3H68A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c)with two zn2+ atoms originally soaked with cantharidin (which is present in the structure in the hydrolyzed form)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
315
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5
total genus 109
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h68A00
2XMOA 3H60A 4DHLA 2NYLC 2WDFA 1UF3A 4FCXA 1II7A 3C9FA 1M63A 3H64A 2JOGA 4J6OA 2GJUA 2WDCA 3C5WC 3H69A 3QFOA 1T70A 2USHA 3AUZA 5B8IA 3ZTVA 2Q8UA 3JYFA 1NNWA 2NPPC 2QFRA 3E7AA 1S70A 4H2GA 3QFMA 3ICFA 3CK2A 4NZVA 4I5LC 4V0XA 3KBPA 1S3LA 4H2BA 3RL3A 3THNA 4FBWA 4YKEA 3H63A 5J28A 5JPFA 1FJMA 1WAO1 3AV0A 1S8EA 5HPEA 3PSOA 4ORCA 4ORBA 2O8GA 1S3MA 1XM7A 2HY1A 3DW8C 4JA7A 2IAEC 2Z1AA 1OI8A 2CV9A 4MOYA 3THOB 4FBKA 4F0ZA 4ZVZA 4TUIA 4UT3B 3K7WC 1S3NA 4O43A 3ZU0A 1SU1A 4KBPA 1OIDA 5JJTA 3EGGA 1T71A 3QG5C 4ZX2A 2HYOA 5IOHA 3H62B 2WDDA 4MP0A 3V4YA 1U32A 1WARA 1AUIA 1UTEA 5DNYA 3IB8A 3EGHA 4LTYA 3T1IA 5C1VA 1HP1A 1OIEA 2BCDA 4H2FA 3QFKA 4I5NC 5JPEA 4DSYA 1KBPA 2BDXA 1HPUA 4B2OA 1QFCA 4IYPC 5INBA 2KKNA 3DSDA 2BQ8X 2QFPA 4G9JA 4KKZA 4HD0A 4XPNA 3RL4A 4O4KA 1HO5A 4V0VA 4H2IA 3H68A 3P71C 1G5BA 1XZWA 1S95A 4O24A 4Q7FA 5EQVA 4ORAA 2YVTA 3IB7A 1Z2XA 5F3WA 3FGAC 1Z2WA 4JA9A 3IVEA 2R17A 2QJCA 3DSCA 2HYPA 2WDEA 3H61A 4FBQA 3H66A 3GVEA 3PSNA 3RQZA 2P6BA 3TGHA 2DFJA 3QFNA 3IVDA 3K7VC 3H67A 4UWQA 3HVQA 1JK7A 2NYMC 4LACC 4H1YP 1QHWA 4LU9A 2Z72A 1USHA 1MF8A 4UT3A 4WWLA 3E7BA 1W24A 4OR9A 2A22A 4V0WA 3RL5A 3N5UA 4TUGA 2IE3C 4MOVA 2Z06A 2NXFA 4IL1A 2ZBMA 4UT2A 3LL8A 4O5GA 5GTUA 2IE4C 4M0VA 1TCOA 1V73A 4DT2A 1IT6A 4H1SA 2AHDA 2O8AA
chains in the Genus database with same CATH superfamily
2XMOA 3H60A 4DHLA 3D03A 2NYLC 2WDFA 1UF3A 4FCXA 1II7A 3C9FA 1M63A 2YEQA 3H64A 2JOGA 4J6OA 2GJUA 2WDCA 3C5WC 3H69A 3QFOA 1T70A 2USHA 3AUZA 5B8IA 3ZTVA 2Q8UA 3JYFA 1NNWA 2NPPC 2QFRA 3E7AA 1S70A 4H2GA 3QFMA 3ICFA 3CK2A 4NZVA 4I5LC 4V0XA 3KBPA 1S3LA 4H2BA 3RL3A 3THNA 4FBWA 4YKEA 3H63A 5J28A 5JPFA 1FJMA 1WAO1 3AV0A 1S8EA 5HPEA 3FLOA 3PSOA 4ORCA 4ORBA 2O8GA 1S3MA 1XM7A 2HY1A 3DW8C 4JA7A 2IAEC 2Z1AA 1OI8A 2CV9A 4MOYA 3THOB 4FBKA 3E0JA 4F0ZA 4ZVZA 4TUIA 4UT3B 3K7WC 1S3NA 4O43A 3ZU0A 1SU1A 4KBPA 1OIDA 5JJTA 3EGGA 1T71A 3QG5C 4ZX2A 2HYOA 5IOHA 3H62B 2WDDA 4MP0A 3V4YA 1U32A 1WARA 1AUIA 1UTEA 5DNYA 3IB8A 3EGHA 4LTYA 3T1IA 5C1VA 1HP1A 1OIEA 2BCDA 4H2FA 3QFKA 4I5NC 5JPEA 4DSYA 1KBPA 2BDXA 1HPUA 4B2OA 1QFCA 4IYPC 5INBA 2KKNA 3DSDA 2BQ8X 2QFPA 4G9JA 4KKZA 4HD0A 4XPNA 3RL4A 2DXLA 4O4KA 1HO5A 4V0VA 4H2IA 3H68A 3P71C 1G5BA 1XZWA 1S95A 4O24A 4Q7FA 5EQVA 4ORAA 2YVTA 3IB7A 1Z2XA 5F3WA 3FGAC 1Z2WA 4JA9A 3IVEA 2R17A 2QJCA 2DXNA 2HYPA 2WDEA 3DSCA 3H61A 4FBQA 3H66A 3GVEA 3PSNA 3RQZA 2P6BA 3TGHA 2DFJA 3QFNA 3IVDA 3K7VC 3H67A 4UWQA 3HVQA 1JK7A 2NYMC 4LACC 4H1YP 1QHWA 4LU9A 2Z72A 1USHA 1MF8A 4UT3A 4WWLA 3E7BA 1W24A 4OR9A 2A22A 4V0WA 3RL5A 3N5UA 4TUGA 2IE3C 4MOVA 2ZOAA 2Z06A 2NXFA 4IL1A 2ZBMA 4UT2A 3LL8A 4O5GA 5GTUA 2IE4C 4M0VA 1TCOA 1V73A 4DT2A 1IT6A 4H1SA 2ZO9B 2AHDA 2O8AA
chains in the Genus database with same CATH topology
2XMOA 3H60A 4DHLA 3D03A 2NYLC 2WDFA 1UF3A 4FCXA 1II7A 3C9FA 1M63A 2YEQA 3H64A 2JOGA 4J6OA 2GJUA 2WDCA 3C5WC 3H69A 3QFOA 1T70A 2USHA 3AUZA 5B8IA 3ZTVA 2Q8UA 3JYFA 1NNWA 2NPPC 2QFRA 3E7AA 1S70A 4H2GA 3QFMA 3ICFA 3CK2A 4NZVA 4I5LC 4V0XA 3KBPA 1S3LA 4H2BA 3RL3A 3THNA 4FBWA 4YKEA 3H63A 5J28A 5JPFA 1FJMA 1WAO1 3AV0A 1S8EA 5HPEA 3FLOA 3PSOA 4ORCA 4ORBA 2O8GA 1S3MA 1XM7A 2HY1A 3DW8C 4JA7A 2IAEC 2Z1AA 1OI8A 2CV9A 4MOYA 3THOB 4FBKA 3E0JA 4F0ZA 4ZVZA 4TUIA 4UT3B 3K7WC 1S3NA 4O43A 3ZU0A 1SU1A 4KBPA 1OIDA 5JJTA 3EGGA 1T71A 3QG5C 4ZX2A 2HYOA 5IOHA 3H62B 2WDDA 4MP0A 3V4YA 1U32A 1WARA 1AUIA 1UTEA 5DNYA 3IB8A 3EGHA 4LTYA 3T1IA 5C1VA 1HP1A 1OIEA 2BCDA 4H2FA 3QFKA 4I5NC 5JPEA 4DSYA 1KBPA 2BDXA 1HPUA 4B2OA 1QFCA 4IYPC 5INBA 2KKNA 3DSDA 2BQ8X 2QFPA 4G9JA 4KKZA 4HD0A 4XPNA 3RL4A 2DXLA 4O4KA 1HO5A 4V0VA 4H2IA 3H68A 3P71C 1G5BA 1XZWA 1S95A 4O24A 4Q7FA 5EQVA 4ORAA 2YVTA 3IB7A 1Z2XA 5F3WA 3FGAC 1Z2WA 4JA9A 3IVEA 2R17A 2QJCA 2DXNA 2HYPA 2WDEA 3DSCA 3H61A 4FBQA 3H66A 3GVEA 3PSNA 3RQZA 2P6BA 3TGHA 2DFJA 3QFNA 3IVDA 3K7VC 3H67A 4UWQA 3HVQA 1JK7A 2NYMC 4LACC 4H1YP 1QHWA 4LU9A 2Z72A 1USHA 1MF8A 4UT3A 4WWLA 3E7BA 1W24A 4OR9A 2A22A 4V0WA 3RL5A 3N5UA 4TUGA 2IE3C 4MOVA 2ZOAA 2Z06A 2NXFA 4IL1A 2ZBMA 4UT2A 3LL8A 4O5GA 5GTUA 2IE4C 4M0VA 1TCOA 1V73A 4DT2A 1IT6A 4H1SA 2ZO9B 2AHDA 2O8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMO A;  3H60 A;  4DHL A;  2NYL C;  2WDF A;  1UF3 A;  4FCX A;  1II7 A;  3C9F A;  1M63 A;  3H64 A;  2JOG A;  4J6O A;  2GJU A;  2WDC A;  3C5W C;  3H69 A;  3QFO A;  1T70 A;  2USH A;  3AUZ A;  5B8I A;  3ZTV A;  2Q8U A;  3JYF A;  1NNW A;  2NPP C;  2QFR A;  3E7A A;  1S70 A;  4H2G A;  3QFM A;  3ICF A;  3CK2 A;  4NZV A;  4I5L C;  4V0X A;  3KBP A;  1S3L A;  4H2B A;  3RL3 A;  3THN A;  4FBW A;  4YKE A;  3H63 A;  5J28 A;  5JPF A;  1FJM A;  1WAO 1;  3AV0 A;  1S8E A;  5HPE A;  3PSO A;  4ORC A;  4ORB A;  2O8G A;  1S3M A;  1XM7 A;  2HY1 A;  3DW8 C;  4JA7 A;  2IAE C;  2Z1A A;  1OI8 A;  2CV9 A;  4MOY A;  3THO B;  4FBK A;  4F0Z A;  4ZVZ A;  4TUI A;  4UT3 B;  3K7W C;  1S3N A;  4O43 A;  3ZU0 A;  1SU1 A;  4KBP A;  1OID A;  5JJT A;  3EGG A;  1T71 A;  3QG5 C;  4ZX2 A;  2HYO A;  5IOH A;  3H62 B;  2WDD A;  4MP0 A;  3V4Y A;  1U32 A;  1WAR A;  1AUI A;  1UTE A;  5DNY A;  3IB8 A;  3EGH A;  4LTY A;  3T1I A;  5C1V A;  1HP1 A;  1OIE A;  2BCD A;  4H2F A;  3QFK A;  4I5N C;  5JPE A;  4DSY A;  1KBP A;  2BDX A;  1HPU A;  4B2O A;  1QFC A;  4IYP C;  5INB A;  2KKN A;  3DSD A;  2BQ8 X;  2QFP A;  4G9J A;  4KKZ A;  4HD0 A;  4XPN A;  3RL4 A;  4O4K A;  1HO5 A;  4V0V A;  4H2I A;  3H68 A;  3P71 C;  1G5B A;  1XZW A;  1S95 A;  4O24 A;  4Q7F A;  5EQV A;  4ORA A;  2YVT A;  3IB7 A;  1Z2X A;  5F3W A;  3FGA C;  1Z2W A;  4JA9 A;  3IVE A;  2R17 A;  2QJC A;  3DSC A;  2HYP A;  2WDE A;  3H61 A;  4FBQ A;  3H66 A;  3GVE A;  3PSN A;  3RQZ A;  2P6B A;  3TGH A;  2DFJ A;  3QFN A;  3IVD A;  3K7V C;  3H67 A;  4UWQ A;  3HVQ A;  1JK7 A;  2NYM C;  4LAC C;  4H1Y P;  1QHW A;  4LU9 A;  2Z72 A;  1USH A;  1MF8 A;  4UT3 A;  4WWL A;  3E7B A;  1W24 A;  4OR9 A;  2A22 A;  4V0W A;  3RL5 A;  3N5U A;  4TUG A;  2IE3 C;  4MOV A;  2Z06 A;  2NXF A;  4IL1 A;  2ZBM A;  4UT2 A;  3LL8 A;  4O5G A;  5GTU A;  2IE4 C;  4M0V A;  1TCO A;  1V73 A;  4DT2 A;  1IT6 A;  4H1S A;  2AHD A;  2O8A A; 
#chains in the Genus database with same CATH topology
 2XMO A;  3H60 A;  4DHL A;  3D03 A;  2NYL C;  2WDF A;  1UF3 A;  4FCX A;  1II7 A;  3C9F A;  1M63 A;  2YEQ A;  3H64 A;  2JOG A;  4J6O A;  2GJU A;  2WDC A;  3C5W C;  3H69 A;  3QFO A;  1T70 A;  2USH A;  3AUZ A;  5B8I A;  3ZTV A;  2Q8U A;  3JYF A;  1NNW A;  2NPP C;  2QFR A;  3E7A A;  1S70 A;  4H2G A;  3QFM A;  3ICF A;  3CK2 A;  4NZV A;  4I5L C;  4V0X A;  3KBP A;  1S3L A;  4H2B A;  3RL3 A;  3THN A;  4FBW A;  4YKE A;  3H63 A;  5J28 A;  5JPF A;  1FJM A;  1WAO 1;  3AV0 A;  1S8E A;  5HPE A;  3FLO A;  3PSO A;  4ORC A;  4ORB A;  2O8G A;  1S3M A;  1XM7 A;  2HY1 A;  3DW8 C;  4JA7 A;  2IAE C;  2Z1A A;  1OI8 A;  2CV9 A;  4MOY A;  3THO B;  4FBK A;  3E0J A;  4F0Z A;  4ZVZ A;  4TUI A;  4UT3 B;  3K7W C;  1S3N A;  4O43 A;  3ZU0 A;  1SU1 A;  4KBP A;  1OID A;  5JJT A;  3EGG A;  1T71 A;  3QG5 C;  4ZX2 A;  2HYO A;  5IOH A;  3H62 B;  2WDD A;  4MP0 A;  3V4Y A;  1U32 A;  1WAR A;  1AUI A;  1UTE A;  5DNY A;  3IB8 A;  3EGH A;  4LTY A;  3T1I A;  5C1V A;  1HP1 A;  1OIE A;  2BCD A;  4H2F A;  3QFK A;  4I5N C;  5JPE A;  4DSY A;  1KBP A;  2BDX A;  1HPU A;  4B2O A;  1QFC A;  4IYP C;  5INB A;  2KKN A;  3DSD A;  2BQ8 X;  2QFP A;  4G9J A;  4KKZ A;  4HD0 A;  4XPN A;  3RL4 A;  2DXL A;  4O4K A;  1HO5 A;  4V0V A;  4H2I A;  3H68 A;  3P71 C;  1G5B A;  1XZW A;  1S95 A;  4O24 A;  4Q7F A;  5EQV A;  4ORA A;  2YVT A;  3IB7 A;  1Z2X A;  5F3W A;  3FGA C;  1Z2W A;  4JA9 A;  3IVE A;  2R17 A;  2QJC A;  2DXN A;  2HYP A;  2WDE A;  3DSC A;  3H61 A;  4FBQ A;  3H66 A;  3GVE A;  3PSN A;  3RQZ A;  2P6B A;  3TGH A;  2DFJ A;  3QFN A;  3IVD A;  3K7V C;  3H67 A;  4UWQ A;  3HVQ A;  1JK7 A;  2NYM C;  4LAC C;  4H1Y P;  1QHW A;  4LU9 A;  2Z72 A;  1USH A;  1MF8 A;  4UT3 A;  4WWL A;  3E7B A;  1W24 A;  4OR9 A;  2A22 A;  4V0W A;  3RL5 A;  3N5U A;  4TUG A;  2IE3 C;  4MOV A;  2ZOA A;  2Z06 A;  2NXF A;  4IL1 A;  2ZBM A;  4UT2 A;  3LL8 A;  4O5G A;  5GTU A;  2IE4 C;  4M0V A;  1TCO A;  1V73 A;  4DT2 A;  1IT6 A;  4H1S A;  2ZO9 B;  2AHD A;  2O8A A; 
#chains in the Genus database with same CATH homology
 2XMO A;  3H60 A;  4DHL A;  3D03 A;  2NYL C;  2WDF A;  1UF3 A;  4FCX A;  1II7 A;  3C9F A;  1M63 A;  2YEQ A;  3H64 A;  2JOG A;  4J6O A;  2GJU A;  2WDC A;  3C5W C;  3H69 A;  3QFO A;  1T70 A;  2USH A;  3AUZ A;  5B8I A;  3ZTV A;  2Q8U A;  3JYF A;  1NNW A;  2NPP C;  2QFR A;  3E7A A;  1S70 A;  4H2G A;  3QFM A;  3ICF A;  3CK2 A;  4NZV A;  4I5L C;  4V0X A;  3KBP A;  1S3L A;  4H2B A;  3RL3 A;  3THN A;  4FBW A;  4YKE A;  3H63 A;  5J28 A;  5JPF A;  1FJM A;  1WAO 1;  3AV0 A;  1S8E A;  5HPE A;  3FLO A;  3PSO A;  4ORC A;  4ORB A;  2O8G A;  1S3M A;  1XM7 A;  2HY1 A;  3DW8 C;  4JA7 A;  2IAE C;  2Z1A A;  1OI8 A;  2CV9 A;  4MOY A;  3THO B;  4FBK A;  3E0J A;  4F0Z A;  4ZVZ A;  4TUI A;  4UT3 B;  3K7W C;  1S3N A;  4O43 A;  3ZU0 A;  1SU1 A;  4KBP A;  1OID A;  5JJT A;  3EGG A;  1T71 A;  3QG5 C;  4ZX2 A;  2HYO A;  5IOH A;  3H62 B;  2WDD A;  4MP0 A;  3V4Y A;  1U32 A;  1WAR A;  1AUI A;  1UTE A;  5DNY A;  3IB8 A;  3EGH A;  4LTY A;  3T1I A;  5C1V A;  1HP1 A;  1OIE A;  2BCD A;  4H2F A;  3QFK A;  4I5N C;  5JPE A;  4DSY A;  1KBP A;  2BDX A;  1HPU A;  4B2O A;  1QFC A;  4IYP C;  5INB A;  2KKN A;  3DSD A;  2BQ8 X;  2QFP A;  4G9J A;  4KKZ A;  4HD0 A;  4XPN A;  3RL4 A;  2DXL A;  4O4K A;  1HO5 A;  4V0V A;  4H2I A;  3H68 A;  3P71 C;  1G5B A;  1XZW A;  1S95 A;  4O24 A;  4Q7F A;  5EQV A;  4ORA A;  2YVT A;  3IB7 A;  1Z2X A;  5F3W A;  3FGA C;  1Z2W A;  4JA9 A;  3IVE A;  2R17 A;  2QJC A;  2DXN A;  2HYP A;  2WDE A;  3DSC A;  3H61 A;  4FBQ A;  3H66 A;  3GVE A;  3PSN A;  3RQZ A;  2P6B A;  3TGH A;  2DFJ A;  3QFN A;  3IVD A;  3K7V C;  3H67 A;  4UWQ A;  3HVQ A;  1JK7 A;  2NYM C;  4LAC C;  4H1Y P;  1QHW A;  4LU9 A;  2Z72 A;  1USH A;  1MF8 A;  4UT3 A;  4WWL A;  3E7B A;  1W24 A;  4OR9 A;  2A22 A;  4V0W A;  3RL5 A;  3N5U A;  4TUG A;  2IE3 C;  4MOV A;  2ZOA A;  2Z06 A;  2NXF A;  4IL1 A;  2ZBM A;  4UT2 A;  3LL8 A;  4O5G A;  5GTU A;  2IE4 C;  4M0V A;  1TCO A;  1V73 A;  4DT2 A;  1IT6 A;  4H1S A;  2ZO9 B;  2AHD A;  2O8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...