2ZBMA

Crystal structure of i115m mutant cold-active protein tyrosine phosphatase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
331
Chain Sequence
TEFDGPYVITPISGQSTAYWICDNRLKTTSIEKLQVNRPEHCGDLPETKLSSEIKQIMPDTYLGIKKVVALSDVHGQYDVLLTLLKKQKIIDSDGNWAFGEGHMVMTGDMFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRYVHQRYDIATTLINRPYNKLYGADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTLDKANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNHIVVGHTSQERVLGLFHNKVIAVDSSIKVGKSGELLLLENNRLIRGLYDGTRETLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of group bulkiness in the catalytic activity of psychrophile cold-active protein tyrosine phosphatase
pubmed doi rcsb
source organism Shewanella sp.
molecule tags Hydrolase
molecule keywords Protein-tyrosine-phosphatase
total genus 116
structure length 331
sequence length 331
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2zbmA00
4O24A 3EGGA 1U32A 4WWLA 4HD0A 1Z2XA 3H64A 4FBWA 3H66A 1S70A 2Z06A 4M0VA 4UT3A 1S3LA 2Z72A 2NXFA 3K7VC 1S8EA 1M63A 3QFNA 4JA9A 4V0WA 1II7A 2WDFA 5C1VA 4LACC 3ICFA 3QG5C 3V4YA 4KKZA 4TUGA 5J28A 1WARA 2HYPA 2USHA 4MP0A 4NZVA 2BDXA 4UT2A 3HVQA 4DT2A 4FCXA 3ZTVA 4I5LC 1SU1A 4V0XA 1W24A 2QFPA 2IE4C 5F3WA 4Q7FA 5GTUA 4MOVA 1V73A 4ORAA 4LTYA 1MF8A 4H2IA 4YKEA 3P71C 3T1IA 2DFJA 5JPFA 3GVEA 4I5NC 3E7BA 1TCOA 3DW8C 4LU9A 3AV0A 2Q8UA 3EGHA 4FBQA 1KBPA 3H62B 3DSCA 3N5UA 4UT3B 3IB8A 1JK7A 3PSOA 2QJCA 4XPNA 3C5WC 2R17A 3IB7A 3LL8A 5JPEA 1UF3A 2NPPC 2AHDA 1NNWA 3QFKA 2O8AA 1HO5A 3THOB 1T71A 3QFOA 1S95A 3TGHA 4MOYA 1G5BA 4ORCA 1WAO1 2BQ8X 4IL1A 3RL5A 2JOGA 1XM7A 4DSYA 4ZVZA 4H1YP 3E7AA 3RL4A 1S3MA 3KBPA 2QFRA 4J6OA 1QHWA 2WDDA 5JJTA 3H68A 1Z2WA 1AUIA 2O8GA 4ORBA 2BCDA 3RL3A 3QFMA 3FGAC 4FBKA 3H61A 4H2FA 1FJMA 2ZBMA 5HPEA 3C9FA 2IE3C 4O43A 2CV9A 2Z1AA 1XZWA 3AUZA 3H63A 2IAEC 3THNA 2XMOA 1OI8A 4V0VA 4DHLA 3RQZA 1OIDA 3DSDA 1OIEA 4IYPC 2HY1A 5EQVA 4UWQA 3H69A 4OR9A 3CK2A 4O4KA 4H2BA 4JA7A 2NYLC 5INBA 1S3NA 4B2OA 4KBPA 4O5GA 1QFCA 2P6BA 2WDEA 3PSNA 4TUIA 1HPUA 2NYMC 5B8IA 2YVTA 2HYOA 2GJUA 2A22A 1USHA 3H60A 1HP1A 4F0ZA 1UTEA 2KKNA 4G9JA 3IVDA 3JYFA 3ZU0A 4H1SA 5DNYA 1T70A 3H67A 3K7WC 4H2GA 3IVEA 5IOHA 2WDCA 4ZX2A 1IT6A
chains in the Genus database with same CATH superfamily
4O24A 3EGGA 1U32A 4WWLA 4HD0A 1Z2XA 3H64A 4FBWA 3H66A 1S70A 2Z06A 4M0VA 4UT3A 1S3LA 2Z72A 2NXFA 3K7VC 1S8EA 1M63A 3QFNA 4JA9A 4V0WA 1II7A 2WDFA 5C1VA 4LACC 3ICFA 3QG5C 3V4YA 4KKZA 4TUGA 5J28A 1WARA 2HYPA 2USHA 4MP0A 4NZVA 2BDXA 2ZO9B 4UT2A 3HVQA 4DT2A 4FCXA 3ZTVA 4I5LC 3FLOA 1SU1A 4V0XA 1W24A 2QFPA 2IE4C 5F3WA 4Q7FA 5GTUA 4MOVA 1V73A 4ORAA 4LTYA 1MF8A 4H2IA 4YKEA 2DXLA 3P71C 3T1IA 2DFJA 5JPFA 3GVEA 4I5NC 3E7BA 1TCOA 3DW8C 4LU9A 3AV0A 2Q8UA 3EGHA 4FBQA 1KBPA 3H62B 3DSCA 3N5UA 4UT3B 2DXNA 3IB8A 1JK7A 3PSOA 2QJCA 4XPNA 3C5WC 2R17A 3IB7A 3LL8A 5JPEA 1UF3A 2NPPC 2AHDA 1NNWA 3QFKA 2O8AA 1HO5A 3THOB 1T71A 3QFOA 1S95A 3TGHA 4MOYA 2YEQA 1G5BA 4ORCA 1WAO1 2BQ8X 4IL1A 3RL5A 2JOGA 1XM7A 4DSYA 4ZVZA 4H1YP 3E7AA 3RL4A 1S3MA 3KBPA 2QFRA 4J6OA 1QHWA 2WDDA 5JJTA 3H68A 1Z2WA 1AUIA 2O8GA 4ORBA 2BCDA 3RL3A 3QFMA 3FGAC 4FBKA 3H61A 4H2FA 1FJMA 2ZBMA 5HPEA 3C9FA 2IE3C 4O43A 2CV9A 2Z1AA 1XZWA 3AUZA 3H63A 2IAEC 3THNA 2XMOA 1OI8A 4V0VA 4DHLA 3RQZA 1OIDA 3DSDA 1OIEA 4IYPC 2HY1A 5EQVA 4UWQA 3H69A 4OR9A 3CK2A 4O4KA 4H2BA 4JA7A 2NYLC 5INBA 1S3NA 4B2OA 4KBPA 4O5GA 1QFCA 2P6BA 2WDEA 3D03A 3PSNA 4TUIA 1HPUA 2NYMC 5B8IA 2YVTA 2HYOA 2GJUA 2A22A 1USHA 3H60A 1HP1A 4F0ZA 2ZOAA 1UTEA 2KKNA 4G9JA 3IVDA 3JYFA 3ZU0A 4H1SA 5DNYA 1T70A 3H67A 3K7WC 4H2GA 3IVEA 5IOHA 2WDCA 4ZX2A 1IT6A 3E0JA
chains in the Genus database with same CATH topology
4O24A 3EGGA 1U32A 4WWLA 4HD0A 1Z2XA 3H64A 4FBWA 3H66A 1S70A 2Z06A 4M0VA 4UT3A 1S3LA 2Z72A 2NXFA 3K7VC 1S8EA 1M63A 3QFNA 4JA9A 4V0WA 1II7A 2WDFA 5C1VA 4LACC 3ICFA 3QG5C 3V4YA 4KKZA 4TUGA 5J28A 1WARA 2HYPA 2USHA 4MP0A 4NZVA 2BDXA 2ZO9B 4UT2A 3HVQA 4DT2A 4FCXA 3ZTVA 4I5LC 3FLOA 1SU1A 4V0XA 1W24A 2QFPA 2IE4C 5F3WA 4Q7FA 5GTUA 4MOVA 1V73A 4ORAA 4LTYA 1MF8A 4H2IA 4YKEA 2DXLA 3P71C 3T1IA 2DFJA 5JPFA 3GVEA 4I5NC 3E7BA 1TCOA 3DW8C 4LU9A 3AV0A 2Q8UA 3EGHA 4FBQA 1KBPA 3H62B 3DSCA 3N5UA 4UT3B 2DXNA 3IB8A 1JK7A 3PSOA 2QJCA 4XPNA 3C5WC 2R17A 3IB7A 3LL8A 5JPEA 1UF3A 2NPPC 2AHDA 1NNWA 3QFKA 2O8AA 1HO5A 3THOB 1T71A 3QFOA 1S95A 3TGHA 4MOYA 2YEQA 1G5BA 4ORCA 1WAO1 2BQ8X 4IL1A 3RL5A 2JOGA 1XM7A 4DSYA 4ZVZA 4H1YP 3E7AA 3RL4A 1S3MA 3KBPA 2QFRA 4J6OA 1QHWA 2WDDA 5JJTA 3H68A 1Z2WA 1AUIA 2O8GA 4ORBA 2BCDA 3RL3A 3QFMA 3FGAC 4FBKA 3H61A 4H2FA 1FJMA 2ZBMA 5HPEA 3C9FA 2IE3C 4O43A 2CV9A 2Z1AA 1XZWA 3AUZA 3H63A 2IAEC 3THNA 2XMOA 1OI8A 4V0VA 4DHLA 3RQZA 1OIDA 3DSDA 1OIEA 4IYPC 2HY1A 5EQVA 4UWQA 3H69A 4OR9A 3CK2A 4O4KA 4H2BA 4JA7A 2NYLC 5INBA 1S3NA 4B2OA 4KBPA 4O5GA 1QFCA 2P6BA 2WDEA 3D03A 3PSNA 4TUIA 1HPUA 2NYMC 5B8IA 2YVTA 2HYOA 2GJUA 2A22A 1USHA 3H60A 1HP1A 4F0ZA 2ZOAA 1UTEA 2KKNA 4G9JA 3IVDA 3JYFA 3ZU0A 4H1SA 5DNYA 1T70A 3H67A 3K7WC 4H2GA 3IVEA 5IOHA 2WDCA 4ZX2A 1IT6A 3E0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O24 A;  3EGG A;  1U32 A;  4WWL A;  4HD0 A;  1Z2X A;  3H64 A;  4FBW A;  3H66 A;  1S70 A;  2Z06 A;  4M0V A;  4UT3 A;  1S3L A;  2Z72 A;  2NXF A;  3K7V C;  1S8E A;  1M63 A;  3QFN A;  4JA9 A;  4V0W A;  1II7 A;  2WDF A;  5C1V A;  4LAC C;  3ICF A;  3QG5 C;  3V4Y A;  4KKZ A;  4TUG A;  5J28 A;  1WAR A;  2HYP A;  2USH A;  4MP0 A;  4NZV A;  2BDX A;  4UT2 A;  3HVQ A;  4DT2 A;  4FCX A;  3ZTV A;  4I5L C;  1SU1 A;  4V0X A;  1W24 A;  2QFP A;  2IE4 C;  5F3W A;  4Q7F A;  5GTU A;  4MOV A;  1V73 A;  4ORA A;  4LTY A;  1MF8 A;  4H2I A;  4YKE A;  3P71 C;  3T1I A;  2DFJ A;  5JPF A;  3GVE A;  4I5N C;  3E7B A;  1TCO A;  3DW8 C;  4LU9 A;  3AV0 A;  2Q8U A;  3EGH A;  4FBQ A;  1KBP A;  3H62 B;  3DSC A;  3N5U A;  4UT3 B;  3IB8 A;  1JK7 A;  3PSO A;  2QJC A;  4XPN A;  3C5W C;  2R17 A;  3IB7 A;  3LL8 A;  5JPE A;  1UF3 A;  2NPP C;  2AHD A;  1NNW A;  3QFK A;  2O8A A;  1HO5 A;  3THO B;  1T71 A;  3QFO A;  1S95 A;  3TGH A;  4MOY A;  1G5B A;  4ORC A;  1WAO 1;  2BQ8 X;  4IL1 A;  3RL5 A;  2JOG A;  1XM7 A;  4DSY A;  4ZVZ A;  4H1Y P;  3E7A A;  3RL4 A;  1S3M A;  3KBP A;  2QFR A;  4J6O A;  1QHW A;  2WDD A;  5JJT A;  3H68 A;  1Z2W A;  1AUI A;  2O8G A;  4ORB A;  2BCD A;  3RL3 A;  3QFM A;  3FGA C;  4FBK A;  3H61 A;  4H2F A;  1FJM A;  2ZBM A;  5HPE A;  3C9F A;  2IE3 C;  4O43 A;  2CV9 A;  2Z1A A;  1XZW A;  3AUZ A;  3H63 A;  2IAE C;  3THN A;  2XMO A;  1OI8 A;  4V0V A;  4DHL A;  3RQZ A;  1OID A;  3DSD A;  1OIE A;  4IYP C;  2HY1 A;  5EQV A;  4UWQ A;  3H69 A;  4OR9 A;  3CK2 A;  4O4K A;  4H2B A;  4JA7 A;  2NYL C;  5INB A;  1S3N A;  4B2O A;  4KBP A;  4O5G A;  1QFC A;  2P6B A;  2WDE A;  3PSN A;  4TUI A;  1HPU A;  2NYM C;  5B8I A;  2YVT A;  2HYO A;  2GJU A;  2A22 A;  1USH A;  3H60 A;  1HP1 A;  4F0Z A;  1UTE A;  2KKN A;  4G9J A;  3IVD A;  3JYF A;  3ZU0 A;  4H1S A;  5DNY A;  1T70 A;  3H67 A;  3K7W C;  4H2G A;  3IVE A;  5IOH A;  2WDC A;  4ZX2 A;  1IT6 A; 
#chains in the Genus database with same CATH topology
 4O24 A;  3EGG A;  1U32 A;  4WWL A;  4HD0 A;  1Z2X A;  3H64 A;  4FBW A;  3H66 A;  1S70 A;  2Z06 A;  4M0V A;  4UT3 A;  1S3L A;  2Z72 A;  2NXF A;  3K7V C;  1S8E A;  1M63 A;  3QFN A;  4JA9 A;  4V0W A;  1II7 A;  2WDF A;  5C1V A;  4LAC C;  3ICF A;  3QG5 C;  3V4Y A;  4KKZ A;  4TUG A;  5J28 A;  1WAR A;  2HYP A;  2USH A;  4MP0 A;  4NZV A;  2BDX A;  2ZO9 B;  4UT2 A;  3HVQ A;  4DT2 A;  4FCX A;  3ZTV A;  4I5L C;  3FLO A;  1SU1 A;  4V0X A;  1W24 A;  2QFP A;  2IE4 C;  5F3W A;  4Q7F A;  5GTU A;  4MOV A;  1V73 A;  4ORA A;  4LTY A;  1MF8 A;  4H2I A;  4YKE A;  2DXL A;  3P71 C;  3T1I A;  2DFJ A;  5JPF A;  3GVE A;  4I5N C;  3E7B A;  1TCO A;  3DW8 C;  4LU9 A;  3AV0 A;  2Q8U A;  3EGH A;  4FBQ A;  1KBP A;  3H62 B;  3DSC A;  3N5U A;  4UT3 B;  2DXN A;  3IB8 A;  1JK7 A;  3PSO A;  2QJC A;  4XPN A;  3C5W C;  2R17 A;  3IB7 A;  3LL8 A;  5JPE A;  1UF3 A;  2NPP C;  2AHD A;  1NNW A;  3QFK A;  2O8A A;  1HO5 A;  3THO B;  1T71 A;  3QFO A;  1S95 A;  3TGH A;  4MOY A;  2YEQ A;  1G5B A;  4ORC A;  1WAO 1;  2BQ8 X;  4IL1 A;  3RL5 A;  2JOG A;  1XM7 A;  4DSY A;  4ZVZ A;  4H1Y P;  3E7A A;  3RL4 A;  1S3M A;  3KBP A;  2QFR A;  4J6O A;  1QHW A;  2WDD A;  5JJT A;  3H68 A;  1Z2W A;  1AUI A;  2O8G A;  4ORB A;  2BCD A;  3RL3 A;  3QFM A;  3FGA C;  4FBK A;  3H61 A;  4H2F A;  1FJM A;  2ZBM A;  5HPE A;  3C9F A;  2IE3 C;  4O43 A;  2CV9 A;  2Z1A A;  1XZW A;  3AUZ A;  3H63 A;  2IAE C;  3THN A;  2XMO A;  1OI8 A;  4V0V A;  4DHL A;  3RQZ A;  1OID A;  3DSD A;  1OIE A;  4IYP C;  2HY1 A;  5EQV A;  4UWQ A;  3H69 A;  4OR9 A;  3CK2 A;  4O4K A;  4H2B A;  4JA7 A;  2NYL C;  5INB A;  1S3N A;  4B2O A;  4KBP A;  4O5G A;  1QFC A;  2P6B A;  2WDE A;  3D03 A;  3PSN A;  4TUI A;  1HPU A;  2NYM C;  5B8I A;  2YVT A;  2HYO A;  2GJU A;  2A22 A;  1USH A;  3H60 A;  1HP1 A;  4F0Z A;  2ZOA A;  1UTE A;  2KKN A;  4G9J A;  3IVD A;  3JYF A;  3ZU0 A;  4H1S A;  5DNY A;  1T70 A;  3H67 A;  3K7W C;  4H2G A;  3IVE A;  5IOH A;  2WDC A;  4ZX2 A;  1IT6 A;  3E0J A; 
#chains in the Genus database with same CATH homology
 4O24 A;  3EGG A;  1U32 A;  4WWL A;  4HD0 A;  1Z2X A;  3H64 A;  4FBW A;  3H66 A;  1S70 A;  2Z06 A;  4M0V A;  4UT3 A;  1S3L A;  2Z72 A;  2NXF A;  3K7V C;  1S8E A;  1M63 A;  3QFN A;  4JA9 A;  4V0W A;  1II7 A;  2WDF A;  5C1V A;  4LAC C;  3ICF A;  3QG5 C;  3V4Y A;  4KKZ A;  4TUG A;  5J28 A;  1WAR A;  2HYP A;  2USH A;  4MP0 A;  4NZV A;  2BDX A;  2ZO9 B;  4UT2 A;  3HVQ A;  4DT2 A;  4FCX A;  3ZTV A;  4I5L C;  3FLO A;  1SU1 A;  4V0X A;  1W24 A;  2QFP A;  2IE4 C;  5F3W A;  4Q7F A;  5GTU A;  4MOV A;  1V73 A;  4ORA A;  4LTY A;  1MF8 A;  4H2I A;  4YKE A;  2DXL A;  3P71 C;  3T1I A;  2DFJ A;  5JPF A;  3GVE A;  4I5N C;  3E7B A;  1TCO A;  3DW8 C;  4LU9 A;  3AV0 A;  2Q8U A;  3EGH A;  4FBQ A;  1KBP A;  3H62 B;  3DSC A;  3N5U A;  4UT3 B;  2DXN A;  3IB8 A;  1JK7 A;  3PSO A;  2QJC A;  4XPN A;  3C5W C;  2R17 A;  3IB7 A;  3LL8 A;  5JPE A;  1UF3 A;  2NPP C;  2AHD A;  1NNW A;  3QFK A;  2O8A A;  1HO5 A;  3THO B;  1T71 A;  3QFO A;  1S95 A;  3TGH A;  4MOY A;  2YEQ A;  1G5B A;  4ORC A;  1WAO 1;  2BQ8 X;  4IL1 A;  3RL5 A;  2JOG A;  1XM7 A;  4DSY A;  4ZVZ A;  4H1Y P;  3E7A A;  3RL4 A;  1S3M A;  3KBP A;  2QFR A;  4J6O A;  1QHW A;  2WDD A;  5JJT A;  3H68 A;  1Z2W A;  1AUI A;  2O8G A;  4ORB A;  2BCD A;  3RL3 A;  3QFM A;  3FGA C;  4FBK A;  3H61 A;  4H2F A;  1FJM A;  2ZBM A;  5HPE A;  3C9F A;  2IE3 C;  4O43 A;  2CV9 A;  2Z1A A;  1XZW A;  3AUZ A;  3H63 A;  2IAE C;  3THN A;  2XMO A;  1OI8 A;  4V0V A;  4DHL A;  3RQZ A;  1OID A;  3DSD A;  1OIE A;  4IYP C;  2HY1 A;  5EQV A;  4UWQ A;  3H69 A;  4OR9 A;  3CK2 A;  4O4K A;  4H2B A;  4JA7 A;  2NYL C;  5INB A;  1S3N A;  4B2O A;  4KBP A;  4O5G A;  1QFC A;  2P6B A;  2WDE A;  3D03 A;  3PSN A;  4TUI A;  1HPU A;  2NYM C;  5B8I A;  2YVT A;  2HYO A;  2GJU A;  2A22 A;  1USH A;  3H60 A;  1HP1 A;  4F0Z A;  2ZOA A;  1UTE A;  2KKN A;  4G9J A;  3IVD A;  3JYF A;  3ZU0 A;  4H1S A;  5DNY A;  1T70 A;  3H67 A;  3K7W C;  4H2G A;  3IVE A;  5IOH A;  2WDC A;  4ZX2 A;  1IT6 A;  3E0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...