2ZBMA

Crystal structure of i115m mutant cold-active protein tyrosine phosphatase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
331
Chain Sequence
TEFDGPYVITPISGQSTAYWICDNRLKTTSIEKLQVNRPEHCGDLPETKLSSEIKQIMPDTYLGIKKVVALSDVHGQYDVLLTLLKKQKIIDSDGNWAFGEGHMVMTGDMFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRYVHQRYDIATTLINRPYNKLYGADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTLDKANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNHIVVGHTSQERVLGLFHNKVIAVDSSIKVGKSGELLLLENNRLIRGLYDGTRETLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of group bulkiness in the catalytic activity of psychrophile cold-active protein tyrosine phosphatase
pubmed doi rcsb
source organism Shewanella sp.
molecule tags Hydrolase
molecule keywords Protein-tyrosine-phosphatase
total genus 116
structure length 331
sequence length 331
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2zbmA00
5JPEA 2IE4C 3DW8C 2JOGA 2DFJA 4ORAA 4F0ZA 2R17A 1USHA 2HYPA 5JJTA 1U32A 2WDCA 2Z06A 2WDFA 3RL5A 3H60A 4OR9A 1S3MA 2WDEA 3N5UA 4DT2A 1KBPA 4H2GA 1S3NA 4H2BA 4LTYA 3DSDA 1Z2WA 4HD0A 4FBKA 4H2IA 3C9FA 1FJMA 4UT3B 4JA7A 4B2OA 2YVTA 4UWQA 3HVQA 3DSCA 2GJUA 3ZTVA 1M63A 1UTEA 4H1YP 4XPNA 5C1VA 4TUIA 3C5WC 1WAO1 3THOB 1T70A 1OIDA 3H67A 4FBWA 4I5NC 3CK2A 4YKEA 3K7WC 5INBA 1II7A 1XZWA 2NXFA 2KKNA 4O5GA 5F3WA 5HPEA 4Q7FA 1OI8A 4IYPC 3RL4A 4WWLA 4JA9A 4DSYA 3EGGA 3QFNA 3EGHA 1JK7A 3T1IA 3IVEA 3GVEA 3H63A 2BQ8X 2HYOA 4H1SA 3P71C 1AUIA 2Z72A 3E7AA 3E7BA 2WDDA 2BCDA 1HPUA 2O8AA 4MP0A 4V0VA 2HY1A 3ICFA 4I5LC 4O24A 1HP1A 2P6BA 5EQVA 1NNWA 3FGAC 2AHDA 3PSNA 1UF3A 5J28A 3AV0A 2QFPA 4V0XA 4TUGA 2ZBMA 3IB7A 4UT2A 3QG5C 3PSOA 1S8EA 4MOYA 3THNA 1W24A 3K7VC 3TGHA 3V4YA 1S70A 4FCXA 3QFMA 4KBPA 4O4KA 3IVDA 2QJCA 1Z2XA 3ZU0A 1OIEA 5DNYA 1QHWA 4IL1A 3RL3A 3H62B 1WARA 4LACC 2Q8UA 1S3LA 4ZVZA 3H64A 3H61A 2Z1AA 3H69A 1TCOA 2IE3C 4V0WA 5IOHA 1QFCA 1XM7A 2O8GA 3H66A 2NPPC 2NYMC 2NYLC 1SU1A 1S95A 4KKZA 4ZX2A 1HO5A 1V73A 5GTUA 2CV9A 2QFRA 4DHLA 1T71A 4UT3A 3QFOA 3LL8A 4G9JA 5B8IA 2USHA 4J6OA 4O43A 4H2FA 1MF8A 3KBPA 4M0VA 2IAEC 3QFKA 3AUZA 5JPFA 3H68A 1IT6A 2XMOA 4MOVA 1G5BA 4FBQA 4ORBA 4LU9A 2BDXA 4ORCA 3JYFA 2A22A 4NZVA 3RQZA 3IB8A
chains in the Genus database with same CATH superfamily
5JPEA 2IE4C 3DW8C 2JOGA 2DFJA 2ZO9B 4ORAA 4F0ZA 2R17A 1USHA 2HYPA 5JJTA 1U32A 2WDCA 2Z06A 2WDFA 3RL5A 3H60A 4OR9A 1S3MA 2WDEA 3N5UA 4DT2A 1KBPA 4H2GA 1S3NA 4H2BA 4LTYA 3DSDA 1Z2WA 4HD0A 4FBKA 4H2IA 3C9FA 1FJMA 4UT3B 4JA7A 4B2OA 2YVTA 4UWQA 3HVQA 3DSCA 2GJUA 3ZTVA 1M63A 1UTEA 4H1YP 3FLOA 4XPNA 5C1VA 4TUIA 2ZOAA 1WAO1 3C5WC 3THOB 1T70A 1OIDA 3H67A 4FBWA 4I5NC 3CK2A 4YKEA 3K7WC 5INBA 1II7A 1XZWA 2NXFA 2KKNA 4O5GA 5F3WA 5HPEA 4Q7FA 1OI8A 4IYPC 3RL4A 4WWLA 4JA9A 4DSYA 3EGGA 3QFNA 3EGHA 1JK7A 2DXNA 3T1IA 3IVEA 3GVEA 3H63A 2BQ8X 2HYOA 4H1SA 3P71C 1AUIA 2Z72A 3E7AA 3E7BA 2WDDA 2BCDA 1HPUA 2O8AA 4MP0A 4V0VA 2HY1A 3ICFA 4I5LC 4O24A 1HP1A 2P6BA 5EQVA 1NNWA 3FGAC 2AHDA 3PSNA 1UF3A 5J28A 3AV0A 2QFPA 4V0XA 4TUGA 2ZBMA 3IB7A 2YEQA 4UT2A 3QG5C 3PSOA 1S8EA 3E0JA 4MOYA 3THNA 1W24A 3K7VC 3TGHA 3V4YA 1S70A 4FCXA 3QFMA 4KBPA 4O4KA 3IVDA 2QJCA 1Z2XA 3ZU0A 1OIEA 5DNYA 1QHWA 4IL1A 3RL3A 3H62B 1WARA 4LACC 2Q8UA 1S3LA 4ZVZA 3H64A 3H61A 2Z1AA 2DXLA 3H69A 1TCOA 2IE3C 4V0WA 3D03A 5IOHA 1QFCA 1XM7A 2O8GA 3H66A 2NPPC 2NYMC 2NYLC 1SU1A 1S95A 4KKZA 4ZX2A 1HO5A 1V73A 5GTUA 2CV9A 2QFRA 4DHLA 1T71A 4UT3A 3QFOA 3LL8A 4G9JA 5B8IA 2USHA 4J6OA 4O43A 4H2FA 1MF8A 3KBPA 4M0VA 2IAEC 3QFKA 3AUZA 5JPFA 3H68A 1IT6A 2XMOA 4MOVA 1G5BA 4FBQA 4ORBA 4LU9A 2BDXA 4ORCA 3JYFA 2A22A 4NZVA 3RQZA 3IB8A
chains in the Genus database with same CATH topology
5JPEA 2IE4C 3DW8C 2JOGA 2DFJA 2ZO9B 4ORAA 4F0ZA 2R17A 1USHA 2HYPA 5JJTA 1U32A 2WDCA 2Z06A 2WDFA 3RL5A 3H60A 4OR9A 1S3MA 2WDEA 3N5UA 4DT2A 1KBPA 4H2GA 1S3NA 4H2BA 4LTYA 3DSDA 1Z2WA 4HD0A 4FBKA 4H2IA 3C9FA 1FJMA 4UT3B 4JA7A 4B2OA 2YVTA 4UWQA 3HVQA 3DSCA 2GJUA 3ZTVA 1M63A 1UTEA 4H1YP 3FLOA 4XPNA 5C1VA 4TUIA 2ZOAA 1WAO1 3C5WC 3THOB 1T70A 1OIDA 3H67A 4FBWA 4I5NC 3CK2A 4YKEA 3K7WC 5INBA 1II7A 1XZWA 2NXFA 2KKNA 4O5GA 5F3WA 5HPEA 4Q7FA 1OI8A 4IYPC 3RL4A 4WWLA 4JA9A 4DSYA 3EGGA 3QFNA 3EGHA 1JK7A 2DXNA 3T1IA 3IVEA 3GVEA 3H63A 2BQ8X 2HYOA 4H1SA 3P71C 1AUIA 2Z72A 3E7AA 3E7BA 2WDDA 2BCDA 1HPUA 2O8AA 4MP0A 4V0VA 2HY1A 3ICFA 4I5LC 4O24A 1HP1A 2P6BA 5EQVA 1NNWA 3FGAC 2AHDA 3PSNA 1UF3A 5J28A 3AV0A 2QFPA 4V0XA 4TUGA 2ZBMA 3IB7A 2YEQA 4UT2A 3QG5C 3PSOA 1S8EA 3E0JA 4MOYA 3THNA 1W24A 3K7VC 3TGHA 3V4YA 1S70A 4FCXA 3QFMA 4KBPA 4O4KA 3IVDA 2QJCA 1Z2XA 3ZU0A 1OIEA 5DNYA 1QHWA 4IL1A 3RL3A 3H62B 1WARA 4LACC 2Q8UA 1S3LA 4ZVZA 3H64A 3H61A 2Z1AA 2DXLA 3H69A 1TCOA 2IE3C 4V0WA 3D03A 5IOHA 1QFCA 1XM7A 2O8GA 3H66A 2NPPC 2NYMC 2NYLC 1SU1A 1S95A 4KKZA 4ZX2A 1HO5A 1V73A 5GTUA 2CV9A 2QFRA 4DHLA 1T71A 4UT3A 3QFOA 3LL8A 4G9JA 5B8IA 2USHA 4J6OA 4O43A 4H2FA 1MF8A 3KBPA 4M0VA 2IAEC 3QFKA 3AUZA 5JPFA 3H68A 1IT6A 2XMOA 4MOVA 1G5BA 4FBQA 4ORBA 4LU9A 2BDXA 4ORCA 3JYFA 2A22A 4NZVA 3RQZA 3IB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPE A;  2IE4 C;  3DW8 C;  2JOG A;  2DFJ A;  4ORA A;  4F0Z A;  2R17 A;  1USH A;  2HYP A;  5JJT A;  1U32 A;  2WDC A;  2Z06 A;  2WDF A;  3RL5 A;  3H60 A;  4OR9 A;  1S3M A;  2WDE A;  3N5U A;  4DT2 A;  1KBP A;  4H2G A;  1S3N A;  4H2B A;  4LTY A;  3DSD A;  1Z2W A;  4HD0 A;  4FBK A;  4H2I A;  3C9F A;  1FJM A;  4UT3 B;  4JA7 A;  4B2O A;  2YVT A;  4UWQ A;  3HVQ A;  3DSC A;  2GJU A;  3ZTV A;  1M63 A;  1UTE A;  4H1Y P;  4XPN A;  5C1V A;  4TUI A;  3C5W C;  1WAO 1;  3THO B;  1T70 A;  1OID A;  3H67 A;  4FBW A;  4I5N C;  3CK2 A;  4YKE A;  3K7W C;  5INB A;  1II7 A;  1XZW A;  2NXF A;  2KKN A;  4O5G A;  5F3W A;  5HPE A;  4Q7F A;  1OI8 A;  4IYP C;  3RL4 A;  4WWL A;  4JA9 A;  4DSY A;  3EGG A;  3QFN A;  3EGH A;  1JK7 A;  3T1I A;  3IVE A;  3GVE A;  3H63 A;  2BQ8 X;  2HYO A;  4H1S A;  3P71 C;  1AUI A;  2Z72 A;  3E7A A;  3E7B A;  2WDD A;  2BCD A;  1HPU A;  2O8A A;  4MP0 A;  4V0V A;  2HY1 A;  3ICF A;  4I5L C;  4O24 A;  1HP1 A;  2P6B A;  5EQV A;  1NNW A;  3FGA C;  2AHD A;  3PSN A;  1UF3 A;  5J28 A;  3AV0 A;  2QFP A;  4V0X A;  4TUG A;  2ZBM A;  3IB7 A;  4UT2 A;  3QG5 C;  3PSO A;  1S8E A;  4MOY A;  3THN A;  1W24 A;  3K7V C;  3TGH A;  3V4Y A;  1S70 A;  4FCX A;  3QFM A;  4KBP A;  4O4K A;  3IVD A;  2QJC A;  1Z2X A;  3ZU0 A;  1OIE A;  5DNY A;  1QHW A;  4IL1 A;  3RL3 A;  3H62 B;  1WAR A;  4LAC C;  2Q8U A;  1S3L A;  4ZVZ A;  3H64 A;  3H61 A;  2Z1A A;  3H69 A;  1TCO A;  2IE3 C;  4V0W A;  5IOH A;  1QFC A;  1XM7 A;  2O8G A;  3H66 A;  2NPP C;  2NYM C;  2NYL C;  1SU1 A;  1S95 A;  4KKZ A;  4ZX2 A;  1HO5 A;  1V73 A;  5GTU A;  2CV9 A;  2QFR A;  4DHL A;  1T71 A;  4UT3 A;  3QFO A;  3LL8 A;  4G9J A;  5B8I A;  2USH A;  4J6O A;  4O43 A;  4H2F A;  1MF8 A;  3KBP A;  4M0V A;  2IAE C;  3QFK A;  3AUZ A;  5JPF A;  3H68 A;  1IT6 A;  2XMO A;  4MOV A;  1G5B A;  4FBQ A;  4ORB A;  4LU9 A;  2BDX A;  4ORC A;  3JYF A;  2A22 A;  4NZV A;  3RQZ A;  3IB8 A; 
#chains in the Genus database with same CATH topology
 5JPE A;  2IE4 C;  3DW8 C;  2JOG A;  2DFJ A;  2ZO9 B;  4ORA A;  4F0Z A;  2R17 A;  1USH A;  2HYP A;  5JJT A;  1U32 A;  2WDC A;  2Z06 A;  2WDF A;  3RL5 A;  3H60 A;  4OR9 A;  1S3M A;  2WDE A;  3N5U A;  4DT2 A;  1KBP A;  4H2G A;  1S3N A;  4H2B A;  4LTY A;  3DSD A;  1Z2W A;  4HD0 A;  4FBK A;  4H2I A;  3C9F A;  1FJM A;  4UT3 B;  4JA7 A;  4B2O A;  2YVT A;  4UWQ A;  3HVQ A;  3DSC A;  2GJU A;  3ZTV A;  1M63 A;  1UTE A;  4H1Y P;  3FLO A;  4XPN A;  5C1V A;  4TUI A;  2ZOA A;  1WAO 1;  3C5W C;  3THO B;  1T70 A;  1OID A;  3H67 A;  4FBW A;  4I5N C;  3CK2 A;  4YKE A;  3K7W C;  5INB A;  1II7 A;  1XZW A;  2NXF A;  2KKN A;  4O5G A;  5F3W A;  5HPE A;  4Q7F A;  1OI8 A;  4IYP C;  3RL4 A;  4WWL A;  4JA9 A;  4DSY A;  3EGG A;  3QFN A;  3EGH A;  1JK7 A;  2DXN A;  3T1I A;  3IVE A;  3GVE A;  3H63 A;  2BQ8 X;  2HYO A;  4H1S A;  3P71 C;  1AUI A;  2Z72 A;  3E7A A;  3E7B A;  2WDD A;  2BCD A;  1HPU A;  2O8A A;  4MP0 A;  4V0V A;  2HY1 A;  3ICF A;  4I5L C;  4O24 A;  1HP1 A;  2P6B A;  5EQV A;  1NNW A;  3FGA C;  2AHD A;  3PSN A;  1UF3 A;  5J28 A;  3AV0 A;  2QFP A;  4V0X A;  4TUG A;  2ZBM A;  3IB7 A;  2YEQ A;  4UT2 A;  3QG5 C;  3PSO A;  1S8E A;  3E0J A;  4MOY A;  3THN A;  1W24 A;  3K7V C;  3TGH A;  3V4Y A;  1S70 A;  4FCX A;  3QFM A;  4KBP A;  4O4K A;  3IVD A;  2QJC A;  1Z2X A;  3ZU0 A;  1OIE A;  5DNY A;  1QHW A;  4IL1 A;  3RL3 A;  3H62 B;  1WAR A;  4LAC C;  2Q8U A;  1S3L A;  4ZVZ A;  3H64 A;  3H61 A;  2Z1A A;  2DXL A;  3H69 A;  1TCO A;  2IE3 C;  4V0W A;  3D03 A;  5IOH A;  1QFC A;  1XM7 A;  2O8G A;  3H66 A;  2NPP C;  2NYM C;  2NYL C;  1SU1 A;  1S95 A;  4KKZ A;  4ZX2 A;  1HO5 A;  1V73 A;  5GTU A;  2CV9 A;  2QFR A;  4DHL A;  1T71 A;  4UT3 A;  3QFO A;  3LL8 A;  4G9J A;  5B8I A;  2USH A;  4J6O A;  4O43 A;  4H2F A;  1MF8 A;  3KBP A;  4M0V A;  2IAE C;  3QFK A;  3AUZ A;  5JPF A;  3H68 A;  1IT6 A;  2XMO A;  4MOV A;  1G5B A;  4FBQ A;  4ORB A;  4LU9 A;  2BDX A;  4ORC A;  3JYF A;  2A22 A;  4NZV A;  3RQZ A;  3IB8 A; 
#chains in the Genus database with same CATH homology
 5JPE A;  2IE4 C;  3DW8 C;  2JOG A;  2DFJ A;  2ZO9 B;  4ORA A;  4F0Z A;  2R17 A;  1USH A;  2HYP A;  5JJT A;  1U32 A;  2WDC A;  2Z06 A;  2WDF A;  3RL5 A;  3H60 A;  4OR9 A;  1S3M A;  2WDE A;  3N5U A;  4DT2 A;  1KBP A;  4H2G A;  1S3N A;  4H2B A;  4LTY A;  3DSD A;  1Z2W A;  4HD0 A;  4FBK A;  4H2I A;  3C9F A;  1FJM A;  4UT3 B;  4JA7 A;  4B2O A;  2YVT A;  4UWQ A;  3HVQ A;  3DSC A;  2GJU A;  3ZTV A;  1M63 A;  1UTE A;  4H1Y P;  3FLO A;  4XPN A;  5C1V A;  4TUI A;  2ZOA A;  1WAO 1;  3C5W C;  3THO B;  1T70 A;  1OID A;  3H67 A;  4FBW A;  4I5N C;  3CK2 A;  4YKE A;  3K7W C;  5INB A;  1II7 A;  1XZW A;  2NXF A;  2KKN A;  4O5G A;  5F3W A;  5HPE A;  4Q7F A;  1OI8 A;  4IYP C;  3RL4 A;  4WWL A;  4JA9 A;  4DSY A;  3EGG A;  3QFN A;  3EGH A;  1JK7 A;  2DXN A;  3T1I A;  3IVE A;  3GVE A;  3H63 A;  2BQ8 X;  2HYO A;  4H1S A;  3P71 C;  1AUI A;  2Z72 A;  3E7A A;  3E7B A;  2WDD A;  2BCD A;  1HPU A;  2O8A A;  4MP0 A;  4V0V A;  2HY1 A;  3ICF A;  4I5L C;  4O24 A;  1HP1 A;  2P6B A;  5EQV A;  1NNW A;  3FGA C;  2AHD A;  3PSN A;  1UF3 A;  5J28 A;  3AV0 A;  2QFP A;  4V0X A;  4TUG A;  2ZBM A;  3IB7 A;  2YEQ A;  4UT2 A;  3QG5 C;  3PSO A;  1S8E A;  3E0J A;  4MOY A;  3THN A;  1W24 A;  3K7V C;  3TGH A;  3V4Y A;  1S70 A;  4FCX A;  3QFM A;  4KBP A;  4O4K A;  3IVD A;  2QJC A;  1Z2X A;  3ZU0 A;  1OIE A;  5DNY A;  1QHW A;  4IL1 A;  3RL3 A;  3H62 B;  1WAR A;  4LAC C;  2Q8U A;  1S3L A;  4ZVZ A;  3H64 A;  3H61 A;  2Z1A A;  2DXL A;  3H69 A;  1TCO A;  2IE3 C;  4V0W A;  3D03 A;  5IOH A;  1QFC A;  1XM7 A;  2O8G A;  3H66 A;  2NPP C;  2NYM C;  2NYL C;  1SU1 A;  1S95 A;  4KKZ A;  4ZX2 A;  1HO5 A;  1V73 A;  5GTU A;  2CV9 A;  2QFR A;  4DHL A;  1T71 A;  4UT3 A;  3QFO A;  3LL8 A;  4G9J A;  5B8I A;  2USH A;  4J6O A;  4O43 A;  4H2F A;  1MF8 A;  3KBP A;  4M0V A;  2IAE C;  3QFK A;  3AUZ A;  5JPF A;  3H68 A;  1IT6 A;  2XMO A;  4MOV A;  1G5B A;  4FBQ A;  4ORB A;  4LU9 A;  2BDX A;  4ORC A;  3JYF A;  2A22 A;  4NZV A;  3RQZ A;  3IB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...