4NZVA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
329
Chain Sequence
HHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Exonuclease, putative
total genus 110
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4nzvA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4nzvA01
2YVTA 4UT2A 1MF8A 1IT6A 4YKEA 4XPNA 1WAO1 2GJUA 4O5GA 4TUIA 1HO5A 4H2IA 4UWQA 3EGHA 3ZU0A 3IVDA 3H63A 2HYPA 4JA9A 4JA7A 1S95A 3V4YA 5GTUA 3QFKA 4LU9A 3DSCA 4MOYA 2BDXA 2P6BA 2BCDA 3H66A 1UTEA 3E7BA 4IL1A 3THOB 4J6OA 3HVQA 4ZVZA 3DSDA 4FCXA 5JPEA 2Z72A 3ZTVA 1S8EA 1T70A 2A22A 5HPEA 2IE4C 2Z06A 2Z1AA 1NNWA 2NYLC 4NZVA 5B8IA 2HY1A 1S3LA 3ICFA 4I5LC 2IE3C 5DNYA 2AHDA 2WDFA 1II7A 3H62B 3THNA 3RL5A 1OIDA 3PSOA 2USHA 3P71C 2JOGA 1USHA 3K7WC 5C1VA 2XMOA 4HD0A 3RQZA 4H2BA 2IAEC 4ORBA 3RL4A 2O8AA 4H2FA 1XZWA 5JPFA 5F3WA 4O4KA 1S3NA 2NPPC 3KBPA 3QFNA 4LTYA 4UT3A 1W24A 3IB7A 5INBA 1HPUA 1T71A 3H61A 2R17A 3TGHA 4DHLA 5JJTA 4FBKA 2CV9A 3H69A 3K7VC 3H68A 4F0ZA 1HP1A 2QJCA 2QFRA 3H60A 3IVEA 4ORAA 1G5BA 2Q8UA 1AUIA 1OI8A 1QHWA 3IB8A 3C5WC 2QFPA 2DFJA 4H2GA 1WARA 2WDDA 1S3MA 3JYFA 4M0VA 4WWLA 1FJMA 4ZX2A 2ZBMA 4V0VA 1UF3A 3PSNA 4FBQA 1Z2WA 5EQVA 1KBPA 4MP0A 1SU1A 3AUZA 4Q7FA 3LL8A 3DW8C 3GVEA 2NXFA 4I5NC 5IOHA 1M63A 4G9JA 3N5UA 3QFOA 2NYMC 3E7AA 2HYOA 4LACC 4MOVA 4UT3B 3RL3A 2O8GA 1QFCA 3EGGA 4TUGA 1V73A 3QFMA 4KKZA 2KKNA 3C9FA 1S70A 4B2OA 4DT2A 1TCOA 4FBWA 4OR9A 1JK7A 4DSYA 2BQ8X 2WDCA 3QG5C 4H1YP 1XM7A 4ORCA 4H1SA 2WDEA 4O43A 1OIEA 4IYPC 4V0WA 4KBPA 3H67A 1Z2XA 5J28A 4V0XA 3CK2A 3H64A 3T1IA 3AV0A 4O24A 1U32A 3FGAC
chains in the Genus database with same CATH superfamily
2YVTA 3M99B 4UT2A 2FTXB 1IT6A 1MF8A 1Z1BA 4XPNA 1UN6B 4O5GA 2LE2A 2YTPA 4RH8A 1HO5A 4H2IA 1GZ6A 4JA9A 3ZU0A 2L2KB 2F8BA 2RS6A 4LU9A 5IWAE 3DSCA 4MOYA 3BBGA 1JK2A 2P6BA 1EH7A 2YTIA 3H66A 2EMXA 1WRJA 2EOXA 2EM0A 3F6GA 1FJGE 3HVQA 4IL1A 3RMPA 1RQ0A 2B7TA 2L8TA 4Q35B 3EPHA 5JPEA 2E72A 3ZTVA 4R2SA 2A22A 1ZBTA 4JI7E 4B3TE 2UXDE 4FK5C 2HC5A 4NZVA 3HPZA 1AH5A 3ICFA 3FIGA 4WPYA 1II7A 2L3JA 4BC7A 1YUJA 3J81C 1G2DC 4JI3E 2L3CA 4N4RB 3VYYA 4IJDA 1MGTA 4JV5E 5C1VA 1YZ9A 2IAEC 2EOFA 3DF6A 2EMYA 3MHHC 5F3WA 4O4KA 2EPNA 5INBA 2KONA 2RTXA 2ENAA 4DR7E 2EMBA 1T71A 3H61A 4YY3E 2JOBA 2ODRC 2EMFA 3KZZA 2MC5A 2CPNA 3EPLA 2QJCA 4R2QA 2QFRA 2J7JA 3IVEA 4ORAA 2WBTA 2V83A 2YTDA 4BHBA 2F4VE 3HQ1A 2M4IA 3OTOE 2YRMA 3VYXA 2EOZA 2ADRA 3J7Yp 2LUPB 4MLVA 3VK6A 2EM5A 1N3GA 4ZX2A 2EM2A 4LF9E 4DV1E 2UXCE 2EM6A 1JK1A 2HGHA 3DW8C 3L00A 1IMUA 1X3CA 2D9HA 1NCSA 2EPOA 2DSYA 3LLHA 4X62E 3E7AA 1IBME 4LACC 1A1IA 2HHHE 5AASA 2CSHA 2EMIA 2EOYA 1V73A 2E1MA 4F6MA 2LV2A 4R03A 4KKZA 4X9JA 2KKNA 1HNXE 1S70A 2ENCA 2R76A 4DT2A 3OMLA 5KL3A 4JI6E 2EM8A 4WSGA 4BBYA 4GKJE 2BQ8X 4H1YP 2EM9A 1XM7A 2YTNA 4O43A 1OIEA 4KBPA 1N33E 1Z2XA 1WHQA 3IWDA 3H64A 1FKAE 4O24A 3JAMC 2H36X 1IBKE 3K6QA 2EMAA 4NXME 2EMLA 4BHCA 2M7QA 1HNWE 3MHSC 4UWQA 2V86A 2G7HA 4JA7A 3V4YA 2HYPA 2ELYA 1SFEA 3EQ1A 4R2RA 4BS9A 2KOUA 4DR1E 2UUCE 2L2MA 4KWYA 4ZVZA 4DR5E 2EQ0A 1UILA 2Z72A 4DV6E 1S8EA 5KL2A 4WX9A 4DV0E 2IE4C 2Z06A 4I8OA 2Z1AA 2N3GA 3EPJA 1NNWA 2NYLC 4HEIA 2HY1A 4LFAE 2N3HA 1RMDA 4BC9A 2EN2A 1XMOE 1PJSA 2RQLA 5DNYA 4DR2E 2WDFA 3H62B 2LRSA 4DR4E 2B9DA 1OIDA 2LJHA 2YZTA 2GLIA 3K7WC 1XNRE 1TF6A 3RQZA 3C6MA 2EZ6A 4L8NA 4LTYA 5IV8B 4UT3A 2EN4A 1J26A 4JI0E 2JYAA 5JJTA 2M9AA 1T4NA 2EORA 1HR0E 3H69A 2BB8A 2L6MA 4X8WA 2ZOAA 2B7VA 1TF3A 4DR3E 2EPXA 2DGCA 4L5NC 4ZYEA 2EP3A 1ZBQA 2EPRA 2V85A 1XNQE 3IB8A 4R2EA 3LMLA 4P7DA 5LLQA 4GKKE 4GZNC 1S3MA 2MKDA 3KZYA 4M0VA 2EPCA 2LTSA 2MDRA 3IWBA 3TQMA 4DV5E 4FBQA 2NUFA 3ZOQB 4X64E 1LLMC 1KBPA 2DMIA 2L92A 1T4OA 2ENHA 2EPUA 3LL8A 2CT1A 2KHXA 4F9AB 4ZYGA 1A1JA 2EPMX 2NXFA 2NUEA 2EM7A 3QFOA 3EPKA 1N34E 2YTGA 2YT4A 4NHRA 2ELZA 2JWOA 1PJTA 2K4VA 4NXNE 4F54A 2DLKA 2EN7A 1T4LB 2V89A 1NEIA 3HPSA 3C4TA 3HTXA 4B3SE 2JOXA 1YPNA 3BIDA 5IT9C 2EMZA 4R8OA 4WSPA 3IWCA 1BBGA 2WDCA 3ADGA 2WBSA 2EWLA 4H1SA 4ORCA 2WZOA 4IYPC 2EMGA 2EOIA 1UHZA 4LF4E 4DV7E 3CK2A 2EOQA 2IHR1 1A1GA 3T1IA 1KYQA 3H60A 3ADLA 1U32A 2JVAA 2EL4A 4R2DA 2YU5A 5AE3A 1IQOA 2UUAE 5KL5A 1X47A 1A1FA 2M1SA 2EOMA 2YWQA 2VQEE 3H63A 1S95A 5AC5A 1DQ3A 3HXLA 3QFKA 4X66E 2BDXA 2BCDA 2JR1A 2EE8A 3E7BA 5IXMB 3THOB 2VRDA 1KJKA 3BGHA 2ODRD 3ADJA 1T70A 5HPEA 1BB8A 2YTFA 3DJWA 5B8IA 5TSEA 2NA2A 2K7IA 2YSPA 2EJ4A 4M9VC 4K0KE 2IE3C 2UU9E 1N32E 2EM3A 3JU0A 2DB2A 1EH8A 2EOHA 3RL5A 5AE1A 3VHTB 3PSOA 2USHA 4HD0A 2V88A 4WXCA 4F9BB 4LF5E 3RL4A 2EN3A 5JPFA 2EL6A 1S3NA 2NPPC 3QFNA 1ZU1A 1W24A 2LJUA 5FLXC 2EQ1A 1XMQE 1X6HA 2CV9A 3H68A 2RPCA 4HTGA 1L4SA 2R1FA 1I94E 1HP1A 1X49A 5T6JA 5KL6A 4YHHE 1G5BA 2Q8UA 4DUZE 1AUIA 1YUIA 3KWRA 3P1XA 2EN1A 2LTRA 1QHWA 3C5WC 3E0JA 5A69A 2FV4B 5LL6R 3JYFA 5LMNE 2MDGA 4F2JC 4V0VA 5AE2A 3PSNA 1IQSA 1Z2WA 1PJQA 2EMWA 4AQYE 2VQFE 2PRTA 4JI1E 5A6BD 1TN9A 4F6NA 2JY9A 2LBSB 2MKNA 4IS1C 1X6FA 3GVEA 3J80C 4I5NC 2EPKX 1STUA 1IBLE 1M63A 2NYMC 5BR8E 1YSAC 2HYOA 4DKKA 1T38A 4DUYE 3FLOA 3RL3A 4B3RE 3F6HA 1F2IG 2YTEA 4DMIA 2O8GA 3EGGA 2DXNA 3UK3C 5A2QC 1N36E 4LF6E 1BBOA 3C9FA 1DGCA 2MC6A 1GQEA 4OR9A 2JPAA 2EPZA 1HNZE 1JK7A 3JTZA 1P47A 3QG5C 4M30A 2YTOA 1PDAA 2EN6A 4V0WA 3H67A 2HJJA 4V0XA 1PKPA 1AAYA 4B3ME 2YTJA 2EQ3A 1EH6A 3T1YE 3FGAC 4ZYHA 1X48A 2GPIA 1G2FC 2EL5A 4DV2E 4YKEA 2B3TB 1WAO1 2GJUA 4Q28A 4TUIA 4DV4E 3EGHA 1QNTA 3C6KA 3IVDA 2EOJA 3MSWA 4WFTA 1EKZA 5GTUA 2YRKA 1WHNA 1UTEA 1SR9A 4J6OA 4JI4E 3DSDA 4DV3E 4FCXA 4OX9E 5KL4A 2V87A 4MLQA 2ZO9B 2RSIA 2DIXA 4LF7E 2FGGA 2UXBE 1S3LA 1DI2A 1YYOA 3J7AG 4I5LC 2I9IA 2N8XA 4BCAA 4BMJA 2AHDA 1YYKA 5A6JA 3THNA 1ZAAC 2VE7C 3P71C 2JOGA 1USHA 4JI8E 5A6BA 2XMOA 2YEQA 2NABA 5AC4A 4R2AA 4H2BA 4ORBA 4ZYDA 2RS7A 2O8AA 4H2FA 1XZWA 3KBPA 4X65E 3IB7A 1X5WA 1HPUA 4F9CB 5CFFE 2LT7A 2R17A 3TGHA 4DHLA 2EMHA 4FBKA 2LMZA 2YU8A 3K7VC 1B69A 1QU6A 1MEYC 4F0ZA 1WXRA 2DLQA 2EOSA 2JP9A 4KHPE 3ADIA 1J5EE 1A1KA 2EMCA 2E5LE 2WBUA 2EM4A 4LFBE 2L2NA 1OI8A 2I13A 2WCC3 2EPAA 1X6EA 5A6KA 1A1LA 2DFJA 4WYQB 2QFPA 1WARA 4H2GA 4J8ZA 2JXPA 2WDDA 2DMYA 2DXLA 1A1HA 2EOOA 4WWLA 1FJMA 2ZBMA 1UF3A 2L33A 5EQVA 2RSMA 2EOEA 3D03A 4MP0A 2V8QB 1SU1A 3AUZA 4Q7FA 2NUGA 4GEQB 2EPLX 2EPPA 2ZM6E 2YPNA 2VF1A 1RC7A 4M2ZA 1T39A 5IOHA 4G9JA 5A6AA 3N5UA 3H09A 3ECRA 2EMKA 2UUBE 1YFHA 1GTKA 2A25A 1O0WA 5ADZA 3T1HE 4LFCE 4MOVA 4UT3B 1UBDC 4JYAE 1QFCA 4TUGA 3QFMA 1ZR9A 3C4BA 4B2OA 1TCOA 2DRPA 4FBWA 2LO3A 2YSOA 4KZSA 1WJPA 2EN8A 2LUQA 2GHFA 4JI2E 4DSYA 4R2PA 5LMUE 1YYWA 2WDEA 2LCEA 2LVHA 4R2CA 4DR6E 2CTDA 4WXDA 5KL7A 2YTQA 5J28A 4OOGC 3BF2A 4LF8E 2BBGA 4JI5E 4P78A 4RHBB 2YRHA 3AV0A
chains in the Genus database with same CATH topology
2YVTA 4UT2A 1MF8A 1IT6A 4YKEA 4XPNA 1WAO1 2GJUA 4O5GA 4TUIA 1HO5A 4H2IA 4UWQA 3EGHA 3ZU0A 3IVDA 3H63A 2HYPA 4JA9A 4JA7A 1S95A 3V4YA 5GTUA 3QFKA 4LU9A 3DSCA 4MOYA 2BDXA 2P6BA 2BCDA 3H66A 1UTEA 3E7BA 4IL1A 3THOB 3DSDA 3HVQA 4J6OA 4ZVZA 4FCXA 5JPEA 2Z72A 3ZTVA 2ZO9B 1S8EA 1T70A 2A22A 5HPEA 2IE4C 2Z06A 2Z1AA 1NNWA 2NYLC 4NZVA 5B8IA 2HY1A 1S3LA 3ICFA 4I5LC 2IE3C 5DNYA 2AHDA 2WDFA 1II7A 3H62B 3THNA 3RL5A 1OIDA 3PSOA 2USHA 3P71C 2JOGA 1USHA 3K7WC 5C1VA 4HD0A 2XMOA 2YEQA 3RQZA 4H2BA 2IAEC 4ORBA 3RL4A 2O8AA 4H2FA 1XZWA 5JPFA 5F3WA 4O4KA 1S3NA 2NPPC 3KBPA 3QFNA 4LTYA 4UT3A 1W24A 3IB7A 5INBA 1HPUA 1T71A 3H61A 2R17A 3TGHA 4DHLA 5JJTA 4FBKA 2CV9A 3H69A 3K7VC 2ZOAA 3H68A 4F0ZA 1HP1A 2QJCA 2QFRA 3H60A 3IVEA 4ORAA 1G5BA 2Q8UA 1AUIA 1OI8A 1QHWA 3IB8A 3E0JA 3C5WC 2QFPA 2DFJA 4H2GA 1WARA 2WDDA 1S3MA 2DXLA 3JYFA 4M0VA 4WWLA 1FJMA 4ZX2A 2ZBMA 4V0VA 1UF3A 3PSNA 4FBQA 1Z2WA 5EQVA 3D03A 1KBPA 4MP0A 1SU1A 3AUZA 4Q7FA 3LL8A 3DW8C 3GVEA 2NXFA 4I5NC 5IOHA 1M63A 4G9JA 3N5UA 3QFOA 2NYMC 3E7AA 2HYOA 4LACC 4MOVA 3FLOA 4UT3B 3RL3A 2O8GA 1QFCA 3EGGA 2DXNA 4TUGA 1V73A 3QFMA 4KKZA 2KKNA 3C9FA 1S70A 4B2OA 4DT2A 1TCOA 4FBWA 4OR9A 1JK7A 4DSYA 2BQ8X 2WDCA 3QG5C 4H1YP 1XM7A 4ORCA 4H1SA 2WDEA 4O43A 1OIEA 4IYPC 4V0WA 4KBPA 3H67A 1Z2XA 5J28A 4V0XA 3CK2A 3H64A 3T1IA 3AV0A 4O24A 1U32A 3FGAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVT A;  4UT2 A;  1MF8 A;  1IT6 A;  4YKE A;  4XPN A;  1WAO 1;  2GJU A;  4O5G A;  4TUI A;  1HO5 A;  4H2I A;  4UWQ A;  3EGH A;  3ZU0 A;  3IVD A;  3H63 A;  2HYP A;  4JA9 A;  4JA7 A;  1S95 A;  3V4Y A;  5GTU A;  3QFK A;  4LU9 A;  3DSC A;  4MOY A;  2BDX A;  2P6B A;  2BCD A;  3H66 A;  1UTE A;  3E7B A;  4IL1 A;  3THO B;  4J6O A;  3HVQ A;  4ZVZ A;  3DSD A;  4FCX A;  5JPE A;  2Z72 A;  3ZTV A;  1S8E A;  1T70 A;  2A22 A;  5HPE A;  2IE4 C;  2Z06 A;  2Z1A A;  1NNW A;  2NYL C;  4NZV A;  5B8I A;  2HY1 A;  1S3L A;  3ICF A;  4I5L C;  2IE3 C;  5DNY A;  2AHD A;  2WDF A;  1II7 A;  3H62 B;  3THN A;  3RL5 A;  1OID A;  3PSO A;  2USH A;  3P71 C;  2JOG A;  1USH A;  3K7W C;  5C1V A;  2XMO A;  4HD0 A;  3RQZ A;  4H2B A;  2IAE C;  4ORB A;  3RL4 A;  2O8A A;  4H2F A;  1XZW A;  5JPF A;  5F3W A;  4O4K A;  1S3N A;  2NPP C;  3KBP A;  3QFN A;  4LTY A;  4UT3 A;  1W24 A;  3IB7 A;  5INB A;  1HPU A;  1T71 A;  3H61 A;  2R17 A;  3TGH A;  4DHL A;  5JJT A;  4FBK A;  2CV9 A;  3H69 A;  3K7V C;  3H68 A;  4F0Z A;  1HP1 A;  2QJC A;  2QFR A;  3H60 A;  3IVE A;  4ORA A;  1G5B A;  2Q8U A;  1AUI A;  1OI8 A;  1QHW A;  3IB8 A;  3C5W C;  2QFP A;  2DFJ A;  4H2G A;  1WAR A;  2WDD A;  1S3M A;  3JYF A;  4M0V A;  4WWL A;  1FJM A;  4ZX2 A;  2ZBM A;  4V0V A;  1UF3 A;  3PSN A;  4FBQ A;  1Z2W A;  5EQV A;  1KBP A;  4MP0 A;  1SU1 A;  3AUZ A;  4Q7F A;  3LL8 A;  3DW8 C;  3GVE A;  2NXF A;  4I5N C;  5IOH A;  1M63 A;  4G9J A;  3N5U A;  3QFO A;  2NYM C;  3E7A A;  2HYO A;  4LAC C;  4MOV A;  4UT3 B;  3RL3 A;  2O8G A;  1QFC A;  3EGG A;  4TUG A;  1V73 A;  3QFM A;  4KKZ A;  2KKN A;  3C9F A;  1S70 A;  4B2O A;  4DT2 A;  1TCO A;  4FBW A;  4OR9 A;  1JK7 A;  4DSY A;  2BQ8 X;  2WDC A;  3QG5 C;  4H1Y P;  1XM7 A;  4ORC A;  4H1S A;  2WDE A;  4O43 A;  1OIE A;  4IYP C;  4V0W A;  4KBP A;  3H67 A;  1Z2X A;  5J28 A;  4V0X A;  3CK2 A;  3H64 A;  3T1I A;  3AV0 A;  4O24 A;  1U32 A;  3FGA C; 
#chains in the Genus database with same CATH topology
 2YVT A;  3M99 B;  4UT2 A;  2FTX B;  1IT6 A;  1MF8 A;  1Z1B A;  4XPN A;  1UN6 B;  4O5G A;  2LE2 A;  2YTP A;  4RH8 A;  1HO5 A;  4H2I A;  1GZ6 A;  4JA9 A;  3ZU0 A;  2L2K B;  2F8B A;  2RS6 A;  4LU9 A;  5IWA E;  3DSC A;  4MOY A;  3BBG A;  1JK2 A;  2P6B A;  1EH7 A;  2YTI A;  3H66 A;  2EMX A;  1WRJ A;  2EOX A;  2EM0 A;  3F6G A;  1FJG E;  3HVQ A;  4IL1 A;  3RMP A;  1RQ0 A;  2B7T A;  2L8T A;  4Q35 B;  3EPH A;  5JPE A;  2E72 A;  3ZTV A;  4R2S A;  2A22 A;  1ZBT A;  4JI7 E;  4B3T E;  2UXD E;  4FK5 C;  2HC5 A;  4NZV A;  3HPZ A;  1AH5 A;  3ICF A;  3FIG A;  4WPY A;  1II7 A;  2L3J A;  4BC7 A;  1YUJ A;  3J81 C;  1G2D C;  4JI3 E;  2L3C A;  4N4R B;  3VYY A;  4IJD A;  1MGT A;  4JV5 E;  5C1V A;  1YZ9 A;  2IAE C;  2EOF A;  3DF6 A;  2EMY A;  3MHH C;  5F3W A;  4O4K A;  2EPN A;  5INB A;  2KON A;  2RTX A;  2ENA A;  4DR7 E;  2EMB A;  1T71 A;  3H61 A;  4YY3 E;  2JOB A;  2ODR C;  2EMF A;  3KZZ A;  2MC5 A;  2CPN A;  3EPL A;  2QJC A;  4R2Q A;  2QFR A;  2J7J A;  3IVE A;  4ORA A;  2WBT A;  2V83 A;  2YTD A;  4BHB A;  2F4V E;  3HQ1 A;  2M4I A;  3OTO E;  2YRM A;  3VYX A;  2EOZ A;  2ADR A;  3J7Y p;  2LUP B;  4MLV A;  3VK6 A;  2EM5 A;  1N3G A;  4ZX2 A;  2EM2 A;  4LF9 E;  4DV1 E;  2UXC E;  2EM6 A;  1JK1 A;  2HGH A;  3DW8 C;  3L00 A;  1IMU A;  1X3C A;  2D9H A;  1NCS A;  2EPO A;  2DSY A;  3LLH A;  4X62 E;  3E7A A;  1IBM E;  4LAC C;  1A1I A;  2HHH E;  5AAS A;  2CSH A;  2EMI A;  2EOY A;  1V73 A;  2E1M A;  4F6M A;  2LV2 A;  4R03 A;  4KKZ A;  4X9J A;  2KKN A;  1HNX E;  1S70 A;  2ENC A;  2R76 A;  4DT2 A;  3OML A;  5KL3 A;  4JI6 E;  2EM8 A;  4WSG A;  4BBY A;  4GKJ E;  2BQ8 X;  4H1Y P;  2EM9 A;  1XM7 A;  2YTN A;  4O43 A;  1OIE A;  4KBP A;  1N33 E;  1Z2X A;  1WHQ A;  3IWD A;  3H64 A;  1FKA E;  4O24 A;  3JAM C;  2H36 X;  1IBK E;  3K6Q A;  2EMA A;  4NXM E;  2EML A;  4BHC A;  2M7Q A;  1HNW E;  3MHS C;  4UWQ A;  2V86 A;  2G7H A;  4JA7 A;  3V4Y A;  2HYP A;  2ELY A;  1SFE A;  3EQ1 A;  4R2R A;  4BS9 A;  2KOU A;  4DR1 E;  2UUC E;  2L2M A;  4KWY A;  4ZVZ A;  4DR5 E;  2EQ0 A;  1UIL A;  2Z72 A;  4DV6 E;  1S8E A;  5KL2 A;  4WX9 A;  4DV0 E;  2IE4 C;  2Z06 A;  4I8O A;  2Z1A A;  2N3G A;  3EPJ A;  1NNW A;  2NYL C;  4HEI A;  2HY1 A;  4LFA E;  2N3H A;  1RMD A;  4BC9 A;  2EN2 A;  1XMO E;  1PJS A;  2RQL A;  5DNY A;  4DR2 E;  2WDF A;  3H62 B;  2LRS A;  4DR4 E;  2B9D A;  1OID A;  2LJH A;  2YZT A;  2GLI A;  3K7W C;  1XNR E;  1TF6 A;  3RQZ A;  3C6M A;  2EZ6 A;  4L8N A;  4LTY A;  5IV8 B;  4UT3 A;  2EN4 A;  1J26 A;  4JI0 E;  2JYA A;  5JJT A;  2M9A A;  1T4N A;  2EOR A;  1HR0 E;  3H69 A;  2BB8 A;  2L6M A;  4X8W A;  2ZOA A;  2B7V A;  1TF3 A;  4DR3 E;  2EPX A;  2DGC A;  4L5N C;  4ZYE A;  2EP3 A;  1ZBQ A;  2EPR A;  2V85 A;  1XNQ E;  3IB8 A;  4R2E A;  3LML A;  4P7D A;  5LLQ A;  4GKK E;  4GZN C;  1S3M A;  2MKD A;  3KZY A;  4M0V A;  2EPC A;  2LTS A;  2MDR A;  3IWB A;  3TQM A;  4DV5 E;  4FBQ A;  2NUF A;  3ZOQ B;  4X64 E;  1LLM C;  1KBP A;  2DMI A;  2L92 A;  1T4O A;  2ENH A;  2EPU A;  3LL8 A;  2CT1 A;  2KHX A;  4F9A B;  4ZYG A;  1A1J A;  2EPM X;  2NXF A;  2NUE A;  2EM7 A;  3QFO A;  3EPK A;  1N34 E;  2YTG A;  2YT4 A;  4NHR A;  2ELZ A;  2JWO A;  1PJT A;  2K4V A;  4NXN E;  4F54 A;  2DLK A;  2EN7 A;  1T4L B;  2V89 A;  1NEI A;  3HPS A;  3C4T A;  3HTX A;  4B3S E;  2JOX A;  1YPN A;  3BID A;  5IT9 C;  2EMZ A;  4R8O A;  4WSP A;  3IWC A;  1BBG A;  2WDC A;  3ADG A;  2WBS A;  2EWL A;  4H1S A;  4ORC A;  2WZO A;  4IYP C;  2EMG A;  2EOI A;  1UHZ A;  4LF4 E;  4DV7 E;  3CK2 A;  2EOQ A;  2IHR 1;  1A1G A;  3T1I A;  1KYQ A;  3H60 A;  3ADL A;  1U32 A;  2JVA A;  2EL4 A;  4R2D A;  2YU5 A;  5AE3 A;  1IQO A;  2UUA E;  5KL5 A;  1X47 A;  1A1F A;  2M1S A;  2EOM A;  2YWQ A;  2VQE E;  3H63 A;  1S95 A;  5AC5 A;  1DQ3 A;  3HXL A;  3QFK A;  4X66 E;  2BDX A;  2BCD A;  2JR1 A;  2EE8 A;  3E7B A;  5IXM B;  3THO B;  2VRD A;  1KJK A;  3BGH A;  2ODR D;  3ADJ A;  1T70 A;  5HPE A;  1BB8 A;  2YTF A;  3DJW A;  5B8I A;  5TSE A;  2NA2 A;  2K7I A;  2YSP A;  2EJ4 A;  4M9V C;  4K0K E;  2IE3 C;  2UU9 E;  1N32 E;  2EM3 A;  3JU0 A;  2DB2 A;  1EH8 A;  2EOH A;  3RL5 A;  5AE1 A;  3VHT B;  3PSO A;  2USH A;  4HD0 A;  2V88 A;  4WXC A;  4F9B B;  4LF5 E;  3RL4 A;  2EN3 A;  5JPF A;  2EL6 A;  1S3N A;  2NPP C;  3QFN A;  1ZU1 A;  1W24 A;  2LJU A;  5FLX C;  2EQ1 A;  1XMQ E;  1X6H A;  2CV9 A;  3H68 A;  2RPC A;  4HTG A;  1L4S A;  2R1F A;  1I94 E;  1HP1 A;  1X49 A;  5T6J A;  5KL6 A;  4YHH E;  1G5B A;  2Q8U A;  4DUZ E;  1AUI A;  1YUI A;  3KWR A;  3P1X A;  2EN1 A;  2LTR A;  1QHW A;  3C5W C;  3E0J A;  5A69 A;  2FV4 B;  5LL6 R;  3JYF A;  5LMN E;  2MDG A;  4F2J C;  4V0V A;  5AE2 A;  3PSN A;  1IQS A;  1Z2W A;  1PJQ A;  2EMW A;  4AQY E;  2VQF E;  2PRT A;  4JI1 E;  5A6B D;  1TN9 A;  4F6N A;  2JY9 A;  2LBS B;  2MKN A;  4IS1 C;  1X6F A;  3GVE A;  3J80 C;  4I5N C;  2EPK X;  1STU A;  1IBL E;  1M63 A;  2NYM C;  5BR8 E;  1YSA C;  2HYO A;  4DKK A;  1T38 A;  4DUY E;  3FLO A;  3RL3 A;  4B3R E;  3F6H A;  1F2I G;  2YTE A;  4DMI A;  2O8G A;  3EGG A;  2DXN A;  3UK3 C;  5A2Q C;  1N36 E;  4LF6 E;  1BBO A;  3C9F A;  1DGC A;  2MC6 A;  1GQE A;  4OR9 A;  2JPA A;  2EPZ A;  1HNZ E;  1JK7 A;  3JTZ A;  1P47 A;  3QG5 C;  4M30 A;  2YTO A;  1PDA A;  2EN6 A;  4V0W A;  3H67 A;  2HJJ A;  4V0X A;  1PKP A;  1AAY A;  4B3M E;  2YTJ A;  2EQ3 A;  1EH6 A;  3T1Y E;  3FGA C;  4ZYH A;  1X48 A;  2GPI A;  1G2F C;  2EL5 A;  4DV2 E;  4YKE A;  2B3T B;  1WAO 1;  2GJU A;  4Q28 A;  4TUI A;  4DV4 E;  3EGH A;  1QNT A;  3C6K A;  3IVD A;  2EOJ A;  3MSW A;  4WFT A;  1EKZ A;  5GTU A;  2YRK A;  1WHN A;  1UTE A;  1SR9 A;  4J6O A;  4JI4 E;  3DSD A;  4DV3 E;  4FCX A;  4OX9 E;  5KL4 A;  2V87 A;  4MLQ A;  2ZO9 B;  2RSI A;  2DIX A;  4LF7 E;  2FGG A;  2UXB E;  1S3L A;  1DI2 A;  1YYO A;  3J7A G;  4I5L C;  2I9I A;  2N8X A;  4BCA A;  4BMJ A;  2AHD A;  1YYK A;  5A6J A;  3THN A;  1ZAA C;  2VE7 C;  3P71 C;  2JOG A;  1USH A;  4JI8 E;  5A6B A;  2XMO A;  2YEQ A;  2NAB A;  5AC4 A;  4R2A A;  4H2B A;  4ORB A;  4ZYD A;  2RS7 A;  2O8A A;  4H2F A;  1XZW A;  3KBP A;  4X65 E;  3IB7 A;  1X5W A;  1HPU A;  4F9C B;  5CFF E;  2LT7 A;  2R17 A;  3TGH A;  4DHL A;  2EMH A;  4FBK A;  2LMZ A;  2YU8 A;  3K7V C;  1B69 A;  1QU6 A;  1MEY C;  4F0Z A;  1WXR A;  2DLQ A;  2EOS A;  2JP9 A;  4KHP E;  3ADI A;  1J5E E;  1A1K A;  2EMC A;  2E5L E;  2WBU A;  2EM4 A;  4LFB E;  2L2N A;  1OI8 A;  2I13 A;  2WCC 3;  2EPA A;  1X6E A;  5A6K A;  1A1L A;  2DFJ A;  4WYQ B;  2QFP A;  1WAR A;  4H2G A;  4J8Z A;  2JXP A;  2WDD A;  2DMY A;  2DXL A;  1A1H A;  2EOO A;  4WWL A;  1FJM A;  2ZBM A;  1UF3 A;  2L33 A;  5EQV A;  2RSM A;  2EOE A;  3D03 A;  4MP0 A;  2V8Q B;  1SU1 A;  3AUZ A;  4Q7F A;  2NUG A;  4GEQ B;  2EPL X;  2EPP A;  2ZM6 E;  2YPN A;  2VF1 A;  1RC7 A;  4M2Z A;  1T39 A;  5IOH A;  4G9J A;  5A6A A;  3N5U A;  3H09 A;  3ECR A;  2EMK A;  2UUB E;  1YFH A;  1GTK A;  2A25 A;  1O0W A;  5ADZ A;  3T1H E;  4LFC E;  4MOV A;  4UT3 B;  1UBD C;  4JYA E;  1QFC A;  4TUG A;  3QFM A;  1ZR9 A;  3C4B A;  4B2O A;  1TCO A;  2DRP A;  4FBW A;  2LO3 A;  2YSO A;  4KZS A;  1WJP A;  2EN8 A;  2LUQ A;  2GHF A;  4JI2 E;  4DSY A;  4R2P A;  5LMU E;  1YYW A;  2WDE A;  2LCE A;  2LVH A;  4R2C A;  4DR6 E;  2CTD A;  4WXD A;  5KL7 A;  2YTQ A;  5J28 A;  4OOG C;  3BF2 A;  4LF8 E;  2BBG A;  4JI5 E;  4P78 A;  4RHB B;  2YRH A;  3AV0 A; 
#chains in the Genus database with same CATH homology
 2YVT A;  4UT2 A;  1MF8 A;  1IT6 A;  4YKE A;  4XPN A;  1WAO 1;  2GJU A;  4O5G A;  4TUI A;  1HO5 A;  4H2I A;  4UWQ A;  3EGH A;  3ZU0 A;  3IVD A;  3H63 A;  2HYP A;  4JA9 A;  4JA7 A;  1S95 A;  3V4Y A;  5GTU A;  3QFK A;  4LU9 A;  3DSC A;  4MOY A;  2BDX A;  2P6B A;  2BCD A;  3H66 A;  1UTE A;  3E7B A;  4IL1 A;  3THO B;  3DSD A;  3HVQ A;  4J6O A;  4ZVZ A;  4FCX A;  5JPE A;  2Z72 A;  3ZTV A;  2ZO9 B;  1S8E A;  1T70 A;  2A22 A;  5HPE A;  2IE4 C;  2Z06 A;  2Z1A A;  1NNW A;  2NYL C;  4NZV A;  5B8I A;  2HY1 A;  1S3L A;  3ICF A;  4I5L C;  2IE3 C;  5DNY A;  2AHD A;  2WDF A;  1II7 A;  3H62 B;  3THN A;  3RL5 A;  1OID A;  3PSO A;  2USH A;  3P71 C;  2JOG A;  1USH A;  3K7W C;  5C1V A;  4HD0 A;  2XMO A;  2YEQ A;  3RQZ A;  4H2B A;  2IAE C;  4ORB A;  3RL4 A;  2O8A A;  4H2F A;  1XZW A;  5JPF A;  5F3W A;  4O4K A;  1S3N A;  2NPP C;  3KBP A;  3QFN A;  4LTY A;  4UT3 A;  1W24 A;  3IB7 A;  5INB A;  1HPU A;  1T71 A;  3H61 A;  2R17 A;  3TGH A;  4DHL A;  5JJT A;  4FBK A;  2CV9 A;  3H69 A;  3K7V C;  2ZOA A;  3H68 A;  4F0Z A;  1HP1 A;  2QJC A;  2QFR A;  3H60 A;  3IVE A;  4ORA A;  1G5B A;  2Q8U A;  1AUI A;  1OI8 A;  1QHW A;  3IB8 A;  3E0J A;  3C5W C;  2QFP A;  2DFJ A;  4H2G A;  1WAR A;  2WDD A;  1S3M A;  2DXL A;  3JYF A;  4M0V A;  4WWL A;  1FJM A;  4ZX2 A;  2ZBM A;  4V0V A;  1UF3 A;  3PSN A;  4FBQ A;  1Z2W A;  5EQV A;  3D03 A;  1KBP A;  4MP0 A;  1SU1 A;  3AUZ A;  4Q7F A;  3LL8 A;  3DW8 C;  3GVE A;  2NXF A;  4I5N C;  5IOH A;  1M63 A;  4G9J A;  3N5U A;  3QFO A;  2NYM C;  3E7A A;  2HYO A;  4LAC C;  4MOV A;  3FLO A;  4UT3 B;  3RL3 A;  2O8G A;  1QFC A;  3EGG A;  2DXN A;  4TUG A;  1V73 A;  3QFM A;  4KKZ A;  2KKN A;  3C9F A;  1S70 A;  4B2O A;  4DT2 A;  1TCO A;  4FBW A;  4OR9 A;  1JK7 A;  4DSY A;  2BQ8 X;  2WDC A;  3QG5 C;  4H1Y P;  1XM7 A;  4ORC A;  4H1S A;  2WDE A;  4O43 A;  1OIE A;  4IYP C;  4V0W A;  4KBP A;  3H67 A;  1Z2X A;  5J28 A;  4V0X A;  3CK2 A;  3H64 A;  3T1I A;  3AV0 A;  4O24 A;  1U32 A;  3FGA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...