4UT2A

X-ray structure of the human pp1 gamma catalytic subunit treated with ascorbate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
291
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYGEFDNAGAMMSVDETLMSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
total genus 107
structure length 291
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4ut2A00
1SU1A 2JOGA 3TGHA 3IVEA 3QFMA 4V0WA 4ORCA 2XMOA 3CK2A 3THOB 4M0VA 3E7BA 4B2OA 3JYFA 2NPPC 1S95A 3C5WC 4OR9A 2R17A 2O8AA 4FCXA 3H69A 4NZVA 4UT3A 2NYMC 3E7AA 3IB8A 4UWQA 1S3MA 3AV0A 4O5GA 4TUGA 4H1SA 4O4KA 2Z72A 3QFKA 5HPEA 4H2IA 1WARA 4Q7FA 1XM7A 1W24A 3H64A 4H2BA 3RL5A 4UT3B 2NXFA 4FBKA 1AUIA 4J6OA 1HP1A 2Q8UA 2WDCA 3H63A 1TCOA 3H68A 4V0XA 4KKZA 5JJTA 5EQVA 3H67A 2BDXA 2GJUA 3DW8C 1T70A 2HYPA 1Z2WA 3N5UA 5J28A 1UF3A 2A22A 1HPUA 3IB7A 1M63A 5DNYA 3V4YA 4IYPC 4HD0A 1S3NA 5JPFA 4I5NC 4MOVA 4WWLA 4YKEA 4JA9A 2WDFA 1OIDA 4JA7A 4DHLA 3C9FA 4TUIA 4H2GA 4DSYA 3ZTVA 1U32A 4ZX2A 1QHWA 5JPEA 1JK7A 4XPNA 1KBPA 1II7A 1XZWA 4I5LC 2YVTA 2HY1A 3H61A 2BCDA 3P71C 5IOHA 2IAEC 3H62B 2IE4C 3LL8A 1QFCA 2BQ8X 1WAO1 3FGAC 2P6BA 2IE3C 3QFNA 4H1YP 4FBWA 4O24A 3AUZA 4LTYA 3QFOA 2DFJA 3K7VC 3RL4A 1NNWA 1S3LA 1V73A 4H2FA 2QFRA 1UTEA 2WDEA 2O8GA 4UT2A 4ORAA 2CV9A 1USHA 1OI8A 5C1VA 1S70A 3RL3A 1T71A 2Z06A 3KBPA 3PSOA 3RQZA 3H66A 4MOYA 3ICFA 3ZU0A 5F3WA 4O43A 2NYLC 4G9JA 2WDDA 1Z2XA 3HVQA 2AHDA 1HO5A 3DSDA 4FBQA 2QJCA 4LACC 4IL1A 2QFPA 1IT6A 4MP0A 4V0VA 5INBA 2ZBMA 1G5BA 1MF8A 4LU9A 5GTUA 4F0ZA 3THNA 5B8IA 3DSCA 3EGGA 3QG5C 3T1IA 3PSNA 3IVDA 2HYOA 4KBPA 3EGHA 4ZVZA 1FJMA 4ORBA 2KKNA 3GVEA 1OIEA 2Z1AA 3K7WC 4DT2A 2USHA 3H60A 1S8EA
chains in the Genus database with same CATH superfamily
1SU1A 2JOGA 3TGHA 3IVEA 3QFMA 4V0WA 4ORCA 2XMOA 3CK2A 3THOB 2ZOAA 4M0VA 3E7BA 4B2OA 3JYFA 2NPPC 1S95A 3C5WC 4OR9A 2R17A 2O8AA 4FCXA 3H69A 4NZVA 4UT3A 2NYMC 3E7AA 3IB8A 4UWQA 1S3MA 3AV0A 4O5GA 4TUGA 4H1SA 4O4KA 2Z72A 3QFKA 5HPEA 3FLOA 4H2IA 1WARA 4Q7FA 1XM7A 1W24A 3H64A 4H2BA 3RL5A 4UT3B 2YEQA 2NXFA 4FBKA 1AUIA 4J6OA 1HP1A 2Q8UA 2WDCA 3H63A 1TCOA 3H68A 4V0XA 4KKZA 5JJTA 5EQVA 3E0JA 3H67A 2BDXA 2GJUA 3DW8C 1T70A 2HYPA 1Z2WA 3N5UA 5J28A 1UF3A 2A22A 1HPUA 3IB7A 1M63A 5DNYA 3V4YA 4IYPC 4HD0A 1S3NA 5JPFA 4I5NC 4MOVA 4WWLA 4YKEA 3DSCA 4JA9A 2WDFA 1OIDA 4JA7A 4DHLA 3C9FA 4TUIA 4H2GA 4DSYA 3ZTVA 1U32A 4ZX2A 1QHWA 5JPEA 1JK7A 4XPNA 1KBPA 1II7A 1XZWA 4I5LC 2YVTA 2HY1A 3H61A 2BCDA 3P71C 5IOHA 2IAEC 3H62B 2IE4C 3LL8A 1QFCA 2BQ8X 1WAO1 3FGAC 2P6BA 2IE3C 3QFNA 4H1YP 4FBWA 4O24A 3AUZA 4LTYA 3QFOA 2DFJA 3K7VC 3RL4A 1NNWA 1S3LA 1V73A 4H2FA 2QFRA 1UTEA 2WDEA 2O8GA 4UT2A 4ORAA 2CV9A 1USHA 1OI8A 5C1VA 1S70A 3RL3A 1T71A 2Z06A 3KBPA 3PSOA 3RQZA 3H66A 4MOYA 3ICFA 3ZU0A 5F3WA 4O43A 2NYLC 4G9JA 2WDDA 1Z2XA 3HVQA 2AHDA 1HO5A 2DXLA 2DXNA 3DSDA 4FBQA 2QJCA 4LACC 3D03A 4IL1A 2QFPA 1IT6A 4MP0A 4V0VA 5INBA 2ZBMA 1G5BA 1MF8A 2ZO9B 4LU9A 5GTUA 3THNA 4F0ZA 5B8IA 3EGGA 3QG5C 3T1IA 3PSNA 3IVDA 2HYOA 4KBPA 3EGHA 4ZVZA 1FJMA 4ORBA 2KKNA 3GVEA 1OIEA 2Z1AA 3K7WC 4DT2A 2USHA 3H60A 1S8EA
chains in the Genus database with same CATH topology
1SU1A 2JOGA 3TGHA 3IVEA 3QFMA 4V0WA 4ORCA 2XMOA 3CK2A 3THOB 2ZOAA 4M0VA 3E7BA 4B2OA 3JYFA 2NPPC 1S95A 3C5WC 4OR9A 2R17A 2O8AA 4FCXA 3H69A 4NZVA 4UT3A 2NYMC 3E7AA 3IB8A 4UWQA 1S3MA 3AV0A 4O5GA 4TUGA 4H1SA 4O4KA 2Z72A 3QFKA 5HPEA 3FLOA 4H2IA 1WARA 4Q7FA 1XM7A 1W24A 3H64A 4H2BA 3RL5A 4UT3B 2YEQA 2NXFA 4FBKA 1AUIA 4J6OA 1HP1A 2Q8UA 2WDCA 3H63A 1TCOA 3H68A 4V0XA 4KKZA 5JJTA 5EQVA 3E0JA 3H67A 2BDXA 2GJUA 3DW8C 1T70A 2HYPA 1Z2WA 3N5UA 5J28A 1UF3A 2A22A 1HPUA 3IB7A 1M63A 5DNYA 3V4YA 4IYPC 4HD0A 1S3NA 5JPFA 4I5NC 4MOVA 4WWLA 4YKEA 3DSCA 4JA9A 2WDFA 1OIDA 4JA7A 4DHLA 3C9FA 4TUIA 4H2GA 4DSYA 3ZTVA 1U32A 4ZX2A 1QHWA 5JPEA 1JK7A 4XPNA 1KBPA 1II7A 1XZWA 4I5LC 2YVTA 2HY1A 3H61A 2BCDA 3P71C 5IOHA 2IAEC 3H62B 2IE4C 3LL8A 1QFCA 2BQ8X 1WAO1 3FGAC 2P6BA 2IE3C 3QFNA 4H1YP 4FBWA 4O24A 3AUZA 4LTYA 3QFOA 2DFJA 3K7VC 3RL4A 1NNWA 1S3LA 1V73A 4H2FA 2QFRA 1UTEA 2WDEA 2O8GA 4UT2A 4ORAA 2CV9A 1USHA 1OI8A 5C1VA 1S70A 3RL3A 1T71A 2Z06A 3KBPA 3PSOA 3RQZA 3H66A 4MOYA 3ICFA 3ZU0A 5F3WA 4O43A 2NYLC 4G9JA 2WDDA 1Z2XA 3HVQA 2AHDA 1HO5A 2DXLA 2DXNA 3DSDA 4FBQA 2QJCA 4LACC 3D03A 4IL1A 2QFPA 1IT6A 4MP0A 4V0VA 5INBA 2ZBMA 1G5BA 1MF8A 2ZO9B 4LU9A 5GTUA 3THNA 4F0ZA 5B8IA 3EGGA 3QG5C 3T1IA 3PSNA 3IVDA 2HYOA 4KBPA 3EGHA 4ZVZA 1FJMA 4ORBA 2KKNA 3GVEA 1OIEA 2Z1AA 3K7WC 4DT2A 2USHA 3H60A 1S8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SU1 A;  2JOG A;  3TGH A;  3IVE A;  3QFM A;  4V0W A;  4ORC A;  2XMO A;  3CK2 A;  3THO B;  4M0V A;  3E7B A;  4B2O A;  3JYF A;  2NPP C;  1S95 A;  3C5W C;  4OR9 A;  2R17 A;  2O8A A;  4FCX A;  3H69 A;  4NZV A;  4UT3 A;  2NYM C;  3E7A A;  3IB8 A;  4UWQ A;  1S3M A;  3AV0 A;  4O5G A;  4TUG A;  4H1S A;  4O4K A;  2Z72 A;  3QFK A;  5HPE A;  4H2I A;  1WAR A;  4Q7F A;  1XM7 A;  1W24 A;  3H64 A;  4H2B A;  3RL5 A;  4UT3 B;  2NXF A;  4FBK A;  1AUI A;  4J6O A;  1HP1 A;  2Q8U A;  2WDC A;  3H63 A;  1TCO A;  3H68 A;  4V0X A;  4KKZ A;  5JJT A;  5EQV A;  3H67 A;  2BDX A;  2GJU A;  3DW8 C;  1T70 A;  2HYP A;  1Z2W A;  3N5U A;  5J28 A;  1UF3 A;  2A22 A;  1HPU A;  3IB7 A;  1M63 A;  5DNY A;  3V4Y A;  4IYP C;  4HD0 A;  1S3N A;  5JPF A;  4I5N C;  4MOV A;  4WWL A;  4YKE A;  4JA9 A;  2WDF A;  1OID A;  4JA7 A;  4DHL A;  3C9F A;  4TUI A;  4H2G A;  4DSY A;  3ZTV A;  1U32 A;  4ZX2 A;  1QHW A;  5JPE A;  1JK7 A;  4XPN A;  1KBP A;  1II7 A;  1XZW A;  4I5L C;  2YVT A;  2HY1 A;  3H61 A;  2BCD A;  3P71 C;  5IOH A;  2IAE C;  3H62 B;  2IE4 C;  3LL8 A;  1QFC A;  2BQ8 X;  1WAO 1;  3FGA C;  2P6B A;  2IE3 C;  3QFN A;  4H1Y P;  4FBW A;  4O24 A;  3AUZ A;  4LTY A;  3QFO A;  2DFJ A;  3K7V C;  3RL4 A;  1NNW A;  1S3L A;  1V73 A;  4H2F A;  2QFR A;  1UTE A;  2WDE A;  2O8G A;  4UT2 A;  4ORA A;  2CV9 A;  1USH A;  1OI8 A;  5C1V A;  1S70 A;  3RL3 A;  1T71 A;  2Z06 A;  3KBP A;  3PSO A;  3RQZ A;  3H66 A;  4MOY A;  3ICF A;  3ZU0 A;  5F3W A;  4O43 A;  2NYL C;  4G9J A;  2WDD A;  1Z2X A;  3HVQ A;  2AHD A;  1HO5 A;  3DSD A;  4FBQ A;  2QJC A;  4LAC C;  4IL1 A;  2QFP A;  1IT6 A;  4MP0 A;  4V0V A;  5INB A;  2ZBM A;  1G5B A;  1MF8 A;  4LU9 A;  5GTU A;  4F0Z A;  3THN A;  5B8I A;  3DSC A;  3EGG A;  3QG5 C;  3T1I A;  3PSN A;  3IVD A;  2HYO A;  4KBP A;  3EGH A;  4ZVZ A;  1FJM A;  4ORB A;  2KKN A;  3GVE A;  1OIE A;  2Z1A A;  3K7W C;  4DT2 A;  2USH A;  3H60 A;  1S8E A; 
#chains in the Genus database with same CATH topology
 1SU1 A;  2JOG A;  3TGH A;  3IVE A;  3QFM A;  4V0W A;  4ORC A;  2XMO A;  3CK2 A;  3THO B;  2ZOA A;  4M0V A;  3E7B A;  4B2O A;  3JYF A;  2NPP C;  1S95 A;  3C5W C;  4OR9 A;  2R17 A;  2O8A A;  4FCX A;  3H69 A;  4NZV A;  4UT3 A;  2NYM C;  3E7A A;  3IB8 A;  4UWQ A;  1S3M A;  3AV0 A;  4O5G A;  4TUG A;  4H1S A;  4O4K A;  2Z72 A;  3QFK A;  5HPE A;  3FLO A;  4H2I A;  1WAR A;  4Q7F A;  1XM7 A;  1W24 A;  3H64 A;  4H2B A;  3RL5 A;  4UT3 B;  2YEQ A;  2NXF A;  4FBK A;  1AUI A;  4J6O A;  1HP1 A;  2Q8U A;  2WDC A;  3H63 A;  1TCO A;  3H68 A;  4V0X A;  4KKZ A;  5JJT A;  5EQV A;  3E0J A;  3H67 A;  2BDX A;  2GJU A;  3DW8 C;  1T70 A;  2HYP A;  1Z2W A;  3N5U A;  5J28 A;  1UF3 A;  2A22 A;  1HPU A;  3IB7 A;  1M63 A;  5DNY A;  3V4Y A;  4IYP C;  4HD0 A;  1S3N A;  5JPF A;  4I5N C;  4MOV A;  4WWL A;  4YKE A;  3DSC A;  4JA9 A;  2WDF A;  1OID A;  4JA7 A;  4DHL A;  3C9F A;  4TUI A;  4H2G A;  4DSY A;  3ZTV A;  1U32 A;  4ZX2 A;  1QHW A;  5JPE A;  1JK7 A;  4XPN A;  1KBP A;  1II7 A;  1XZW A;  4I5L C;  2YVT A;  2HY1 A;  3H61 A;  2BCD A;  3P71 C;  5IOH A;  2IAE C;  3H62 B;  2IE4 C;  3LL8 A;  1QFC A;  2BQ8 X;  1WAO 1;  3FGA C;  2P6B A;  2IE3 C;  3QFN A;  4H1Y P;  4FBW A;  4O24 A;  3AUZ A;  4LTY A;  3QFO A;  2DFJ A;  3K7V C;  3RL4 A;  1NNW A;  1S3L A;  1V73 A;  4H2F A;  2QFR A;  1UTE A;  2WDE A;  2O8G A;  4UT2 A;  4ORA A;  2CV9 A;  1USH A;  1OI8 A;  5C1V A;  1S70 A;  3RL3 A;  1T71 A;  2Z06 A;  3KBP A;  3PSO A;  3RQZ A;  3H66 A;  4MOY A;  3ICF A;  3ZU0 A;  5F3W A;  4O43 A;  2NYL C;  4G9J A;  2WDD A;  1Z2X A;  3HVQ A;  2AHD A;  1HO5 A;  2DXL A;  2DXN A;  3DSD A;  4FBQ A;  2QJC A;  4LAC C;  3D03 A;  4IL1 A;  2QFP A;  1IT6 A;  4MP0 A;  4V0V A;  5INB A;  2ZBM A;  1G5B A;  1MF8 A;  2ZO9 B;  4LU9 A;  5GTU A;  3THN A;  4F0Z A;  5B8I A;  3EGG A;  3QG5 C;  3T1I A;  3PSN A;  3IVD A;  2HYO A;  4KBP A;  3EGH A;  4ZVZ A;  1FJM A;  4ORB A;  2KKN A;  3GVE A;  1OIE A;  2Z1A A;  3K7W C;  4DT2 A;  2USH A;  3H60 A;  1S8E A; 
#chains in the Genus database with same CATH homology
 1SU1 A;  2JOG A;  3TGH A;  3IVE A;  3QFM A;  4V0W A;  4ORC A;  2XMO A;  3CK2 A;  3THO B;  2ZOA A;  4M0V A;  3E7B A;  4B2O A;  3JYF A;  2NPP C;  1S95 A;  3C5W C;  4OR9 A;  2R17 A;  2O8A A;  4FCX A;  3H69 A;  4NZV A;  4UT3 A;  2NYM C;  3E7A A;  3IB8 A;  4UWQ A;  1S3M A;  3AV0 A;  4O5G A;  4TUG A;  4H1S A;  4O4K A;  2Z72 A;  3QFK A;  5HPE A;  3FLO A;  4H2I A;  1WAR A;  4Q7F A;  1XM7 A;  1W24 A;  3H64 A;  4H2B A;  3RL5 A;  4UT3 B;  2YEQ A;  2NXF A;  4FBK A;  1AUI A;  4J6O A;  1HP1 A;  2Q8U A;  2WDC A;  3H63 A;  1TCO A;  3H68 A;  4V0X A;  4KKZ A;  5JJT A;  5EQV A;  3E0J A;  3H67 A;  2BDX A;  2GJU A;  3DW8 C;  1T70 A;  2HYP A;  1Z2W A;  3N5U A;  5J28 A;  1UF3 A;  2A22 A;  1HPU A;  3IB7 A;  1M63 A;  5DNY A;  3V4Y A;  4IYP C;  4HD0 A;  1S3N A;  5JPF A;  4I5N C;  4MOV A;  4WWL A;  4YKE A;  3DSC A;  4JA9 A;  2WDF A;  1OID A;  4JA7 A;  4DHL A;  3C9F A;  4TUI A;  4H2G A;  4DSY A;  3ZTV A;  1U32 A;  4ZX2 A;  1QHW A;  5JPE A;  1JK7 A;  4XPN A;  1KBP A;  1II7 A;  1XZW A;  4I5L C;  2YVT A;  2HY1 A;  3H61 A;  2BCD A;  3P71 C;  5IOH A;  2IAE C;  3H62 B;  2IE4 C;  3LL8 A;  1QFC A;  2BQ8 X;  1WAO 1;  3FGA C;  2P6B A;  2IE3 C;  3QFN A;  4H1Y P;  4FBW A;  4O24 A;  3AUZ A;  4LTY A;  3QFO A;  2DFJ A;  3K7V C;  3RL4 A;  1NNW A;  1S3L A;  1V73 A;  4H2F A;  2QFR A;  1UTE A;  2WDE A;  2O8G A;  4UT2 A;  4ORA A;  2CV9 A;  1USH A;  1OI8 A;  5C1V A;  1S70 A;  3RL3 A;  1T71 A;  2Z06 A;  3KBP A;  3PSO A;  3RQZ A;  3H66 A;  4MOY A;  3ICF A;  3ZU0 A;  5F3W A;  4O43 A;  2NYL C;  4G9J A;  2WDD A;  1Z2X A;  3HVQ A;  2AHD A;  1HO5 A;  2DXL A;  2DXN A;  3DSD A;  4FBQ A;  2QJC A;  4LAC C;  3D03 A;  4IL1 A;  2QFP A;  1IT6 A;  4MP0 A;  4V0V A;  5INB A;  2ZBM A;  1G5B A;  1MF8 A;  2ZO9 B;  4LU9 A;  5GTU A;  3THN A;  4F0Z A;  5B8I A;  3EGG A;  3QG5 C;  3T1I A;  3PSN A;  3IVD A;  2HYO A;  4KBP A;  3EGH A;  4ZVZ A;  1FJM A;  4ORB A;  2KKN A;  3GVE A;  1OIE A;  2Z1A A;  3K7W C;  4DT2 A;  2USH A;  3H60 A;  1S8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...