4NZVA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
329
Chain Sequence
HHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 110
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4nzvA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4nzvA01
3K7VC 1WAO1 4LACC 4V0XA 1II7A 2XMOA 5GTUA 1AUIA 4IYPC 4O24A 4TUGA 3QFMA 4YKEA 1S3LA 4H2BA 3THOB 3H66A 1QHWA 4ORAA 5J28A 1QFCA 2WDEA 1OI8A 4JA9A 2O8GA 3RL4A 4HD0A 4ZVZA 1OIEA 1XM7A 3EGHA 1Z2XA 2BQ8X 4J6OA 3C5WC 2HYOA 4LTYA 1V73A 2USHA 3DSDA 1Z2WA 2YVTA 4H2IA 5C1VA 4DT2A 3GVEA 3H64A 2BDXA 3ZTVA 5B8IA 4OR9A 1M63A 3C9FA 3DW8C 4KBPA 4IL1A 1T70A 4FBQA 4KKZA 4JA7A 2R17A 2NYLC 3EGGA 3H69A 4FBKA 3ZU0A 3ICFA 5INBA 1HO5A 2Z06A 3K7WC 2O8AA 3TGHA 2Q8UA 4FCXA 1T71A 1S95A 3IVDA 1G5BA 1FJMA 1UF3A 1NNWA 4V0WA 4M0VA 5DNYA 4UT3B 3E7AA 3KBPA 2QFRA 2P6BA 2Z1AA 1W24A 1XZWA 3IVEA 3E7BA 3V4YA 3LL8A 2ZBMA 3QFNA 3QFOA 4G9JA 1HPUA 4DSYA 4F0ZA 1S70A 4O43A 3IB7A 3RL3A 4ZX2A 1S3MA 4DHLA 3THNA 2NYMC 3H60A 4H2FA 5JJTA 4LU9A 4UWQA 4ORBA 3QFKA 4Q7FA 3IB8A 3T1IA 3H62B 2DFJA 3PSNA 4V0VA 5HPEA 2AHDA 2QJCA 1JK7A 2WDFA 2NXFA 4MOYA 3PSOA 4MP0A 4FBWA 4MOVA 2IE4C 1OIDA 1TCOA 4B2OA 4TUIA 3AV0A 1USHA 3RQZA 4ORCA 2IE3C 3QG5C 1IT6A 1S8EA 2GJUA 3HVQA 2NPPC 3H67A 4H2GA 2HYPA 2WDDA 3JYFA 1S3NA 4H1YP 1UTEA 1U32A 2CV9A 4XPNA 3AUZA 4H1SA 2HY1A 2QFPA 5EQVA 3H61A 5F3WA 2KKNA 3RL5A 3H68A 2BCDA 1WARA 4O4KA 1HP1A 4NZVA 2WDCA 3CK2A 4I5LC 1MF8A 4O5GA 3P71C 5JPFA 4I5NC 2Z72A 2IAEC 3FGAC 4WWLA 4UT3A 5JPEA 3DSCA 2A22A 2JOGA 3H63A 5IOHA 4UT2A 3N5UA 1SU1A 1KBPA
chains in the Genus database with same CATH superfamily
3C6KA 1A1IA 1GTKA 2FTXB 2JP9A 1G2FC 4BS9A 1II7A 2EOJA 3MSWA 3E0JA 2EJ4A 2YRHA 5AE2A 4JI4E 2LRSA 1S3LA 1PJQA 2ZOAA 1QNTA 1MEYC 4H2BA 4ORAA 2EPKX 3EPHA 2F8BA 4HD0A 2HGHA 2L6MA 3J7AG 1Z2XA 4L5NC 4LTYA 3RMPA 1Z2WA 1YSAC 2YVTA 5C1VA 4DT2A 2V88A 5A2QC 2EPPA 4IS1C 2UU9E 2M4IA 2E72A 3MHHC 4KKZA 2YT4A 4JA7A 2RS6A 1YYKA 2NYLC 3EGGA 5INBA 4FBKA 2EM7A 4F9BB 1XNQE 1HO5A 3K7WC 2EL5A 2ENCA 1YZ9A 2LT7A 4B3SE 4V0WA 2V87A 3KBPA 2JR1A 4DR2E 2HHHE 2Z1AA 4LF4E 1GZ6A 1LLMC 3E7BA 3L00A 1X6FA 3QFOA 4DV6E 4JI0E 1B69A 2EQ0A 2L3CA 2EPLX 4DKKA 3IB7A 4DSYA 4ZX2A 2FV4B 5LMUE 2CPNA 2JXPA 4DHLA 1PKPA 3THNA 4WX9A 3H60A 1NCSA 1T4NA 5JJTA 1X48A 4L8NA 4F9CB 4ORBA 3QFKA 4Q7FA 3T1IA 1X47A 2EPMX 2WBSA 2H36X 2EM9A 3J81C 2DFJA 2EL6A 1JK7A 2WDFA 4MOYA 1STUA 2YTDA 4MP0A 2LTSA 1EH6A 1BBOA 2YTGA 2CT1A 4I8OA 2F4VE 2YTJA 1XMQE 1IQSA 2EOQA 3HVQA 3H67A 4DMIA 3IWBA 2NUFA 2LE2A 5FLXC 2YU5A 4R2EA 4IJDA 4H1YP 3BIDA 2LJUA 4OX9E 4ZYHA 4H1SA 3ECRA 2J7JA 2HY1A 2EMHA 2EM0A 3K6QA 4R2QA 3BF2A 2EMGA 4I5LC 3P71C 2CTDA 2E5LE 2EM6A 5JPEA 4P7DA 3OTOE 1IBLE 2EOMA 2V89A 4M2ZA 5BR8E 1IBME 2JOGA 2KHXA 3TGHA 2YSOA 1XMOE 1KBPA 5AE3A 4YY3E 4B3TE 2CSHA 2YPNA 2LBSB 5KL5A 2ADRA 2JYAA 1WAO1 2I9IA 5IV8B 1FJGE 5LL6R 1A1HA 2XMOA 2DMYA 1N36E 2DLQA 2WBUA 1WRJA 4O24A 5CFFE 1WXRA 1XNRE 4JYAE 3HPSA 3THOB 3H66A 5IWAE 4LF5E 1J26A 5J28A 2WDEA 2L92A 1OI8A 4KWYA 3RL4A 4ZVZA 4DUYE 1XM7A 3EGHA 2NABA 3UK3C 2WZOA 2VF1A 3ADGA 2DB2A 3DSDA 1JK2A 4R2PA 1YUIA 2EMBA 4H2IA 2YWQA 3GVEA 3ZTVA 2DRPA 4HEIA 2LTRA 3ADJA 2L2NA 1YYWA 4LFAE 4FBQA 4P78A 4R2SA 3KZZA 4JI7E 4BBYA 2Z06A 2YRKA 3JAMC 2Q8UA 4FCXA 2MDRA 2RPCA 2G7HA 1T71A 1S95A 2EN1A 1G5BA 1WHQA 5AC5A 4DUZE 2EM3A 1X6HA 3IWCA 2P6BA 5KL2A 4DV5E 2EE8A 2EMFA 2LVHA 2MC5A 3HQ1A 4R2CA 4RH8A 5A6BD 5LMNE 2L33A 3V4YA 3LL8A 1T38A 2ZBMA 2WBTA 2YTFA 2LUPB 4JI5E 4F0ZA 4R2RA 4BC7A 1SFEA 1TF3A 1YYOA 1A1JA 1PDAA 2EORA 2EQ1A 2V8QB 4DR5E 2YTPA 5ADZA 2V83A 2DIXA 1DI2A 1N34E 3VK6A 5HPEA 3VYYA 2AHDA 2QJCA 2NXFA 4KZSA 1HR0E 1SR9A 4MOVA 2IE4C 4B2OA 4TUIA 2M7QA 2JVAA 4F2JC 4F6MA 2V85A 2UUCE 1IT6A 1YPNA 4GZNC 2GJUA 4WFTA 4NXME 2RQLA 4GKJE 2WDDA 3C4BA 4F6NA 3JYFA 2DLKA 3EPLA 2EN3A 2EMCA 2L2MA 4X65E 2L2KB 2EN8A 1U32A 3AUZA 4LF7E 2RTXA 1T4OA 4BMJA 5EQVA 5F3WA 4ZYGA 2EMLA 1HNWE 2ENHA 2EMAA 1ZBQA 2R76A 1JK1A 2EL4A 4O4KA 1HP1A 2E1MA 2EMWA 5KL3A 4O5GA 1MF8A 2YSPA 3F6GA 4I5NC 2Z72A 1ZU1A 1ZBTA 4DR4E 2VQEE 1J5EE 1IMUA 3DSCA 5IXMB 4MLQA 1DQ3A 2LV2A 4WSPA 2EM8A 2UXCE 5IOHA 4UT2A 2RS7A 4DV4E 2JOXA 2D9HA 3K7VC 2YTEA 2UXDE 2KOUA 2EN7A 2YRMA 2EOZA 4LACC 1N32E 1L4SA 4F54A 4V0XA 2EZ6A 3TQMA 1HNZE 1AUIA 5GTUA 4IYPC 4DR1E 3HXLA 2YEQA 4TUGA 4M9VC 2NA2A 4YKEA 3DF6A 3EPKA 1IQOA 2M9AA 4F9AB 1T4LB 2LCEA 4WYQB 1BB8A 1QHWA 1QFCA 2MKDA 4JA9A 4DR3E 2WCC3 2O8GA 4N4RB 2ZO9B 3D03A 2YU8A 4Q28A 4J6OA 3C5WC 2HYOA 5AASA 3FIGA 1NEIA 2ZM6E 2EOHA 1HNXE 4JV5E 4LFCE 2KONA 2BDXA 3H64A 2RSIA 2PRTA 2MDGA 3EQ1A 4OR9A 1N3GA 1M63A 3C9FA 4KBPA 4J8ZA 1TF6A 4DV3E 3C6MA 1T70A 2EMZA 4WPYA 1UBDC 4ZYDA 1EH8A 3H69A 2K4VA 2A25A 3J7Yp 1AH5A 1KYQA 3EPJA 3T1YE 2L8TA 5A6AA 1UN6B 4BHCA 1F2IG 1A1KA 2DGCA 4R8OA 1Z1BA 4R2AA 2DMIA 4ZYEA 4X66E 4UT3B 1G2DC 2EMIA 4DV0E 3OMLA 2IHR1 2EOOA 1XZWA 5IT9C 3IVEA 4RHBB 3QFNA 4G9JA 3MHSC 2FGGA 4WXCA 2GLIA 2JY9A 2UXBE 3KWRA 4O43A 3F6HA 3RL3A 1S3MA 2LUQA 1WHNA 4NHRA 4B3RE 2EPXA 2VE7C 4LU9A 4UWQA 2LJHA 2ENAA 2EM4A 3M99B 2HJJA 2L3JA 2BBGA 4DR7E 3PSNA 4FK5C 2EPZA 4DR6E 4JI6E 1KJKA 1RC7A 3PSOA 2EPCA 4FBWA 5AE1A 4YHHE 1OIDA 2EPUA 3AV0A 4X62E 3RQZA 5A69A 4BCAA 2VQFE 3VYXA 4GEQB 1MGTA 2NPPC 2EQ3A 2EWLA 3P1XA 2N8XA 1S3NA 1UTEA 5A6KA 1WJPA 2EMXA 2DSYA 1IBKE 4XPNA 4KHPE 2EMKA 4LF9E 1A1GA 3JU0A 1AAYA 2KKNA 3RL5A 5TSEA 1I94E 3CK2A 2YTNA 1RQ0A 1A1LA 4UT3A 2IAEC 4WWLA 3ADLA 2B7TA 3C4TA 2R1FA 4K0KE 2JWOA 2A22A 5A6JA 4JI8E 1SU1A 3VHTB 2B3TB 2EM5A 5AC4A 4DV7E 4BC9A 2EPOA 5T6JA 4JI3E 1ZAAC 2ODRD 1UHZA 1X6EA 3QFMA 2I13A 2EOSA 1N33E 4JI1E 2YZTA 2VRDA 4BHBA 5A6BA 2EOFA 4LF8E 3BBGA 1OIEA 2EN2A 2EPRA 1O0WA 1P47A 1GQEA 2BQ8X 1V73A 2USHA 2EOYA 3ZOQB 2NUEA 2EM2A 5B8IA 2ELZA 3DW8C 4IL1A 2ODRC 2EN4A 2BB8A 2R17A 4LFBE 4M30A 4DV2E 4HTGA 3ICFA 3BGHA 4DV1E 3ZU0A 3DJWA 4GKKE 1PJSA 1FKAE 2O8AA 4X9JA 4OOGC 3IVDA 1YFHA 3KZYA 2MKNA 3IWDA 1FJMA 1UF3A 1NNWA 4LF6E 4M0VA 5DNYA 1TN9A 1UILA 2LMZA 3E7AA 2QFRA 2UUAE 1W24A 1PJTA 3H09A 4B3ME 1HPUA 1S70A 3LMLA 2NUGA 2JOBA 2M1SA 2EPNA 2DXNA 2GHFA 2NYMC 4H2FA 1EKZA 2EPAA 2ELYA 2DXLA 1QU6A 2YTIA 3HTXA 3IB8A 5LLQA 1DGCA 4WXDA 2EMYA 3H62B 4V0VA 2LO3A 1A1FA 2K7IA 3HPZA 2EOXA 2N3GA 4Q35B 1TCOA 1USHA 4WSGA 4ORCA 1X5WA 4NXNE 3QG5C 2IE3C 2EN6A 1S8EA 4AQYE 2HC5A 4H2GA 2HYPA 3JTZA 4JI2E 4MLVA 2EOIA 2CV9A 4R03A 2GPIA 2QFPA 3J80C 5KL4A 2JPAA 1ZR9A 3H61A 2EOEA 5KL7A 1YUJA 2YTQA 4R2DA 2V86A 2MC6A 3H68A 3ADIA 2BCDA 1WARA 2YTOA 2B9DA 4NZVA 2WDCA 1RMDA 5KL6A 2B7VA 5JPFA 3FLOA 2EP3A 4X8WA 3FGAC 1BBGA 2N3HA 3LLHA 2UUBE 1X49A 4X64E 3H63A 2RSMA 1X3CA 1T39A 3N5UA 3T1HE 1EH7A
chains in the Genus database with same CATH topology
3K7VC 1WAO1 4LACC 4V0XA 1II7A 3E0JA 2XMOA 5GTUA 1AUIA 4IYPC 2YEQA 4O24A 4TUGA 3QFMA 4YKEA 1S3LA 2ZOAA 4H2BA 3THOB 3H66A 1QHWA 4ORAA 5J28A 1QFCA 2WDEA 1OI8A 4JA9A 2O8GA 3RL4A 4HD0A 2ZO9B 3D03A 4ZVZA 1OIEA 1XM7A 3EGHA 1Z2XA 2BQ8X 4J6OA 3C5WC 2HYOA 4LTYA 1V73A 2USHA 3DSDA 1Z2WA 2YVTA 4H2IA 5C1VA 4DT2A 3GVEA 3H64A 2BDXA 3ZTVA 5B8IA 4OR9A 1M63A 3C9FA 3DW8C 4KBPA 4IL1A 1T70A 4FBQA 4KKZA 4JA7A 2R17A 2NYLC 3EGGA 3H69A 4FBKA 3ZU0A 3ICFA 5INBA 1HO5A 2Z06A 3K7WC 2O8AA 3TGHA 2Q8UA 4FCXA 1T71A 1S95A 3IVDA 1G5BA 1FJMA 1UF3A 1NNWA 4V0WA 4M0VA 5DNYA 4UT3B 3E7AA 3KBPA 2QFRA 2P6BA 2Z1AA 1W24A 1XZWA 3IVEA 3E7BA 3V4YA 3LL8A 2ZBMA 3QFNA 3QFOA 4G9JA 1HPUA 4DSYA 4F0ZA 1S70A 4O43A 3IB7A 3RL3A 4ZX2A 1S3MA 4DHLA 2DXNA 3THNA 2NYMC 3H60A 4H2FA 5JJTA 4LU9A 2DXLA 4UWQA 4ORBA 3QFKA 4Q7FA 3IB8A 3T1IA 3H62B 2DFJA 3PSNA 4V0VA 5HPEA 2AHDA 1JK7A 2QJCA 2WDFA 2NXFA 4MOYA 3PSOA 4MP0A 4FBWA 4MOVA 2IE4C 1OIDA 1TCOA 4B2OA 4TUIA 3AV0A 1USHA 3RQZA 4ORCA 2IE3C 3QG5C 1IT6A 1S8EA 2GJUA 3HVQA 2NPPC 3H67A 4H2GA 2HYPA 2WDDA 3JYFA 1S3NA 4H1YP 1UTEA 1U32A 2CV9A 4XPNA 3AUZA 4H1SA 2HY1A 2QFPA 5EQVA 3H61A 5F3WA 2KKNA 3RL5A 3H68A 2BCDA 1WARA 4O4KA 1HP1A 4NZVA 2WDCA 3CK2A 4I5LC 1MF8A 4O5GA 3P71C 5JPFA 4I5NC 2Z72A 2IAEC 3FGAC 3FLOA 4WWLA 4UT3A 5JPEA 3DSCA 2A22A 2JOGA 3H63A 5IOHA 4UT2A 3N5UA 1SU1A 1KBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7V C;  1WAO 1;  4LAC C;  4V0X A;  1II7 A;  2XMO A;  5GTU A;  1AUI A;  4IYP C;  4O24 A;  4TUG A;  3QFM A;  4YKE A;  1S3L A;  4H2B A;  3THO B;  3H66 A;  1QHW A;  4ORA A;  5J28 A;  1QFC A;  2WDE A;  1OI8 A;  4JA9 A;  2O8G A;  3RL4 A;  4HD0 A;  4ZVZ A;  1OIE A;  1XM7 A;  3EGH A;  1Z2X A;  2BQ8 X;  4J6O A;  3C5W C;  2HYO A;  4LTY A;  1V73 A;  2USH A;  3DSD A;  1Z2W A;  2YVT A;  4H2I A;  5C1V A;  4DT2 A;  3GVE A;  3H64 A;  2BDX A;  3ZTV A;  5B8I A;  4OR9 A;  1M63 A;  3C9F A;  3DW8 C;  4KBP A;  4IL1 A;  1T70 A;  4FBQ A;  4KKZ A;  4JA7 A;  2R17 A;  2NYL C;  3EGG A;  3H69 A;  4FBK A;  3ZU0 A;  3ICF A;  5INB A;  1HO5 A;  2Z06 A;  3K7W C;  2O8A A;  3TGH A;  2Q8U A;  4FCX A;  1T71 A;  1S95 A;  3IVD A;  1G5B A;  1FJM A;  1UF3 A;  1NNW A;  4V0W A;  4M0V A;  5DNY A;  4UT3 B;  3E7A A;  3KBP A;  2QFR A;  2P6B A;  2Z1A A;  1W24 A;  1XZW A;  3IVE A;  3E7B A;  3V4Y A;  3LL8 A;  2ZBM A;  3QFN A;  3QFO A;  4G9J A;  1HPU A;  4DSY A;  4F0Z A;  1S70 A;  4O43 A;  3IB7 A;  3RL3 A;  4ZX2 A;  1S3M A;  4DHL A;  3THN A;  2NYM C;  3H60 A;  4H2F A;  5JJT A;  4LU9 A;  4UWQ A;  4ORB A;  3QFK A;  4Q7F A;  3IB8 A;  3T1I A;  3H62 B;  2DFJ A;  3PSN A;  4V0V A;  5HPE A;  2AHD A;  2QJC A;  1JK7 A;  2WDF A;  2NXF A;  4MOY A;  3PSO A;  4MP0 A;  4FBW A;  4MOV A;  2IE4 C;  1OID A;  1TCO A;  4B2O A;  4TUI A;  3AV0 A;  1USH A;  3RQZ A;  4ORC A;  2IE3 C;  3QG5 C;  1IT6 A;  1S8E A;  2GJU A;  3HVQ A;  2NPP C;  3H67 A;  4H2G A;  2HYP A;  2WDD A;  3JYF A;  1S3N A;  4H1Y P;  1UTE A;  1U32 A;  2CV9 A;  4XPN A;  3AUZ A;  4H1S A;  2HY1 A;  2QFP A;  5EQV A;  3H61 A;  5F3W A;  2KKN A;  3RL5 A;  3H68 A;  2BCD A;  1WAR A;  4O4K A;  1HP1 A;  4NZV A;  2WDC A;  3CK2 A;  4I5L C;  1MF8 A;  4O5G A;  3P71 C;  5JPF A;  4I5N C;  2Z72 A;  2IAE C;  3FGA C;  4WWL A;  4UT3 A;  5JPE A;  3DSC A;  2A22 A;  2JOG A;  3H63 A;  5IOH A;  4UT2 A;  3N5U A;  1SU1 A;  1KBP A; 
#chains in the Genus database with same CATH topology
 3C6K A;  1A1I A;  1GTK A;  2FTX B;  2JP9 A;  1G2F C;  4BS9 A;  1II7 A;  2EOJ A;  3MSW A;  3E0J A;  2EJ4 A;  2YRH A;  5AE2 A;  4JI4 E;  2LRS A;  1S3L A;  1PJQ A;  2ZOA A;  1QNT A;  1MEY C;  4H2B A;  4ORA A;  2EPK X;  3EPH A;  2F8B A;  4HD0 A;  2HGH A;  2L6M A;  3J7A G;  1Z2X A;  4L5N C;  4LTY A;  3RMP A;  1Z2W A;  1YSA C;  2YVT A;  5C1V A;  4DT2 A;  2V88 A;  5A2Q C;  2EPP A;  4IS1 C;  2UU9 E;  2M4I A;  2E72 A;  3MHH C;  4KKZ A;  2YT4 A;  4JA7 A;  2RS6 A;  1YYK A;  2NYL C;  3EGG A;  5INB A;  4FBK A;  2EM7 A;  4F9B B;  1XNQ E;  1HO5 A;  3K7W C;  2EL5 A;  2ENC A;  1YZ9 A;  2LT7 A;  4B3S E;  4V0W A;  2V87 A;  3KBP A;  2JR1 A;  4DR2 E;  2HHH E;  2Z1A A;  4LF4 E;  1GZ6 A;  1LLM C;  3E7B A;  3L00 A;  1X6F A;  3QFO A;  4DV6 E;  4JI0 E;  1B69 A;  2EQ0 A;  2L3C A;  2EPL X;  4DKK A;  3IB7 A;  4DSY A;  4ZX2 A;  2FV4 B;  5LMU E;  2CPN A;  2JXP A;  4DHL A;  1PKP A;  3THN A;  4WX9 A;  3H60 A;  1NCS A;  1T4N A;  5JJT A;  1X48 A;  4L8N A;  4F9C B;  4ORB A;  3QFK A;  4Q7F A;  3T1I A;  1X47 A;  2EPM X;  2WBS A;  2H36 X;  2EM9 A;  3J81 C;  2DFJ A;  2EL6 A;  1JK7 A;  2WDF A;  4MOY A;  1STU A;  2YTD A;  4MP0 A;  2LTS A;  1EH6 A;  1BBO A;  2YTG A;  2CT1 A;  4I8O A;  2F4V E;  2YTJ A;  1XMQ E;  1IQS A;  2EOQ A;  3HVQ A;  3H67 A;  4DMI A;  3IWB A;  2NUF A;  2LE2 A;  5FLX C;  2YU5 A;  4R2E A;  4IJD A;  4H1Y P;  3BID A;  2LJU A;  4OX9 E;  4ZYH A;  4H1S A;  3ECR A;  2J7J A;  2HY1 A;  2EMH A;  2EM0 A;  3K6Q A;  4R2Q A;  3BF2 A;  2EMG A;  4I5L C;  3P71 C;  2CTD A;  2E5L E;  2EM6 A;  5JPE A;  4P7D A;  3OTO E;  1IBL E;  2EOM A;  2V89 A;  4M2Z A;  5BR8 E;  1IBM E;  2JOG A;  2KHX A;  3TGH A;  2YSO A;  1XMO E;  1KBP A;  5AE3 A;  4YY3 E;  4B3T E;  2CSH A;  2YPN A;  2LBS B;  5KL5 A;  2ADR A;  2JYA A;  1WAO 1;  2I9I A;  5IV8 B;  1FJG E;  5LL6 R;  1A1H A;  2XMO A;  2DMY A;  1N36 E;  2DLQ A;  2WBU A;  1WRJ A;  4O24 A;  5CFF E;  1WXR A;  1XNR E;  4JYA E;  3HPS A;  3THO B;  3H66 A;  5IWA E;  4LF5 E;  1J26 A;  5J28 A;  2WDE A;  2L92 A;  1OI8 A;  4KWY A;  3RL4 A;  4ZVZ A;  4DUY E;  1XM7 A;  3EGH A;  2NAB A;  3UK3 C;  2WZO A;  2VF1 A;  3ADG A;  2DB2 A;  3DSD A;  1JK2 A;  4R2P A;  1YUI A;  2EMB A;  4H2I A;  2YWQ A;  3GVE A;  3ZTV A;  2DRP A;  4HEI A;  2LTR A;  3ADJ A;  2L2N A;  1YYW A;  4LFA E;  4FBQ A;  4P78 A;  4R2S A;  3KZZ A;  4JI7 E;  4BBY A;  2Z06 A;  2YRK A;  3JAM C;  2Q8U A;  4FCX A;  2MDR A;  2RPC A;  2G7H A;  1T71 A;  1S95 A;  2EN1 A;  1G5B A;  1WHQ A;  5AC5 A;  4DUZ E;  2EM3 A;  1X6H A;  3IWC A;  2P6B A;  5KL2 A;  4DV5 E;  2EE8 A;  2EMF A;  2LVH A;  2MC5 A;  3HQ1 A;  4R2C A;  4RH8 A;  5A6B D;  5LMN E;  2L33 A;  3V4Y A;  3LL8 A;  1T38 A;  2ZBM A;  2WBT A;  2YTF A;  2LUP B;  4JI5 E;  4F0Z A;  4R2R A;  4BC7 A;  1SFE A;  1TF3 A;  1YYO A;  1A1J A;  1PDA A;  2EOR A;  2EQ1 A;  2V8Q B;  4DR5 E;  2YTP A;  5ADZ A;  2V83 A;  2DIX A;  1DI2 A;  1N34 E;  3VK6 A;  5HPE A;  3VYY A;  2AHD A;  2QJC A;  2NXF A;  4KZS A;  1HR0 E;  1SR9 A;  4MOV A;  2IE4 C;  4B2O A;  4TUI A;  2M7Q A;  2JVA A;  4F2J C;  4F6M A;  2V85 A;  2UUC E;  1IT6 A;  1YPN A;  4GZN C;  2GJU A;  4WFT A;  4NXM E;  2RQL A;  4GKJ E;  2WDD A;  3C4B A;  4F6N A;  3JYF A;  2DLK A;  3EPL A;  2EN3 A;  2EMC A;  2L2M A;  4X65 E;  2L2K B;  2EN8 A;  1U32 A;  3AUZ A;  4LF7 E;  2RTX A;  1T4O A;  4BMJ A;  5EQV A;  5F3W A;  4ZYG A;  2EML A;  1HNW E;  2ENH A;  2EMA A;  1ZBQ A;  2R76 A;  1JK1 A;  2EL4 A;  4O4K A;  1HP1 A;  2E1M A;  2EMW A;  5KL3 A;  4O5G A;  1MF8 A;  2YSP A;  3F6G A;  4I5N C;  2Z72 A;  1ZU1 A;  1ZBT A;  4DR4 E;  2VQE E;  1J5E E;  1IMU A;  3DSC A;  5IXM B;  4MLQ A;  1DQ3 A;  2LV2 A;  4WSP A;  2EM8 A;  2UXC E;  5IOH A;  4UT2 A;  2RS7 A;  4DV4 E;  2JOX A;  2D9H A;  3K7V C;  2YTE A;  2UXD E;  2KOU A;  2EN7 A;  2YRM A;  2EOZ A;  4LAC C;  1N32 E;  1L4S A;  4F54 A;  4V0X A;  2EZ6 A;  3TQM A;  1HNZ E;  1AUI A;  5GTU A;  4IYP C;  4DR1 E;  3HXL A;  2YEQ A;  4TUG A;  4M9V C;  2NA2 A;  4YKE A;  3DF6 A;  3EPK A;  1IQO A;  2M9A A;  4F9A B;  1T4L B;  2LCE A;  4WYQ B;  1BB8 A;  1QHW A;  1QFC A;  2MKD A;  4JA9 A;  4DR3 E;  2WCC 3;  2O8G A;  4N4R B;  2ZO9 B;  3D03 A;  2YU8 A;  4Q28 A;  4J6O A;  3C5W C;  2HYO A;  5AAS A;  3FIG A;  1NEI A;  2ZM6 E;  2EOH A;  1HNX E;  4JV5 E;  4LFC E;  2KON A;  2BDX A;  3H64 A;  2RSI A;  2PRT A;  2MDG A;  3EQ1 A;  4OR9 A;  1N3G A;  1M63 A;  3C9F A;  4KBP A;  4J8Z A;  1TF6 A;  4DV3 E;  3C6M A;  1T70 A;  2EMZ A;  4WPY A;  1UBD C;  4ZYD A;  1EH8 A;  3H69 A;  2K4V A;  2A25 A;  3J7Y p;  1AH5 A;  1KYQ A;  3EPJ A;  3T1Y E;  2L8T A;  5A6A A;  1UN6 B;  4BHC A;  1F2I G;  1A1K A;  2DGC A;  4R8O A;  1Z1B A;  4R2A A;  2DMI A;  4ZYE A;  4X66 E;  4UT3 B;  1G2D C;  2EMI A;  4DV0 E;  3OML A;  2IHR 1;  2EOO A;  1XZW A;  5IT9 C;  3IVE A;  4RHB B;  3QFN A;  4G9J A;  3MHS C;  2FGG A;  4WXC A;  2GLI A;  2JY9 A;  2UXB E;  3KWR A;  4O43 A;  3F6H A;  3RL3 A;  1S3M A;  2LUQ A;  1WHN A;  4NHR A;  4B3R E;  2EPX A;  2VE7 C;  4LU9 A;  4UWQ A;  2LJH A;  2ENA A;  2EM4 A;  3M99 B;  2HJJ A;  2L3J A;  2BBG A;  4DR7 E;  3PSN A;  4FK5 C;  2EPZ A;  4DR6 E;  4JI6 E;  1KJK A;  1RC7 A;  3PSO A;  2EPC A;  4FBW A;  5AE1 A;  4YHH E;  1OID A;  2EPU A;  3AV0 A;  4X62 E;  3RQZ A;  5A69 A;  4BCA A;  2VQF E;  3VYX A;  4GEQ B;  1MGT A;  2NPP C;  2EQ3 A;  2EWL A;  3P1X A;  2N8X A;  1S3N A;  1UTE A;  5A6K A;  1WJP A;  2EMX A;  2DSY A;  1IBK E;  4XPN A;  4KHP E;  2EMK A;  4LF9 E;  1A1G A;  3JU0 A;  1AAY A;  2KKN A;  3RL5 A;  5TSE A;  1I94 E;  3CK2 A;  2YTN A;  1RQ0 A;  1A1L A;  4UT3 A;  2IAE C;  4WWL A;  3ADL A;  2B7T A;  3C4T A;  2R1F A;  4K0K E;  2JWO A;  2A22 A;  5A6J A;  4JI8 E;  1SU1 A;  3VHT B;  2B3T B;  2EM5 A;  5AC4 A;  4DV7 E;  4BC9 A;  2EPO A;  5T6J A;  4JI3 E;  1ZAA C;  2ODR D;  1UHZ A;  1X6E A;  3QFM A;  2I13 A;  2EOS A;  1N33 E;  4JI1 E;  2YZT A;  2VRD A;  4BHB A;  5A6B A;  2EOF A;  4LF8 E;  3BBG A;  1OIE A;  2EN2 A;  2EPR A;  1O0W A;  1P47 A;  1GQE A;  2BQ8 X;  1V73 A;  2USH A;  2EOY A;  3ZOQ B;  2NUE A;  2EM2 A;  5B8I A;  2ELZ A;  3DW8 C;  4IL1 A;  2ODR C;  2EN4 A;  2BB8 A;  2R17 A;  4LFB E;  4M30 A;  4DV2 E;  4HTG A;  3ICF A;  3BGH A;  4DV1 E;  3ZU0 A;  3DJW A;  4GKK E;  1PJS A;  1FKA E;  2O8A A;  4X9J A;  4OOG C;  3IVD A;  1YFH A;  3KZY A;  2MKN A;  3IWD A;  1FJM A;  1UF3 A;  1NNW A;  4LF6 E;  4M0V A;  5DNY A;  1TN9 A;  1UIL A;  2LMZ A;  3E7A A;  2QFR A;  2UUA E;  1W24 A;  1PJT A;  3H09 A;  4B3M E;  1HPU A;  1S70 A;  3LML A;  2NUG A;  2JOB A;  2M1S A;  2EPN A;  2DXN A;  2GHF A;  2NYM C;  4H2F A;  1EKZ A;  2EPA A;  2ELY A;  2DXL A;  1QU6 A;  2YTI A;  3HTX A;  3IB8 A;  5LLQ A;  1DGC A;  4WXD A;  2EMY A;  3H62 B;  4V0V A;  2LO3 A;  1A1F A;  2K7I A;  3HPZ A;  2EOX A;  2N3G A;  4Q35 B;  1TCO A;  1USH A;  4WSG A;  4ORC A;  1X5W A;  4NXN E;  3QG5 C;  2IE3 C;  2EN6 A;  1S8E A;  4AQY E;  2HC5 A;  4H2G A;  2HYP A;  3JTZ A;  4JI2 E;  4MLV A;  2EOI A;  2CV9 A;  4R03 A;  2GPI A;  2QFP A;  3J80 C;  5KL4 A;  2JPA A;  1ZR9 A;  3H61 A;  2EOE A;  5KL7 A;  1YUJ A;  2YTQ A;  4R2D A;  2V86 A;  2MC6 A;  3H68 A;  3ADI A;  2BCD A;  1WAR A;  2YTO A;  2B9D A;  4NZV A;  2WDC A;  1RMD A;  5KL6 A;  2B7V A;  5JPF A;  3FLO A;  2EP3 A;  4X8W A;  3FGA C;  1BBG A;  2N3H A;  3LLH A;  2UUB E;  1X49 A;  4X64 E;  3H63 A;  2RSM A;  1X3C A;  1T39 A;  3N5U A;  3T1H E;  1EH7 A; 
#chains in the Genus database with same CATH homology
 3K7V C;  1WAO 1;  4LAC C;  4V0X A;  1II7 A;  3E0J A;  2XMO A;  5GTU A;  1AUI A;  4IYP C;  2YEQ A;  4O24 A;  4TUG A;  3QFM A;  4YKE A;  1S3L A;  2ZOA A;  4H2B A;  3THO B;  3H66 A;  1QHW A;  4ORA A;  5J28 A;  1QFC A;  2WDE A;  1OI8 A;  4JA9 A;  2O8G A;  3RL4 A;  4HD0 A;  2ZO9 B;  3D03 A;  4ZVZ A;  1OIE A;  1XM7 A;  3EGH A;  1Z2X A;  2BQ8 X;  4J6O A;  3C5W C;  2HYO A;  4LTY A;  1V73 A;  2USH A;  3DSD A;  1Z2W A;  2YVT A;  4H2I A;  5C1V A;  4DT2 A;  3GVE A;  3H64 A;  2BDX A;  3ZTV A;  5B8I A;  4OR9 A;  1M63 A;  3C9F A;  3DW8 C;  4KBP A;  4IL1 A;  1T70 A;  4FBQ A;  4KKZ A;  4JA7 A;  2R17 A;  2NYL C;  3EGG A;  3H69 A;  4FBK A;  3ZU0 A;  3ICF A;  5INB A;  1HO5 A;  2Z06 A;  3K7W C;  2O8A A;  3TGH A;  2Q8U A;  4FCX A;  1T71 A;  1S95 A;  3IVD A;  1G5B A;  1FJM A;  1UF3 A;  1NNW A;  4V0W A;  4M0V A;  5DNY A;  4UT3 B;  3E7A A;  3KBP A;  2QFR A;  2P6B A;  2Z1A A;  1W24 A;  1XZW A;  3IVE A;  3E7B A;  3V4Y A;  3LL8 A;  2ZBM A;  3QFN A;  3QFO A;  4G9J A;  1HPU A;  4DSY A;  4F0Z A;  1S70 A;  4O43 A;  3IB7 A;  3RL3 A;  4ZX2 A;  1S3M A;  4DHL A;  2DXN A;  3THN A;  2NYM C;  3H60 A;  4H2F A;  5JJT A;  4LU9 A;  2DXL A;  4UWQ A;  4ORB A;  3QFK A;  4Q7F A;  3IB8 A;  3T1I A;  3H62 B;  2DFJ A;  3PSN A;  4V0V A;  5HPE A;  2AHD A;  1JK7 A;  2QJC A;  2WDF A;  2NXF A;  4MOY A;  3PSO A;  4MP0 A;  4FBW A;  4MOV A;  2IE4 C;  1OID A;  1TCO A;  4B2O A;  4TUI A;  3AV0 A;  1USH A;  3RQZ A;  4ORC A;  2IE3 C;  3QG5 C;  1IT6 A;  1S8E A;  2GJU A;  3HVQ A;  2NPP C;  3H67 A;  4H2G A;  2HYP A;  2WDD A;  3JYF A;  1S3N A;  4H1Y P;  1UTE A;  1U32 A;  2CV9 A;  4XPN A;  3AUZ A;  4H1S A;  2HY1 A;  2QFP A;  5EQV A;  3H61 A;  5F3W A;  2KKN A;  3RL5 A;  3H68 A;  2BCD A;  1WAR A;  4O4K A;  1HP1 A;  4NZV A;  2WDC A;  3CK2 A;  4I5L C;  1MF8 A;  4O5G A;  3P71 C;  5JPF A;  4I5N C;  2Z72 A;  2IAE C;  3FGA C;  3FLO A;  4WWL A;  4UT3 A;  5JPE A;  3DSC A;  2A22 A;  2JOG A;  3H63 A;  5IOH A;  4UT2 A;  3N5U A;  1SU1 A;  1KBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...