4NZVA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
329
Chain Sequence
b'HHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 110
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4nzvA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4nzvA01
1NNWA 4MP0A 2HYPA 3H60A 4O24A 3RL5A 4JA9A 3K7VC 4KKZA 2O8AA 3E7AA 4ORAA 3KBPA 3HVQA 4TUIA 5JPEA 2IE3C 4F0ZA 1HO5A 3ZTVA 2JOGA 3H67A 2QFRA 2Z06A 3EGGA 4KBPA 4MOVA 5B8IA 5IOHA 2QFPA 2BDXA 4V0XA 5J28A 1G5BA 2WDFA 2NXFA 3PSOA 4I5LC 1II7A 2IE4C 3DSDA 1KBPA 1QFCA 1Z2WA 1JK7A 4H1SA 3THNA 4UT2A 4FBQA 3TGHA 4LU9A 2CV9A 4FCXA 4O5GA 3H68A 4G9JA 3QFOA 2Q8UA 1S8EA 2WDCA 1WAO1 3E7BA 3IB7A 3N5UA 4YKEA 3DSCA 4H2IA 3H61A 1U32A 4V0WA 4UWQA 3QFMA 4FBWA 4ZX2A 1S3LA 4H2GA 3IVDA 2QJCA 4Q7FA 3AUZA 1W24A 2A22A 3GVEA 2USHA 4DHLA 2Z72A 3H64A 4MOYA 1QHWA 4H2BA 5JJTA 2NYMC 1S95A 3V4YA 2WDEA 3PSNA 4IL1A 4J6OA 1OIEA 1WARA 3H66A 1AUIA 1UF3A 3C9FA 5INBA 2R17A 4UT3B 2NPPC 3IB8A 1USHA 2KKNA 3LL8A 4H1YP 2DFJA 2YVTA 4LACC 1MF8A 1M63A 2HYOA 4O43A 1T70A 5C1VA 4O4KA 1S70A 3FGAC 4I5NC 4LTYA 3T1IA 2O8GA 4HD0A 3AV0A 3ZU0A 3H63A 4ORBA 2AHDA 2Z1AA 3EGHA 3RQZA 4JA7A 2ZBMA 5EQVA 4TUGA 3THOB 4UT3A 2NYLC 1S3NA 5GTUA 2BQ8X 5HPEA 3ICFA 2BCDA 4M0VA 4ORCA 4DSYA 3DW8C 4H2FA 3RL3A 3CK2A 4V0VA 4ZVZA 3QG5C 4OR9A 2GJUA 3H62B 1XM7A 1IT6A 4IYPC 4WWLA 1UTEA 1OIDA 1XZWA 1Z2XA 2P6BA 3P71C 2WDDA 1HP1A 1T71A 3QFNA 3JYFA 4FBKA 4B2OA 3RL4A 5F3WA 4NZVA 5JPFA 1S3MA 4DT2A 2XMOA 1HPUA 1SU1A 3H69A 1FJMA 3IVEA 2IAEC 3K7WC 2HY1A 3C5WC 4XPNA 1V73A 1OI8A 5DNYA 1TCOA 3QFKA
chains in the Genus database with same CATH superfamily
2EMCA 1NNWA 1IBME 4MP0A 2HYPA 1N36E 2D9HA 4JA9A 2V85A 3RL5A 4BHBA 2EMLA 2EJ4A 2ENCA 2A25A 3HPZA 5IXMB 4NXNE 4OOGC 2NUFA 4TUIA 1XMOE 4JI5E 2WZOA 2HGHA 5JPEA 1HO5A 5FLXC 2JOGA 2FGGA 3ZTVA 4DV4E 3H67A 4X66E 3EPLA 2QFRA 4KBPA 5A69A 2NA2A 3EPJA 5J28A 2NXFA 2IE4C 2R1FA 2ADRA 1AAYA 1MGTA 1N33E 2YTIA 1QFCA 3HXLA 4R2QA 3EPHA 5AC4A 4WSGA 1N3GA 3OTOE 4UT2A 3J80C 2HC5A 2UXCE 4FCXA 1FKAE 2CTDA 3ADJA 4G9JA 3QFOA 2EE8A 2WDCA 1WAO1 4LF8E 4BBYA 2ZM6E 4YKEA 3DSCA 2YTOA 2F4VE 2EMWA 3IVDA 4LF6E 4GEQB 4NXME 4MLQA 1W24A 2JP9A 2USHA 3BGHA 3TQMA 3KZYA 2I9IA 4MOYA 4KWYA 2NABA 1QHWA 3V4YA 4R2EA 4IL1A 1GTKA 3HTXA 2B3TB 2EPZA 4F6NA 1PJTA 2LRSA 2M9AA 2NUGA 5KL4A 1EKZA 3MHSC 3KZZA 2CSHA 4X8WA 4X64E 2EPRA 2YSOA 1MF8A 4DV6E 2YTNA 2EOIA 4O43A 2BBGA 2LVHA 2RPCA 1IBLE 4N4RB 3T1IA 2O8GA 1YUJA 2YTGA 3H63A 4ORBA 1EH7A 1SR9A 1EH6A 2MC5A 1T4LB 3VYYA 5EQVA 4UT3A 1X6HA 2DSYA 2RQLA 5GTUA 3L00A 2JOBA 2EN1A 2EPPA 4LF7E 2LV2A 5CFFE 4H2FA 4R2CA 3CK2A 1DQ3A 4V0VA 2B7VA 3RL3A 4L8NA 4ZVZA 5LL6R 4BMJA 1IT6A 1LLMC 2L92A 2UU9E 1OIDA 5IWAE 2N8XA 3ADIA 1QU6A 5KL6A 1HP1A 2EMKA 3JYFA 5LMUE 4M9VC 1WRJA 5F3WA 2MKNA 2EZ6A 4DT2A 2EM7A 2XMOA 1PKPA 2R76A 2EN2A 4Q28A 1HPUA 2EMGA 2LUPB 1FJMA 3K7WC 2IAEC 3QFKA 2DRPA 2ELYA 2V88A 2B9DA 2VQFE 4FK5C 4O24A 2NUEA 2DMYA 4KHPE 3E7AA 3F6GA 2DMIA 2L8TA 2BB8A 3KBPA 3HVQA 5TSEA 2EPLX 4P78A 1DI2A 1WJPA 4F0ZA 2JR1A 2LUQA 1DGCA 1YFHA 1IBKE 1Z1BA 1X6FA 3BIDA 2EL6A 1KBPA 3UK3C 3JU0A 1HNWE 1Z2WA 4IS1C 2EOJA 2EQ3A 4LU9A 1J5EE 2MC6A 2UXDE 2E72A 1WXRA 3H68A 2JWOA 3J7Yp 1S8EA 3E7BA 2EPKX 3HPSA 1ZR9A 3H61A 3C6MA 5A6BD 3ECRA 2LE2A 5A6BA 1S3LA 4F54A 2LJHA 2EPXA 2L3JA 1X3CA 4JI8E 3C4TA 2Z72A 4BHCA 4DMIA 2YT4A 2EQ0A 1GQEA 1S95A 2NYMC 1I94E 3OMLA 4WFTA 1AUIA 1ZBQA 2KOUA 3C9FA 3EQ1A 1A1HA 5INBA 3KWRA 2R17A 2NPPC 2UUAE 5KL3A 2KKNA 4H1YP 2EM5A 2EOXA 4WX9A 1P47A 4LACC 3ADLA 1BBGA 4BCAA 3DF6A 5C1VA 2IHR1 2YTDA 1S70A 2EOHA 3FGAC 4LTYA 2YTPA 1UHZA 4HD0A 3ZU0A 3LMLA 1A1JA 2EPCA 2AHDA 1TN9A 2WBTA 4AQYE 2B7TA 3VYXA 2I13A 3P1XA 4TUGA 4ZYDA 2YU5A 5HPEA 5AE1A 4KZSA 2GLIA 3ICFA 4ORCA 2ELZA 4DSYA 1A1LA 2YTQA 1G2DC 2LJUA 2YRKA 3ADGA 1RC7A 3QG5C 4ZYGA 4DV0E 3H62B 4BS9A 2EPNA 4DR4E 2YZTA 4JI0E 4IYPC 1UTEA 1A1IA 2EOOA 2DLQA 2P6BA 4B3ME 3P71C 2EN4A 3JTZA 1NEIA 2G7HA 2VF1A 1HNXE 1PJQA 4B2OA 2EN7A 2FV4B 2EMBA 4RH8A 4M30A 3VHTB 4ZYHA 1ZAAC 2E5LE 2EM6A 2HHHE 4R2RA 2HY1A 5T6JA 1HNZE 5DNYA 1V73A 4X65E 4DV7E 3C5WC 4XPNA 4X62E 2ZO9B 1X6EA 4I8OA 1UN6B 1YPNA 2L2MA 3IWDA 4WPYA 4ZYEA 2DXLA 3VK6A 2HJJA 1KYQA 3C4BA 2ENHA 2N3HA 2EOMA 4YY3E 4BC9A 2FTXB 1NCSA 2MKDA 2Z06A 3EGGA 1ZBTA 5B8IA 2YRMA 3DJWA 2EN6A 2BDXA 4V0XA 2WDFA 4NHRA 1F2IG 4DR2E 4I5LC 3DSDA 3LLHA 2L3CA 4F9CB 2EOYA 1JK7A 3THNA 3TGHA 4DR1E 2CV9A 5AASA 1A1KA 1N32E 3N5UA 4MLVA 3IB7A 2L2NA 2YTFA 4V0WA 2RS6A 3QFMA 1UBDC 4DKKA 4FBWA 2CPNA 4H2GA 4ZX2A 2EM2A 3AUZA 2EWLA 2EPAA 2A22A 5KL5A 3JAMC 4LFAE 4YHHE 2YTEA 4BC7A 4GKKE 1T38A 5JJTA 2JVAA 2WDEA 3EPKA 1OIEA 1WARA 4F2JC 1MEYC 1UF3A 2RSMA 4X9JA 2UXBE 4OX9E 1PDAA 3IB8A 4JI4E 4LF9E 1USHA 4J8ZA 3FIGA 2EL5A 2VQEE 2RTXA 2DFJA 4WXDA 1TF3A 1A1FA 1GZ6A 2EM9A 1T70A 1ZU1A 1T39A 1G2FC 2EORA 4I5NC 1YSAC 2WBUA 3D03A 2LTRA 2VRDA 2V83A 2Z1AA 2EM4A 2YTJA 2EOFA 3H09A 3J7AG 4JA7A 2DGCA 3THOB 2GHFA 1AH5A 2MDGA 4B3RE 2EOEA 2BCDA 2YEQA 2M7QA 2M1SA 1EH8A 3RMPA 3DW8C 2L2KB 2LO3A 4LF4E 1KJKA 4WYQB 3F6HA 4OR9A 1IQSA 1T4OA 2EN3A 2ODRD 5LLQA 1XM7A 1FJGE 2EP3A 4WWLA 4DV2E 2K7IA 1X47A 2ODRC 1Z2XA 5A6AA 4Q35B 2V8QB 1B69A 1RQ0A 1BB8A 1T71A 3E0JA 3QFNA 2ZOAA 5AE3A 2EPOA 2VE7C 3K6QA 4L5NC 1RMDA 3T1YE 4DR6E 1A1GA 2EPUA 1S3MA 5IT9C 1SU1A 2UUBE 3H69A 2YU8A 3IVEA 4IJDA 2WCC3 2EMZA 2EM8A 1QNTA 3C6KA 4K0KE 1YYWA 2E1MA 4JI7E 3H60A 3K7VC 3IWBA 4KKZA 3MSWA 3BF2A 2O8AA 2EQ1A 2LT7A 1N34E 4LF5E 4JV5E 2EOSA 2WBSA 1YZ9A 4ORAA 2EMHA 4DV1E 2IE3C 1XMQE 5AC5A 1IQOA 1PJSA 4MOVA 3J81C 5IOHA 1XNQE 4DV5E 1JK1A 4LFCE 2QFPA 1G5BA 2EL4A 1XNRE 3PSOA 4R8OA 1II7A 2V87A 2L33A 4F9BB 4HEIA 3BBGA 2N3GA 4H1SA 2EM3A 1YUIA 4FBQA 4R2PA 2L6MA 2JY9A 4O5GA 2Q8UA 3M99B 4DV3E 2J7JA 5KL2A 1IMUA 4H2IA 1U32A 4UWQA 3MHHC 4GZNC 1YYOA 4Q7FA 2QJCA 2EN8A 4F9AB 3GVEA 2YSPA 2JPAA 4GKJE 4DHLA 1WHNA 3H64A 1T4NA 4H2BA 2LMZA 3PSNA 4J6OA 2EPMX 3IWCA 5BR8E 3H66A 3T1HE 2YPNA 4B3TE 4DUYE 1WHQA 2DIXA 4UT3B 4JI2E 1STUA 2GPIA 2H36X 2DXNA 2KHXA 2ENAA 3LL8A 2RSIA 2YVTA 1M63A 2YWQA 2EMAA 2HYOA 2DB2A 1BBOA 1X49A 2LTSA 4O4KA 2EOZA 2EMFA 3AV0A 2UUCE 2JOXA 4HTGA 3EGHA 3RQZA 2ZBMA 5LMNE 2PRTA 4DR3E 2NYLC 2K4VA 1S3NA 1X48A 2M4IA 2BQ8X 4M0VA 5AE2A 2LBSB 3FLOA 4JI3E 1YYKA 2KONA 5IV8B 1HR0E 2EMYA 4JI6E 2RS7A 2YRHA 4LFBE 2V89A 2LCEA 4R2SA 2MDRA 2GJUA 2EMXA 4P7DA 1J26A 4M2ZA 5ADZA 4B3SE 5A2QC 1TF6A 4JYAE 1L4SA 1UILA 1XZWA 1SFEA 2WDDA 4JI1E 3ZOQB 2V86A 4R2DA 5KL7A 4DR5E 4RHBB 2F8BA 4FBKA 3RL4A 1O0WA 2JXPA 4R2AA 4NZVA 1JK2A 5JPFA 4WXCA 4R03A 3HQ1A 5A6JA 4F6MA 2CT1A 4WSPA 1X5WA 4DR7E 2DLKA 2JYAA 1OI8A 1TCOA 2EOQA 5A6KA 4DUZE 2EM0A 2EMIA
chains in the Genus database with same CATH topology
1NNWA 4MP0A 2HYPA 2ZO9B 3H60A 4O24A 3RL5A 4JA9A 3K7VC 4KKZA 2DXLA 2O8AA 3E7AA 4ORAA 3KBPA 3HVQA 4TUIA 5JPEA 2IE3C 4F0ZA 1HO5A 3ZTVA 2JOGA 3H67A 2QFRA 2Z06A 3EGGA 4KBPA 4MOVA 5B8IA 5IOHA 2QFPA 2BDXA 4V0XA 5J28A 1G5BA 2WDFA 2NXFA 3PSOA 4I5LC 1II7A 3DSDA 2IE4C 1KBPA 1QFCA 1Z2WA 1JK7A 4H1SA 3THNA 4UT2A 4FBQA 3TGHA 4LU9A 2CV9A 4FCXA 4O5GA 3H68A 4G9JA 3QFOA 1S8EA 2Q8UA 2WDCA 1WAO1 3E7BA 3IB7A 3DSCA 3N5UA 4YKEA 4H2IA 3H61A 1U32A 4V0WA 4UWQA 3QFMA 4FBWA 4ZX2A 1S3LA 4H2GA 3IVDA 2QJCA 4Q7FA 3AUZA 1W24A 2A22A 3GVEA 2USHA 4DHLA 2Z72A 3H64A 4MOYA 1QHWA 4H2BA 5JJTA 2NYMC 1S95A 3V4YA 2WDEA 3PSNA 4IL1A 4J6OA 1OIEA 1WARA 3H66A 1AUIA 1UF3A 3C9FA 5INBA 2R17A 4UT3B 2DXNA 2NPPC 3IB8A 1USHA 2KKNA 3LL8A 4H1YP 2DFJA 2YVTA 4LACC 1MF8A 1M63A 2HYOA 4O43A 1T70A 5C1VA 4O4KA 1S70A 3FGAC 4I5NC 4LTYA 3T1IA 2O8GA 3D03A 4HD0A 3AV0A 3ZU0A 3H63A 4ORBA 2AHDA 2Z1AA 3EGHA 3RQZA 4JA7A 2ZBMA 5EQVA 4TUGA 3THOB 4UT3A 2NYLC 1S3NA 5GTUA 2BQ8X 5HPEA 3ICFA 2BCDA 2YEQA 4M0VA 4ORCA 3FLOA 4DSYA 3DW8C 4H2FA 3RL3A 3CK2A 4V0VA 4ZVZA 3QG5C 4OR9A 2GJUA 3H62B 1XM7A 1IT6A 4IYPC 4WWLA 1UTEA 1OIDA 1XZWA 1Z2XA 2P6BA 3P71C 2WDDA 1HP1A 1T71A 3E0JA 3QFNA 2ZOAA 3JYFA 4FBKA 4B2OA 3RL4A 5F3WA 4NZVA 5JPFA 1S3MA 4DT2A 2XMOA 1HPUA 1SU1A 3H69A 1FJMA 3IVEA 2IAEC 3K7WC 2HY1A 3C5WC 4XPNA 1V73A 1OI8A 5DNYA 1TCOA 3QFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNW A;  4MP0 A;  2HYP A;  3H60 A;  4O24 A;  3RL5 A;  4JA9 A;  3K7V C;  4KKZ A;  2O8A A;  3E7A A;  4ORA A;  3KBP A;  3HVQ A;  4TUI A;  5JPE A;  2IE3 C;  4F0Z A;  1HO5 A;  3ZTV A;  2JOG A;  3H67 A;  2QFR A;  2Z06 A;  3EGG A;  4KBP A;  4MOV A;  5B8I A;  5IOH A;  2QFP A;  2BDX A;  4V0X A;  5J28 A;  1G5B A;  2WDF A;  2NXF A;  3PSO A;  4I5L C;  1II7 A;  2IE4 C;  3DSD A;  1KBP A;  1QFC A;  1Z2W A;  1JK7 A;  4H1S A;  3THN A;  4UT2 A;  4FBQ A;  3TGH A;  4LU9 A;  2CV9 A;  4FCX A;  4O5G A;  3H68 A;  4G9J A;  3QFO A;  2Q8U A;  1S8E A;  2WDC A;  1WAO 1;  3E7B A;  3IB7 A;  3N5U A;  4YKE A;  3DSC A;  4H2I A;  3H61 A;  1U32 A;  4V0W A;  4UWQ A;  3QFM A;  4FBW A;  4ZX2 A;  1S3L A;  4H2G A;  3IVD A;  2QJC A;  4Q7F A;  3AUZ A;  1W24 A;  2A22 A;  3GVE A;  2USH A;  4DHL A;  2Z72 A;  3H64 A;  4MOY A;  1QHW A;  4H2B A;  5JJT A;  2NYM C;  1S95 A;  3V4Y A;  2WDE A;  3PSN A;  4IL1 A;  4J6O A;  1OIE A;  1WAR A;  3H66 A;  1AUI A;  1UF3 A;  3C9F A;  5INB A;  2R17 A;  4UT3 B;  2NPP C;  3IB8 A;  1USH A;  2KKN A;  3LL8 A;  4H1Y P;  2DFJ A;  2YVT A;  4LAC C;  1MF8 A;  1M63 A;  2HYO A;  4O43 A;  1T70 A;  5C1V A;  4O4K A;  1S70 A;  3FGA C;  4I5N C;  4LTY A;  3T1I A;  2O8G A;  4HD0 A;  3AV0 A;  3ZU0 A;  3H63 A;  4ORB A;  2AHD A;  2Z1A A;  3EGH A;  3RQZ A;  4JA7 A;  2ZBM A;  5EQV A;  4TUG A;  3THO B;  4UT3 A;  2NYL C;  1S3N A;  5GTU A;  2BQ8 X;  5HPE A;  3ICF A;  2BCD A;  4M0V A;  4ORC A;  4DSY A;  3DW8 C;  4H2F A;  3RL3 A;  3CK2 A;  4V0V A;  4ZVZ A;  3QG5 C;  4OR9 A;  2GJU A;  3H62 B;  1XM7 A;  1IT6 A;  4IYP C;  4WWL A;  1UTE A;  1OID A;  1XZW A;  1Z2X A;  2P6B A;  3P71 C;  2WDD A;  1HP1 A;  1T71 A;  3QFN A;  3JYF A;  4FBK A;  4B2O A;  3RL4 A;  5F3W A;  4NZV A;  5JPF A;  1S3M A;  4DT2 A;  2XMO A;  1HPU A;  1SU1 A;  3H69 A;  1FJM A;  3IVE A;  2IAE C;  3K7W C;  2HY1 A;  3C5W C;  4XPN A;  1V73 A;  1OI8 A;  5DNY A;  1TCO A;  3QFK A; 
#chains in the Genus database with same CATH topology
 2EMC A;  1NNW A;  1IBM E;  4MP0 A;  2HYP A;  1N36 E;  2D9H A;  4JA9 A;  2V85 A;  3RL5 A;  4BHB A;  2EML A;  2EJ4 A;  2ENC A;  2A25 A;  3HPZ A;  5IXM B;  4NXN E;  4OOG C;  2NUF A;  4TUI A;  1XMO E;  4JI5 E;  2WZO A;  2HGH A;  5JPE A;  1HO5 A;  5FLX C;  2JOG A;  2FGG A;  3ZTV A;  4DV4 E;  3H67 A;  4X66 E;  3EPL A;  2QFR A;  4KBP A;  5A69 A;  2NA2 A;  3EPJ A;  5J28 A;  2NXF A;  2IE4 C;  2R1F A;  2ADR A;  1AAY A;  1MGT A;  1N33 E;  2YTI A;  1QFC A;  3HXL A;  4R2Q A;  3EPH A;  5AC4 A;  4WSG A;  1N3G A;  3OTO E;  4UT2 A;  3J80 C;  2HC5 A;  2UXC E;  4FCX A;  1FKA E;  2CTD A;  3ADJ A;  4G9J A;  3QFO A;  2EE8 A;  2WDC A;  1WAO 1;  4LF8 E;  4BBY A;  2ZM6 E;  4YKE A;  3DSC A;  2YTO A;  2F4V E;  2EMW A;  3IVD A;  4LF6 E;  4GEQ B;  4NXM E;  4MLQ A;  1W24 A;  2JP9 A;  2USH A;  3BGH A;  3TQM A;  3KZY A;  2I9I A;  4MOY A;  4KWY A;  2NAB A;  1QHW A;  3V4Y A;  4R2E A;  4IL1 A;  1GTK A;  3HTX A;  2B3T B;  2EPZ A;  4F6N A;  1PJT A;  2LRS A;  2M9A A;  2NUG A;  5KL4 A;  1EKZ A;  3MHS C;  3KZZ A;  2CSH A;  4X8W A;  4X64 E;  2EPR A;  2YSO A;  1MF8 A;  4DV6 E;  2YTN A;  2EOI A;  4O43 A;  2BBG A;  2LVH A;  2RPC A;  1IBL E;  4N4R B;  3T1I A;  2O8G A;  1YUJ A;  2YTG A;  3H63 A;  4ORB A;  1EH7 A;  1SR9 A;  1EH6 A;  2MC5 A;  1T4L B;  3VYY A;  5EQV A;  4UT3 A;  1X6H A;  2DSY A;  2RQL A;  5GTU A;  3L00 A;  2JOB A;  2EN1 A;  2EPP A;  4LF7 E;  2LV2 A;  5CFF E;  4H2F A;  4R2C A;  3CK2 A;  1DQ3 A;  4V0V A;  2B7V A;  3RL3 A;  4L8N A;  4ZVZ A;  5LL6 R;  4BMJ A;  1IT6 A;  1LLM C;  2L92 A;  2UU9 E;  1OID A;  5IWA E;  2N8X A;  3ADI A;  1QU6 A;  5KL6 A;  1HP1 A;  2EMK A;  3JYF A;  5LMU E;  4M9V C;  1WRJ A;  5F3W A;  2MKN A;  2EZ6 A;  4DT2 A;  2EM7 A;  2XMO A;  1PKP A;  2R76 A;  2EN2 A;  4Q28 A;  1HPU A;  2EMG A;  2LUP B;  1FJM A;  3K7W C;  2IAE C;  3QFK A;  2DRP A;  2ELY A;  2V88 A;  2B9D A;  2VQF E;  4FK5 C;  4O24 A;  2NUE A;  2DMY A;  4KHP E;  3E7A A;  3F6G A;  2DMI A;  2L8T A;  2BB8 A;  3KBP A;  3HVQ A;  5TSE A;  2EPL X;  4P78 A;  1DI2 A;  1WJP A;  4F0Z A;  2JR1 A;  2LUQ A;  1DGC A;  1YFH A;  1IBK E;  1Z1B A;  1X6F A;  3BID A;  2EL6 A;  1KBP A;  3UK3 C;  3JU0 A;  1HNW E;  1Z2W A;  4IS1 C;  2EOJ A;  2EQ3 A;  4LU9 A;  1J5E E;  2MC6 A;  2UXD E;  2E72 A;  1WXR A;  3H68 A;  2JWO A;  3J7Y p;  1S8E A;  3E7B A;  2EPK X;  3HPS A;  1ZR9 A;  3H61 A;  3C6M A;  5A6B D;  3ECR A;  2LE2 A;  5A6B A;  1S3L A;  4F54 A;  2LJH A;  2EPX A;  2L3J A;  1X3C A;  4JI8 E;  3C4T A;  2Z72 A;  4BHC A;  4DMI A;  2YT4 A;  2EQ0 A;  1GQE A;  1S95 A;  2NYM C;  1I94 E;  3OML A;  4WFT A;  1AUI A;  1ZBQ A;  2KOU A;  3C9F A;  3EQ1 A;  1A1H A;  5INB A;  3KWR A;  2R17 A;  2NPP C;  2UUA E;  5KL3 A;  2KKN A;  4H1Y P;  2EM5 A;  2EOX A;  4WX9 A;  1P47 A;  4LAC C;  3ADL A;  1BBG A;  4BCA A;  3DF6 A;  5C1V A;  2IHR 1;  2YTD A;  1S70 A;  2EOH A;  3FGA C;  4LTY A;  2YTP A;  1UHZ A;  4HD0 A;  3ZU0 A;  3LML A;  1A1J A;  2EPC A;  2AHD A;  1TN9 A;  2WBT A;  4AQY E;  2B7T A;  3VYX A;  2I13 A;  3P1X A;  4TUG A;  4ZYD A;  2YU5 A;  5HPE A;  5AE1 A;  4KZS A;  2GLI A;  3ICF A;  4ORC A;  2ELZ A;  4DSY A;  1A1L A;  2YTQ A;  1G2D C;  2LJU A;  2YRK A;  3ADG A;  1RC7 A;  3QG5 C;  4ZYG A;  4DV0 E;  3H62 B;  4BS9 A;  2EPN A;  4DR4 E;  2YZT A;  4JI0 E;  4IYP C;  1UTE A;  1A1I A;  2EOO A;  2DLQ A;  2P6B A;  4B3M E;  3P71 C;  2EN4 A;  3JTZ A;  1NEI A;  2G7H A;  2VF1 A;  1HNX E;  1PJQ A;  4B2O A;  2EN7 A;  2FV4 B;  2EMB A;  4RH8 A;  4M30 A;  3VHT B;  4ZYH A;  1ZAA C;  2E5L E;  2EM6 A;  2HHH E;  4R2R A;  2HY1 A;  5T6J A;  1HNZ E;  5DNY A;  1V73 A;  4X65 E;  4DV7 E;  3C5W C;  4XPN A;  4X62 E;  2ZO9 B;  1X6E A;  4I8O A;  1UN6 B;  1YPN A;  2L2M A;  3IWD A;  4WPY A;  4ZYE A;  2DXL A;  3VK6 A;  2HJJ A;  1KYQ A;  3C4B A;  2ENH A;  2N3H A;  2EOM A;  4YY3 E;  4BC9 A;  2FTX B;  1NCS A;  2MKD A;  2Z06 A;  3EGG A;  1ZBT A;  5B8I A;  2YRM A;  3DJW A;  2EN6 A;  2BDX A;  4V0X A;  2WDF A;  4NHR A;  1F2I G;  4DR2 E;  4I5L C;  3DSD A;  3LLH A;  2L3C A;  4F9C B;  2EOY A;  1JK7 A;  3THN A;  3TGH A;  4DR1 E;  2CV9 A;  5AAS A;  1A1K A;  1N32 E;  3N5U A;  4MLV A;  3IB7 A;  2L2N A;  2YTF A;  4V0W A;  2RS6 A;  3QFM A;  1UBD C;  4DKK A;  4FBW A;  2CPN A;  4H2G A;  4ZX2 A;  2EM2 A;  3AUZ A;  2EWL A;  2EPA A;  2A22 A;  5KL5 A;  3JAM C;  4LFA E;  4YHH E;  2YTE A;  4BC7 A;  4GKK E;  1T38 A;  5JJT A;  2JVA A;  2WDE A;  3EPK A;  1OIE A;  1WAR A;  4F2J C;  1MEY C;  1UF3 A;  2RSM A;  4X9J A;  2UXB E;  4OX9 E;  1PDA A;  3IB8 A;  4JI4 E;  4LF9 E;  1USH A;  4J8Z A;  3FIG A;  2EL5 A;  2VQE E;  2RTX A;  2DFJ A;  4WXD A;  1TF3 A;  1A1F A;  1GZ6 A;  2EM9 A;  1T70 A;  1ZU1 A;  1T39 A;  1G2F C;  2EOR A;  4I5N C;  1YSA C;  2WBU A;  3D03 A;  2LTR A;  2VRD A;  2V83 A;  2Z1A A;  2EM4 A;  2YTJ A;  2EOF A;  3H09 A;  3J7A G;  4JA7 A;  2DGC A;  3THO B;  2GHF A;  1AH5 A;  2MDG A;  4B3R E;  2EOE A;  2BCD A;  2YEQ A;  2M7Q A;  2M1S A;  1EH8 A;  3RMP A;  3DW8 C;  2L2K B;  2LO3 A;  4LF4 E;  1KJK A;  4WYQ B;  3F6H A;  4OR9 A;  1IQS A;  1T4O A;  2EN3 A;  2ODR D;  5LLQ A;  1XM7 A;  1FJG E;  2EP3 A;  4WWL A;  4DV2 E;  2K7I A;  1X47 A;  2ODR C;  1Z2X A;  5A6A A;  4Q35 B;  2V8Q B;  1B69 A;  1RQ0 A;  1BB8 A;  1T71 A;  3E0J A;  3QFN A;  2ZOA A;  5AE3 A;  2EPO A;  2VE7 C;  3K6Q A;  4L5N C;  1RMD A;  3T1Y E;  4DR6 E;  1A1G A;  2EPU A;  1S3M A;  5IT9 C;  1SU1 A;  2UUB E;  3H69 A;  2YU8 A;  3IVE A;  4IJD A;  2WCC 3;  2EMZ A;  2EM8 A;  1QNT A;  3C6K A;  4K0K E;  1YYW A;  2E1M A;  4JI7 E;  3H60 A;  3K7V C;  3IWB A;  4KKZ A;  3MSW A;  3BF2 A;  2O8A A;  2EQ1 A;  2LT7 A;  1N34 E;  4LF5 E;  4JV5 E;  2EOS A;  2WBS A;  1YZ9 A;  4ORA A;  2EMH A;  4DV1 E;  2IE3 C;  1XMQ E;  5AC5 A;  1IQO A;  1PJS A;  4MOV A;  3J81 C;  5IOH A;  1XNQ E;  4DV5 E;  1JK1 A;  4LFC E;  2QFP A;  1G5B A;  2EL4 A;  1XNR E;  3PSO A;  4R8O A;  1II7 A;  2V87 A;  2L33 A;  4F9B B;  4HEI A;  3BBG A;  2N3G A;  4H1S A;  2EM3 A;  1YUI A;  4FBQ A;  4R2P A;  2L6M A;  2JY9 A;  4O5G A;  2Q8U A;  3M99 B;  4DV3 E;  2J7J A;  5KL2 A;  1IMU A;  4H2I A;  1U32 A;  4UWQ A;  3MHH C;  4GZN C;  1YYO A;  4Q7F A;  2QJC A;  2EN8 A;  4F9A B;  3GVE A;  2YSP A;  2JPA A;  4GKJ E;  4DHL A;  1WHN A;  3H64 A;  1T4N A;  4H2B A;  2LMZ A;  3PSN A;  4J6O A;  2EPM X;  3IWC A;  5BR8 E;  3H66 A;  3T1H E;  2YPN A;  4B3T E;  4DUY E;  1WHQ A;  2DIX A;  4UT3 B;  4JI2 E;  1STU A;  2GPI A;  2H36 X;  2DXN A;  2KHX A;  2ENA A;  3LL8 A;  2RSI A;  2YVT A;  1M63 A;  2YWQ A;  2EMA A;  2HYO A;  2DB2 A;  1BBO A;  1X49 A;  2LTS A;  4O4K A;  2EOZ A;  2EMF A;  3AV0 A;  2UUC E;  2JOX A;  4HTG A;  3EGH A;  3RQZ A;  2ZBM A;  5LMN E;  2PRT A;  4DR3 E;  2NYL C;  2K4V A;  1S3N A;  1X48 A;  2M4I A;  2BQ8 X;  4M0V A;  5AE2 A;  2LBS B;  3FLO A;  4JI3 E;  1YYK A;  2KON A;  5IV8 B;  1HR0 E;  2EMY A;  4JI6 E;  2RS7 A;  2YRH A;  4LFB E;  2V89 A;  2LCE A;  4R2S A;  2MDR A;  2GJU A;  2EMX A;  4P7D A;  1J26 A;  4M2Z A;  5ADZ A;  4B3S E;  5A2Q C;  1TF6 A;  4JYA E;  1L4S A;  1UIL A;  1XZW A;  1SFE A;  2WDD A;  4JI1 E;  3ZOQ B;  2V86 A;  4R2D A;  5KL7 A;  4DR5 E;  4RHB B;  2F8B A;  4FBK A;  3RL4 A;  1O0W A;  2JXP A;  4R2A A;  4NZV A;  1JK2 A;  5JPF A;  4WXC A;  4R03 A;  3HQ1 A;  5A6J A;  4F6M A;  2CT1 A;  4WSP A;  1X5W A;  4DR7 E;  2DLK A;  2JYA A;  1OI8 A;  1TCO A;  2EOQ A;  5A6K A;  4DUZ E;  2EM0 A;  2EMI A; 
#chains in the Genus database with same CATH homology
 1NNW A;  4MP0 A;  2HYP A;  2ZO9 B;  3H60 A;  4O24 A;  3RL5 A;  4JA9 A;  3K7V C;  4KKZ A;  2DXL A;  2O8A A;  3E7A A;  4ORA A;  3KBP A;  3HVQ A;  4TUI A;  5JPE A;  2IE3 C;  4F0Z A;  1HO5 A;  3ZTV A;  2JOG A;  3H67 A;  2QFR A;  2Z06 A;  3EGG A;  4KBP A;  4MOV A;  5B8I A;  5IOH A;  2QFP A;  2BDX A;  4V0X A;  5J28 A;  1G5B A;  2WDF A;  2NXF A;  3PSO A;  4I5L C;  1II7 A;  3DSD A;  2IE4 C;  1KBP A;  1QFC A;  1Z2W A;  1JK7 A;  4H1S A;  3THN A;  4UT2 A;  4FBQ A;  3TGH A;  4LU9 A;  2CV9 A;  4FCX A;  4O5G A;  3H68 A;  4G9J A;  3QFO A;  1S8E A;  2Q8U A;  2WDC A;  1WAO 1;  3E7B A;  3IB7 A;  3DSC A;  3N5U A;  4YKE A;  4H2I A;  3H61 A;  1U32 A;  4V0W A;  4UWQ A;  3QFM A;  4FBW A;  4ZX2 A;  1S3L A;  4H2G A;  3IVD A;  2QJC A;  4Q7F A;  3AUZ A;  1W24 A;  2A22 A;  3GVE A;  2USH A;  4DHL A;  2Z72 A;  3H64 A;  4MOY A;  1QHW A;  4H2B A;  5JJT A;  2NYM C;  1S95 A;  3V4Y A;  2WDE A;  3PSN A;  4IL1 A;  4J6O A;  1OIE A;  1WAR A;  3H66 A;  1AUI A;  1UF3 A;  3C9F A;  5INB A;  2R17 A;  4UT3 B;  2DXN A;  2NPP C;  3IB8 A;  1USH A;  2KKN A;  3LL8 A;  4H1Y P;  2DFJ A;  2YVT A;  4LAC C;  1MF8 A;  1M63 A;  2HYO A;  4O43 A;  1T70 A;  5C1V A;  4O4K A;  1S70 A;  3FGA C;  4I5N C;  4LTY A;  3T1I A;  2O8G A;  3D03 A;  4HD0 A;  3AV0 A;  3ZU0 A;  3H63 A;  4ORB A;  2AHD A;  2Z1A A;  3EGH A;  3RQZ A;  4JA7 A;  2ZBM A;  5EQV A;  4TUG A;  3THO B;  4UT3 A;  2NYL C;  1S3N A;  5GTU A;  2BQ8 X;  5HPE A;  3ICF A;  2BCD A;  2YEQ A;  4M0V A;  4ORC A;  3FLO A;  4DSY A;  3DW8 C;  4H2F A;  3RL3 A;  3CK2 A;  4V0V A;  4ZVZ A;  3QG5 C;  4OR9 A;  2GJU A;  3H62 B;  1XM7 A;  1IT6 A;  4IYP C;  4WWL A;  1UTE A;  1OID A;  1XZW A;  1Z2X A;  2P6B A;  3P71 C;  2WDD A;  1HP1 A;  1T71 A;  3E0J A;  3QFN A;  2ZOA A;  3JYF A;  4FBK A;  4B2O A;  3RL4 A;  5F3W A;  4NZV A;  5JPF A;  1S3M A;  4DT2 A;  2XMO A;  1HPU A;  1SU1 A;  3H69 A;  1FJM A;  3IVE A;  2IAE C;  3K7W C;  2HY1 A;  3C5W C;  4XPN A;  1V73 A;  1OI8 A;  5DNY A;  1TCO A;  3QFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...