4NZVA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
329
Chain Sequence
HHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Exonuclease, putative
total genus 110
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4nzvA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4nzvA01
4DHLA 1S8EA 4Q7FA 3H64A 4LU9A 5GTUA 4ORBA 4MOVA 3RL4A 4WWLA 5JPEA 2Z06A 3H67A 4LACC 2WDCA 1IT6A 4M0VA 4O4KA 4H2FA 1M63A 3E7BA 1AUIA 2BCDA 4LTYA 4KKZA 2IE4C 3QFMA 2BDXA 4V0XA 3IB8A 3V4YA 2CV9A 2WDDA 3IB7A 4ZX2A 3DSDA 2O8AA 4F0ZA 2BQ8X 4MP0A 4DSYA 4JA9A 3KBPA 3K7VC 1SU1A 2HYPA 4UT3B 3EGGA 2KKNA 1TCOA 2HY1A 2QFRA 3RL3A 1XM7A 2ZBMA 2Z72A 5J28A 1G5BA 3LL8A 4FCXA 3ZU0A 5HPEA 2QFPA 1XZWA 2AHDA 2O8GA 3ICFA 2DFJA 1S95A 3H63A 2YVTA 4MOYA 1WARA 3AUZA 5IOHA 3RQZA 3THNA 3JYFA 4UT2A 5INBA 2WDFA 3THOB 4V0WA 3H60A 1KBPA 1HPUA 3DSCA 4XPNA 2A22A 4IL1A 3H68A 4TUGA 2Q8UA 1FJMA 4HD0A 3H69A 4I5LC 2P6BA 3QFOA 1W24A 4FBKA 4UT3A 1NNWA 1S3NA 4H1SA 4ZVZA 2IE3C 3QFNA 4H1YP 1HO5A 1OIEA 5F3WA 4NZVA 1OI8A 4ORCA 3FGAC 4H2IA 3HVQA 4OR9A 3EGHA 4V0VA 3H61A 2NPPC 2QJCA 3H66A 1UTEA 1S70A 1U32A 4YKEA 1S3LA 2Z1AA 3IVEA 2USHA 3PSOA 4KBPA 3DW8C 5JJTA 1MF8A 2NYMC 2HYOA 4IYPC 3T1IA 3P71C 2IAEC 3QFKA 4G9JA 4I5NC 1OIDA 5DNYA 3C9FA 3E7AA 5B8IA 4FBQA 1QHWA 2JOGA 3ZTVA 1JK7A 3AV0A 3N5UA 4O43A 1WAO1 4DT2A 1Z2XA 2GJUA 3CK2A 1UF3A 1USHA 3H62B 1T70A 3RL5A 4TUIA 1V73A 3C5WC 1QFCA 2NYLC 1T71A 1Z2WA 1HP1A 2XMOA 5C1VA 4J6OA 4O24A 2R17A 3GVEA 4FBWA 5EQVA 4B2OA 1S3MA 4H2BA 5JPFA 4ORAA 4O5GA 4UWQA 3K7WC 2NXFA 2WDEA 4JA7A 1II7A 3TGHA 3QG5C 3IVDA 3PSNA 4H2GA
chains in the Genus database with same CATH superfamily
2IHR1 4ZYHA 4BC9A 5IT9C 4LU9A 4ORBA 1YSAC 2H36X 4RHBB 1N34E 1XNQE 4JI8E 2DB2A 4WWLA 4NHRA 1EH6A 2Z06A 4LACC 2B7TA 5KL3A 5A6KA 3J7AG 1RMDA 1UILA 2BDXA 4V0XA 3IB8A 3V4YA 2WDDA 2ELZA 1A1FA 2V85A 4DMIA 2MC6A 2EJ4A 2RS6A 3C6KA 4DUYE 2BQ8X 4KZSA 2YSPA 3UK3C 1SU1A 4UT3B 1WJPA 2WBSA 4F9AB 2HY1A 2EMYA 4WSGA 4BS9A 4R2CA 2ZBMA 1YYKA 5HPEA 3ZU0A 3VK6A 4JI3E 3ICFA 1X3CA 2DFJA 2DSYA 3H63A 4JI6E 5IOHA 2LUPB 4LF4E 1IQSA 4Q35B 4V0WA 2WBUA 3H60A 3OMLA 2I9IA 2V8QB 1ZR9A 2EQ3A 2JP9A 2YTFA 4DR4E 1FJMA 2YRHA 4BHBA 2DMIA 5A6AA 1HR0E 2DXLA 5AASA 2LUQA 2WCC3 2EL4A 4GZNC 4ZVZA 2EMWA 3FIGA 2F8BA 2M1SA 2KONA 1HO5A 3C6MA 2EL5A 1A1KA 2EOQA 4ORCA 5FLXC 3L00A 4HEIA 4LFCE 3EGHA 3J80C 2PRTA 3HVQA 4OR9A 2ZOAA 1S70A 1U32A 4YKEA 2Z1AA 2USHA 2EN1A 2N3GA 4KBPA 2EL6A 3BF2A 2EN6A 2RPCA 4KWYA 3E0JA 2YTNA 4GEQB 3P71C 2IAEC 1TN9A 1WHNA 5KL2A 2MKNA 5B8IA 5KL5A 2JOGA 2LTSA 4R2RA 2J7JA 3KZYA 4O43A 2EM2A 1IBME 2ENCA 1YUIA 1JK2A 1USHA 3H62B 3TQMA 1V73A 2YU5A 1J26A 2NYLC 1XNRE 2DRPA 2EMXA 4J6OA 2E1MA 2R17A 4FBWA 5EQVA 2JYAA 3ADLA 4DV5E 4H2BA 5JPFA 1QNTA 4O5GA 4I8OA 1YYOA 4ORAA 4UWQA 3T1HE 4DV6E 4JA7A 1II7A 3IVDA 5KL4A 3PSNA 1IBLE 2WZOA 3H64A 1LLMC 4Q7FA 5ADZA 4NXNE 1G2FC 2ELYA 3H67A 2JXPA 2LJHA 5KL6A 2EOMA 1IT6A 3RMPA 2ADRA 5IXMB 1M63A 1X6EA 2UUBE 2L33A 2JPAA 5A6JA 4B3ME 1YPNA 1STUA 2EM4A 4KKZA 2RTXA 2EOXA 4FK5C 2HC5A 3VYYA 2LMZA 3K6QA 1N36E 2CV9A 3IB7A 5LL6R 2EN3A 4F0ZA 4X65E 2A25A 5IV8B 4F9BB 4DSYA 3KBPA 3K7VC 5A2QC 2KKNA 4JI5E 2LJUA 5J28A 2Z72A 2EOSA 4FCXA 2YZTA 1UBDC 2AHDA 4MOYA 2YVTA 4R2SA 2CPNA 2HGHA 3THNA 2B7VA 3JYFA 4UT2A 2N8XA 2ENAA 2ZO9B 2WDFA 3T1YE 2KHXA 2YEQA 3DSCA 2CSHA 1GQEA 2EM9A 2RSIA 4DR1E 1NCSA 1YZ9A 4IL1A 2R1FA 4TUGA 2EMZA 2EN8A 1TF3A 2EMHA 2FTXB 3LLHA 4R2DA 1IBKE 1W24A 2P6BA 1DI2A 2EORA 2E5LE 2YRMA 4H1SA 2IE3C 2ZM6E 4B3RE 4H1YP 3JAMC 2EM7A 2KOUA 4JI7E 1RC7A 2FV4B 5F3WA 4MLQA 4NZVA 4BMJA 4DR7E 1F2IG 4V0VA 4LF6E 2NPPC 4DKKA 1Z1BA 2QJCA 3H66A 1S3LA 4IS1C 3MSWA 4WSPA 5AE3A 3PSOA 4YY3E 1UHZA 1ZAAC 3BBGA 4ZYDA 4JI0E 4DR3E 2N3HA 3T1IA 2CTDA 2JVAA 1A1GA 1X5WA 2EN2A 2YTOA 2EPPA 2LE2A 4YHHE 4I5NC 1NEIA 3E7AA 2EM3A 1AAYA 2EPOA 2EMFA 2YT4A 2YTEA 2GHFA 4R2AA 2YTJA 2EZ6A 1EH7A 4F6MA 3N5UA 1XMOE 4R2PA 4Q28A 1DQ3A 2YTDA 5BR8E 4TUIA 4DR2E 1UF3A 3RL5A 1QFCA 1IQOA 4F54A 2EPUA 5TSEA 1Z2WA 3IWDA 1HP1A 2XMOA 2JOBA 2EMGA 4LF8E 5AE1A 2M7QA 1ZU1A 3C4BA 4M9VC 1S3MA 3FLOA 3K7WC 5LLQA 1YUJA 2I13A 1MEYC 1RQ0A 3VHTB 3EPHA 3EPKA 1N32E 2NUEA 4DHLA 5AC5A 1S8EA 2YPNA 4WXDA 4BC7A 3EPLA 2FGGA 4ZYGA 3DJWA 4LFAE 2WDCA 2V86A 4O4KA 4H2FA 2NUGA 1SR9A 2DLKA 1KYQA 1N3GA 3ECRA 4P7DA 2EOEA 4DV2E 1AUIA 1QU6A 2YTGA 1HNZE 4OOGC 1X47A 3QFMA 2EP3A 1IMUA 3H09A 4HTGA 1YFHA 2O8AA 2JWOA 1YYWA 1HNWE 2K4VA 3F6GA 1X6FA 3BGHA 2L3CA 3EGGA 3M99B 2EPNA 3ZOQB 3RL3A 2DMYA 1L4SA 1G5BA 3F6HA 4OX9E 3OTOE 2UU9E 1XZWA 4R2QA 1BB8A 1A1LA 2EOJA 3AUZA 1WARA 2RQLA 2YWQA 5INBA 2V83A 2EM6A 2EPRA 4R2EA 2GLIA 1HPUA 3VYXA 2A22A 4DV7E 2UXBE 1TF6A 2Q8UA 2UXCE 2WBTA 4J8ZA 4X8WA 5AE2A 4I5LC 1PKPA 4UT3A 1T38A 1NNWA 1S3NA 1WXRA 1P47A 2RSMA 2NUFA 1X49A 4BCAA 2LCEA 4LF7E 2F4VE 2L2NA 1EKZA 4X9JA 1BBGA 2VF1A 4LF5E 4WYQB 5A69A 2JR1A 2EMKA 2L6MA 1N33E 3H61A 3J7Yp 2DXNA 2NABA 1A1JA 2EPZA 5LMNE 4WX9A 1JK1A 4BBYA 2V88A 2HHHE 1O0WA 3DW8C 5JJTA 1MF8A 3HXLA 1FKAE 2LRSA 2MDGA 2YU8A 3EQ1A 2EMBA 4X62E 1A1HA 3QFKA 2ODRC 5LMUE 2LTRA 2MDRA 3KZZA 2UUCE 1BBOA 4G9JA 4DV0E 5DNYA 3C9FA 2G7HA 4FBQA 1QHWA 1JK7A 2UUAE 3LMLA 1WAO1 4DT2A 4DR6E 1Z2XA 2VQFE 4JI1E 1T70A 2EM8A 3DF6A 2NA2A 1MGTA 4X64E 2K7IA 1B69A 2ODRD 2DIXA 4JI4E 3J81C 4KHPE 5C1VA 4GKJE 4O24A 5AC4A 1HNXE 3GVEA 2EMLA 4JYAE 2EPLX 2MKDA 4JV5E 4GKKE 1I94E 2NXFA 3KWRA 1WRJA 3TGHA 3IWBA 4LF9E 2EE8A 4H2GA 1PJQA 2L2MA 2DGCA 1FJGE 4LFBE 4K0KE 2L8TA 3JTZA 5GTUA 2EPXA 3P1XA 1PDAA 2B3TB 4DUZE 4MOVA 2EOIA 3JU0A 3RL4A 4WPYA 5JPEA 4BHCA 5A6BA 4M0VA 4DV4E 2EPKX 4M30A 3E7BA 2UXDE 4F9CB 1AH5A 1T39A 2YSOA 2BCDA 1GZ6A 4LTYA 3HTXA 2IE4C 4ZX2A 1GTKA 1ZBQA 3DSDA 2ENHA 2BBGA 1XMQE 4WXCA 4MP0A 2B9DA 4JA9A 2E72A 2HYPA 3HPZA 1TCOA 1KJKA 2QFRA 2EOHA 1XM7A 5A6BD 2EQ0A 1T4NA 3LL8A 2L3JA 1DGCA 4X66E 1T4LB 2QFPA 2CT1A 3EPJA 2O8GA 2LV2A 1T4OA 4R03A 4N4RB 1S95A 2VRDA 3RQZA 2VQEE 4R8OA 3THOB 2EOFA 2EPMX 4RH8A 2M9AA 1KBPA 4AQYE 1UN6B 4XPNA 2HJJA 4DR5E 2VE7C 2YTIA 2R76A 3H68A 4DV3E 2LBSB 4HD0A 3ADGA 5CFFE 3HQ1A 3H69A 4NXME 3QFOA 4FBKA 2JY9A 4F6NA 4DV1E 3ADIA 5T6JA 2EM5A 2EWLA 2EMIA 4WFTA 3QFNA 1OIEA 1X48A 4B3TE 1EH8A 2EQ1A 2EN7A 2D9HA 1OI8A 3MHHC 4ZYEA 1PJSA 2YTPA 4L5NC 3FGAC 2GPIA 4P78A 4H2IA 3HPSA 2EM0A 1UTEA 2RS7A 2LVHA 3IVEA 2EPAA 2LT7A 3IWCA 5KL7A 2EOOA 2NYMC 2HYOA 4IYPC 2L92A 2V89A 4IJDA 2EN4A 4L8NA 1OIDA 2JOXA 3BIDA 2MC5A 2V87A 3D03A 5IWAE 2YRKA 2EOYA 3ZTVA 3AV0A 1ZBTA 4MLVA 1G2DC 2GJUA 2LO3A 3CK2A 2DLQA 2EPCA 3C5WC 2L2KB 2EMAA 1T71A 2M4IA 1WHQA 1PJTA 2EOZA 4B3SE 2EMCA 3MHSC 4B2OA 4M2ZA 2BB8A 1SFEA 4F2JC 1X6HA 4JI2E 1J5EE 2WDEA 3C4TA 3ADJA 3QG5C 1A1IA 2YTQA
chains in the Genus database with same CATH topology
4DHLA 1S8EA 4Q7FA 3H64A 4LU9A 5GTUA 4ORBA 4MOVA 3RL4A 4WWLA 5JPEA 2Z06A 3H67A 4LACC 2WDCA 1IT6A 4M0VA 4O4KA 4H2FA 1M63A 3E7BA 1AUIA 2BCDA 4LTYA 4KKZA 2IE4C 3QFMA 2BDXA 4V0XA 3IB8A 3V4YA 2CV9A 2WDDA 3IB7A 4ZX2A 3DSDA 2O8AA 4F0ZA 2BQ8X 4MP0A 4DSYA 4JA9A 3KBPA 3K7VC 1SU1A 2HYPA 4UT3B 3EGGA 2KKNA 1TCOA 2HY1A 2QFRA 3RL3A 1XM7A 2ZBMA 2Z72A 5J28A 1G5BA 3LL8A 4FCXA 3ZU0A 5HPEA 2QFPA 1XZWA 2AHDA 2O8GA 3ICFA 2DFJA 1S95A 3H63A 2YVTA 4MOYA 1WARA 3AUZA 5IOHA 3RQZA 3THNA 3JYFA 4UT2A 5INBA 2ZO9B 2WDFA 3THOB 4V0WA 3H60A 1KBPA 1HPUA 3DSCA 2YEQA 4XPNA 2A22A 4IL1A 3H68A 4TUGA 2Q8UA 1FJMA 4HD0A 3H69A 4I5LC 2P6BA 3QFOA 1W24A 4FBKA 2DXLA 4UT3A 1NNWA 1S3NA 4H1SA 4ZVZA 2IE3C 3QFNA 4H1YP 1HO5A 1OIEA 5F3WA 4NZVA 1OI8A 4ORCA 3FGAC 4H2IA 3HVQA 4OR9A 3EGHA 4V0VA 3H61A 2NPPC 2QJCA 2DXNA 2ZOAA 1UTEA 3H66A 1S70A 1U32A 4YKEA 1S3LA 2Z1AA 3IVEA 2USHA 3PSOA 4KBPA 3DW8C 5JJTA 1MF8A 2NYMC 2HYOA 4IYPC 3E0JA 3T1IA 3P71C 2IAEC 3QFKA 4G9JA 4I5NC 1OIDA 5DNYA 3C9FA 3E7AA 3D03A 5B8IA 4FBQA 1QHWA 2JOGA 3ZTVA 1JK7A 3AV0A 3N5UA 4O43A 1WAO1 4DT2A 1Z2XA 2GJUA 3CK2A 1UF3A 1USHA 3H62B 1T70A 3RL5A 4TUIA 1V73A 3C5WC 1QFCA 2NYLC 1T71A 1Z2WA 1HP1A 2XMOA 5C1VA 4J6OA 4O24A 2R17A 3GVEA 4FBWA 5EQVA 4B2OA 1S3MA 4H2BA 5JPFA 4ORAA 4O5GA 3FLOA 4UWQA 3K7WC 2NXFA 2WDEA 4JA7A 1II7A 3TGHA 3QG5C 3IVDA 3PSNA 4H2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHL A;  1S8E A;  4Q7F A;  3H64 A;  4LU9 A;  5GTU A;  4ORB A;  4MOV A;  3RL4 A;  4WWL A;  5JPE A;  2Z06 A;  3H67 A;  4LAC C;  2WDC A;  1IT6 A;  4M0V A;  4O4K A;  4H2F A;  1M63 A;  3E7B A;  1AUI A;  2BCD A;  4LTY A;  4KKZ A;  2IE4 C;  3QFM A;  2BDX A;  4V0X A;  3IB8 A;  3V4Y A;  2CV9 A;  2WDD A;  3IB7 A;  4ZX2 A;  3DSD A;  2O8A A;  4F0Z A;  2BQ8 X;  4MP0 A;  4DSY A;  4JA9 A;  3KBP A;  3K7V C;  1SU1 A;  2HYP A;  4UT3 B;  3EGG A;  2KKN A;  1TCO A;  2HY1 A;  2QFR A;  3RL3 A;  1XM7 A;  2ZBM A;  2Z72 A;  5J28 A;  1G5B A;  3LL8 A;  4FCX A;  3ZU0 A;  5HPE A;  2QFP A;  1XZW A;  2AHD A;  2O8G A;  3ICF A;  2DFJ A;  1S95 A;  3H63 A;  2YVT A;  4MOY A;  1WAR A;  3AUZ A;  5IOH A;  3RQZ A;  3THN A;  3JYF A;  4UT2 A;  5INB A;  2WDF A;  3THO B;  4V0W A;  3H60 A;  1KBP A;  1HPU A;  3DSC A;  4XPN A;  2A22 A;  4IL1 A;  3H68 A;  4TUG A;  2Q8U A;  1FJM A;  4HD0 A;  3H69 A;  4I5L C;  2P6B A;  3QFO A;  1W24 A;  4FBK A;  4UT3 A;  1NNW A;  1S3N A;  4H1S A;  4ZVZ A;  2IE3 C;  3QFN A;  4H1Y P;  1HO5 A;  1OIE A;  5F3W A;  4NZV A;  1OI8 A;  4ORC A;  3FGA C;  4H2I A;  3HVQ A;  4OR9 A;  3EGH A;  4V0V A;  3H61 A;  2NPP C;  2QJC A;  3H66 A;  1UTE A;  1S70 A;  1U32 A;  4YKE A;  1S3L A;  2Z1A A;  3IVE A;  2USH A;  3PSO A;  4KBP A;  3DW8 C;  5JJT A;  1MF8 A;  2NYM C;  2HYO A;  4IYP C;  3T1I A;  3P71 C;  2IAE C;  3QFK A;  4G9J A;  4I5N C;  1OID A;  5DNY A;  3C9F A;  3E7A A;  5B8I A;  4FBQ A;  1QHW A;  2JOG A;  3ZTV A;  1JK7 A;  3AV0 A;  3N5U A;  4O43 A;  1WAO 1;  4DT2 A;  1Z2X A;  2GJU A;  3CK2 A;  1UF3 A;  1USH A;  3H62 B;  1T70 A;  3RL5 A;  4TUI A;  1V73 A;  3C5W C;  1QFC A;  2NYL C;  1T71 A;  1Z2W A;  1HP1 A;  2XMO A;  5C1V A;  4J6O A;  4O24 A;  2R17 A;  3GVE A;  4FBW A;  5EQV A;  4B2O A;  1S3M A;  4H2B A;  5JPF A;  4ORA A;  4O5G A;  4UWQ A;  3K7W C;  2NXF A;  2WDE A;  4JA7 A;  1II7 A;  3TGH A;  3QG5 C;  3IVD A;  3PSN A;  4H2G A; 
#chains in the Genus database with same CATH topology
 2IHR 1;  4ZYH A;  4BC9 A;  5IT9 C;  4LU9 A;  4ORB A;  1YSA C;  2H36 X;  4RHB B;  1N34 E;  1XNQ E;  4JI8 E;  2DB2 A;  4WWL A;  4NHR A;  1EH6 A;  2Z06 A;  4LAC C;  2B7T A;  5KL3 A;  5A6K A;  3J7A G;  1RMD A;  1UIL A;  2BDX A;  4V0X A;  3IB8 A;  3V4Y A;  2WDD A;  2ELZ A;  1A1F A;  2V85 A;  4DMI A;  2MC6 A;  2EJ4 A;  2RS6 A;  3C6K A;  4DUY E;  2BQ8 X;  4KZS A;  2YSP A;  3UK3 C;  1SU1 A;  4UT3 B;  1WJP A;  2WBS A;  4F9A B;  2HY1 A;  2EMY A;  4WSG A;  4BS9 A;  4R2C A;  2ZBM A;  1YYK A;  5HPE A;  3ZU0 A;  3VK6 A;  4JI3 E;  3ICF A;  1X3C A;  2DFJ A;  2DSY A;  3H63 A;  4JI6 E;  5IOH A;  2LUP B;  4LF4 E;  1IQS A;  4Q35 B;  4V0W A;  2WBU A;  3H60 A;  3OML A;  2I9I A;  2V8Q B;  1ZR9 A;  2EQ3 A;  2JP9 A;  2YTF A;  4DR4 E;  1FJM A;  2YRH A;  4BHB A;  2DMI A;  5A6A A;  1HR0 E;  2DXL A;  5AAS A;  2LUQ A;  2WCC 3;  2EL4 A;  4GZN C;  4ZVZ A;  2EMW A;  3FIG A;  2F8B A;  2M1S A;  2KON A;  1HO5 A;  3C6M A;  2EL5 A;  1A1K A;  2EOQ A;  4ORC A;  5FLX C;  3L00 A;  4HEI A;  4LFC E;  3EGH A;  3J80 C;  2PRT A;  3HVQ A;  4OR9 A;  2ZOA A;  1S70 A;  1U32 A;  4YKE A;  2Z1A A;  2USH A;  2EN1 A;  2N3G A;  4KBP A;  2EL6 A;  3BF2 A;  2EN6 A;  2RPC A;  4KWY A;  3E0J A;  2YTN A;  4GEQ B;  3P71 C;  2IAE C;  1TN9 A;  1WHN A;  5KL2 A;  2MKN A;  5B8I A;  5KL5 A;  2JOG A;  2LTS A;  4R2R A;  2J7J A;  3KZY A;  4O43 A;  2EM2 A;  1IBM E;  2ENC A;  1YUI A;  1JK2 A;  1USH A;  3H62 B;  3TQM A;  1V73 A;  2YU5 A;  1J26 A;  2NYL C;  1XNR E;  2DRP A;  2EMX A;  4J6O A;  2E1M A;  2R17 A;  4FBW A;  5EQV A;  2JYA A;  3ADL A;  4DV5 E;  4H2B A;  5JPF A;  1QNT A;  4O5G A;  4I8O A;  1YYO A;  4ORA A;  4UWQ A;  3T1H E;  4DV6 E;  4JA7 A;  1II7 A;  3IVD A;  5KL4 A;  3PSN A;  1IBL E;  2WZO A;  3H64 A;  1LLM C;  4Q7F A;  5ADZ A;  4NXN E;  1G2F C;  2ELY A;  3H67 A;  2JXP A;  2LJH A;  5KL6 A;  2EOM A;  1IT6 A;  3RMP A;  2ADR A;  5IXM B;  1M63 A;  1X6E A;  2UUB E;  2L33 A;  2JPA A;  5A6J A;  4B3M E;  1YPN A;  1STU A;  2EM4 A;  4KKZ A;  2RTX A;  2EOX A;  4FK5 C;  2HC5 A;  3VYY A;  2LMZ A;  3K6Q A;  1N36 E;  2CV9 A;  3IB7 A;  5LL6 R;  2EN3 A;  4F0Z A;  4X65 E;  2A25 A;  5IV8 B;  4F9B B;  4DSY A;  3KBP A;  3K7V C;  5A2Q C;  2KKN A;  4JI5 E;  2LJU A;  5J28 A;  2Z72 A;  2EOS A;  4FCX A;  2YZT A;  1UBD C;  2AHD A;  4MOY A;  2YVT A;  4R2S A;  2CPN A;  2HGH A;  3THN A;  2B7V A;  3JYF A;  4UT2 A;  2N8X A;  2ENA A;  2ZO9 B;  2WDF A;  3T1Y E;  2KHX A;  2YEQ A;  3DSC A;  2CSH A;  1GQE A;  2EM9 A;  2RSI A;  4DR1 E;  1NCS A;  1YZ9 A;  4IL1 A;  2R1F A;  4TUG A;  2EMZ A;  2EN8 A;  1TF3 A;  2EMH A;  2FTX B;  3LLH A;  4R2D A;  1IBK E;  1W24 A;  2P6B A;  1DI2 A;  2EOR A;  2E5L E;  2YRM A;  4H1S A;  2IE3 C;  2ZM6 E;  4B3R E;  4H1Y P;  3JAM C;  2EM7 A;  2KOU A;  4JI7 E;  1RC7 A;  2FV4 B;  5F3W A;  4MLQ A;  4NZV A;  4BMJ A;  4DR7 E;  1F2I G;  4V0V A;  4LF6 E;  2NPP C;  4DKK A;  1Z1B A;  2QJC A;  3H66 A;  1S3L A;  4IS1 C;  3MSW A;  4WSP A;  5AE3 A;  3PSO A;  4YY3 E;  1UHZ A;  1ZAA C;  3BBG A;  4ZYD A;  4JI0 E;  4DR3 E;  2N3H A;  3T1I A;  2CTD A;  2JVA A;  1A1G A;  1X5W A;  2EN2 A;  2YTO A;  2EPP A;  2LE2 A;  4YHH E;  4I5N C;  1NEI A;  3E7A A;  2EM3 A;  1AAY A;  2EPO A;  2EMF A;  2YT4 A;  2YTE A;  2GHF A;  4R2A A;  2YTJ A;  2EZ6 A;  1EH7 A;  4F6M A;  3N5U A;  1XMO E;  4R2P A;  4Q28 A;  1DQ3 A;  2YTD A;  5BR8 E;  4TUI A;  4DR2 E;  1UF3 A;  3RL5 A;  1QFC A;  1IQO A;  4F54 A;  2EPU A;  5TSE A;  1Z2W A;  3IWD A;  1HP1 A;  2XMO A;  2JOB A;  2EMG A;  4LF8 E;  5AE1 A;  2M7Q A;  1ZU1 A;  3C4B A;  4M9V C;  1S3M A;  3FLO A;  3K7W C;  5LLQ A;  1YUJ A;  2I13 A;  1MEY C;  1RQ0 A;  3VHT B;  3EPH A;  3EPK A;  1N32 E;  2NUE A;  4DHL A;  5AC5 A;  1S8E A;  2YPN A;  4WXD A;  4BC7 A;  3EPL A;  2FGG A;  4ZYG A;  3DJW A;  4LFA E;  2WDC A;  2V86 A;  4O4K A;  4H2F A;  2NUG A;  1SR9 A;  2DLK A;  1KYQ A;  1N3G A;  3ECR A;  4P7D A;  2EOE A;  4DV2 E;  1AUI A;  1QU6 A;  2YTG A;  1HNZ E;  4OOG C;  1X47 A;  3QFM A;  2EP3 A;  1IMU A;  3H09 A;  4HTG A;  1YFH A;  2O8A A;  2JWO A;  1YYW A;  1HNW E;  2K4V A;  3F6G A;  1X6F A;  3BGH A;  2L3C A;  3EGG A;  3M99 B;  2EPN A;  3ZOQ B;  3RL3 A;  2DMY A;  1L4S A;  1G5B A;  3F6H A;  4OX9 E;  3OTO E;  2UU9 E;  1XZW A;  4R2Q A;  1BB8 A;  1A1L A;  2EOJ A;  3AUZ A;  1WAR A;  2RQL A;  2YWQ A;  5INB A;  2V83 A;  2EM6 A;  2EPR A;  4R2E A;  2GLI A;  1HPU A;  3VYX A;  2A22 A;  4DV7 E;  2UXB E;  1TF6 A;  2Q8U A;  2UXC E;  2WBT A;  4J8Z A;  4X8W A;  5AE2 A;  4I5L C;  1PKP A;  4UT3 A;  1T38 A;  1NNW A;  1S3N A;  1WXR A;  1P47 A;  2RSM A;  2NUF A;  1X49 A;  4BCA A;  2LCE A;  4LF7 E;  2F4V E;  2L2N A;  1EKZ A;  4X9J A;  1BBG A;  2VF1 A;  4LF5 E;  4WYQ B;  5A69 A;  2JR1 A;  2EMK A;  2L6M A;  1N33 E;  3H61 A;  3J7Y p;  2DXN A;  2NAB A;  1A1J A;  2EPZ A;  5LMN E;  4WX9 A;  1JK1 A;  4BBY A;  2V88 A;  2HHH E;  1O0W A;  3DW8 C;  5JJT A;  1MF8 A;  3HXL A;  1FKA E;  2LRS A;  2MDG A;  2YU8 A;  3EQ1 A;  2EMB A;  4X62 E;  1A1H A;  3QFK A;  2ODR C;  5LMU E;  2LTR A;  2MDR A;  3KZZ A;  2UUC E;  1BBO A;  4G9J A;  4DV0 E;  5DNY A;  3C9F A;  2G7H A;  4FBQ A;  1QHW A;  1JK7 A;  2UUA E;  3LML A;  1WAO 1;  4DT2 A;  4DR6 E;  1Z2X A;  2VQF E;  4JI1 E;  1T70 A;  2EM8 A;  3DF6 A;  2NA2 A;  1MGT A;  4X64 E;  2K7I A;  1B69 A;  2ODR D;  2DIX A;  4JI4 E;  3J81 C;  4KHP E;  5C1V A;  4GKJ E;  4O24 A;  5AC4 A;  1HNX E;  3GVE A;  2EML A;  4JYA E;  2EPL X;  2MKD A;  4JV5 E;  4GKK E;  1I94 E;  2NXF A;  3KWR A;  1WRJ A;  3TGH A;  3IWB A;  4LF9 E;  2EE8 A;  4H2G A;  1PJQ A;  2L2M A;  2DGC A;  1FJG E;  4LFB E;  4K0K E;  2L8T A;  3JTZ A;  5GTU A;  2EPX A;  3P1X A;  1PDA A;  2B3T B;  4DUZ E;  4MOV A;  2EOI A;  3JU0 A;  3RL4 A;  4WPY A;  5JPE A;  4BHC A;  5A6B A;  4M0V A;  4DV4 E;  2EPK X;  4M30 A;  3E7B A;  2UXD E;  4F9C B;  1AH5 A;  1T39 A;  2YSO A;  2BCD A;  1GZ6 A;  4LTY A;  3HTX A;  2IE4 C;  4ZX2 A;  1GTK A;  1ZBQ A;  3DSD A;  2ENH A;  2BBG A;  1XMQ E;  4WXC A;  4MP0 A;  2B9D A;  4JA9 A;  2E72 A;  2HYP A;  3HPZ A;  1TCO A;  1KJK A;  2QFR A;  2EOH A;  1XM7 A;  5A6B D;  2EQ0 A;  1T4N A;  3LL8 A;  2L3J A;  1DGC A;  4X66 E;  1T4L B;  2QFP A;  2CT1 A;  3EPJ A;  2O8G A;  2LV2 A;  1T4O A;  4R03 A;  4N4R B;  1S95 A;  2VRD A;  3RQZ A;  2VQE E;  4R8O A;  3THO B;  2EOF A;  2EPM X;  4RH8 A;  2M9A A;  1KBP A;  4AQY E;  1UN6 B;  4XPN A;  2HJJ A;  4DR5 E;  2VE7 C;  2YTI A;  2R76 A;  3H68 A;  4DV3 E;  2LBS B;  4HD0 A;  3ADG A;  5CFF E;  3HQ1 A;  3H69 A;  4NXM E;  3QFO A;  4FBK A;  2JY9 A;  4F6N A;  4DV1 E;  3ADI A;  5T6J A;  2EM5 A;  2EWL A;  2EMI A;  4WFT A;  3QFN A;  1OIE A;  1X48 A;  4B3T E;  1EH8 A;  2EQ1 A;  2EN7 A;  2D9H A;  1OI8 A;  3MHH C;  4ZYE A;  1PJS A;  2YTP A;  4L5N C;  3FGA C;  2GPI A;  4P78 A;  4H2I A;  3HPS A;  2EM0 A;  1UTE A;  2RS7 A;  2LVH A;  3IVE A;  2EPA A;  2LT7 A;  3IWC A;  5KL7 A;  2EOO A;  2NYM C;  2HYO A;  4IYP C;  2L92 A;  2V89 A;  4IJD A;  2EN4 A;  4L8N A;  1OID A;  2JOX A;  3BID A;  2MC5 A;  2V87 A;  3D03 A;  5IWA E;  2YRK A;  2EOY A;  3ZTV A;  3AV0 A;  1ZBT A;  4MLV A;  1G2D C;  2GJU A;  2LO3 A;  3CK2 A;  2DLQ A;  2EPC A;  3C5W C;  2L2K B;  2EMA A;  1T71 A;  2M4I A;  1WHQ A;  1PJT A;  2EOZ A;  4B3S E;  2EMC A;  3MHS C;  4B2O A;  4M2Z A;  2BB8 A;  1SFE A;  4F2J C;  1X6H A;  4JI2 E;  1J5E E;  2WDE A;  3C4T A;  3ADJ A;  3QG5 C;  1A1I A;  2YTQ A; 
#chains in the Genus database with same CATH homology
 4DHL A;  1S8E A;  4Q7F A;  3H64 A;  4LU9 A;  5GTU A;  4ORB A;  4MOV A;  3RL4 A;  4WWL A;  5JPE A;  2Z06 A;  3H67 A;  4LAC C;  2WDC A;  1IT6 A;  4M0V A;  4O4K A;  4H2F A;  1M63 A;  3E7B A;  1AUI A;  2BCD A;  4LTY A;  4KKZ A;  2IE4 C;  3QFM A;  2BDX A;  4V0X A;  3IB8 A;  3V4Y A;  2CV9 A;  2WDD A;  3IB7 A;  4ZX2 A;  3DSD A;  2O8A A;  4F0Z A;  2BQ8 X;  4MP0 A;  4DSY A;  4JA9 A;  3KBP A;  3K7V C;  1SU1 A;  2HYP A;  4UT3 B;  3EGG A;  2KKN A;  1TCO A;  2HY1 A;  2QFR A;  3RL3 A;  1XM7 A;  2ZBM A;  2Z72 A;  5J28 A;  1G5B A;  3LL8 A;  4FCX A;  3ZU0 A;  5HPE A;  2QFP A;  1XZW A;  2AHD A;  2O8G A;  3ICF A;  2DFJ A;  1S95 A;  3H63 A;  2YVT A;  4MOY A;  1WAR A;  3AUZ A;  5IOH A;  3RQZ A;  3THN A;  3JYF A;  4UT2 A;  5INB A;  2ZO9 B;  2WDF A;  3THO B;  4V0W A;  3H60 A;  1KBP A;  1HPU A;  3DSC A;  2YEQ A;  4XPN A;  2A22 A;  4IL1 A;  3H68 A;  4TUG A;  2Q8U A;  1FJM A;  4HD0 A;  3H69 A;  4I5L C;  2P6B A;  3QFO A;  1W24 A;  4FBK A;  2DXL A;  4UT3 A;  1NNW A;  1S3N A;  4H1S A;  4ZVZ A;  2IE3 C;  3QFN A;  4H1Y P;  1HO5 A;  1OIE A;  5F3W A;  4NZV A;  1OI8 A;  4ORC A;  3FGA C;  4H2I A;  3HVQ A;  4OR9 A;  3EGH A;  4V0V A;  3H61 A;  2NPP C;  2QJC A;  2DXN A;  2ZOA A;  1UTE A;  3H66 A;  1S70 A;  1U32 A;  4YKE A;  1S3L A;  2Z1A A;  3IVE A;  2USH A;  3PSO A;  4KBP A;  3DW8 C;  5JJT A;  1MF8 A;  2NYM C;  2HYO A;  4IYP C;  3E0J A;  3T1I A;  3P71 C;  2IAE C;  3QFK A;  4G9J A;  4I5N C;  1OID A;  5DNY A;  3C9F A;  3E7A A;  3D03 A;  5B8I A;  4FBQ A;  1QHW A;  2JOG A;  3ZTV A;  1JK7 A;  3AV0 A;  3N5U A;  4O43 A;  1WAO 1;  4DT2 A;  1Z2X A;  2GJU A;  3CK2 A;  1UF3 A;  1USH A;  3H62 B;  1T70 A;  3RL5 A;  4TUI A;  1V73 A;  3C5W C;  1QFC A;  2NYL C;  1T71 A;  1Z2W A;  1HP1 A;  2XMO A;  5C1V A;  4J6O A;  4O24 A;  2R17 A;  3GVE A;  4FBW A;  5EQV A;  4B2O A;  1S3M A;  4H2B A;  5JPF A;  4ORA A;  4O5G A;  3FLO A;  4UWQ A;  3K7W C;  2NXF A;  2WDE A;  4JA7 A;  1II7 A;  3TGH A;  3QG5 C;  3IVD A;  3PSN A;  4H2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...