4UT2A

X-ray structure of the human pp1 gamma catalytic subunit treated with ascorbate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
291
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYGEFDNAGAMMSVDETLMSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
publication title Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 107
structure length 291
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4ut2A00
2NYMC 4LTYA 4DT2A 1HO5A 2USHA 4FBWA 2HYOA 1OIDA 5F3WA 2IAEC 4I5LC 3DSCA 1IT6A 3RQZA 1WARA 3H64A 4O43A 2AHDA 3FGAC 3K7VC 2WDCA 1SU1A 3IB7A 1HP1A 2ZBMA 3QFNA 4H1YP 1JK7A 2QFPA 2QJCA 2A22A 4TUGA 4LACC 3P71C 4M0VA 4G9JA 2WDEA 2IE3C 4O5GA 3EGGA 5J28A 2Z72A 3EGHA 4O4KA 3LL8A 4DSYA 5B8IA 3DW8C 4H2BA 4YKEA 1T70A 3PSNA 4ZX2A 3C9FA 1NNWA 1W24A 3AUZA 1Z2WA 1UTEA 1T71A 2O8GA 2JOGA 3H68A 4H2FA 3RL5A 4UT3A 1HPUA 2Q8UA 2P6BA 1S8EA 2GJUA 3C5WC 2NPPC 3H67A 3QG5C 1QHWA 1S3MA 1OIEA 2KKNA 4FBKA 4H1SA 1S95A 1TCOA 2BDXA 1MF8A 4FBQA 4IYPC 3RL3A 3IVDA 2BCDA 3H60A 4H2IA 2Z1AA 3QFMA 3IVEA 2IE4C 2Z06A 3CK2A 3K7WC 5EQVA 2NYLC 3GVEA 4B2OA 4JA7A 2WDFA 4MOYA 2NXFA 3H62B 4ORBA 4HD0A 1KBPA 1G5BA 1S3LA 5IOHA 3ICFA 5JPFA 2HY1A 5C1VA 4DHLA 1XZWA 3TGHA 1QFCA 2HYPA 4ZVZA 4LU9A 1S3NA 2BQ8X 5INBA 1U32A 5DNYA 5GTUA 4JA9A 4V0VA 4O24A 2YVTA 3H63A 4KKZA 3PSOA 3JYFA 1II7A 1AUIA 2QFRA 3HVQA 3QFKA 1M63A 5JJTA 1Z2XA 4FCXA 3AV0A 3QFOA 4IL1A 2WDDA 4KBPA 1USHA 3V4YA 4NZVA 3IB8A 2DFJA 3H61A 4UT3B 3N5UA 3H69A 4H2GA 3ZTVA 4MOVA 4MP0A 4Q7FA 4V0XA 3DSDA 3H66A 4ORCA 2R17A 4WWLA 2O8AA 1UF3A 4ORAA 3RL4A 5HPEA 4UT2A 3ZU0A 1WAO1 1XM7A 3T1IA 4UWQA 2CV9A 2XMOA 5JPEA 4J6OA 4OR9A 1S70A 1V73A 1FJMA 3THNA 4TUIA 3KBPA 4V0WA 3E7AA 3E7BA 4I5NC 4XPNA 3THOB 1OI8A 4F0ZA
chains in the Genus database with same CATH superfamily
2NYMC 4LTYA 4DT2A 1HO5A 2USHA 4FBWA 2HYOA 3FLOA 1OIDA 5F3WA 2IAEC 4I5LC 3DSCA 1IT6A 3RQZA 1WARA 3H64A 4O43A 2AHDA 3FGAC 3K7VC 2WDCA 1SU1A 3IB7A 1HP1A 2ZBMA 3QFNA 4H1YP 1JK7A 2QFPA 2QJCA 2A22A 4TUGA 4LACC 3P71C 4M0VA 4G9JA 2WDEA 2IE3C 4O5GA 3EGGA 5J28A 2Z72A 3EGHA 4O4KA 3LL8A 4DSYA 5B8IA 3DW8C 4H2BA 4YKEA 1T70A 3PSNA 4ZX2A 3C9FA 1NNWA 1W24A 3AUZA 1Z2WA 1UTEA 1T71A 2O8GA 2JOGA 3H68A 4H2FA 3RL5A 4UT3A 1HPUA 2Q8UA 2P6BA 1S8EA 2DXLA 2GJUA 3C5WC 2NPPC 3H67A 3QG5C 1QHWA 1S3MA 1OIEA 3E0JA 2KKNA 4FBKA 4H1SA 1S95A 1TCOA 2BDXA 1MF8A 4FBQA 4IYPC 3RL3A 3IVDA 2BCDA 3H60A 4H2IA 2Z1AA 3QFMA 2ZO9B 3IVEA 2IE4C 2Z06A 2DXNA 3CK2A 3K7WC 2NYLC 3GVEA 5EQVA 4B2OA 4JA7A 2WDFA 3D03A 4MOYA 2NXFA 3H62B 4ORBA 4HD0A 1KBPA 1G5BA 1S3LA 5IOHA 3ICFA 5JPFA 2HY1A 5C1VA 4DHLA 1XZWA 3TGHA 1QFCA 2HYPA 4ZVZA 4LU9A 1S3NA 2BQ8X 5INBA 1U32A 5DNYA 5GTUA 4JA9A 4V0VA 4O24A 2YVTA 3H63A 4KKZA 3PSOA 3JYFA 1II7A 1AUIA 2QFRA 3HVQA 3QFKA 1M63A 2YEQA 5JJTA 1Z2XA 4FCXA 3AV0A 3QFOA 4IL1A 2WDDA 4KBPA 1USHA 3V4YA 4NZVA 3IB8A 2DFJA 3H61A 4UT3B 3N5UA 3H69A 4H2GA 3ZTVA 4MOVA 4MP0A 4Q7FA 4V0XA 3DSDA 3H66A 4ORCA 2R17A 2ZOAA 4WWLA 2O8AA 1UF3A 4ORAA 3RL4A 5HPEA 4UT2A 3ZU0A 1WAO1 1XM7A 3T1IA 4UWQA 2CV9A 2XMOA 5JPEA 4J6OA 4OR9A 1S70A 1V73A 1FJMA 3THNA 4TUIA 3KBPA 4V0WA 3E7AA 3E7BA 4I5NC 4XPNA 3THOB 1OI8A 4F0ZA
chains in the Genus database with same CATH topology
2NYMC 4LTYA 4DT2A 1HO5A 2USHA 4FBWA 2HYOA 3FLOA 1OIDA 5F3WA 2IAEC 4I5LC 3DSCA 1IT6A 3RQZA 1WARA 3H64A 4O43A 2AHDA 3FGAC 3K7VC 2WDCA 1SU1A 3IB7A 1HP1A 2ZBMA 3QFNA 4H1YP 1JK7A 2QFPA 2QJCA 2A22A 4TUGA 4LACC 3P71C 4M0VA 4G9JA 2WDEA 2IE3C 4O5GA 3EGGA 5J28A 2Z72A 3EGHA 4O4KA 3LL8A 4DSYA 5B8IA 3DW8C 4H2BA 4YKEA 1T70A 3PSNA 4ZX2A 3C9FA 1NNWA 1W24A 3AUZA 1Z2WA 1UTEA 1T71A 2O8GA 2JOGA 3H68A 4H2FA 3RL5A 4UT3A 1HPUA 2Q8UA 2P6BA 1S8EA 2DXLA 2GJUA 3C5WC 2NPPC 3H67A 3QG5C 1QHWA 1S3MA 1OIEA 3E0JA 2KKNA 4FBKA 4H1SA 1S95A 1TCOA 2BDXA 1MF8A 4FBQA 4IYPC 3RL3A 3IVDA 2BCDA 3H60A 4H2IA 2Z1AA 3QFMA 2ZO9B 3IVEA 2IE4C 2Z06A 2DXNA 3CK2A 3K7WC 2NYLC 3GVEA 5EQVA 4B2OA 4JA7A 2WDFA 3D03A 4MOYA 2NXFA 3H62B 4ORBA 4HD0A 1KBPA 1G5BA 1S3LA 5IOHA 3ICFA 5JPFA 2HY1A 5C1VA 4DHLA 1XZWA 3TGHA 1QFCA 2HYPA 4ZVZA 4LU9A 1S3NA 2BQ8X 5INBA 1U32A 5DNYA 5GTUA 4JA9A 4V0VA 4O24A 2YVTA 3H63A 4KKZA 3PSOA 3JYFA 1II7A 1AUIA 2QFRA 3HVQA 3QFKA 1M63A 2YEQA 5JJTA 1Z2XA 4FCXA 3AV0A 3QFOA 4IL1A 2WDDA 4KBPA 1USHA 3V4YA 4NZVA 3IB8A 2DFJA 3H61A 4UT3B 3N5UA 3H69A 4H2GA 3ZTVA 4MOVA 4MP0A 4Q7FA 4V0XA 3DSDA 3H66A 4ORCA 2R17A 2ZOAA 4WWLA 2O8AA 1UF3A 4ORAA 3RL4A 5HPEA 4UT2A 3ZU0A 1WAO1 1XM7A 3T1IA 4UWQA 2CV9A 2XMOA 5JPEA 4J6OA 4OR9A 1S70A 1V73A 1FJMA 3THNA 4TUIA 3KBPA 4V0WA 3E7AA 3E7BA 4I5NC 4XPNA 3THOB 1OI8A 4F0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYM C;  4LTY A;  4DT2 A;  1HO5 A;  2USH A;  4FBW A;  2HYO A;  1OID A;  5F3W A;  2IAE C;  4I5L C;  3DSC A;  1IT6 A;  3RQZ A;  1WAR A;  3H64 A;  4O43 A;  2AHD A;  3FGA C;  3K7V C;  2WDC A;  1SU1 A;  3IB7 A;  1HP1 A;  2ZBM A;  3QFN A;  4H1Y P;  1JK7 A;  2QFP A;  2QJC A;  2A22 A;  4TUG A;  4LAC C;  3P71 C;  4M0V A;  4G9J A;  2WDE A;  2IE3 C;  4O5G A;  3EGG A;  5J28 A;  2Z72 A;  3EGH A;  4O4K A;  3LL8 A;  4DSY A;  5B8I A;  3DW8 C;  4H2B A;  4YKE A;  1T70 A;  3PSN A;  4ZX2 A;  3C9F A;  1NNW A;  1W24 A;  3AUZ A;  1Z2W A;  1UTE A;  1T71 A;  2O8G A;  2JOG A;  3H68 A;  4H2F A;  3RL5 A;  4UT3 A;  1HPU A;  2Q8U A;  2P6B A;  1S8E A;  2GJU A;  3C5W C;  2NPP C;  3H67 A;  3QG5 C;  1QHW A;  1S3M A;  1OIE A;  2KKN A;  4FBK A;  4H1S A;  1S95 A;  1TCO A;  2BDX A;  1MF8 A;  4FBQ A;  4IYP C;  3RL3 A;  3IVD A;  2BCD A;  3H60 A;  4H2I A;  2Z1A A;  3QFM A;  3IVE A;  2IE4 C;  2Z06 A;  3CK2 A;  3K7W C;  5EQV A;  2NYL C;  3GVE A;  4B2O A;  4JA7 A;  2WDF A;  4MOY A;  2NXF A;  3H62 B;  4ORB A;  4HD0 A;  1KBP A;  1G5B A;  1S3L A;  5IOH A;  3ICF A;  5JPF A;  2HY1 A;  5C1V A;  4DHL A;  1XZW A;  3TGH A;  1QFC A;  2HYP A;  4ZVZ A;  4LU9 A;  1S3N A;  2BQ8 X;  5INB A;  1U32 A;  5DNY A;  5GTU A;  4JA9 A;  4V0V A;  4O24 A;  2YVT A;  3H63 A;  4KKZ A;  3PSO A;  3JYF A;  1II7 A;  1AUI A;  2QFR A;  3HVQ A;  3QFK A;  1M63 A;  5JJT A;  1Z2X A;  4FCX A;  3AV0 A;  3QFO A;  4IL1 A;  2WDD A;  4KBP A;  1USH A;  3V4Y A;  4NZV A;  3IB8 A;  2DFJ A;  3H61 A;  4UT3 B;  3N5U A;  3H69 A;  4H2G A;  3ZTV A;  4MOV A;  4MP0 A;  4Q7F A;  4V0X A;  3DSD A;  3H66 A;  4ORC A;  2R17 A;  4WWL A;  2O8A A;  1UF3 A;  4ORA A;  3RL4 A;  5HPE A;  4UT2 A;  3ZU0 A;  1WAO 1;  1XM7 A;  3T1I A;  4UWQ A;  2CV9 A;  2XMO A;  5JPE A;  4J6O A;  4OR9 A;  1S70 A;  1V73 A;  1FJM A;  3THN A;  4TUI A;  3KBP A;  4V0W A;  3E7A A;  3E7B A;  4I5N C;  4XPN A;  3THO B;  1OI8 A;  4F0Z A; 
#chains in the Genus database with same CATH topology
 2NYM C;  4LTY A;  4DT2 A;  1HO5 A;  2USH A;  4FBW A;  2HYO A;  3FLO A;  1OID A;  5F3W A;  2IAE C;  4I5L C;  3DSC A;  1IT6 A;  3RQZ A;  1WAR A;  3H64 A;  4O43 A;  2AHD A;  3FGA C;  3K7V C;  2WDC A;  1SU1 A;  3IB7 A;  1HP1 A;  2ZBM A;  3QFN A;  4H1Y P;  1JK7 A;  2QFP A;  2QJC A;  2A22 A;  4TUG A;  4LAC C;  3P71 C;  4M0V A;  4G9J A;  2WDE A;  2IE3 C;  4O5G A;  3EGG A;  5J28 A;  2Z72 A;  3EGH A;  4O4K A;  3LL8 A;  4DSY A;  5B8I A;  3DW8 C;  4H2B A;  4YKE A;  1T70 A;  3PSN A;  4ZX2 A;  3C9F A;  1NNW A;  1W24 A;  3AUZ A;  1Z2W A;  1UTE A;  1T71 A;  2O8G A;  2JOG A;  3H68 A;  4H2F A;  3RL5 A;  4UT3 A;  1HPU A;  2Q8U A;  2P6B A;  1S8E A;  2DXL A;  2GJU A;  3C5W C;  2NPP C;  3H67 A;  3QG5 C;  1QHW A;  1S3M A;  1OIE A;  3E0J A;  2KKN A;  4FBK A;  4H1S A;  1S95 A;  1TCO A;  2BDX A;  1MF8 A;  4FBQ A;  4IYP C;  3RL3 A;  3IVD A;  2BCD A;  3H60 A;  4H2I A;  2Z1A A;  3QFM A;  2ZO9 B;  3IVE A;  2IE4 C;  2Z06 A;  2DXN A;  3CK2 A;  3K7W C;  2NYL C;  3GVE A;  5EQV A;  4B2O A;  4JA7 A;  2WDF A;  3D03 A;  4MOY A;  2NXF A;  3H62 B;  4ORB A;  4HD0 A;  1KBP A;  1G5B A;  1S3L A;  5IOH A;  3ICF A;  5JPF A;  2HY1 A;  5C1V A;  4DHL A;  1XZW A;  3TGH A;  1QFC A;  2HYP A;  4ZVZ A;  4LU9 A;  1S3N A;  2BQ8 X;  5INB A;  1U32 A;  5DNY A;  5GTU A;  4JA9 A;  4V0V A;  4O24 A;  2YVT A;  3H63 A;  4KKZ A;  3PSO A;  3JYF A;  1II7 A;  1AUI A;  2QFR A;  3HVQ A;  3QFK A;  1M63 A;  2YEQ A;  5JJT A;  1Z2X A;  4FCX A;  3AV0 A;  3QFO A;  4IL1 A;  2WDD A;  4KBP A;  1USH A;  3V4Y A;  4NZV A;  3IB8 A;  2DFJ A;  3H61 A;  4UT3 B;  3N5U A;  3H69 A;  4H2G A;  3ZTV A;  4MOV A;  4MP0 A;  4Q7F A;  4V0X A;  3DSD A;  3H66 A;  4ORC A;  2R17 A;  2ZOA A;  4WWL A;  2O8A A;  1UF3 A;  4ORA A;  3RL4 A;  5HPE A;  4UT2 A;  3ZU0 A;  1WAO 1;  1XM7 A;  3T1I A;  4UWQ A;  2CV9 A;  2XMO A;  5JPE A;  4J6O A;  4OR9 A;  1S70 A;  1V73 A;  1FJM A;  3THN A;  4TUI A;  3KBP A;  4V0W A;  3E7A A;  3E7B A;  4I5N C;  4XPN A;  3THO B;  1OI8 A;  4F0Z A; 
#chains in the Genus database with same CATH homology
 2NYM C;  4LTY A;  4DT2 A;  1HO5 A;  2USH A;  4FBW A;  2HYO A;  3FLO A;  1OID A;  5F3W A;  2IAE C;  4I5L C;  3DSC A;  1IT6 A;  3RQZ A;  1WAR A;  3H64 A;  4O43 A;  2AHD A;  3FGA C;  3K7V C;  2WDC A;  1SU1 A;  3IB7 A;  1HP1 A;  2ZBM A;  3QFN A;  4H1Y P;  1JK7 A;  2QFP A;  2QJC A;  2A22 A;  4TUG A;  4LAC C;  3P71 C;  4M0V A;  4G9J A;  2WDE A;  2IE3 C;  4O5G A;  3EGG A;  5J28 A;  2Z72 A;  3EGH A;  4O4K A;  3LL8 A;  4DSY A;  5B8I A;  3DW8 C;  4H2B A;  4YKE A;  1T70 A;  3PSN A;  4ZX2 A;  3C9F A;  1NNW A;  1W24 A;  3AUZ A;  1Z2W A;  1UTE A;  1T71 A;  2O8G A;  2JOG A;  3H68 A;  4H2F A;  3RL5 A;  4UT3 A;  1HPU A;  2Q8U A;  2P6B A;  1S8E A;  2DXL A;  2GJU A;  3C5W C;  2NPP C;  3H67 A;  3QG5 C;  1QHW A;  1S3M A;  1OIE A;  3E0J A;  2KKN A;  4FBK A;  4H1S A;  1S95 A;  1TCO A;  2BDX A;  1MF8 A;  4FBQ A;  4IYP C;  3RL3 A;  3IVD A;  2BCD A;  3H60 A;  4H2I A;  2Z1A A;  3QFM A;  2ZO9 B;  3IVE A;  2IE4 C;  2Z06 A;  2DXN A;  3CK2 A;  3K7W C;  2NYL C;  3GVE A;  5EQV A;  4B2O A;  4JA7 A;  2WDF A;  3D03 A;  4MOY A;  2NXF A;  3H62 B;  4ORB A;  4HD0 A;  1KBP A;  1G5B A;  1S3L A;  5IOH A;  3ICF A;  5JPF A;  2HY1 A;  5C1V A;  4DHL A;  1XZW A;  3TGH A;  1QFC A;  2HYP A;  4ZVZ A;  4LU9 A;  1S3N A;  2BQ8 X;  5INB A;  1U32 A;  5DNY A;  5GTU A;  4JA9 A;  4V0V A;  4O24 A;  2YVT A;  3H63 A;  4KKZ A;  3PSO A;  3JYF A;  1II7 A;  1AUI A;  2QFR A;  3HVQ A;  3QFK A;  1M63 A;  2YEQ A;  5JJT A;  1Z2X A;  4FCX A;  3AV0 A;  3QFO A;  4IL1 A;  2WDD A;  4KBP A;  1USH A;  3V4Y A;  4NZV A;  3IB8 A;  2DFJ A;  3H61 A;  4UT3 B;  3N5U A;  3H69 A;  4H2G A;  3ZTV A;  4MOV A;  4MP0 A;  4Q7F A;  4V0X A;  3DSD A;  3H66 A;  4ORC A;  2R17 A;  2ZOA A;  4WWL A;  2O8A A;  1UF3 A;  4ORA A;  3RL4 A;  5HPE A;  4UT2 A;  3ZU0 A;  1WAO 1;  1XM7 A;  3T1I A;  4UWQ A;  2CV9 A;  2XMO A;  5JPE A;  4J6O A;  4OR9 A;  1S70 A;  1V73 A;  1FJM A;  3THN A;  4TUI A;  3KBP A;  4V0W A;  3E7A A;  3E7B A;  4I5N C;  4XPN A;  3THO B;  1OI8 A;  4F0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...