4UT2A

X-ray structure of the human pp1 gamma catalytic subunit treated with ascorbate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
291
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYGEFDNAGAMMSVDETLMSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
total genus 107
structure length 291
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4ut2A00
4O43A 1Z2WA 1S70A 2GJUA 1OI8A 3QG5C 4UWQA 2Z1AA 1USHA 3IVEA 4I5NC 2Z06A 3DW8C 4ORCA 3N5UA 1S3NA 2IE4C 4HD0A 4H2IA 3P71C 4DSYA 4O4KA 4IL1A 4FCXA 3E7AA 3H61A 5EQVA 5B8IA 3AUZA 2AHDA 3H69A 4I5LC 1WARA 4F0ZA 4WWLA 4LU9A 2USHA 4FBQA 3ZU0A 1Z2XA 1T71A 3KBPA 1V73A 1WAO1 2CV9A 1UF3A 3H66A 3T1IA 4LTYA 5JPFA 3PSNA 1MF8A 4B2OA 1JK7A 1II7A 4TUIA 5IOHA 1S8EA 4O5GA 1OIDA 4M0VA 1M63A 3H67A 3THOB 2Z72A 4MOVA 3RQZA 4UT3A 3ICFA 3DSDA 3K7VC 3PSOA 2WDFA 2BQ8X 4FBWA 4V0WA 3ZTVA 2A22A 3RL3A 3RL4A 5F3WA 1W24A 2WDEA 2HY1A 4MOYA 4JA7A 5INBA 3LL8A 3C9FA 3QFNA 1AUIA 3CK2A 2BCDA 2IE3C 3RL5A 1S95A 2O8AA 2NXFA 2HYPA 4H2BA 4MP0A 4TUGA 5J28A 4OR9A 3GVEA 3E7BA 3AV0A 3EGHA 3H63A 4DT2A 1T70A 4H2GA 1HPUA 1OIEA 2NYMC 2WDCA 3H68A 2NYLC 2BDXA 3HVQA 2QFRA 3THNA 2NPPC 3QFKA 4H2FA 4XPNA 4IYPC 1KBPA 2DFJA 4Q7FA 4ZVZA 1TCOA 1IT6A 2ZBMA 4ORBA 3QFMA 1UTEA 4NZVA 4UT2A 4ORAA 4KBPA 3V4YA 4DHLA 2HYOA 3DSCA 3IB7A 1HO5A 2WDDA 5HPEA 1S3MA 1QFCA 5JPEA 4JA9A 3QFOA 3IB8A 4H1SA 1QHWA 2QFPA 4J6OA 1XM7A 1FJMA 1U32A 4UT3B 4ZX2A 3C5WC 3IVDA 1XZWA 2XMOA 2R17A 2KKNA 5DNYA 3JYFA 2Q8UA 5C1VA 2YVTA 4O24A 4V0XA 3FGAC 1SU1A 3TGHA 3EGGA 1HP1A 3H64A 2P6BA 1NNWA 2IAEC 4G9JA 1G5BA 4YKEA 3H62B 5GTUA 4H1YP 5JJTA 2O8GA 4FBKA 3K7WC 4V0VA 4LACC 4KKZA 3H60A 2JOGA 2QJCA 1S3LA
chains in the Genus database with same CATH superfamily
4O43A 1Z2WA 1S70A 2GJUA 1OI8A 3QG5C 4UWQA 2Z1AA 1USHA 2ZOAA 3IVEA 2Z06A 4I5NC 3DW8C 4ORCA 3N5UA 1S3NA 2IE4C 4HD0A 4H2IA 3P71C 4DSYA 4O4KA 4IL1A 4FCXA 3E7AA 3H61A 5EQVA 5B8IA 3AUZA 2AHDA 3H69A 4I5LC 1WARA 4F0ZA 4WWLA 4LU9A 2USHA 4FBQA 3ZU0A 1Z2XA 1T71A 3KBPA 1V73A 1WAO1 2CV9A 1UF3A 3H66A 3T1IA 4LTYA 3D03A 5JPFA 3PSNA 1MF8A 4B2OA 1JK7A 1II7A 4TUIA 5IOHA 2YEQA 1S8EA 4O5GA 1OIDA 4M0VA 1M63A 3H67A 3THOB 2Z72A 4MOVA 3RQZA 4UT3A 3ICFA 3DSDA 3K7VC 3PSOA 2WDFA 2BQ8X 4FBWA 4V0WA 3ZTVA 2A22A 3RL3A 3RL4A 5F3WA 1W24A 2WDEA 2HY1A 4MOYA 4JA7A 5INBA 3LL8A 3C9FA 3QFNA 1AUIA 3CK2A 2BCDA 2IE3C 3RL5A 1S95A 2O8AA 2NXFA 2HYPA 4H2BA 4MP0A 4TUGA 5J28A 4OR9A 3GVEA 3E7BA 3AV0A 3EGHA 3H63A 4DT2A 1T70A 4H2GA 1HPUA 1OIEA 2NYMC 2WDCA 3H68A 2NYLC 2BDXA 3HVQA 2QFRA 3THNA 2NPPC 2ZO9B 3QFKA 4H2FA 4XPNA 4IYPC 1KBPA 2DFJA 4Q7FA 4ZVZA 1TCOA 1IT6A 2ZBMA 4ORBA 3QFMA 3E0JA 1UTEA 4NZVA 4UT2A 4ORAA 4KBPA 3V4YA 4DHLA 2HYOA 3DSCA 3IB7A 1HO5A 2WDDA 5HPEA 1S3MA 1QFCA 5JPEA 4JA9A 3QFOA 3IB8A 4H1SA 1QHWA 2QFPA 2DXLA 4J6OA 1XM7A 1FJMA 1U32A 4UT3B 4ZX2A 3C5WC 3IVDA 1XZWA 2XMOA 2R17A 2KKNA 5DNYA 3JYFA 2Q8UA 2DXNA 5C1VA 2YVTA 4O24A 4V0XA 3FGAC 1SU1A 3TGHA 3EGGA 1HP1A 3H64A 2P6BA 1NNWA 2IAEC 4G9JA 1G5BA 4YKEA 3H62B 5GTUA 4H1YP 5JJTA 2O8GA 4FBKA 3K7WC 4V0VA 4LACC 4KKZA 3FLOA 3H60A 2JOGA 2QJCA 1S3LA
chains in the Genus database with same CATH topology
4O43A 1Z2WA 1S70A 2GJUA 1OI8A 3QG5C 4UWQA 2Z1AA 1USHA 2ZOAA 3IVEA 2Z06A 4I5NC 3DW8C 4ORCA 3N5UA 1S3NA 2IE4C 4HD0A 4H2IA 3P71C 4DSYA 4O4KA 4IL1A 4FCXA 3E7AA 3H61A 5EQVA 5B8IA 3AUZA 2AHDA 3H69A 4I5LC 1WARA 4F0ZA 4WWLA 4LU9A 2USHA 4FBQA 3ZU0A 1Z2XA 1T71A 3KBPA 1V73A 1WAO1 2CV9A 1UF3A 3H66A 3T1IA 4LTYA 3D03A 5JPFA 3PSNA 1MF8A 4B2OA 1JK7A 1II7A 4TUIA 5IOHA 2YEQA 1S8EA 4O5GA 1OIDA 4M0VA 1M63A 3H67A 3THOB 2Z72A 4MOVA 3RQZA 4UT3A 3ICFA 3DSDA 3K7VC 3PSOA 2WDFA 2BQ8X 4FBWA 4V0WA 3ZTVA 2A22A 3RL3A 3RL4A 5F3WA 1W24A 2WDEA 2HY1A 4MOYA 4JA7A 5INBA 3LL8A 3C9FA 3QFNA 1AUIA 3CK2A 2BCDA 2IE3C 3RL5A 1S95A 2O8AA 2NXFA 2HYPA 4H2BA 4MP0A 4TUGA 5J28A 4OR9A 3GVEA 3E7BA 3AV0A 3EGHA 3H63A 4DT2A 1T70A 4H2GA 1HPUA 1OIEA 2NYMC 2WDCA 3H68A 2NYLC 2BDXA 3HVQA 2QFRA 3THNA 2NPPC 2ZO9B 3QFKA 4H2FA 4XPNA 4IYPC 1KBPA 2DFJA 4Q7FA 4ZVZA 1TCOA 1IT6A 2ZBMA 4ORBA 3QFMA 3E0JA 1UTEA 4NZVA 4UT2A 4ORAA 4KBPA 3V4YA 4DHLA 2HYOA 3DSCA 3IB7A 1HO5A 2WDDA 5HPEA 1S3MA 1QFCA 5JPEA 4JA9A 3QFOA 3IB8A 4H1SA 1QHWA 2QFPA 2DXLA 4J6OA 1XM7A 1FJMA 1U32A 4UT3B 4ZX2A 3C5WC 3IVDA 1XZWA 2XMOA 2R17A 2KKNA 5DNYA 3JYFA 2Q8UA 2DXNA 5C1VA 2YVTA 4O24A 4V0XA 3FGAC 1SU1A 3TGHA 3EGGA 1HP1A 3H64A 2P6BA 1NNWA 2IAEC 4G9JA 1G5BA 4YKEA 3H62B 5GTUA 4H1YP 5JJTA 2O8GA 4FBKA 3K7WC 4V0VA 4LACC 4KKZA 3FLOA 3H60A 2JOGA 2QJCA 1S3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O43 A;  1Z2W A;  1S70 A;  2GJU A;  1OI8 A;  3QG5 C;  4UWQ A;  2Z1A A;  1USH A;  3IVE A;  4I5N C;  2Z06 A;  3DW8 C;  4ORC A;  3N5U A;  1S3N A;  2IE4 C;  4HD0 A;  4H2I A;  3P71 C;  4DSY A;  4O4K A;  4IL1 A;  4FCX A;  3E7A A;  3H61 A;  5EQV A;  5B8I A;  3AUZ A;  2AHD A;  3H69 A;  4I5L C;  1WAR A;  4F0Z A;  4WWL A;  4LU9 A;  2USH A;  4FBQ A;  3ZU0 A;  1Z2X A;  1T71 A;  3KBP A;  1V73 A;  1WAO 1;  2CV9 A;  1UF3 A;  3H66 A;  3T1I A;  4LTY A;  5JPF A;  3PSN A;  1MF8 A;  4B2O A;  1JK7 A;  1II7 A;  4TUI A;  5IOH A;  1S8E A;  4O5G A;  1OID A;  4M0V A;  1M63 A;  3H67 A;  3THO B;  2Z72 A;  4MOV A;  3RQZ A;  4UT3 A;  3ICF A;  3DSD A;  3K7V C;  3PSO A;  2WDF A;  2BQ8 X;  4FBW A;  4V0W A;  3ZTV A;  2A22 A;  3RL3 A;  3RL4 A;  5F3W A;  1W24 A;  2WDE A;  2HY1 A;  4MOY A;  4JA7 A;  5INB A;  3LL8 A;  3C9F A;  3QFN A;  1AUI A;  3CK2 A;  2BCD A;  2IE3 C;  3RL5 A;  1S95 A;  2O8A A;  2NXF A;  2HYP A;  4H2B A;  4MP0 A;  4TUG A;  5J28 A;  4OR9 A;  3GVE A;  3E7B A;  3AV0 A;  3EGH A;  3H63 A;  4DT2 A;  1T70 A;  4H2G A;  1HPU A;  1OIE A;  2NYM C;  2WDC A;  3H68 A;  2NYL C;  2BDX A;  3HVQ A;  2QFR A;  3THN A;  2NPP C;  3QFK A;  4H2F A;  4XPN A;  4IYP C;  1KBP A;  2DFJ A;  4Q7F A;  4ZVZ A;  1TCO A;  1IT6 A;  2ZBM A;  4ORB A;  3QFM A;  1UTE A;  4NZV A;  4UT2 A;  4ORA A;  4KBP A;  3V4Y A;  4DHL A;  2HYO A;  3DSC A;  3IB7 A;  1HO5 A;  2WDD A;  5HPE A;  1S3M A;  1QFC A;  5JPE A;  4JA9 A;  3QFO A;  3IB8 A;  4H1S A;  1QHW A;  2QFP A;  4J6O A;  1XM7 A;  1FJM A;  1U32 A;  4UT3 B;  4ZX2 A;  3C5W C;  3IVD A;  1XZW A;  2XMO A;  2R17 A;  2KKN A;  5DNY A;  3JYF A;  2Q8U A;  5C1V A;  2YVT A;  4O24 A;  4V0X A;  3FGA C;  1SU1 A;  3TGH A;  3EGG A;  1HP1 A;  3H64 A;  2P6B A;  1NNW A;  2IAE C;  4G9J A;  1G5B A;  4YKE A;  3H62 B;  5GTU A;  4H1Y P;  5JJT A;  2O8G A;  4FBK A;  3K7W C;  4V0V A;  4LAC C;  4KKZ A;  3H60 A;  2JOG A;  2QJC A;  1S3L A; 
#chains in the Genus database with same CATH topology
 4O43 A;  1Z2W A;  1S70 A;  2GJU A;  1OI8 A;  3QG5 C;  4UWQ A;  2Z1A A;  1USH A;  2ZOA A;  3IVE A;  2Z06 A;  4I5N C;  3DW8 C;  4ORC A;  3N5U A;  1S3N A;  2IE4 C;  4HD0 A;  4H2I A;  3P71 C;  4DSY A;  4O4K A;  4IL1 A;  4FCX A;  3E7A A;  3H61 A;  5EQV A;  5B8I A;  3AUZ A;  2AHD A;  3H69 A;  4I5L C;  1WAR A;  4F0Z A;  4WWL A;  4LU9 A;  2USH A;  4FBQ A;  3ZU0 A;  1Z2X A;  1T71 A;  3KBP A;  1V73 A;  1WAO 1;  2CV9 A;  1UF3 A;  3H66 A;  3T1I A;  4LTY A;  3D03 A;  5JPF A;  3PSN A;  1MF8 A;  4B2O A;  1JK7 A;  1II7 A;  4TUI A;  5IOH A;  2YEQ A;  1S8E A;  4O5G A;  1OID A;  4M0V A;  1M63 A;  3H67 A;  3THO B;  2Z72 A;  4MOV A;  3RQZ A;  4UT3 A;  3ICF A;  3DSD A;  3K7V C;  3PSO A;  2WDF A;  2BQ8 X;  4FBW A;  4V0W A;  3ZTV A;  2A22 A;  3RL3 A;  3RL4 A;  5F3W A;  1W24 A;  2WDE A;  2HY1 A;  4MOY A;  4JA7 A;  5INB A;  3LL8 A;  3C9F A;  3QFN A;  1AUI A;  3CK2 A;  2BCD A;  2IE3 C;  3RL5 A;  1S95 A;  2O8A A;  2NXF A;  2HYP A;  4H2B A;  4MP0 A;  4TUG A;  5J28 A;  4OR9 A;  3GVE A;  3E7B A;  3AV0 A;  3EGH A;  3H63 A;  4DT2 A;  1T70 A;  4H2G A;  1HPU A;  1OIE A;  2NYM C;  2WDC A;  3H68 A;  2NYL C;  2BDX A;  3HVQ A;  2QFR A;  3THN A;  2NPP C;  2ZO9 B;  3QFK A;  4H2F A;  4XPN A;  4IYP C;  1KBP A;  2DFJ A;  4Q7F A;  4ZVZ A;  1TCO A;  1IT6 A;  2ZBM A;  4ORB A;  3QFM A;  3E0J A;  1UTE A;  4NZV A;  4UT2 A;  4ORA A;  4KBP A;  3V4Y A;  4DHL A;  2HYO A;  3DSC A;  3IB7 A;  1HO5 A;  2WDD A;  5HPE A;  1S3M A;  1QFC A;  5JPE A;  4JA9 A;  3QFO A;  3IB8 A;  4H1S A;  1QHW A;  2QFP A;  2DXL A;  4J6O A;  1XM7 A;  1FJM A;  1U32 A;  4UT3 B;  4ZX2 A;  3C5W C;  3IVD A;  1XZW A;  2XMO A;  2R17 A;  2KKN A;  5DNY A;  3JYF A;  2Q8U A;  2DXN A;  5C1V A;  2YVT A;  4O24 A;  4V0X A;  3FGA C;  1SU1 A;  3TGH A;  3EGG A;  1HP1 A;  3H64 A;  2P6B A;  1NNW A;  2IAE C;  4G9J A;  1G5B A;  4YKE A;  3H62 B;  5GTU A;  4H1Y P;  5JJT A;  2O8G A;  4FBK A;  3K7W C;  4V0V A;  4LAC C;  4KKZ A;  3FLO A;  3H60 A;  2JOG A;  2QJC A;  1S3L A; 
#chains in the Genus database with same CATH homology
 4O43 A;  1Z2W A;  1S70 A;  2GJU A;  1OI8 A;  3QG5 C;  4UWQ A;  2Z1A A;  1USH A;  2ZOA A;  3IVE A;  2Z06 A;  4I5N C;  3DW8 C;  4ORC A;  3N5U A;  1S3N A;  2IE4 C;  4HD0 A;  4H2I A;  3P71 C;  4DSY A;  4O4K A;  4IL1 A;  4FCX A;  3E7A A;  3H61 A;  5EQV A;  5B8I A;  3AUZ A;  2AHD A;  3H69 A;  4I5L C;  1WAR A;  4F0Z A;  4WWL A;  4LU9 A;  2USH A;  4FBQ A;  3ZU0 A;  1Z2X A;  1T71 A;  3KBP A;  1V73 A;  1WAO 1;  2CV9 A;  1UF3 A;  3H66 A;  3T1I A;  4LTY A;  3D03 A;  5JPF A;  3PSN A;  1MF8 A;  4B2O A;  1JK7 A;  1II7 A;  4TUI A;  5IOH A;  2YEQ A;  1S8E A;  4O5G A;  1OID A;  4M0V A;  1M63 A;  3H67 A;  3THO B;  2Z72 A;  4MOV A;  3RQZ A;  4UT3 A;  3ICF A;  3DSD A;  3K7V C;  3PSO A;  2WDF A;  2BQ8 X;  4FBW A;  4V0W A;  3ZTV A;  2A22 A;  3RL3 A;  3RL4 A;  5F3W A;  1W24 A;  2WDE A;  2HY1 A;  4MOY A;  4JA7 A;  5INB A;  3LL8 A;  3C9F A;  3QFN A;  1AUI A;  3CK2 A;  2BCD A;  2IE3 C;  3RL5 A;  1S95 A;  2O8A A;  2NXF A;  2HYP A;  4H2B A;  4MP0 A;  4TUG A;  5J28 A;  4OR9 A;  3GVE A;  3E7B A;  3AV0 A;  3EGH A;  3H63 A;  4DT2 A;  1T70 A;  4H2G A;  1HPU A;  1OIE A;  2NYM C;  2WDC A;  3H68 A;  2NYL C;  2BDX A;  3HVQ A;  2QFR A;  3THN A;  2NPP C;  2ZO9 B;  3QFK A;  4H2F A;  4XPN A;  4IYP C;  1KBP A;  2DFJ A;  4Q7F A;  4ZVZ A;  1TCO A;  1IT6 A;  2ZBM A;  4ORB A;  3QFM A;  3E0J A;  1UTE A;  4NZV A;  4UT2 A;  4ORA A;  4KBP A;  3V4Y A;  4DHL A;  2HYO A;  3DSC A;  3IB7 A;  1HO5 A;  2WDD A;  5HPE A;  1S3M A;  1QFC A;  5JPE A;  4JA9 A;  3QFO A;  3IB8 A;  4H1S A;  1QHW A;  2QFP A;  2DXL A;  4J6O A;  1XM7 A;  1FJM A;  1U32 A;  4UT3 B;  4ZX2 A;  3C5W C;  3IVD A;  1XZW A;  2XMO A;  2R17 A;  2KKN A;  5DNY A;  3JYF A;  2Q8U A;  2DXN A;  5C1V A;  2YVT A;  4O24 A;  4V0X A;  3FGA C;  1SU1 A;  3TGH A;  3EGG A;  1HP1 A;  3H64 A;  2P6B A;  1NNW A;  2IAE C;  4G9J A;  1G5B A;  4YKE A;  3H62 B;  5GTU A;  4H1Y P;  5JJT A;  2O8G A;  4FBK A;  3K7W C;  4V0V A;  4LAC C;  4KKZ A;  3FLO A;  3H60 A;  2JOG A;  2QJC A;  1S3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...