4UT2A

X-ray structure of the human pp1 gamma catalytic subunit treated with ascorbate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
291
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYGEFDNAGAMMSVDETLMSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
publication title Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 291
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4ut2A00
1MF8A 3CK2A 3EGHA 5JPFA 1T71A 3QFKA 2XMOA 1FJMA 2DFJA 3E7AA 1WARA 4TUGA 2HYPA 1UF3A 3H63A 3RL3A 4H2BA 2NYLC 4J6OA 1QHWA 1G5BA 2Z1AA 5DNYA 3AV0A 1S3LA 4TUIA 3N5UA 3E7BA 4MP0A 3IB7A 1T70A 2GJUA 4H2GA 4FCXA 3TGHA 1WAO1 2BCDA 3C9FA 1XZWA 2ZBMA 5IOHA 4O43A 3AUZA 2KKNA 1USHA 2HY1A 3IVEA 3H69A 4Q7FA 4ORCA 3V4YA 3C5WC 1XM7A 2BDXA 4MOYA 4ORBA 4B2OA 4XPNA 2A22A 5EQVA 3RL5A 3JYFA 2QFPA 3QG5C 4ORAA 3PSNA 4DT2A 2CV9A 1HO5A 3QFNA 1OIDA 4O5GA 2YVTA 4O24A 1KBPA 4DHLA 4FBWA 4LU9A 4F0ZA 3IVDA 4IL1A 3ICFA 2HYOA 2QFRA 4V0WA 2Z72A 4I5LC 4V0XA 4O4KA 3RQZA 2AHDA 2WDEA 3PSOA 1HPUA 2NXFA 3DW8C 3RL4A 4OR9A 1IT6A 1UTEA 2WDCA 2BQ8X 4JA9A 2JOGA 5C1VA 1OIEA 2IE4C 3H62B 1S8EA 4H2IA 1U32A 3LL8A 4V0VA 1NNWA 1SU1A 2Q8UA 3H60A 3H66A 2USHA 4ZVZA 4YKEA 4FBKA 1V73A 3THNA 5INBA 3IB8A 1II7A 5GTUA 1S95A 1JK7A 5JPEA 3THOB 2QJCA 3ZTVA 1HP1A 3K7VC 1M63A 4H1SA 3QFOA 3EGGA 4KBPA 4H2FA 3FGAC 2R17A 2Z06A 2NPPC 2NYMC 3H61A 1S70A 4G9JA 3DSCA 3T1IA 3H64A 2WDDA 1QFCA 4IYPC 4UT2A 4UT3B 3KBPA 1AUIA 4M0VA 3HVQA 4LTYA 4KKZA 1OI8A 4FBQA 1Z2WA 5F3WA 5J28A 2WDFA 1TCOA 4H1YP 4HD0A 3P71C 4I5NC 4JA7A 3GVEA 1Z2XA 1W24A 3H68A 1S3NA 2P6BA 4LACC 3K7WC 4DSYA 5JJTA 4UT3A 3DSDA 2O8GA 4UWQA 2O8AA 4WWLA 4MOVA 4NZVA 4ZX2A 2IE3C 5B8IA 1S3MA 2IAEC 3H67A 3QFMA 3ZU0A 5HPEA
chains in the Genus database with same CATH superfamily
1MF8A 3CK2A 3EGHA 5JPFA 1T71A 3QFKA 2XMOA 1FJMA 2DFJA 3E7AA 1WARA 4TUGA 2HYPA 3E0JA 1UF3A 3H63A 3RL3A 2DXLA 4H2BA 2NYLC 4J6OA 1QHWA 1G5BA 2Z1AA 5DNYA 3AV0A 1S3LA 4TUIA 3N5UA 3E7BA 4MP0A 3IB7A 1T70A 2GJUA 4H2GA 4FCXA 3TGHA 1WAO1 2BCDA 3C9FA 1XZWA 2ZBMA 5IOHA 4O43A 3AUZA 2KKNA 1USHA 2HY1A 2ZOAA 3IVEA 3H69A 4Q7FA 4ORCA 3V4YA 3C5WC 1XM7A 2BDXA 4MOYA 4ORBA 4B2OA 4XPNA 2A22A 5EQVA 3RL5A 3JYFA 2QFPA 3QG5C 4ORAA 3PSNA 4DT2A 2CV9A 1HO5A 3QFNA 1OIDA 4O5GA 2YVTA 4O24A 1KBPA 4DHLA 4FBWA 4LU9A 4F0ZA 3IVDA 4IL1A 3ICFA 2HYOA 2QFRA 2ZO9B 4V0WA 2Z72A 4I5LC 4V0XA 4O4KA 3RQZA 2AHDA 2WDEA 3PSOA 1HPUA 2NXFA 3DW8C 2YEQA 3RL4A 4OR9A 1IT6A 1UTEA 2WDCA 2BQ8X 4JA9A 2JOGA 5C1VA 1OIEA 2IE4C 3H62B 1S8EA 4H2IA 1U32A 3LL8A 4V0VA 1NNWA 1SU1A 2Q8UA 3H60A 3H66A 2USHA 4ZVZA 4YKEA 4FBKA 1V73A 3THNA 5INBA 3IB8A 1II7A 5GTUA 1S95A 1JK7A 5JPEA 3THOB 2QJCA 3ZTVA 1HP1A 3K7VC 1M63A 4H1SA 3QFOA 3EGGA 4KBPA 4H2FA 3FGAC 2R17A 2Z06A 2NPPC 2NYMC 3FLOA 1S70A 2DXNA 3H61A 4G9JA 3T1IA 3DSCA 3H64A 2WDDA 1QFCA 4IYPC 4UT2A 3D03A 4UT3B 3KBPA 1AUIA 4M0VA 3HVQA 4LTYA 4KKZA 1OI8A 4FBQA 1Z2WA 5F3WA 5J28A 2WDFA 1TCOA 4H1YP 4HD0A 3P71C 4I5NC 4JA7A 3GVEA 1Z2XA 1W24A 3H68A 1S3NA 2P6BA 4LACC 3K7WC 4DSYA 5JJTA 4UT3A 3DSDA 2O8GA 4UWQA 2O8AA 4WWLA 4MOVA 4NZVA 4ZX2A 2IE3C 5B8IA 1S3MA 2IAEC 3H67A 3QFMA 3ZU0A 5HPEA
chains in the Genus database with same CATH topology
1MF8A 3CK2A 3EGHA 5JPFA 1T71A 3QFKA 2XMOA 1FJMA 2DFJA 3E7AA 1WARA 4TUGA 2HYPA 3E0JA 1UF3A 3H63A 3RL3A 2DXLA 4H2BA 2NYLC 4J6OA 1QHWA 1G5BA 2Z1AA 5DNYA 3AV0A 1S3LA 4TUIA 3N5UA 3E7BA 4MP0A 3IB7A 1T70A 2GJUA 4H2GA 4FCXA 3TGHA 1WAO1 2BCDA 3C9FA 1XZWA 2ZBMA 5IOHA 4O43A 3AUZA 2KKNA 1USHA 2HY1A 2ZOAA 3IVEA 3H69A 4Q7FA 4ORCA 3V4YA 3C5WC 1XM7A 2BDXA 4MOYA 4ORBA 4B2OA 4XPNA 2A22A 5EQVA 3RL5A 3JYFA 2QFPA 3QG5C 4ORAA 3PSNA 4DT2A 2CV9A 1HO5A 3QFNA 1OIDA 4O5GA 2YVTA 4O24A 1KBPA 4DHLA 4FBWA 4LU9A 4F0ZA 3IVDA 4IL1A 3ICFA 2HYOA 2QFRA 2ZO9B 4V0WA 2Z72A 4I5LC 4V0XA 4O4KA 3RQZA 2AHDA 2WDEA 3PSOA 1HPUA 2NXFA 3DW8C 2YEQA 3RL4A 4OR9A 1IT6A 1UTEA 2WDCA 2BQ8X 4JA9A 2JOGA 5C1VA 1OIEA 2IE4C 3H62B 1S8EA 4H2IA 1U32A 3LL8A 4V0VA 1NNWA 1SU1A 2Q8UA 3H60A 3H66A 2USHA 4ZVZA 4YKEA 4FBKA 1V73A 3THNA 5INBA 3IB8A 1II7A 5GTUA 1S95A 1JK7A 5JPEA 3THOB 2QJCA 3ZTVA 1HP1A 3K7VC 1M63A 4H1SA 3QFOA 3EGGA 4KBPA 4H2FA 3FGAC 2R17A 2Z06A 2NPPC 2NYMC 3FLOA 1S70A 2DXNA 3H61A 4G9JA 3T1IA 3DSCA 3H64A 2WDDA 1QFCA 4IYPC 4UT2A 3D03A 4UT3B 3KBPA 1AUIA 4M0VA 3HVQA 4LTYA 4KKZA 1OI8A 4FBQA 1Z2WA 5F3WA 5J28A 2WDFA 1TCOA 4H1YP 4HD0A 3P71C 4I5NC 4JA7A 3GVEA 1Z2XA 1W24A 3H68A 1S3NA 2P6BA 4LACC 3K7WC 4DSYA 5JJTA 4UT3A 3DSDA 2O8GA 4UWQA 2O8AA 4WWLA 4MOVA 4NZVA 4ZX2A 2IE3C 5B8IA 1S3MA 2IAEC 3H67A 3QFMA 3ZU0A 5HPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MF8 A;  3CK2 A;  3EGH A;  5JPF A;  1T71 A;  3QFK A;  2XMO A;  1FJM A;  2DFJ A;  3E7A A;  1WAR A;  4TUG A;  2HYP A;  1UF3 A;  3H63 A;  3RL3 A;  4H2B A;  2NYL C;  4J6O A;  1QHW A;  1G5B A;  2Z1A A;  5DNY A;  3AV0 A;  1S3L A;  4TUI A;  3N5U A;  3E7B A;  4MP0 A;  3IB7 A;  1T70 A;  2GJU A;  4H2G A;  4FCX A;  3TGH A;  1WAO 1;  2BCD A;  3C9F A;  1XZW A;  2ZBM A;  5IOH A;  4O43 A;  3AUZ A;  2KKN A;  1USH A;  2HY1 A;  3IVE A;  3H69 A;  4Q7F A;  4ORC A;  3V4Y A;  3C5W C;  1XM7 A;  2BDX A;  4MOY A;  4ORB A;  4B2O A;  4XPN A;  2A22 A;  5EQV A;  3RL5 A;  3JYF A;  2QFP A;  3QG5 C;  4ORA A;  3PSN A;  4DT2 A;  2CV9 A;  1HO5 A;  3QFN A;  1OID A;  4O5G A;  2YVT A;  4O24 A;  1KBP A;  4DHL A;  4FBW A;  4LU9 A;  4F0Z A;  3IVD A;  4IL1 A;  3ICF A;  2HYO A;  2QFR A;  4V0W A;  2Z72 A;  4I5L C;  4V0X A;  4O4K A;  3RQZ A;  2AHD A;  2WDE A;  3PSO A;  1HPU A;  2NXF A;  3DW8 C;  3RL4 A;  4OR9 A;  1IT6 A;  1UTE A;  2WDC A;  2BQ8 X;  4JA9 A;  2JOG A;  5C1V A;  1OIE A;  2IE4 C;  3H62 B;  1S8E A;  4H2I A;  1U32 A;  3LL8 A;  4V0V A;  1NNW A;  1SU1 A;  2Q8U A;  3H60 A;  3H66 A;  2USH A;  4ZVZ A;  4YKE A;  4FBK A;  1V73 A;  3THN A;  5INB A;  3IB8 A;  1II7 A;  5GTU A;  1S95 A;  1JK7 A;  5JPE A;  3THO B;  2QJC A;  3ZTV A;  1HP1 A;  3K7V C;  1M63 A;  4H1S A;  3QFO A;  3EGG A;  4KBP A;  4H2F A;  3FGA C;  2R17 A;  2Z06 A;  2NPP C;  2NYM C;  3H61 A;  1S70 A;  4G9J A;  3DSC A;  3T1I A;  3H64 A;  2WDD A;  1QFC A;  4IYP C;  4UT2 A;  4UT3 B;  3KBP A;  1AUI A;  4M0V A;  3HVQ A;  4LTY A;  4KKZ A;  1OI8 A;  4FBQ A;  1Z2W A;  5F3W A;  5J28 A;  2WDF A;  1TCO A;  4H1Y P;  4HD0 A;  3P71 C;  4I5N C;  4JA7 A;  3GVE A;  1Z2X A;  1W24 A;  3H68 A;  1S3N A;  2P6B A;  4LAC C;  3K7W C;  4DSY A;  5JJT A;  4UT3 A;  3DSD A;  2O8G A;  4UWQ A;  2O8A A;  4WWL A;  4MOV A;  4NZV A;  4ZX2 A;  2IE3 C;  5B8I A;  1S3M A;  2IAE C;  3H67 A;  3QFM A;  3ZU0 A;  5HPE A; 
#chains in the Genus database with same CATH topology
 1MF8 A;  3CK2 A;  3EGH A;  5JPF A;  1T71 A;  3QFK A;  2XMO A;  1FJM A;  2DFJ A;  3E7A A;  1WAR A;  4TUG A;  2HYP A;  3E0J A;  1UF3 A;  3H63 A;  3RL3 A;  2DXL A;  4H2B A;  2NYL C;  4J6O A;  1QHW A;  1G5B A;  2Z1A A;  5DNY A;  3AV0 A;  1S3L A;  4TUI A;  3N5U A;  3E7B A;  4MP0 A;  3IB7 A;  1T70 A;  2GJU A;  4H2G A;  4FCX A;  3TGH A;  1WAO 1;  2BCD A;  3C9F A;  1XZW A;  2ZBM A;  5IOH A;  4O43 A;  3AUZ A;  2KKN A;  1USH A;  2HY1 A;  2ZOA A;  3IVE A;  3H69 A;  4Q7F A;  4ORC A;  3V4Y A;  3C5W C;  1XM7 A;  2BDX A;  4MOY A;  4ORB A;  4B2O A;  4XPN A;  2A22 A;  5EQV A;  3RL5 A;  3JYF A;  2QFP A;  3QG5 C;  4ORA A;  3PSN A;  4DT2 A;  2CV9 A;  1HO5 A;  3QFN A;  1OID A;  4O5G A;  2YVT A;  4O24 A;  1KBP A;  4DHL A;  4FBW A;  4LU9 A;  4F0Z A;  3IVD A;  4IL1 A;  3ICF A;  2HYO A;  2QFR A;  2ZO9 B;  4V0W A;  2Z72 A;  4I5L C;  4V0X A;  4O4K A;  3RQZ A;  2AHD A;  2WDE A;  3PSO A;  1HPU A;  2NXF A;  3DW8 C;  2YEQ A;  3RL4 A;  4OR9 A;  1IT6 A;  1UTE A;  2WDC A;  2BQ8 X;  4JA9 A;  2JOG A;  5C1V A;  1OIE A;  2IE4 C;  3H62 B;  1S8E A;  4H2I A;  1U32 A;  3LL8 A;  4V0V A;  1NNW A;  1SU1 A;  2Q8U A;  3H60 A;  3H66 A;  2USH A;  4ZVZ A;  4YKE A;  4FBK A;  1V73 A;  3THN A;  5INB A;  3IB8 A;  1II7 A;  5GTU A;  1S95 A;  1JK7 A;  5JPE A;  3THO B;  2QJC A;  3ZTV A;  1HP1 A;  3K7V C;  1M63 A;  4H1S A;  3QFO A;  3EGG A;  4KBP A;  4H2F A;  3FGA C;  2R17 A;  2Z06 A;  2NPP C;  2NYM C;  3FLO A;  1S70 A;  2DXN A;  3H61 A;  4G9J A;  3T1I A;  3DSC A;  3H64 A;  2WDD A;  1QFC A;  4IYP C;  4UT2 A;  3D03 A;  4UT3 B;  3KBP A;  1AUI A;  4M0V A;  3HVQ A;  4LTY A;  4KKZ A;  1OI8 A;  4FBQ A;  1Z2W A;  5F3W A;  5J28 A;  2WDF A;  1TCO A;  4H1Y P;  4HD0 A;  3P71 C;  4I5N C;  4JA7 A;  3GVE A;  1Z2X A;  1W24 A;  3H68 A;  1S3N A;  2P6B A;  4LAC C;  3K7W C;  4DSY A;  5JJT A;  4UT3 A;  3DSD A;  2O8G A;  4UWQ A;  2O8A A;  4WWL A;  4MOV A;  4NZV A;  4ZX2 A;  2IE3 C;  5B8I A;  1S3M A;  2IAE C;  3H67 A;  3QFM A;  3ZU0 A;  5HPE A; 
#chains in the Genus database with same CATH homology
 1MF8 A;  3CK2 A;  3EGH A;  5JPF A;  1T71 A;  3QFK A;  2XMO A;  1FJM A;  2DFJ A;  3E7A A;  1WAR A;  4TUG A;  2HYP A;  3E0J A;  1UF3 A;  3H63 A;  3RL3 A;  2DXL A;  4H2B A;  2NYL C;  4J6O A;  1QHW A;  1G5B A;  2Z1A A;  5DNY A;  3AV0 A;  1S3L A;  4TUI A;  3N5U A;  3E7B A;  4MP0 A;  3IB7 A;  1T70 A;  2GJU A;  4H2G A;  4FCX A;  3TGH A;  1WAO 1;  2BCD A;  3C9F A;  1XZW A;  2ZBM A;  5IOH A;  4O43 A;  3AUZ A;  2KKN A;  1USH A;  2HY1 A;  2ZOA A;  3IVE A;  3H69 A;  4Q7F A;  4ORC A;  3V4Y A;  3C5W C;  1XM7 A;  2BDX A;  4MOY A;  4ORB A;  4B2O A;  4XPN A;  2A22 A;  5EQV A;  3RL5 A;  3JYF A;  2QFP A;  3QG5 C;  4ORA A;  3PSN A;  4DT2 A;  2CV9 A;  1HO5 A;  3QFN A;  1OID A;  4O5G A;  2YVT A;  4O24 A;  1KBP A;  4DHL A;  4FBW A;  4LU9 A;  4F0Z A;  3IVD A;  4IL1 A;  3ICF A;  2HYO A;  2QFR A;  2ZO9 B;  4V0W A;  2Z72 A;  4I5L C;  4V0X A;  4O4K A;  3RQZ A;  2AHD A;  2WDE A;  3PSO A;  1HPU A;  2NXF A;  3DW8 C;  2YEQ A;  3RL4 A;  4OR9 A;  1IT6 A;  1UTE A;  2WDC A;  2BQ8 X;  4JA9 A;  2JOG A;  5C1V A;  1OIE A;  2IE4 C;  3H62 B;  1S8E A;  4H2I A;  1U32 A;  3LL8 A;  4V0V A;  1NNW A;  1SU1 A;  2Q8U A;  3H60 A;  3H66 A;  2USH A;  4ZVZ A;  4YKE A;  4FBK A;  1V73 A;  3THN A;  5INB A;  3IB8 A;  1II7 A;  5GTU A;  1S95 A;  1JK7 A;  5JPE A;  3THO B;  2QJC A;  3ZTV A;  1HP1 A;  3K7V C;  1M63 A;  4H1S A;  3QFO A;  3EGG A;  4KBP A;  4H2F A;  3FGA C;  2R17 A;  2Z06 A;  2NPP C;  2NYM C;  3FLO A;  1S70 A;  2DXN A;  3H61 A;  4G9J A;  3T1I A;  3DSC A;  3H64 A;  2WDD A;  1QFC A;  4IYP C;  4UT2 A;  3D03 A;  4UT3 B;  3KBP A;  1AUI A;  4M0V A;  3HVQ A;  4LTY A;  4KKZ A;  1OI8 A;  4FBQ A;  1Z2W A;  5F3W A;  5J28 A;  2WDF A;  1TCO A;  4H1Y P;  4HD0 A;  3P71 C;  4I5N C;  4JA7 A;  3GVE A;  1Z2X A;  1W24 A;  3H68 A;  1S3N A;  2P6B A;  4LAC C;  3K7W C;  4DSY A;  5JJT A;  4UT3 A;  3DSD A;  2O8G A;  4UWQ A;  2O8A A;  4WWL A;  4MOV A;  4NZV A;  4ZX2 A;  2IE3 C;  5B8I A;  1S3M A;  2IAE C;  3H67 A;  3QFM A;  3ZU0 A;  5HPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...