1HPUA 1TCOA 4FBWA 1M63A 3RL5A 4ZX2A 1S70A 3DSCA 1OIDA 2Q8UA 4WWLA 1S3MA 2NYLC 1S95A 2WDCA 4JA7A 2HY1A 3IB8A 1Z2XA 3IVDA 3IVEA 4MOVA 3ZTVA 1OIEA 1W24A 3HVQA 4UT2A 4UWQA 4H2GA 3TGHA 2BQ8X 4LACC 4KBPA 4Q7FA 4B2OA 2IE4C 1AUIA 2IE3C 3C5WC 3GVEA 1Z2WA 4NZVA 3D03A 3H60A 4ORCA 3JYFA 3E7BA 3K7VC 1HO5A 4YKEA 2QFRA 3PSOA 2QJCA 3AUZA 3C9FA 1OI8A 3H62B 3K7WC 4FCXA 2WDDA 3PSNA 1WARA 2AHDA 4DSYA 2WDFA 3QG5C 4IYPC 4ZVZA 3H69A 4OR9A 1II7A 2P6BA 3H67A 2DXLA 1SU1A 3E0JA 3H64A 3QFMA 1XM7A 3AV0A 4G9JA 4IL1A 5INBA 2ZOAA 5J28A 2A22A 4HD0A 1U32A 3THOB 5F3WA 4V0VA 4I5LC 1QFCA 4M0VA 2BDXA 2CV9A 1T71A 4DHLA 2YEQA 4V0XA 2KKNA 5JPEA 2Z06A 2NXFA 3E7AA 2WDEA 3QFNA 3QFKA 1KBPA 4F0ZA 2XMOA 2DXNA 2Z1AA 4DT2A 2HYPA 4O5GA 1T70A 3IB7A 1WAO1 2O8GA 3EGGA 4H2IA 4H2BA 5B8IA 3RL4A 2ZO9B 3ICFA 1V73A 1S3NA 1IT6A 4H1YP 5HPEA 3H63A 4H2FA 5JJTA 4O4KA 2QFPA 2BCDA 3FGAC
chains in the Genus database with same CATH topology
1QHWA 3H66A 1G5BA 2JOGA 2NYMC 1JK7A 2DFJA 1HP1A 4I5NC 4V0WA 2IAEC 4FBQA 4O43A 3KBPA 2YVTA 2Z72A 4MOYA 3RL3A 4UT3B 4XPNA 3EGHA 5DNYA 1MF8A 1UTEA 4TUIA 4KKZA 3CK2A 1UF3A 4MP0A 4ORBA 3THNA 3DSDA 2GJUA 4FBKA 5EQVA 3V4YA 1S3LA 3N5UA 2USHA 3LL8A 2O8AA 3H68A 1NNWA 5GTUA 1FJMA 3H61A 1XZWA 3QFOA 2HYOA 4LTYA 4O24A 4ORAA 5C1VA 5IOHA 3P71C 3FLOA 3ZU0A 5JPFA 4H1SA 3DW8C 4JA9A 4LU9A 4TUGA 1S8EA 4UT3A 3T1IA 1USHA 2NPPC 2R17A 3RQZA 2ZBMA 4J6OA 1HPUA 1TCOA 4FBWA 1M63A 3RL5A 4ZX2A 1S70A 3DSCA 1OIDA 2Q8UA 4WWLA 1S3MA 2NYLC 1S95A 2WDCA 4JA7A 2HY1A 3IB8A 1Z2XA 3IVDA 3IVEA 4MOVA 3ZTVA 1OIEA 1W24A 3HVQA 4UT2A 4UWQA 4H2GA 3TGHA 2BQ8X 4LACC 4KBPA 4Q7FA 4B2OA 2IE4C 1AUIA 2IE3C 3C5WC 3GVEA 1Z2WA 4NZVA 3D03A 3H60A 4ORCA 3JYFA 3E7BA 3K7VC 1HO5A 4YKEA 2QFRA 3PSOA 2QJCA 3AUZA 3C9FA 1OI8A 3H62B 3K7WC 4FCXA 2WDDA 3PSNA 1WARA 2AHDA 4DSYA 2WDFA 3QG5C 4IYPC 4ZVZA 3H69A 4OR9A 1II7A 2P6BA 3H67A 2DXLA 1SU1A 3E0JA 3H64A 3QFMA 1XM7A 3AV0A 4G9JA 4IL1A 5INBA 2ZOAA 5J28A 2A22A 4HD0A 1U32A 3THOB 5F3WA 4V0VA 4I5LC 1QFCA 4M0VA 2BDXA 2CV9A 1T71A 4DHLA 2YEQA 4V0XA 2KKNA 5JPEA 2Z06A 2NXFA 3E7AA 2WDEA 3QFNA 3QFKA 1KBPA 4F0ZA 2XMOA 2DXNA 2Z1AA 4DT2A 2HYPA 4O5GA 1T70A 3IB7A 1WAO1 2O8GA 3EGGA 4H2IA 4H2BA 5B8IA 3RL4A 2ZO9B 3ICFA 1V73A 1S3NA 1IT6A 4H1YP 5HPEA 3H63A 4H2FA 5JJTA 4O4KA 2QFPA 2BCDA 3FGAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QHW A;  3H66 A;  1G5B A;  2JOG A;  2NYM C;  1JK7 A;  2DFJ A;  1HP1 A;  4I5N C;  4V0W A;  2IAE C;  4FBQ A;  4O43 A;  3KBP A;  2YVT A;  2Z72 A;  4MOY A;  3RL3 A;  4UT3 B;  4XPN A;  3EGH A;  5DNY A;  1MF8 A;  1UTE A;  4TUI A;  4KKZ A;  3CK2 A;  1UF3 A;  4MP0 A;  4ORB A;  3THN A;  3DSD A;  2GJU A;  4FBK A;  5EQV A;  3V4Y A;  1S3L A;  3N5U A;  2USH A;  3LL8 A;  2O8A A;  3H68 A;  1NNW A;  5GTU A;  1FJM A;  3H61 A;  1XZW A;  3QFO A;  2HYO A;  4LTY A;  4O24 A;  4ORA A;  5C1V A;  5IOH A;  3P71 C;  3ZU0 A;  5JPF A;  4H1S A;  3DW8 C;  4JA9 A;  4LU9 A;  4TUG A;  1S8E A;  4UT3 A;  3T1I A;  1USH A;  2NPP C;  2R17 A;  3RQZ A;  2ZBM A;  4J6O A;  1HPU A;  1TCO A;  4FBW A;  1M63 A;  3RL5 A;  4ZX2 A;  1S70 A;  3DSC A;  1OID A;  2Q8U A;  4WWL A;  1S3M A;  2NYL C;  1S95 A;  2WDC A;  4JA7 A;  2HY1 A;  3IB8 A;  1Z2X A;  3IVD A;  3IVE A;  4MOV A;  3ZTV A;  1OIE A;  1W24 A;  3HVQ A;  4UT2 A;  4UWQ A;  4H2G A;  3TGH A;  2BQ8 X;  4LAC C;  4KBP A;  4Q7F A;  4B2O A;  2IE4 C;  1AUI A;  2IE3 C;  3C5W C;  3GVE A;  1Z2W A;  4NZV A;  3H60 A;  4ORC A;  3JYF A;  3E7B A;  3K7V C;  1HO5 A;  4YKE A;  2QFR A;  3PSO A;  2QJC A;  3AUZ A;  3C9F A;  1OI8 A;  3H62 B;  3K7W C;  4FCX A;  2WDD A;  3PSN A;  1WAR A;  2AHD A;  4DSY A;  2WDF A;  3QG5 C;  4IYP C;  4ZVZ A;  3H69 A;  4OR9 A;  1II7 A;  2P6B A;  3H67 A;  1SU1 A;  3H64 A;  3QFM A;  4G9J A;  1XM7 A;  3AV0 A;  4IL1 A;  5INB A;  5J28 A;  2A22 A;  4HD0 A;  1U32 A;  3THO B;  5F3W A;  4V0V A;  4I5L C;  1QFC A;  4M0V A;  2BDX A;  2CV9 A;  1T71 A;  4DHL A;  4V0X A;  2KKN A;  5JPE A;  2Z06 A;  2NXF A;  3E7A A;  2WDE A;  3QFN A;  3QFK A;  1KBP A;  4F0Z A;  2XMO A;  2Z1A A;  4DT2 A;  2HYP A;  4O5G A;  1T70 A;  3IB7 A;  1WAO 1;  2O8G A;  3EGG A;  4H2I A;  4H2B A;  5B8I A;  3RL4 A;  3ICF A;  1V73 A;  1S3N A;  1IT6 A;  4H1Y P;  5HPE A;  3H63 A;  4H2F A;  5JJT A;  4O4K A;  2QFP A;  2BCD A;  3FGA C; 
#chains in the Genus database with same CATH topology
 1QHW A;  3H66 A;  1G5B A;  2JOG A;  2NYM C;  1JK7 A;  2DFJ A;  1HP1 A;  4I5N C;  4V0W A;  2IAE C;  4FBQ A;  4O43 A;  3KBP A;  2YVT A;  2Z72 A;  4MOY A;  3RL3 A;  4UT3 B;  4XPN A;  3EGH A;  5DNY A;  1MF8 A;  1UTE A;  4TUI A;  4KKZ A;  3CK2 A;  1UF3 A;  4MP0 A;  4ORB A;  3THN A;  3DSD A;  2GJU A;  4FBK A;  5EQV A;  3V4Y A;  1S3L A;  3N5U A;  2USH A;  3LL8 A;  2O8A A;  3H68 A;  1NNW A;  5GTU A;  1FJM A;  3H61 A;  1XZW A;  3QFO A;  2HYO A;  4LTY A;  4O24 A;  4ORA A;  5C1V A;  5IOH A;  3P71 C;  3FLO A;  3ZU0 A;  5JPF A;  4H1S A;  3DW8 C;  4JA9 A;  4LU9 A;  4TUG A;  1S8E A;  4UT3 A;  3T1I A;  1USH A;  2NPP C;  2R17 A;  3RQZ A;  2ZBM A;  4J6O A;  1HPU A;  1TCO A;  4FBW A;  1M63 A;  3RL5 A;  4ZX2 A;  1S70 A;  3DSC A;  1OID A;  2Q8U A;  4WWL A;  1S3M A;  2NYL C;  1S95 A;  2WDC A;  4JA7 A;  2HY1 A;  3IB8 A;  1Z2X A;  3IVD A;  3IVE A;  4MOV A;  3ZTV A;  1OIE A;  1W24 A;  3HVQ A;  4UT2 A;  4UWQ A;  4H2G A;  3TGH A;  2BQ8 X;  4LAC C;  4KBP A;  4Q7F A;  4B2O A;  2IE4 C;  1AUI A;  2IE3 C;  3C5W C;  3GVE A;  1Z2W A;  4NZV A;  3D03 A;  3H60 A;  4ORC A;  3JYF A;  3E7B A;  3K7V C;  1HO5 A;  4YKE A;  2QFR A;  3PSO A;  2QJC A;  3AUZ A;  3C9F A;  1OI8 A;  3H62 B;  3K7W C;  4FCX A;  2WDD A;  3PSN A;  1WAR A;  2AHD A;  4DSY A;  2WDF A;  3QG5 C;  4IYP C;  4ZVZ A;  3H69 A;  4OR9 A;  1II7 A;  2P6B A;  3H67 A;  2DXL A;  1SU1 A;  3E0J A;  3H64 A;  3QFM A;  1XM7 A;  3AV0 A;  4G9J A;  4IL1 A;  5INB A;  2ZOA A;  5J28 A;  2A22 A;  4HD0 A;  1U32 A;  3THO B;  5F3W A;  4V0V A;  4I5L C;  1QFC A;  4M0V A;  2BDX A;  2CV9 A;  1T71 A;  4DHL A;  2YEQ A;  4V0X A;  2KKN A;  5JPE A;  2Z06 A;  2NXF A;  3E7A A;  2WDE A;  3QFN A;  3QFK A;  1KBP A;  4F0Z A;  2XMO A;  2DXN A;  2Z1A A;  4DT2 A;  2HYP A;  4O5G A;  1T70 A;  3IB7 A;  1WAO 1;  2O8G A;  3EGG A;  4H2I A;  4H2B A;  5B8I A;  3RL4 A;  2ZO9 B;  3ICF A;  1V73 A;  1S3N A;  1IT6 A;  4H1Y P;  5HPE A;  3H63 A;  4H2F A;  5JJT A;  4O4K A;  2QFP A;  2BCD A;  3FGA C; 
#chains in the Genus database with same CATH homology
 1QHW A;  3H66 A;  1G5B A;  2JOG A;  2NYM C;  1JK7 A;  2DFJ A;  1HP1 A;  4I5N C;  4V0W A;  2IAE C;  4FBQ A;  4O43 A;  3KBP A;  2YVT A;  2Z72 A;  4MOY A;  3RL3 A;  4UT3 B;  4XPN A;  3EGH A;  5DNY A;  1MF8 A;  1UTE A;  4TUI A;  4KKZ A;  3CK2 A;  1UF3 A;  4MP0 A;  4ORB A;  3THN A;  3DSD A;  2GJU A;  4FBK A;  5EQV A;  3V4Y A;  1S3L A;  3N5U A;  2USH A;  3LL8 A;  2O8A A;  3H68 A;  1NNW A;  5GTU A;  1FJM A;  3H61 A;  1XZW A;  3QFO A;  2HYO A;  4LTY A;  4O24 A;  4ORA A;  5C1V A;  5IOH A;  3P71 C;  3FLO A;  3ZU0 A;  5JPF A;  4H1S A;  3DW8 C;  4JA9 A;  4LU9 A;  4TUG A;  1S8E A;  4UT3 A;  3T1I A;  1USH A;  2NPP C;  2R17 A;  3RQZ A;  2ZBM A;  4J6O A;  1HPU A;  1TCO A;  4FBW A;  1M63 A;  3RL5 A;  4ZX2 A;  1S70 A;  3DSC A;  1OID A;  2Q8U A;  4WWL A;  1S3M A;  2NYL C;  1S95 A;  2WDC A;  4JA7 A;  2HY1 A;  3IB8 A;  1Z2X A;  3IVD A;  3IVE A;  4MOV A;  3ZTV A;  1OIE A;  1W24 A;  3HVQ A;  4UT2 A;  4UWQ A;  4H2G A;  3TGH A;  2BQ8 X;  4LAC C;  4KBP A;  4Q7F A;  4B2O A;  2IE4 C;  1AUI A;  2IE3 C;  3C5W C;  3GVE A;  1Z2W A;  4NZV A;  3D03 A;  3H60 A;  4ORC A;  3JYF A;  3E7B A;  3K7V C;  1HO5 A;  4YKE A;  2QFR A;  3PSO A;  2QJC A;  3AUZ A;  3C9F A;  1OI8 A;  3H62 B;  3K7W C;  4FCX A;  2WDD A;  3PSN A;  1WAR A;  2AHD A;  4DSY A;  2WDF A;  3QG5 C;  4IYP C;  4ZVZ A;  3H69 A;  4OR9 A;  1II7 A;  2P6B A;  3H67 A;  2DXL A;  1SU1 A;  3E0J A;  3H64 A;  3QFM A;  1XM7 A;  3AV0 A;  4G9J A;  4IL1 A;  5INB A;  2ZOA A;  5J28 A;  2A22 A;  4HD0 A;  1U32 A;  3THO B;  5F3W A;  4V0V A;  4I5L C;  1QFC A;  4M0V A;  2BDX A;  2CV9 A;  1T71 A;  4DHL A;  2YEQ A;  4V0X A;  2KKN A;  5JPE A;  2Z06 A;  2NXF A;  3E7A A;  2WDE A;  3QFN A;  3QFK A;  1KBP A;  4F0Z A;  2XMO A;  2DXN A;  2Z1A A;  4DT2 A;  2HYP A;  4O5G A;  1T70 A;  3IB7 A;  1WAO 1;  2O8G A;  3EGG A;  4H2I A;  4H2B A;  5B8I A;  3RL4 A;  2ZO9 B;  3ICF A;  1V73 A;  1S3N A;  1IT6 A;  4H1Y P;  5HPE A;  3H63 A;  4H2F A;  5JJT A;  4O4K A;  2QFP A;  2BCD A;  3FGA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...