4NZVA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
329
structure length
329
Chain Sequence
HHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 110
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4nzvA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4nzvA01
3THNA 4UT3B 1HP1A 2NYLC 4H2IA 5JPFA 4J6OA 3QFMA 2WDCA 3ICFA 3N5UA 4FBKA 4H2BA 3H64A 1Z2XA 3QFKA 3H60A 4FBWA 2KKNA 4O5GA 2AHDA 3ZTVA 5J28A 3IVDA 3H68A 2WDDA 2IE3C 3H61A 3HVQA 4LU9A 2GJUA 3TGHA 4IL1A 1WAO1 4H1SA 4DT2A 1TCOA 4I5NC 4ORBA 2NYMC 2P6BA 4B2OA 2QFPA 2USHA 3GVEA 2DFJA 1W24A 1WARA 2YVTA 4DSYA 3K7VC 2CV9A 2A22A 4I5LC 1IT6A 4TUGA 2BCDA 4ORCA 1S3MA 4V0WA 4M0VA 3THOB 3IB8A 1S95A 2NXFA 4XPNA 2BQ8X 3RL5A 3V4YA 2IAEC 2Z1AA 3C5WC 3C9FA 1V73A 3H62B 2Z72A 4FCXA 5F3WA 1QFCA 4MOYA 3H66A 3EGHA 3K7WC 3E7AA 3EGGA 2IE4C 3IVEA 4H2GA 3PSNA 1UF3A 3RQZA 1KBPA 3QG5C 4KKZA 2HYPA 3DW8C 4YKEA 4G9JA 1OIEA 5GTUA 2BDXA 5C1VA 4IYPC 5JPEA 4JA9A 5INBA 2NPPC 3H69A 3PSOA 4HD0A 4ORAA 4WWLA 4F0ZA 1II7A 3P71C 1T71A 4H2FA 3RL4A 4Q7FA 4LACC 3DSCA 1Z2WA 2QJCA 1OIDA 3ZU0A 1XZWA 2HY1A 5HPEA 1AUIA 1XM7A 3RL3A 4FBQA 5EQVA 1U32A 4O4KA 4NZVA 3QFOA 4KBPA 2O8AA 3H63A 2JOGA 2O8GA 4UWQA 2R17A 3FGAC 1OI8A 1JK7A 4TUIA 1MF8A 4OR9A 2XMOA 4MP0A 1S3LA 4JA7A 1S3NA 5B8IA 4ZVZA 1G5BA 3JYFA 1QHWA 3LL8A 4DHLA 5IOHA 4LTYA 1HPUA 4MOVA 1NNWA 4V0XA 4ZX2A 1USHA 1M63A 3CK2A 1S8EA 1T70A 3E7BA 3AV0A 4UT3A 5DNYA 3DSDA 1UTEA 4O24A 1SU1A 2HYOA 4O43A 3AUZA 1S70A 1HO5A 4H1YP 3IB7A 3QFNA 3H67A 2WDFA 1FJMA 2ZBMA 3T1IA 2WDEA 2Q8UA 2Z06A 5JJTA 3KBPA 4UT2A 2QFRA 4V0VA
chains in the Genus database with same CATH superfamily
1UILA 4X65E 1ZR9A 5JPFA 1ZBQA 4DKKA 1A1KA 4KWYA 1WHNA 3N5UA 1DI2A 5FLXC 3OMLA 3HQ1A 2KKNA 2DXLA 2EMAA 2EOHA 2M7QA 1RC7A 3H68A 4LF7E 2IE3C 1BB8A 2DLKA 1J26A 2GHFA 4DR2E 4H1SA 4DT2A 2N3GA 4Q28A 4F9CB 3HPSA 4L8NA 2P6BA 4DV0E 2QFPA 2USHA 2YTPA 1W24A 2EL5A 1WARA 3HTXA 3K7VC 1X3CA 2A22A 2V88A 4TUGA 4HTGA 4ORCA 3THOB 2EPXA 4B3TE 2BQ8X 3M99B 3J80C 4LF5E 1EKZA 3DJWA 3C9FA 1V73A 3H62B 1IQSA 1PJSA 2LCEA 2EZ6A 1N36E 3ADIA 2FTXB 3L00A 4MLVA 4NXME 1UF3A 2YRKA 4KKZA 2EMWA 4YKEA 5T6JA 2EQ0A 2NA2A 2I9IA 2JVAA 4YY3E 4JI2E 4JA9A 4YHHE 5KL7A 2ZO9B 2DMYA 2ZM6E 4WWLA 4WFTA 4F0ZA 2EM5A 4K0KE 1IBKE 1Z2WA 3MSWA 2QJCA 3ZU0A 2EOMA 4DR1E 3F6GA 1PJQA 2F8BA 4IS1C 1X6FA 4WSGA 2MC6A 2MDRA 4DV3E 1ZBTA 1STUA 3BIDA 4BC9A 2DRPA 3RL3A 2UUCE 5EQVA 1U32A 4O4KA 1J5EE 4B3SE 2EN8A 1Z1BA 1RMDA 2R17A 2DIXA 2EJ4A 5A6KA 2EMYA 1S3LA 5TSEA 2EOOA 1QHWA 4DHLA 4R2DA 1HPUA 4LF4E 4DV6E 4ZX2A 1USHA 1S8EA 5IWAE 3VK6A 4X62E 4HEIA 1X47A 2EMGA 3OTOE 1SU1A 2KHXA 3AUZA 4B3ME 2E5LE 5KL2A 4R2RA 3IB7A 3QFNA 2WDFA 1A1JA 2LE2A 2YTEA 4R2QA 2EMIA 2PRTA 3T1IA 3VYYA 2LRSA 4I8OA 2YSOA 1QNTA 1F2IG 4UT2A 1DGCA 2JR1A 4R2CA 2YTDA 4OX9E 2RSMA 2E1MA 3ADLA 4M2ZA 4H2IA 1QU6A 3IWDA 2JXPA 3ICFA 1TN9A 4KHPE 3RMPA 2DSYA 2YTIA 3ECRA 3H64A 5AC5A 1T38A 1GTKA 1WJPA 4ZYGA 2EN1A 2MC5A 4O5GA 2AHDA 5J28A 4BMJA 4BC7A 2YTNA 4LU9A 2LJUA 3TGHA 2EPAA 2HHHE 1FJGE 4IL1A 1WAO1 4I5NC 2NYMC 2EMBA 1YUIA 4WXDA 4R2SA 3BGHA 3VYXA 3GVEA 4B2OA 4JYAE 1PJTA 2G7HA 2RQLA 4BBYA 3IWBA 3VHTB 4ZYDA 2VF1A 2UUBE 4I5LC 1O0WA 5AASA 2EMFA 2YU8A 3IB8A 1JK7A 2NXFA 3RL5A 3V4YA 4AQYE 2IAEC 2CPNA 2J7JA 2B7VA 4DR4E 2EPKX 2Z72A 2EL6A 2V86A 1QFCA 3MHSC 4MOYA 3H66A 4F9AB 3K7WC 4F54A 3T1HE 1KBPA 2EOJA 1G2FC 2UXBE 1G2DC 2LJHA 5GTUA 3KWRA 2YTQA 2EM7A 1N32E 2EOZA 2EPRA 5INBA 3H69A 2B9DA 4ORAA 4X8WA 2JPAA 1JK2A 1YYKA 2YT4A 1KJKA 1II7A 4Q7FA 2LUPB 3RL4A 1SFEA 3BF2A 1RQ0A 2UUAE 1LLMC 2NABA 4BS9A 2EN4A 2HY1A 2ENCA 1UHZA 1A1IA 4F6NA 5KL3A 2EE8A 2LMZA 4NZVA 3QFOA 4KBPA 2N8XA 3HPZA 1N34E 3FIGA 3H63A 2JOGA 2M1SA 3LMLA 3FGAC 4UWQA 4WX9A 1OI8A 2EM4A 2L6MA 1YFHA 1HR0E 1A1GA 4DR6E 5B8IA 4JA7A 1S3NA 4DUYE 3FLOA 2L8TA 1X49A 5A6JA 2EPMX 2HC5A 3HXLA 3EPLA 1T4LB 1UBDC 4GKKE 3LL8A 3TQMA 4LFCE 2LUQA 2EORA 2WZOA 2DGCA 1T70A 5DNYA 4UT3A 2VE7C 2EOFA 4O24A 4RHBB 2V83A 4DV2E 2WBTA 1S70A 2V87A 5KL5A 3KZYA 4FK5C 2NUFA 4R03A 3H67A 5CFFE 2LTRA 2EN3A 2JYAA 3C4TA 5AE3A 4R2PA 3C6KA 2EQ1A 2Q8UA 2FV4B 4P7DA 2JP9A 2Z06A 4B3RE 2YTOA 3JAMC 2LVHA 5LMNE 3KBPA 1IQOA 3H09A 1AH5A 3F6HA 1EH6A 2CTDA 1N3GA 2RS6A 2ENHA 2WDCA 2EM2A 4H2BA 2EM9A 2L3CA 1X6HA 3UK3C 1Z2XA 1AAYA 3QFKA 3H60A 2EOSA 1I94E 2YTGA 4DUZE 2GPIA 4LF9E 1MEYC 3IVDA 2K7IA 2RS7A 1X48A 4WSPA 3H61A 3HVQA 1UN6B 2UU9E 1A1FA 5A2QC 3ZOQB 2EMCA 1TCOA 5A6BA 4X66E 3J7AG 3T1YE 3C6MA 2DXNA 1X5WA 2F4VE 3DF6A 4F9BB 2D9HA 4JI3E 3EPJA 4DV1E 4DSYA 4R8OA 5A6BD 2I13A 4BCAA 1IT6A 2ELYA 1XNRE 1TF3A 1S3MA 2V85A 4M0VA 4JI0E 1YZ9A 2WBUA 2Z1AA 3C5WC 2L33A 2EMZA 2MDGA 2EMLA 4FCXA 3EPHA 2EMKA 2HGHA 2A25A 2EPUA 2UXCE 3EGHA 3EGGA 1TF6A 4JI4E 4H2GA 3PSNA 2ODRD 1XMOE 3QG5C 1YYOA 5LL6R 2WCC3 3E0JA 5C1VA 1WRJA 4M9VC 4IYPC 2B3TB 2EOYA 3PSOA 4HD0A 2EN6A 1B69A 5IV8B 1T71A 2E72A 4H2FA 4LACC 1YSAC 4F6MA 4DR5E 5KL4A 2RPCA 4GKJE 4LF6E 1AUIA 2WBSA 1BBGA 2ZOAA 4L5NC 5IXMB 2EMHA 2O8GA 2NUEA 2V8QB 4TUIA 3JTZA 1IBLE 1N33E 2EN2A 2DB2A 2RSIA 3KZZA 5AE1A 5LMUE 1MF8A 2LBSB 2BBGA 1HNZE 2XMOA 1WXRA 5A69A 1JK1A 3P1XA 4BHBA 3JYFA 5IOHA 4LTYA 2EM8A 1SR9A 2YTJA 1NNWA 4V0XA 1GQEA 2EMXA 2YSPA 4OOGC 1T4OA 3E7BA 3AV0A 3DSDA 4JV5E 1UTEA 2R76A 4NXNE 3K6QA 2ELZA 2EOEA 2HYOA 4Q35B 2VQEE 2LO3A 2L2MA 5AE2A 5IT9C 3D03A 1HO5A 2EPCA 2GLIA 2LV2A 2HJJA 1FJMA 2M4IA 2KONA 4NHRA 2WDEA 2YZTA 5LLQA 4R2AA 1PKPA 2JOBA 2ADRA 2KOUA 4R2EA 2VRDA 4V0VA 3THNA 4UT3B 1HP1A 2NYLC 1HNXE 3IWCA 2CT1A 5KL6A 3J7Yp 4J6OA 3J81C 3QFMA 4JI1E 4FBKA 2N3HA 4GEQB 1XNQE 2M9AA 2EWLA 1NCSA 4FBWA 1YPNA 2LTSA 1HNWE 2LT7A 1NEIA 3ZTVA 2WDDA 2GJUA 4X64E 2CSHA 2YWQA 2YTFA 4P78A 4RH8A 1EH7A 1DQ3A 2K4VA 2EOIA 1EH8A 4F2JC 4WPYA 4WYQB 4ORBA 2DMIA 2L2NA 3BBGA 4N4RB 2DFJA 2B7TA 1BBOA 2YVTA 4DR7E 4DV4E 2CV9A 2R1FA 4JI7E 2BCDA 2EPLX 2JY9A 2YRHA 4J8ZA 4V0WA 2EN7A 2ODRC 1S95A 4XPNA 3EPKA 4KZSA 1A1LA 3ADGA 1IBME 4MLQA 4JI6E 2BB8A 5F3WA 4DR3E 2EM6A 4DV7E 2IHR1 1PDAA 2EP3A 1A1HA 3E7AA 2IE4C 3IVEA 3C4BA 4LFBE 3RQZA 3LLHA 2H36X 2L92A 4ZYEA 2HYPA 3DW8C 4G9JA 4LF8E 1OIEA 4DMIA 1KYQA 4M30A 2BDXA 4IJDA 4WXCA 1FKAE 5JPEA 2YEQA 2NPPC 1P47A 1MGTA 2ENAA 2VQFE 3P71C 3EQ1A 3DSCA 4GZNC 1L4SA 1OIDA 1ZU1A 1XZWA 5ADZA 2EM3A 1ZAAC 2EPOA 1YYWA 5HPEA 4JI5E 2JWOA 4X9JA 1XM7A 2EQ3A 2YRMA 4FBQA 2YU5A 2NUGA 3MHHC 2O8AA 5BR8E 1WHQA 1X6EA 1XMQE 1YUJA 4JI8E 4OR9A 5A6AA 2JOXA 2YPNA 3JU0A 4MP0A 4ZVZA 2EPNA 1G5BA 2L2KB 4DV5E 2EPPA 5AC4A 4MOVA 1GZ6A 2EM0A 1M63A 3CK2A 2EOXA 1IMUA 4ZYHA 4O43A 2EOQA 4H1YP 2RTXA 1T4NA 1T39A 2V89A 2L3JA 2ZBMA 2UXDE 2EL4A 2MKNA 3ADJA 2MKDA 4LFAE 5JJTA 2FGGA 2QFRA 2DLQA 4BHCA 2EPZA
chains in the Genus database with same CATH topology
3THNA 4UT3B 1HP1A 2NYLC 4H2IA 5JPFA 4J6OA 3QFMA 2WDCA 3ICFA 3N5UA 4FBKA 4H2BA 3H64A 1Z2XA 3QFKA 3H60A 4FBWA 2KKNA 4O5GA 2AHDA 2DXLA 3ZTVA 5J28A 3IVDA 3H68A 2WDDA 2IE3C 3H61A 3HVQA 4LU9A 2GJUA 3TGHA 4IL1A 1WAO1 4H1SA 4DT2A 1TCOA 4I5NC 4ORBA 2NYMC 2P6BA 4B2OA 2QFPA 2USHA 3GVEA 2DFJA 2DXNA 1W24A 1WARA 2YVTA 4DSYA 3K7VC 2CV9A 2A22A 4I5LC 1IT6A 4TUGA 2BCDA 4ORCA 1S3MA 4V0WA 4M0VA 3THOB 3IB8A 1S95A 2NXFA 4XPNA 2BQ8X 3RL5A 3V4YA 2IAEC 2Z1AA 3C5WC 3C9FA 1V73A 3H62B 2Z72A 4FCXA 5F3WA 1QFCA 4MOYA 3H66A 3EGHA 3K7WC 3E7AA 3EGGA 2IE4C 3IVEA 4H2GA 3PSNA 1UF3A 3RQZA 1KBPA 3QG5C 4KKZA 2HYPA 3DW8C 4YKEA 4G9JA 1OIEA 5GTUA 2BDXA 3E0JA 5C1VA 4IYPC 5JPEA 2YEQA 4JA9A 5INBA 2ZO9B 2NPPC 3H69A 3PSOA 4HD0A 4ORAA 4WWLA 4F0ZA 1II7A 3P71C 1T71A 4H2FA 3DSCA 4Q7FA 4LACC 3RL4A 1Z2WA 2QJCA 1OIDA 3ZU0A 1XZWA 2HY1A 5HPEA 1AUIA 1XM7A 2ZOAA 3RL3A 4FBQA 5EQVA 1U32A 4O4KA 4NZVA 3QFOA 4KBPA 2O8AA 3H63A 2JOGA 2O8GA 4UWQA 2R17A 3FGAC 1OI8A 1JK7A 4TUIA 1MF8A 4OR9A 2XMOA 4MP0A 1S3LA 4JA7A 1S3NA 3FLOA 4ZVZA 5B8IA 1G5BA 3JYFA 1QHWA 3LL8A 4DHLA 5IOHA 4LTYA 1HPUA 4MOVA 1NNWA 4V0XA 4ZX2A 1USHA 1M63A 3CK2A 1S8EA 1T70A 3E7BA 3DSDA 3AV0A 4UT3A 5DNYA 1UTEA 4O24A 1SU1A 2HYOA 4O43A 3AUZA 1S70A 3D03A 1HO5A 4H1YP 3IB7A 3QFNA 3H67A 2WDFA 1FJMA 2ZBMA 3T1IA 2WDEA 2Q8UA 2Z06A 5JJTA 3KBPA 4UT2A 2QFRA 4V0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THN A;  4UT3 B;  1HP1 A;  2NYL C;  4H2I A;  5JPF A;  4J6O A;  3QFM A;  2WDC A;  3ICF A;  3N5U A;  4FBK A;  4H2B A;  3H64 A;  1Z2X A;  3QFK A;  3H60 A;  4FBW A;  2KKN A;  4O5G A;  2AHD A;  3ZTV A;  5J28 A;  3IVD A;  3H68 A;  2WDD A;  2IE3 C;  3H61 A;  3HVQ A;  4LU9 A;  2GJU A;  3TGH A;  4IL1 A;  1WAO 1;  4H1S A;  4DT2 A;  1TCO A;  4I5N C;  4ORB A;  2NYM C;  2P6B A;  4B2O A;  2QFP A;  2USH A;  3GVE A;  2DFJ A;  1W24 A;  1WAR A;  2YVT A;  4DSY A;  3K7V C;  2CV9 A;  2A22 A;  4I5L C;  1IT6 A;  4TUG A;  2BCD A;  4ORC A;  1S3M A;  4V0W A;  4M0V A;  3THO B;  3IB8 A;  1S95 A;  2NXF A;  4XPN A;  2BQ8 X;  3RL5 A;  3V4Y A;  2IAE C;  2Z1A A;  3C5W C;  3C9F A;  1V73 A;  3H62 B;  2Z72 A;  4FCX A;  5F3W A;  1QFC A;  4MOY A;  3H66 A;  3EGH A;  3K7W C;  3E7A A;  3EGG A;  2IE4 C;  3IVE A;  4H2G A;  3PSN A;  1UF3 A;  3RQZ A;  1KBP A;  3QG5 C;  4KKZ A;  2HYP A;  3DW8 C;  4YKE A;  4G9J A;  1OIE A;  5GTU A;  2BDX A;  5C1V A;  4IYP C;  5JPE A;  4JA9 A;  5INB A;  2NPP C;  3H69 A;  3PSO A;  4HD0 A;  4ORA A;  4WWL A;  4F0Z A;  1II7 A;  3P71 C;  1T71 A;  4H2F A;  3RL4 A;  4Q7F A;  4LAC C;  3DSC A;  1Z2W A;  2QJC A;  1OID A;  3ZU0 A;  1XZW A;  2HY1 A;  5HPE A;  1AUI A;  1XM7 A;  3RL3 A;  4FBQ A;  5EQV A;  1U32 A;  4O4K A;  4NZV A;  3QFO A;  4KBP A;  2O8A A;  3H63 A;  2JOG A;  2O8G A;  4UWQ A;  2R17 A;  3FGA C;  1OI8 A;  1JK7 A;  4TUI A;  1MF8 A;  4OR9 A;  2XMO A;  4MP0 A;  1S3L A;  4JA7 A;  1S3N A;  5B8I A;  4ZVZ A;  1G5B A;  3JYF A;  1QHW A;  3LL8 A;  4DHL A;  5IOH A;  4LTY A;  1HPU A;  4MOV A;  1NNW A;  4V0X A;  4ZX2 A;  1USH A;  1M63 A;  3CK2 A;  1S8E A;  1T70 A;  3E7B A;  3AV0 A;  4UT3 A;  5DNY A;  3DSD A;  1UTE A;  4O24 A;  1SU1 A;  2HYO A;  4O43 A;  3AUZ A;  1S70 A;  1HO5 A;  4H1Y P;  3IB7 A;  3QFN A;  3H67 A;  2WDF A;  1FJM A;  2ZBM A;  3T1I A;  2WDE A;  2Q8U A;  2Z06 A;  5JJT A;  3KBP A;  4UT2 A;  2QFR A;  4V0V A; 
#chains in the Genus database with same CATH topology
 1UIL A;  4X65 E;  1ZR9 A;  5JPF A;  1ZBQ A;  4DKK A;  1A1K A;  4KWY A;  1WHN A;  3N5U A;  1DI2 A;  5FLX C;  3OML A;  3HQ1 A;  2KKN A;  2DXL A;  2EMA A;  2EOH A;  2M7Q A;  1RC7 A;  3H68 A;  4LF7 E;  2IE3 C;  1BB8 A;  2DLK A;  1J26 A;  2GHF A;  4DR2 E;  4H1S A;  4DT2 A;  2N3G A;  4Q28 A;  4F9C B;  3HPS A;  4L8N A;  2P6B A;  4DV0 E;  2QFP A;  2USH A;  2YTP A;  1W24 A;  2EL5 A;  1WAR A;  3HTX A;  3K7V C;  1X3C A;  2A22 A;  2V88 A;  4TUG A;  4HTG A;  4ORC A;  3THO B;  2EPX A;  4B3T E;  2BQ8 X;  3M99 B;  3J80 C;  4LF5 E;  1EKZ A;  3DJW A;  3C9F A;  1V73 A;  3H62 B;  1IQS A;  1PJS A;  2LCE A;  2EZ6 A;  1N36 E;  3ADI A;  2FTX B;  3L00 A;  4MLV A;  4NXM E;  1UF3 A;  2YRK A;  4KKZ A;  2EMW A;  4YKE A;  5T6J A;  2EQ0 A;  2NA2 A;  2I9I A;  2JVA A;  4YY3 E;  4JI2 E;  4JA9 A;  4YHH E;  5KL7 A;  2ZO9 B;  2DMY A;  2ZM6 E;  4WWL A;  4WFT A;  4F0Z A;  2EM5 A;  4K0K E;  1IBK E;  1Z2W A;  3MSW A;  2QJC A;  3ZU0 A;  2EOM A;  4DR1 E;  3F6G A;  1PJQ A;  2F8B A;  4IS1 C;  1X6F A;  4WSG A;  2MC6 A;  2MDR A;  4DV3 E;  1ZBT A;  1STU A;  3BID A;  4BC9 A;  2DRP A;  3RL3 A;  2UUC E;  5EQV A;  1U32 A;  4O4K A;  1J5E E;  4B3S E;  2EN8 A;  1Z1B A;  1RMD A;  2R17 A;  2DIX A;  2EJ4 A;  5A6K A;  2EMY A;  1S3L A;  5TSE A;  2EOO A;  1QHW A;  4DHL A;  4R2D A;  1HPU A;  4LF4 E;  4DV6 E;  4ZX2 A;  1USH A;  1S8E A;  5IWA E;  3VK6 A;  4X62 E;  4HEI A;  1X47 A;  2EMG A;  3OTO E;  1SU1 A;  2KHX A;  3AUZ A;  4B3M E;  2E5L E;  5KL2 A;  4R2R A;  3IB7 A;  3QFN A;  2WDF A;  1A1J A;  2LE2 A;  2YTE A;  4R2Q A;  2EMI A;  2PRT A;  3T1I A;  3VYY A;  2LRS A;  4I8O A;  2YSO A;  1QNT A;  1F2I G;  4UT2 A;  1DGC A;  2JR1 A;  4R2C A;  2YTD A;  4OX9 E;  2RSM A;  2E1M A;  3ADL A;  4M2Z A;  4H2I A;  1QU6 A;  3IWD A;  2JXP A;  3ICF A;  1TN9 A;  4KHP E;  3RMP A;  2DSY A;  2YTI A;  3ECR A;  3H64 A;  5AC5 A;  1T38 A;  1GTK A;  1WJP A;  4ZYG A;  2EN1 A;  2MC5 A;  4O5G A;  2AHD A;  5J28 A;  4BMJ A;  4BC7 A;  2YTN A;  4LU9 A;  2LJU A;  3TGH A;  2EPA A;  2HHH E;  1FJG E;  4IL1 A;  1WAO 1;  4I5N C;  2NYM C;  2EMB A;  1YUI A;  4WXD A;  4R2S A;  3BGH A;  3VYX A;  3GVE A;  4B2O A;  4JYA E;  1PJT A;  2G7H A;  2RQL A;  4BBY A;  3IWB A;  3VHT B;  4ZYD A;  2VF1 A;  2UUB E;  4I5L C;  1O0W A;  5AAS A;  2EMF A;  2YU8 A;  3IB8 A;  1JK7 A;  2NXF A;  3RL5 A;  3V4Y A;  4AQY E;  2IAE C;  2CPN A;  2J7J A;  2B7V A;  4DR4 E;  2EPK X;  2Z72 A;  2EL6 A;  2V86 A;  1QFC A;  3MHS C;  4MOY A;  3H66 A;  4F9A B;  3K7W C;  4F54 A;  3T1H E;  1KBP A;  2EOJ A;  1G2F C;  2UXB E;  1G2D C;  2LJH A;  5GTU A;  3KWR A;  2YTQ A;  2EM7 A;  1N32 E;  2EOZ A;  2EPR A;  5INB A;  3H69 A;  2B9D A;  4ORA A;  4X8W A;  2JPA A;  1JK2 A;  1YYK A;  2YT4 A;  1KJK A;  1II7 A;  4Q7F A;  2LUP B;  3RL4 A;  1SFE A;  3BF2 A;  1RQ0 A;  2UUA E;  1LLM C;  2NAB A;  4BS9 A;  2EN4 A;  2HY1 A;  2ENC A;  1UHZ A;  1A1I A;  4F6N A;  5KL3 A;  2EE8 A;  2LMZ A;  4NZV A;  3QFO A;  4KBP A;  2N8X A;  3HPZ A;  1N34 E;  3FIG A;  3H63 A;  2JOG A;  2M1S A;  3LML A;  3FGA C;  4UWQ A;  4WX9 A;  1OI8 A;  2EM4 A;  2L6M A;  1YFH A;  1HR0 E;  1A1G A;  4DR6 E;  5B8I A;  4JA7 A;  1S3N A;  4DUY E;  3FLO A;  2L8T A;  1X49 A;  5A6J A;  2EPM X;  2HC5 A;  3HXL A;  3EPL A;  1T4L B;  1UBD C;  4GKK E;  3LL8 A;  3TQM A;  4LFC E;  2LUQ A;  2EOR A;  2WZO A;  2DGC A;  1T70 A;  5DNY A;  4UT3 A;  2VE7 C;  2EOF A;  4O24 A;  4RHB B;  2V83 A;  4DV2 E;  2WBT A;  1S70 A;  2V87 A;  5KL5 A;  3KZY A;  4FK5 C;  2NUF A;  4R03 A;  3H67 A;  5CFF E;  2LTR A;  2EN3 A;  2JYA A;  3C4T A;  5AE3 A;  4R2P A;  3C6K A;  2EQ1 A;  2Q8U A;  2FV4 B;  4P7D A;  2JP9 A;  2Z06 A;  4B3R E;  2YTO A;  3JAM C;  2LVH A;  5LMN E;  3KBP A;  1IQO A;  3H09 A;  1AH5 A;  3F6H A;  1EH6 A;  2CTD A;  1N3G A;  2RS6 A;  2ENH A;  2WDC A;  2EM2 A;  4H2B A;  2EM9 A;  2L3C A;  1X6H A;  3UK3 C;  1Z2X A;  1AAY A;  3QFK A;  3H60 A;  2EOS A;  1I94 E;  2YTG A;  4DUZ E;  2GPI A;  4LF9 E;  1MEY C;  3IVD A;  2K7I A;  2RS7 A;  1X48 A;  4WSP A;  3H61 A;  3HVQ A;  1UN6 B;  2UU9 E;  1A1F A;  5A2Q C;  3ZOQ B;  2EMC A;  1TCO A;  5A6B A;  4X66 E;  3J7A G;  3T1Y E;  3C6M A;  2DXN A;  1X5W A;  2F4V E;  3DF6 A;  4F9B B;  2D9H A;  4JI3 E;  3EPJ A;  4DV1 E;  4DSY A;  4R8O A;  5A6B D;  2I13 A;  4BCA A;  1IT6 A;  2ELY A;  1XNR E;  1TF3 A;  1S3M A;  2V85 A;  4M0V A;  4JI0 E;  1YZ9 A;  2WBU A;  2Z1A A;  3C5W C;  2L33 A;  2EMZ A;  2MDG A;  2EML A;  4FCX A;  3EPH A;  2EMK A;  2HGH A;  2A25 A;  2EPU A;  2UXC E;  3EGH A;  3EGG A;  1TF6 A;  4JI4 E;  4H2G A;  3PSN A;  2ODR D;  1XMO E;  3QG5 C;  1YYO A;  5LL6 R;  2WCC 3;  3E0J A;  5C1V A;  1WRJ A;  4M9V C;  4IYP C;  2B3T B;  2EOY A;  3PSO A;  4HD0 A;  2EN6 A;  1B69 A;  5IV8 B;  1T71 A;  2E72 A;  4H2F A;  4LAC C;  1YSA C;  4F6M A;  4DR5 E;  5KL4 A;  2RPC A;  4GKJ E;  4LF6 E;  1AUI A;  2WBS A;  1BBG A;  2ZOA A;  4L5N C;  5IXM B;  2EMH A;  2O8G A;  2NUE A;  2V8Q B;  4TUI A;  3JTZ A;  1IBL E;  1N33 E;  2EN2 A;  2DB2 A;  2RSI A;  3KZZ A;  5AE1 A;  5LMU E;  1MF8 A;  2LBS B;  2BBG A;  1HNZ E;  2XMO A;  1WXR A;  5A69 A;  1JK1 A;  3P1X A;  4BHB A;  3JYF A;  5IOH A;  4LTY A;  2EM8 A;  1SR9 A;  2YTJ A;  1NNW A;  4V0X A;  1GQE A;  2EMX A;  2YSP A;  4OOG C;  1T4O A;  3E7B A;  3AV0 A;  3DSD A;  4JV5 E;  1UTE A;  2R76 A;  4NXN E;  3K6Q A;  2ELZ A;  2EOE A;  2HYO A;  4Q35 B;  2VQE E;  2LO3 A;  2L2M A;  5AE2 A;  5IT9 C;  3D03 A;  1HO5 A;  2EPC A;  2GLI A;  2LV2 A;  2HJJ A;  1FJM A;  2M4I A;  2KON A;  4NHR A;  2WDE A;  2YZT A;  5LLQ A;  4R2A A;  1PKP A;  2JOB A;  2ADR A;  2KOU A;  4R2E A;  2VRD A;  4V0V A;  3THN A;  4UT3 B;  1HP1 A;  2NYL C;  1HNX E;  3IWC A;  2CT1 A;  5KL6 A;  3J7Y p;  4J6O A;  3J81 C;  3QFM A;  4JI1 E;  4FBK A;  2N3H A;  4GEQ B;  1XNQ E;  2M9A A;  2EWL A;  1NCS A;  4FBW A;  1YPN A;  2LTS A;  1HNW E;  2LT7 A;  1NEI A;  3ZTV A;  2WDD A;  2GJU A;  4X64 E;  2CSH A;  2YWQ A;  2YTF A;  4P78 A;  4RH8 A;  1EH7 A;  1DQ3 A;  2K4V A;  2EOI A;  1EH8 A;  4F2J C;  4WPY A;  4WYQ B;  4ORB A;  2DMI A;  2L2N A;  3BBG A;  4N4R B;  2DFJ A;  2B7T A;  1BBO A;  2YVT A;  4DR7 E;  4DV4 E;  2CV9 A;  2R1F A;  4JI7 E;  2BCD A;  2EPL X;  2JY9 A;  2YRH A;  4J8Z A;  4V0W A;  2EN7 A;  2ODR C;  1S95 A;  4XPN A;  3EPK A;  4KZS A;  1A1L A;  3ADG A;  1IBM E;  4MLQ A;  4JI6 E;  2BB8 A;  5F3W A;  4DR3 E;  2EM6 A;  4DV7 E;  2IHR 1;  1PDA A;  2EP3 A;  1A1H A;  3E7A A;  2IE4 C;  3IVE A;  3C4B A;  4LFB E;  3RQZ A;  3LLH A;  2H36 X;  2L92 A;  4ZYE A;  2HYP A;  3DW8 C;  4G9J A;  4LF8 E;  1OIE A;  4DMI A;  1KYQ A;  4M30 A;  2BDX A;  4IJD A;  4WXC A;  1FKA E;  5JPE A;  2YEQ A;  2NPP C;  1P47 A;  1MGT A;  2ENA A;  2VQF E;  3P71 C;  3EQ1 A;  3DSC A;  4GZN C;  1L4S A;  1OID A;  1ZU1 A;  1XZW A;  5ADZ A;  2EM3 A;  1ZAA C;  2EPO A;  1YYW A;  5HPE A;  4JI5 E;  2JWO A;  4X9J A;  1XM7 A;  2EQ3 A;  2YRM A;  4FBQ A;  2YU5 A;  2NUG A;  3MHH C;  2O8A A;  5BR8 E;  1WHQ A;  1X6E A;  1XMQ E;  1YUJ A;  4JI8 E;  4OR9 A;  5A6A A;  2JOX A;  2YPN A;  3JU0 A;  4MP0 A;  4ZVZ A;  2EPN A;  1G5B A;  2L2K B;  4DV5 E;  2EPP A;  5AC4 A;  4MOV A;  1GZ6 A;  2EM0 A;  1M63 A;  3CK2 A;  2EOX A;  1IMU A;  4ZYH A;  4O43 A;  2EOQ A;  4H1Y P;  2RTX A;  1T4N A;  1T39 A;  2V89 A;  2L3J A;  2ZBM A;  2UXD E;  2EL4 A;  2MKN A;  3ADJ A;  2MKD A;  4LFA E;  5JJT A;  2FGG A;  2QFR A;  2DLQ A;  4BHC A;  2EPZ A; 
#chains in the Genus database with same CATH homology
 3THN A;  4UT3 B;  1HP1 A;  2NYL C;  4H2I A;  5JPF A;  4J6O A;  3QFM A;  2WDC A;  3ICF A;  3N5U A;  4FBK A;  4H2B A;  3H64 A;  1Z2X A;  3QFK A;  3H60 A;  4FBW A;  2KKN A;  4O5G A;  2AHD A;  2DXL A;  3ZTV A;  5J28 A;  3IVD A;  3H68 A;  2WDD A;  2IE3 C;  3H61 A;  3HVQ A;  4LU9 A;  2GJU A;  3TGH A;  4IL1 A;  1WAO 1;  4H1S A;  4DT2 A;  1TCO A;  4I5N C;  4ORB A;  2NYM C;  2P6B A;  4B2O A;  2QFP A;  2USH A;  3GVE A;  2DFJ A;  2DXN A;  1W24 A;  1WAR A;  2YVT A;  4DSY A;  3K7V C;  2CV9 A;  2A22 A;  4I5L C;  1IT6 A;  4TUG A;  2BCD A;  4ORC A;  1S3M A;  4V0W A;  4M0V A;  3THO B;  3IB8 A;  1S95 A;  2NXF A;  4XPN A;  2BQ8 X;  3RL5 A;  3V4Y A;  2IAE C;  2Z1A A;  3C5W C;  3C9F A;  1V73 A;  3H62 B;  2Z72 A;  4FCX A;  5F3W A;  1QFC A;  4MOY A;  3H66 A;  3EGH A;  3K7W C;  3E7A A;  3EGG A;  2IE4 C;  3IVE A;  4H2G A;  3PSN A;  1UF3 A;  3RQZ A;  1KBP A;  3QG5 C;  4KKZ A;  2HYP A;  3DW8 C;  4YKE A;  4G9J A;  1OIE A;  5GTU A;  2BDX A;  3E0J A;  5C1V A;  4IYP C;  5JPE A;  2YEQ A;  4JA9 A;  5INB A;  2ZO9 B;  2NPP C;  3H69 A;  3PSO A;  4HD0 A;  4ORA A;  4WWL A;  4F0Z A;  1II7 A;  3P71 C;  1T71 A;  4H2F A;  3DSC A;  4Q7F A;  4LAC C;  3RL4 A;  1Z2W A;  2QJC A;  1OID A;  3ZU0 A;  1XZW A;  2HY1 A;  5HPE A;  1AUI A;  1XM7 A;  2ZOA A;  3RL3 A;  4FBQ A;  5EQV A;  1U32 A;  4O4K A;  4NZV A;  3QFO A;  4KBP A;  2O8A A;  3H63 A;  2JOG A;  2O8G A;  4UWQ A;  2R17 A;  3FGA C;  1OI8 A;  1JK7 A;  4TUI A;  1MF8 A;  4OR9 A;  2XMO A;  4MP0 A;  1S3L A;  4JA7 A;  1S3N A;  3FLO A;  4ZVZ A;  5B8I A;  1G5B A;  3JYF A;  1QHW A;  3LL8 A;  4DHL A;  5IOH A;  4LTY A;  1HPU A;  4MOV A;  1NNW A;  4V0X A;  4ZX2 A;  1USH A;  1M63 A;  3CK2 A;  1S8E A;  1T70 A;  3E7B A;  3DSD A;  3AV0 A;  4UT3 A;  5DNY A;  1UTE A;  4O24 A;  1SU1 A;  2HYO A;  4O43 A;  3AUZ A;  1S70 A;  3D03 A;  1HO5 A;  4H1Y P;  3IB7 A;  3QFN A;  3H67 A;  2WDF A;  1FJM A;  2ZBM A;  3T1I A;  2WDE A;  2Q8U A;  2Z06 A;  5JJT A;  3KBP A;  4UT2 A;  2QFR A;  4V0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...