4NZVA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
329
Chain Sequence
HHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 110
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4nzvA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4nzvA01
4FBWA 1S3LA 1KBPA 4HD0A 4LACC 2USHA 2JOGA 3K7WC 3DSDA 1XM7A 1Z2XA 5F3WA 1M63A 2AHDA 1S3MA 3H66A 1S3NA 3RQZA 4O4KA 3THOB 3RL4A 2Z06A 3H63A 5C1VA 3E7AA 2XMOA 4JA9A 3C9FA 1XZWA 4I5NC 4IL1A 2WDCA 4XPNA 3QFMA 3LL8A 4H2IA 1IT6A 4FBQA 1USHA 4MOVA 1UTEA 2BDXA 3K7VC 2IAEC 3QFOA 3TGHA 3RL3A 3HVQA 1WAO1 3ICFA 2O8GA 2HYPA 4F0ZA 3ZU0A 3ZTVA 5GTUA 3IVEA 2CV9A 4H1SA 3H64A 1QFCA 1OIDA 3H68A 3IB7A 4FBKA 3RL5A 3QFKA 1II7A 4I5LC 3N5UA 4MP0A 4Q7FA 1OI8A 2QFPA 5HPEA 5J28A 4LU9A 4LTYA 4B2OA 4G9JA 2O8AA 1SU1A 3DSCA 3THNA 1G5BA 2P6BA 3FGAC 4H2BA 4DSYA 5B8IA 2HYOA 4M0VA 2IE4C 2WDDA 3PSNA 1S95A 4H2FA 3H67A 4OR9A 3C5WC 3H60A 3GVEA 4H1YP 1S8EA 2HY1A 4ORCA 1T71A 4DT2A 2GJUA 3H62B 1HPUA 1UF3A 2Q8UA 3P71C 4ORBA 2KKNA 3EGHA 2Z72A 3T1IA 4TUGA 3QFNA 1HO5A 2ZBMA 2WDEA 2IE3C 3KBPA 4V0WA 4JA7A 1Z2WA 2Z1AA 4V0XA 3EGGA 2DFJA 3QG5C 1QHWA 4J6OA 2NPPC 2NYLC 4KKZA 3IVDA 1MF8A 1WARA 3V4YA 4UT3A 4TUIA 1HP1A 3DW8C 4O24A 4UT2A 1U32A 4NZVA 3CK2A 4FCXA 4UT3B 5JPEA 4ZX2A 1TCOA 4UWQA 1AUIA 1T70A 2A22A 2QFRA 2NYMC 5EQVA 2BQ8X 4YKEA 3IB8A 4WWLA 4ORAA 1JK7A 1W24A 4IYPC 4O5GA 3AV0A 1FJMA 4H2GA 2NXFA 5DNYA 4MOYA 4KBPA 1V73A 2YVTA 1OIEA 3H69A 4ZVZA 5INBA 1NNWA 3JYFA 5IOHA 5JPFA 5JJTA 3E7BA 2QJCA 3H61A 2BCDA 3PSOA 4DHLA 1S70A 2R17A 2WDFA 3AUZA 4V0VA 4O43A
chains in the Genus database with same CATH superfamily
4BMJA 4R03A 2L8TA 1MEYC 5AE1A 2NUGA 3RMPA 4HD0A 2WCC3 2EN8A 2USHA 3DSDA 1P47A 2EMWA 1M63A 2EMYA 1FKAE 1S3MA 4F6NA 1T4LB 4P7DA 4ZYEA 2YTNA 5KL7A 3H63A 2LT7A 2XMOA 4JA9A 5A6BD 1AAYA 2EOSA 2LV2A 1A1IA 1PDAA 2YTIA 1HR0E 3OTOE 2DSYA 5TSEA 1QU6A 1IQSA 2BDXA 4B3RE 2YT4A 2EM8A 5KL3A 3C4BA 1GQEA 2O8GA 2EMIA 4DMIA 2HGHA 3HPSA 5AC4A 1ZR9A 2N3GA 4R8OA 5IWAE 3T1YE 4OX9E 1WXRA 4DR7E 4MP0A 4Q7FA 5HPEA 2QFPA 5J28A 4LTYA 2UXBE 2EL4A 2EMXA 3LMLA 1SU1A 2JY9A 1X6FA 4H2BA 1ZU1A 2EN7A 2EPXA 2YTFA 3IWBA 3F6GA 4BBYA 2VQEE 2EOYA 2KONA 4DV6E 4H1YP 2V83A 3DJWA 2EOOA 1ZBTA 4WYQB 4ORCA 3HPZA 2IHR1 4RHBB 2RTXA 1YSAC 2GPIA 2EOJA 3EGHA 5KL5A 4NXNE 2Z72A 2H36X 1WRJA 4X66E 1YUIA 3E0JA 3J80C 3QFNA 2B7TA 2KHXA 4R2QA 1IMUA 2WDEA 2ZBMA 2EORA 2EP3A 2YTDA 2Z1AA 3EGGA 2ZO9B 4V0XA 2DFJA 2UU9E 2JXPA 2L3JA 2EZ6A 1G2FC 3IVDA 1N34E 4BHBA 4JI4E 1SFEA 4UT2A 2EM0A 4ZYGA 1HNWE 1WHNA 4KWYA 4LF4E 2UUBE 2JOXA 4FCXA 1ZAAC 2A22A 2B7VA 4WSGA 2QFRA 2M7QA 5EQVA 2EQ3A 3FIGA 4LF8E 1GTKA 5AE2A 4DV0E 1LLMC 1JK7A 3VYXA 2HC5A 2EM9A 5DNYA 2NXFA 1FJGE 3EQ1A 2WBSA 1V73A 3MHSC 1X3CA 2V87A 1OIEA 2DB2A 3H69A 3JYFA 4I8OA 4JI1E 2QJCA 1SR9A 4BHCA 4Q28A 1EKZA 1I94E 1AH5A 1S70A 1YYOA 3AUZA 5AE3A 2RS7A 3IWDA 2ENAA 2LO3A 2DMIA 1S3LA 4JI5E 2I13A 2EPPA 2ELZA 1XM7A 2AHDA 2YEQA 2ADRA 4DV3E 2Z06A 3ADLA 2EM6A 2EJ4A 5C1VA 3E7AA 2LRSA 5BR8E 2EMCA 2V88A 2EN2A 2YU8A 1QNTA 2EOIA 4I5NC 3K6QA 2LTRA 4H2IA 2MC6A 4FBQA 2N8XA 1UTEA 5FLXC 3BBGA 1BBGA 3TGHA 1L4SA 3HVQA 1PKPA 1WAO1 2LCEA 3ICFA 3JU0A 3ZU0A 2EPAA 3ZTVA 3IVEA 2YZTA 2JR1A 3EPJA 2EM4A 4F9CB 3KZYA 4DV4E 3MHHC 1MGTA 4LF7E 1OIDA 1QFCA 3H68A 2UXCE 2EL5A 4FBKA 3RL5A 2EPOA 2VE7C 2E5LE 1B69A 4NHRA 4R2PA 4G9JA 1DI2A 4GKJE 1YZ9A 2YPNA 2P6BA 1EH8A 4DSYA 5B8IA 2EN1A 4F9BB 2L2MA 5IXMB 2WDDA 4H2FA 2EPMX 4WXDA 2L6MA 3MSWA 4LFAE 2G7HA 4DR2E 2LMZA 1F2IG 4DR3E 1S8EA 4ZYHA 4J8ZA 4DT2A 2GJUA 3H62B 3ADJA 1JK1A 4F2JC 1UF3A 4MLVA 4FK5C 3P71C 2LE2A 2NABA 5KL6A 2ELYA 1JK2A 4TUGA 1DQ3A 2FTXB 2UXDE 2ODRC 1RC7A 3QG5C 2LJHA 2DLQA 1STUA 2YTJA 4DV2E 2YSPA 4KZSA 2JVAA 3F6HA 1IBKE 2V89A 4UT3A 1X6HA 1N3GA 3C4TA 1ZBQA 2RQLA 5A6BA 4O24A 3DW8C 4DR5E 2MKNA 2LTSA 4R2EA 3TQMA 1AUIA 2MKDA 4F6MA 1GZ6A 1A1FA 4ZYDA 1W24A 1A1HA 1RMDA 2B3TB 2EOQA 2EN3A 4H2GA 1PJSA 2YWQA 4HEIA 2F4VE 4KBPA 4MOYA 3BIDA 1X5WA 2DMYA 3BGHA 2YTGA 2NUFA 1KJKA 2R1FA 1O0WA 3PSOA 2EMGA 2R17A 1J5EE 4V0VA 4O43A 3DSCA 4M9VC 2KOUA 2L92A 2F8BA 4WFTA 4YHHE 2YTOA 4LACC 4F54A 2UUCE 4WXCA 3ADIA 2FGGA 5F3WA 3FLOA 3H66A 2YRKA 3RQZA 3THOB 3J7Yp 3IWCA 3ADGA 4R2DA 2NA2A 2EM7A 4L8NA 3C9FA 5AC5A 2EMLA 2EMHA 2VRDA 4IL1A 2L3CA 4B3SE 2WDCA 2LUQA 1XMQE 1TN9A 3VK6A 1IT6A 1USHA 1UHZA 4DUZE 2IAEC 4BCAA 5KL4A 3QFOA 2EN6A 4LFBE 2R76A 3RL3A 4LF9E 4JI6E 1YYKA 1XNQE 2HYPA 2JOBA 4LFCE 2EQ0A 2ZM6E 3H64A 2M4IA 2LUPB 1YYWA 2K7IA 1HNXE 2ODRD 1II7A 1A1LA 2RSIA 1EH7A 4RH8A 1T39A 4JI3E 2E72A 2EM3A 4LU9A 2EPCA 5LL6R 5A69A 2LBSB 1WHQA 2L2NA 3FGAC 2EMAA 4M0VA 3T1HE 3UK3C 2LJUA 2DGCA 1A1GA 1PJQA 2DXNA 2V85A 1S95A 2EMFA 3C5WC 4B3ME 1X48A 4JV5E 2RS6A 4DV1E 1T71A 3J7AG 2RPCA 4BC7A 3P1XA 3VYYA 2EPUA 5AASA 4IJDA 4WSPA 5IV8B 2M1SA 3T1IA 1X49A 2EPKX 1T4NA 1YPNA 1HO5A 4GKKE 4F9AB 4X62E 2WBUA 1BB8A 1TF3A 2MDGA 2JP9A 4R2CA 1N33E 2PRTA 1QHWA 1N32E 4KKZA 2EOZA 2LVHA 1WARA 1DGCA 2J7JA 2EPZA 1HP1A 2DIXA 4BS9A 5JPEA 2WBTA 2A25A 1N36E 4UWQA 1T70A 2NYMC 2CPNA 3D03A 2NUEA 1EH6A 3IB8A 2WZOA 4WWLA 1X47A 2YRMA 5A6AA 4O5GA 4IYPC 2EM2A 1A1JA 2EM5A 1IQOA 3LLHA 3J81C 2JWOA 4ZVZA 4X65E 4DR1E 2BB8A 1NNWA 5JJTA 4DKKA 4OOGC 3E7BA 2RSMA 3H61A 2YTPA 4YY3E 2WDFA 4JI7E 3JTZA 1J26A 3ECRA 4FBWA 2DRPA 3OMLA 1KBPA 2EPNA 5CFFE 1HNZE 1UN6B 2JOGA 3K7WC 1WJPA 1Z2XA 1BBOA 4DV7E 4WX9A 4AQYE 4O4KA 1S3NA 3RL4A 1PJTA 4DUYE 2EPLX 1Z1BA 2ENHA 3EPKA 4JI8E 1UBDC 1XZWA 1X6EA 4XPNA 3QFMA 2EMBA 2HJJA 2I9IA 5KL2A 4NXME 4R2SA 3LL8A 5T6JA 4MOVA 4F0ZA 3M99B 5A6KA 3K7VC 2GHFA 2UUAE 4DV5E 2V86A 2CT1A 2D9HA 4R2AA 3VHTB 3KZZA 2EL6A 5LMNE 2ENCA 4HTGA 1XNRE 5GTUA 4B3TE 2CV9A 4H1SA 3KWRA 2EN4A 2YRHA 3IB7A 2ZOAA 1A1KA 3QFKA 4I5LC 2CSHA 2EOXA 4DR4E 3N5UA 1G2DC 2MC5A 2V8QB 4X64E 4X9JA 4L5NC 1IBLE 2EE8A 4JI2E 1OI8A 2L2KB 4JI0E 4B2OA 1IBME 2EOMA 2O8AA 2YTQA 3THNA 3EPLA 4WPYA 4KHPE 1G5BA 3BF2A 2HYOA 3HTXA 2IE4C 3PSNA 4P78A 2DXLA 2N3HA 3C6MA 2EOFA 4GEQB 4N4RB 3H67A 2JYAA 1YUJA 2GLIA 4OR9A 3H60A 4MLQA 3GVEA 2BBGA 4DR6E 4IS1C 2HY1A 3L00A 2MDRA 1RQ0A 2EWLA 1T38A 1HPUA 2Q8UA 4ORBA 2KKNA 2FV4B 3HQ1A 4LF6E 2EQ1A 1NCSA 2L33A 5IT9C 5A2QC 4GZNC 4LF5E 2IE3C 2EOEA 2EMZA 3KBPA 4V0WA 1YFHA 4JYAE 4JA7A 2E1MA 1Z2WA 3DF6A 4J6OA 2NPPC 2NYLC 3C6KA 1MF8A 3H09A 3EPHA 2YSOA 3V4YA 2DLKA 2VF1A 4TUIA 5ADZA 1UILA 2YTEA 4BC9A 1U32A 4NZVA 3CK2A 1KYQA 4UT3B 4M2ZA 4ZX2A 2JPAA 1TCOA 2BQ8X 4YKEA 4X8WA 4ORAA 1NEIA 4M30A 3JAMC 3ZOQB 2YU5A 1TF6A 2CTDA 3AV0A 1FJMA 4K0KE 2B9DA 2YVTA 2HHHE 5INBA 2EMKA 5IOHA 5JPFA 1T4OA 2EPRA 5LLQA 2M9AA 3HXLA 4R2RA 4Q35B 5A6JA 2VQFE 2EOHA 5LMUE 2BCDA 4DHLA 1XMOE 2K4VA
chains in the Genus database with same CATH topology
4FBWA 4V0VA 1S3LA 1KBPA 4HD0A 4LACC 2USHA 2JOGA 3DSDA 3K7WC 1XM7A 1Z2XA 3FLOA 5F3WA 1M63A 2AHDA 2YEQA 1S3MA 3H66A 1S3NA 3RQZA 4O4KA 3THOB 3RL4A 2Z06A 3H63A 5C1VA 3E7AA 2XMOA 4JA9A 3C9FA 1XZWA 4I5NC 4IL1A 2WDCA 4XPNA 3QFMA 3LL8A 4H2IA 1IT6A 4FBQA 1USHA 4MOVA 1UTEA 2BDXA 3K7VC 2IAEC 3QFOA 3TGHA 3RL3A 3HVQA 1WAO1 3ICFA 2O8GA 2HYPA 4F0ZA 3ZU0A 3ZTVA 5GTUA 3IVEA 2CV9A 4H1SA 3H64A 1QFCA 1OIDA 3H68A 3IB7A 4FBKA 2ZOAA 3RL5A 3QFKA 1II7A 4I5LC 3N5UA 4MP0A 4Q7FA 1OI8A 2QFPA 5HPEA 5J28A 4LU9A 4LTYA 4B2OA 4G9JA 2O8AA 1SU1A 3THNA 1G5BA 2P6BA 3FGAC 4H2BA 4DSYA 5B8IA 2HYOA 4M0VA 2IE4C 2WDDA 3PSNA 2DXLA 2DXNA 1S95A 4H2FA 3H67A 4OR9A 3C5WC 3H60A 3GVEA 4H1YP 1S8EA 2HY1A 4ORCA 1T71A 4DT2A 2GJUA 3H62B 1HPUA 1UF3A 2Q8UA 3P71C 4ORBA 2KKNA 3EGHA 2Z72A 3T1IA 3E0JA 4TUGA 3QFNA 1HO5A 2ZBMA 2WDEA 2IE3C 3KBPA 4V0WA 4JA7A 1Z2WA 2Z1AA 4V0XA 3EGGA 2ZO9B 2DFJA 3QG5C 1QHWA 4J6OA 2NPPC 2NYLC 4KKZA 3IVDA 1MF8A 1WARA 3V4YA 4UT3A 4TUIA 1HP1A 3DW8C 4O24A 4UT2A 1U32A 4NZVA 3CK2A 4FCXA 4UT3B 5JPEA 4ZX2A 1TCOA 4UWQA 1AUIA 1T70A 2A22A 2QFRA 2NYMC 3D03A 5EQVA 2BQ8X 4YKEA 3IB8A 4WWLA 4ORAA 1JK7A 1W24A 4IYPC 4O5GA 3AV0A 1FJMA 4H2GA 2NXFA 5DNYA 4MOYA 4KBPA 1V73A 2YVTA 1OIEA 3H69A 4ZVZA 5INBA 1NNWA 3JYFA 5IOHA 5JPFA 5JJTA 3E7BA 2QJCA 3H61A 2BCDA 3PSOA 4DHLA 1S70A 2R17A 2WDFA 3AUZA 3DSCA 4O43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBW A;  1S3L A;  1KBP A;  4HD0 A;  4LAC C;  2USH A;  2JOG A;  3K7W C;  3DSD A;  1XM7 A;  1Z2X A;  5F3W A;  1M63 A;  2AHD A;  1S3M A;  3H66 A;  1S3N A;  3RQZ A;  4O4K A;  3THO B;  3RL4 A;  2Z06 A;  3H63 A;  5C1V A;  3E7A A;  2XMO A;  4JA9 A;  3C9F A;  1XZW A;  4I5N C;  4IL1 A;  2WDC A;  4XPN A;  3QFM A;  3LL8 A;  4H2I A;  1IT6 A;  4FBQ A;  1USH A;  4MOV A;  1UTE A;  2BDX A;  3K7V C;  2IAE C;  3QFO A;  3TGH A;  3RL3 A;  3HVQ A;  1WAO 1;  3ICF A;  2O8G A;  2HYP A;  4F0Z A;  3ZU0 A;  3ZTV A;  5GTU A;  3IVE A;  2CV9 A;  4H1S A;  3H64 A;  1QFC A;  1OID A;  3H68 A;  3IB7 A;  4FBK A;  3RL5 A;  3QFK A;  1II7 A;  4I5L C;  3N5U A;  4MP0 A;  4Q7F A;  1OI8 A;  2QFP A;  5HPE A;  5J28 A;  4LU9 A;  4LTY A;  4B2O A;  4G9J A;  2O8A A;  1SU1 A;  3DSC A;  3THN A;  1G5B A;  2P6B A;  3FGA C;  4H2B A;  4DSY A;  5B8I A;  2HYO A;  4M0V A;  2IE4 C;  2WDD A;  3PSN A;  1S95 A;  4H2F A;  3H67 A;  4OR9 A;  3C5W C;  3H60 A;  3GVE A;  4H1Y P;  1S8E A;  2HY1 A;  4ORC A;  1T71 A;  4DT2 A;  2GJU A;  3H62 B;  1HPU A;  1UF3 A;  2Q8U A;  3P71 C;  4ORB A;  2KKN A;  3EGH A;  2Z72 A;  3T1I A;  4TUG A;  3QFN A;  1HO5 A;  2ZBM A;  2WDE A;  2IE3 C;  3KBP A;  4V0W A;  4JA7 A;  1Z2W A;  2Z1A A;  4V0X A;  3EGG A;  2DFJ A;  3QG5 C;  1QHW A;  4J6O A;  2NPP C;  2NYL C;  4KKZ A;  3IVD A;  1MF8 A;  1WAR A;  3V4Y A;  4UT3 A;  4TUI A;  1HP1 A;  3DW8 C;  4O24 A;  4UT2 A;  1U32 A;  4NZV A;  3CK2 A;  4FCX A;  4UT3 B;  5JPE A;  4ZX2 A;  1TCO A;  4UWQ A;  1AUI A;  1T70 A;  2A22 A;  2QFR A;  2NYM C;  5EQV A;  2BQ8 X;  4YKE A;  3IB8 A;  4WWL A;  4ORA A;  1JK7 A;  1W24 A;  4IYP C;  4O5G A;  3AV0 A;  1FJM A;  4H2G A;  2NXF A;  5DNY A;  4MOY A;  4KBP A;  1V73 A;  2YVT A;  1OIE A;  3H69 A;  4ZVZ A;  5INB A;  1NNW A;  3JYF A;  5IOH A;  5JPF A;  5JJT A;  3E7B A;  2QJC A;  3H61 A;  2BCD A;  3PSO A;  4DHL A;  1S70 A;  2R17 A;  2WDF A;  3AUZ A;  4V0V A;  4O43 A; 
#chains in the Genus database with same CATH topology
 4BMJ A;  4R03 A;  2L8T A;  1MEY C;  5AE1 A;  2NUG A;  3RMP A;  4HD0 A;  2WCC 3;  2EN8 A;  2USH A;  3DSD A;  1P47 A;  2EMW A;  1M63 A;  2EMY A;  1FKA E;  1S3M A;  4F6N A;  1T4L B;  4P7D A;  4ZYE A;  2YTN A;  5KL7 A;  3H63 A;  2LT7 A;  2XMO A;  4JA9 A;  5A6B D;  1AAY A;  2EOS A;  2LV2 A;  1A1I A;  1PDA A;  2YTI A;  1HR0 E;  3OTO E;  2DSY A;  5TSE A;  1QU6 A;  1IQS A;  2BDX A;  4B3R E;  2YT4 A;  2EM8 A;  5KL3 A;  3C4B A;  1GQE A;  2O8G A;  2EMI A;  4DMI A;  2HGH A;  3HPS A;  5AC4 A;  1ZR9 A;  2N3G A;  4R8O A;  5IWA E;  3T1Y E;  4OX9 E;  1WXR A;  4DR7 E;  4MP0 A;  4Q7F A;  5HPE A;  2QFP A;  5J28 A;  4LTY A;  2UXB E;  2EL4 A;  2EMX A;  3LML A;  1SU1 A;  2JY9 A;  1X6F A;  4H2B A;  1ZU1 A;  2EN7 A;  2EPX A;  2YTF A;  3IWB A;  3F6G A;  4BBY A;  2VQE E;  2EOY A;  2KON A;  4DV6 E;  4H1Y P;  2V83 A;  3DJW A;  2EOO A;  1ZBT A;  4WYQ B;  4ORC A;  3HPZ A;  2IHR 1;  4RHB B;  2RTX A;  1YSA C;  2GPI A;  2EOJ A;  3EGH A;  5KL5 A;  4NXN E;  2Z72 A;  2H36 X;  1WRJ A;  4X66 E;  1YUI A;  3E0J A;  3J80 C;  3QFN A;  2B7T A;  2KHX A;  4R2Q A;  1IMU A;  2WDE A;  2ZBM A;  2EOR A;  2EP3 A;  2YTD A;  2Z1A A;  3EGG A;  2ZO9 B;  4V0X A;  2DFJ A;  2UU9 E;  2JXP A;  2L3J A;  2EZ6 A;  1G2F C;  3IVD A;  1N34 E;  4BHB A;  4JI4 E;  1SFE A;  4UT2 A;  2EM0 A;  4ZYG A;  1HNW E;  1WHN A;  4KWY A;  4LF4 E;  2UUB E;  2JOX A;  4FCX A;  1ZAA C;  2A22 A;  2B7V A;  4WSG A;  2QFR A;  2M7Q A;  5EQV A;  2EQ3 A;  3FIG A;  4LF8 E;  1GTK A;  5AE2 A;  4DV0 E;  1LLM C;  1JK7 A;  3VYX A;  2HC5 A;  2EM9 A;  5DNY A;  2NXF A;  1FJG E;  3EQ1 A;  2WBS A;  1V73 A;  3MHS C;  1X3C A;  2V87 A;  1OIE A;  2DB2 A;  3H69 A;  3JYF A;  4I8O A;  4JI1 E;  2QJC A;  1SR9 A;  4BHC A;  4Q28 A;  1EKZ A;  1I94 E;  1AH5 A;  1S70 A;  1YYO A;  3AUZ A;  5AE3 A;  2RS7 A;  3IWD A;  2ENA A;  2LO3 A;  2DMI A;  1S3L A;  4JI5 E;  2I13 A;  2EPP A;  2ELZ A;  1XM7 A;  2AHD A;  2YEQ A;  2ADR A;  4DV3 E;  2Z06 A;  3ADL A;  2EM6 A;  2EJ4 A;  5C1V A;  3E7A A;  2LRS A;  5BR8 E;  2EMC A;  2V88 A;  2EN2 A;  2YU8 A;  1QNT A;  2EOI A;  4I5N C;  3K6Q A;  2LTR A;  4H2I A;  2MC6 A;  4FBQ A;  2N8X A;  1UTE A;  5FLX C;  3BBG A;  1BBG A;  3TGH A;  1L4S A;  3HVQ A;  1PKP A;  1WAO 1;  2LCE A;  3ICF A;  3JU0 A;  3ZU0 A;  2EPA A;  3ZTV A;  3IVE A;  2YZT A;  2JR1 A;  3EPJ A;  2EM4 A;  4F9C B;  3KZY A;  4DV4 E;  3MHH C;  1MGT A;  4LF7 E;  1OID A;  1QFC A;  3H68 A;  2UXC E;  2EL5 A;  4FBK A;  3RL5 A;  2EPO A;  2VE7 C;  2E5L E;  1B69 A;  4NHR A;  4R2P A;  4G9J A;  1DI2 A;  4GKJ E;  1YZ9 A;  2YPN A;  2P6B A;  1EH8 A;  4DSY A;  5B8I A;  2EN1 A;  4F9B B;  2L2M A;  5IXM B;  2WDD A;  4H2F A;  2EPM X;  4WXD A;  2L6M A;  3MSW A;  4LFA E;  2G7H A;  4DR2 E;  2LMZ A;  1F2I G;  4DR3 E;  1S8E A;  4ZYH A;  4J8Z A;  4DT2 A;  2GJU A;  3H62 B;  3ADJ A;  1JK1 A;  4F2J C;  1UF3 A;  4MLV A;  4FK5 C;  3P71 C;  2LE2 A;  2NAB A;  5KL6 A;  2ELY A;  1JK2 A;  4TUG A;  1DQ3 A;  2FTX B;  2UXD E;  2ODR C;  1RC7 A;  3QG5 C;  2LJH A;  2DLQ A;  1STU A;  2YTJ A;  4DV2 E;  2YSP A;  4KZS A;  2JVA A;  3F6H A;  1IBK E;  2V89 A;  4UT3 A;  1X6H A;  1N3G A;  3C4T A;  1ZBQ A;  2RQL A;  5A6B A;  4O24 A;  3DW8 C;  4DR5 E;  2MKN A;  2LTS A;  4R2E A;  3TQM A;  1AUI A;  2MKD A;  4F6M A;  1GZ6 A;  1A1F A;  4ZYD A;  1W24 A;  1A1H A;  1RMD A;  2B3T B;  2EOQ A;  2EN3 A;  4H2G A;  1PJS A;  2YWQ A;  4HEI A;  2F4V E;  4KBP A;  4MOY A;  3BID A;  1X5W A;  2DMY A;  3BGH A;  2YTG A;  2NUF A;  1KJK A;  2R1F A;  1O0W A;  3PSO A;  2EMG A;  2R17 A;  1J5E E;  4V0V A;  4O43 A;  3DSC A;  4M9V C;  2KOU A;  2L92 A;  2F8B A;  4WFT A;  4YHH E;  2YTO A;  4LAC C;  4F54 A;  2UUC E;  4WXC A;  3ADI A;  2FGG A;  5F3W A;  3FLO A;  3H66 A;  2YRK A;  3RQZ A;  3THO B;  3J7Y p;  3IWC A;  3ADG A;  4R2D A;  2NA2 A;  2EM7 A;  4L8N A;  3C9F A;  5AC5 A;  2EML A;  2EMH A;  2VRD A;  4IL1 A;  2L3C A;  4B3S E;  2WDC A;  2LUQ A;  1XMQ E;  1TN9 A;  3VK6 A;  1IT6 A;  1USH A;  1UHZ A;  4DUZ E;  2IAE C;  4BCA A;  5KL4 A;  3QFO A;  2EN6 A;  4LFB E;  2R76 A;  3RL3 A;  4LF9 E;  4JI6 E;  1YYK A;  1XNQ E;  2HYP A;  2JOB A;  4LFC E;  2EQ0 A;  2ZM6 E;  3H64 A;  2M4I A;  2LUP B;  1YYW A;  2K7I A;  1HNX E;  2ODR D;  1II7 A;  1A1L A;  2RSI A;  1EH7 A;  4RH8 A;  1T39 A;  4JI3 E;  2E72 A;  2EM3 A;  4LU9 A;  2EPC A;  5LL6 R;  5A69 A;  2LBS B;  1WHQ A;  2L2N A;  3FGA C;  2EMA A;  4M0V A;  3T1H E;  3UK3 C;  2LJU A;  2DGC A;  1A1G A;  1PJQ A;  2DXN A;  2V85 A;  1S95 A;  2EMF A;  3C5W C;  4B3M E;  1X48 A;  4JV5 E;  2RS6 A;  4DV1 E;  1T71 A;  3J7A G;  2RPC A;  4BC7 A;  3P1X A;  3VYY A;  2EPU A;  5AAS A;  4IJD A;  4WSP A;  5IV8 B;  2M1S A;  3T1I A;  1X49 A;  2EPK X;  1T4N A;  1YPN A;  1HO5 A;  4GKK E;  4F9A B;  4X62 E;  2WBU A;  1BB8 A;  1TF3 A;  2MDG A;  2JP9 A;  4R2C A;  1N33 E;  2PRT A;  1QHW A;  1N32 E;  4KKZ A;  2EOZ A;  2LVH A;  1WAR A;  1DGC A;  2J7J A;  2EPZ A;  1HP1 A;  2DIX A;  4BS9 A;  5JPE A;  2WBT A;  2A25 A;  1N36 E;  4UWQ A;  1T70 A;  2NYM C;  2CPN A;  3D03 A;  2NUE A;  1EH6 A;  3IB8 A;  2WZO A;  4WWL A;  1X47 A;  2YRM A;  5A6A A;  4O5G A;  4IYP C;  2EM2 A;  1A1J A;  2EM5 A;  1IQO A;  3LLH A;  3J81 C;  2JWO A;  4ZVZ A;  4X65 E;  4DR1 E;  2BB8 A;  1NNW A;  5JJT A;  4DKK A;  4OOG C;  3E7B A;  2RSM A;  3H61 A;  2YTP A;  4YY3 E;  2WDF A;  4JI7 E;  3JTZ A;  1J26 A;  3ECR A;  4FBW A;  2DRP A;  3OML A;  1KBP A;  2EPN A;  5CFF E;  1HNZ E;  1UN6 B;  2JOG A;  3K7W C;  1WJP A;  1Z2X A;  1BBO A;  4DV7 E;  4WX9 A;  4AQY E;  4O4K A;  1S3N A;  3RL4 A;  1PJT A;  4DUY E;  2EPL X;  1Z1B A;  2ENH A;  3EPK A;  4JI8 E;  1UBD C;  1XZW A;  1X6E A;  4XPN A;  3QFM A;  2EMB A;  2HJJ A;  2I9I A;  5KL2 A;  4NXM E;  4R2S A;  3LL8 A;  5T6J A;  4MOV A;  4F0Z A;  3M99 B;  5A6K A;  3K7V C;  2GHF A;  2UUA E;  4DV5 E;  2V86 A;  2CT1 A;  2D9H A;  4R2A A;  3VHT B;  3KZZ A;  2EL6 A;  5LMN E;  2ENC A;  4HTG A;  1XNR E;  5GTU A;  4B3T E;  2CV9 A;  4H1S A;  3KWR A;  2EN4 A;  2YRH A;  3IB7 A;  2ZOA A;  1A1K A;  3QFK A;  4I5L C;  2CSH A;  2EOX A;  4DR4 E;  3N5U A;  1G2D C;  2MC5 A;  2V8Q B;  4X64 E;  4X9J A;  4L5N C;  1IBL E;  2EE8 A;  4JI2 E;  1OI8 A;  2L2K B;  4JI0 E;  4B2O A;  1IBM E;  2EOM A;  2O8A A;  2YTQ A;  3THN A;  3EPL A;  4WPY A;  4KHP E;  1G5B A;  3BF2 A;  2HYO A;  3HTX A;  2IE4 C;  3PSN A;  4P78 A;  2DXL A;  2N3H A;  3C6M A;  2EOF A;  4GEQ B;  4N4R B;  3H67 A;  2JYA A;  1YUJ A;  2GLI A;  4OR9 A;  3H60 A;  4MLQ A;  3GVE A;  2BBG A;  4DR6 E;  4IS1 C;  2HY1 A;  3L00 A;  2MDR A;  1RQ0 A;  2EWL A;  1T38 A;  1HPU A;  2Q8U A;  4ORB A;  2KKN A;  2FV4 B;  3HQ1 A;  4LF6 E;  2EQ1 A;  1NCS A;  2L33 A;  5IT9 C;  5A2Q C;  4GZN C;  4LF5 E;  2IE3 C;  2EOE A;  2EMZ A;  3KBP A;  4V0W A;  1YFH A;  4JYA E;  4JA7 A;  2E1M A;  1Z2W A;  3DF6 A;  4J6O A;  2NPP C;  2NYL C;  3C6K A;  1MF8 A;  3H09 A;  3EPH A;  2YSO A;  3V4Y A;  2DLK A;  2VF1 A;  4TUI A;  5ADZ A;  1UIL A;  2YTE A;  4BC9 A;  1U32 A;  4NZV A;  3CK2 A;  1KYQ A;  4UT3 B;  4M2Z A;  4ZX2 A;  2JPA A;  1TCO A;  2BQ8 X;  4YKE A;  4X8W A;  4ORA A;  1NEI A;  4M30 A;  3JAM C;  3ZOQ B;  2YU5 A;  1TF6 A;  2CTD A;  3AV0 A;  1FJM A;  4K0K E;  2B9D A;  2YVT A;  2HHH E;  5INB A;  2EMK A;  5IOH A;  5JPF A;  1T4O A;  2EPR A;  5LLQ A;  2M9A A;  3HXL A;  4R2R A;  4Q35 B;  5A6J A;  2VQF E;  2EOH A;  5LMU E;  2BCD A;  4DHL A;  1XMO E;  2K4V A; 
#chains in the Genus database with same CATH homology
 4FBW A;  4V0V A;  1S3L A;  1KBP A;  4HD0 A;  4LAC C;  2USH A;  2JOG A;  3DSD A;  3K7W C;  1XM7 A;  1Z2X A;  3FLO A;  5F3W A;  1M63 A;  2AHD A;  2YEQ A;  1S3M A;  3H66 A;  1S3N A;  3RQZ A;  4O4K A;  3THO B;  3RL4 A;  2Z06 A;  3H63 A;  5C1V A;  3E7A A;  2XMO A;  4JA9 A;  3C9F A;  1XZW A;  4I5N C;  4IL1 A;  2WDC A;  4XPN A;  3QFM A;  3LL8 A;  4H2I A;  1IT6 A;  4FBQ A;  1USH A;  4MOV A;  1UTE A;  2BDX A;  3K7V C;  2IAE C;  3QFO A;  3TGH A;  3RL3 A;  3HVQ A;  1WAO 1;  3ICF A;  2O8G A;  2HYP A;  4F0Z A;  3ZU0 A;  3ZTV A;  5GTU A;  3IVE A;  2CV9 A;  4H1S A;  3H64 A;  1QFC A;  1OID A;  3H68 A;  3IB7 A;  4FBK A;  2ZOA A;  3RL5 A;  3QFK A;  1II7 A;  4I5L C;  3N5U A;  4MP0 A;  4Q7F A;  1OI8 A;  2QFP A;  5HPE A;  5J28 A;  4LU9 A;  4LTY A;  4B2O A;  4G9J A;  2O8A A;  1SU1 A;  3THN A;  1G5B A;  2P6B A;  3FGA C;  4H2B A;  4DSY A;  5B8I A;  2HYO A;  4M0V A;  2IE4 C;  2WDD A;  3PSN A;  2DXL A;  2DXN A;  1S95 A;  4H2F A;  3H67 A;  4OR9 A;  3C5W C;  3H60 A;  3GVE A;  4H1Y P;  1S8E A;  2HY1 A;  4ORC A;  1T71 A;  4DT2 A;  2GJU A;  3H62 B;  1HPU A;  1UF3 A;  2Q8U A;  3P71 C;  4ORB A;  2KKN A;  3EGH A;  2Z72 A;  3T1I A;  3E0J A;  4TUG A;  3QFN A;  1HO5 A;  2ZBM A;  2WDE A;  2IE3 C;  3KBP A;  4V0W A;  4JA7 A;  1Z2W A;  2Z1A A;  4V0X A;  3EGG A;  2ZO9 B;  2DFJ A;  3QG5 C;  1QHW A;  4J6O A;  2NPP C;  2NYL C;  4KKZ A;  3IVD A;  1MF8 A;  1WAR A;  3V4Y A;  4UT3 A;  4TUI A;  1HP1 A;  3DW8 C;  4O24 A;  4UT2 A;  1U32 A;  4NZV A;  3CK2 A;  4FCX A;  4UT3 B;  5JPE A;  4ZX2 A;  1TCO A;  4UWQ A;  1AUI A;  1T70 A;  2A22 A;  2QFR A;  2NYM C;  3D03 A;  5EQV A;  2BQ8 X;  4YKE A;  3IB8 A;  4WWL A;  4ORA A;  1JK7 A;  1W24 A;  4IYP C;  4O5G A;  3AV0 A;  1FJM A;  4H2G A;  2NXF A;  5DNY A;  4MOY A;  4KBP A;  1V73 A;  2YVT A;  1OIE A;  3H69 A;  4ZVZ A;  5INB A;  1NNW A;  3JYF A;  5IOH A;  5JPF A;  5JJT A;  3E7B A;  2QJC A;  3H61 A;  2BCD A;  3PSO A;  4DHL A;  1S70 A;  2R17 A;  2WDF A;  3AUZ A;  3DSC A;  4O43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...