3FGAC

Structural basis of pp2a and sgo interaction
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
303
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVNRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRTRRTPDYFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the PP2A-shugoshin interaction
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 99
structure length 303
sequence length 308
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3fgaC00
3PSOA 4TUIA 3ICFA 4MP0A 2ZBMA 5IOHA 4J6OA 4H1SA 1HPUA 3E7BA 2Q8UA 4DSYA 3K7VC 4H2FA 4UT3A 2Z72A 1KBPA 1S70A 3H67A 4O24A 4O4KA 3H64A 1S3LA 1S95A 3FGAC 4I5LC 4KKZA 1Z2WA 3EGHA 3DSCA 3GVEA 4ORAA 4ZX2A 1XM7A 4UWQA 5JJTA 3QFKA 3PSNA 3IVDA 3RQZA 2HYPA 2WDEA 4KBPA 3RL5A 1S3MA 1S8EA 4FBKA 4UT2A 2JOGA 2NPPC 1IT6A 4FBWA 1M63A 3C9FA 5J28A 3EGGA 4JA7A 1USHA 1WARA 4DT2A 3THNA 2KKNA 5DNYA 4O43A 4V0XA 3P71C 3KBPA 5INBA 2BQ8X 3IVEA 4IL1A 4NZVA 5C1VA 2XMOA 1OIEA 1Z2XA 1TCOA 3H68A 2AHDA 4MOVA 1UTEA 4TUGA 3JYFA 3H61A 3LL8A 2YVTA 2QJCA 4H2GA 3AUZA 4F0ZA 2NYMC 5B8IA 3DSDA 2QFPA 4O5GA 3RL4A 3ZU0A 4LTYA 2Z1AA 1OIDA 1XZWA 2IE4C 2BCDA 2NXFA 2IE3C 4B2OA 1HO5A 4MOYA 4XPNA 2CV9A 3K7WC 5F3WA 3HVQA 4ORBA 3N5UA 1QFCA 4IYPC 4LU9A 4V0WA 3QG5C 4HD0A 3H66A 5EQVA 2P6BA 1T71A 1W24A 1SU1A 2WDDA 4OR9A 2USHA 1WAO1 3QFOA 2Z06A 4V0VA 4FBQA 1FJMA 4ORCA 4ZVZA 3TGHA 1NNWA 1MF8A 2A22A 2WDCA 3H69A 4DHLA 2R17A 3H62B 2DFJA 2O8GA 2O8AA 3C5WC 2QFRA 3E7AA 1QHWA 3IB7A 1UF3A 4LACC 4H1YP 3CK2A 3T1IA 1U32A 1AUIA 3AV0A 3ZTVA 2GJUA 4M0VA 2IAEC 1G5BA 1JK7A 3DW8C 4H2BA 4G9JA 2HY1A 2BDXA 4H2IA 3THOB 4FCXA 1V73A 5GTUA 4YKEA 3RL3A 1S3NA 2HYOA 5JPFA 4WWLA 1OI8A 3H60A 3H63A 3QFMA 5JPEA 1II7A 2WDFA 4UT3B 1HP1A 3IB8A 1T70A 4I5NC 2NYLC 4Q7FA 4JA9A 3V4YA 5HPEA 3QFNA
chains in the Genus database with same CATH superfamily
3PSOA 4TUIA 3ICFA 4MP0A 2ZBMA 2ZO9B 5IOHA 4J6OA 4H1SA 1HPUA 3E7BA 2Q8UA 4DSYA 3K7VC 4H2FA 4UT3A 2Z72A 1KBPA 1S70A 3H67A 4O24A 4O4KA 3H64A 1S3LA 1S95A 3FGAC 4I5LC 4KKZA 2DXLA 1Z2WA 3EGHA 3DSCA 3GVEA 4ORAA 4ZX2A 1XM7A 4UWQA 5JJTA 3QFKA 3PSNA 3IVDA 3FLOA 2HYPA 2WDEA 3RQZA 4KBPA 3RL5A 1S3MA 1S8EA 4FBKA 4UT2A 2JOGA 2NPPC 1IT6A 4FBWA 1M63A 3C9FA 5J28A 3EGGA 2YEQA 4JA7A 1USHA 1WARA 4DT2A 3THNA 2KKNA 5DNYA 4O43A 4V0XA 3P71C 3KBPA 5INBA 2BQ8X 3IVEA 4IL1A 4NZVA 5C1VA 2XMOA 1OIEA 1Z2XA 1TCOA 3H68A 2AHDA 4MOVA 1UTEA 4TUGA 3JYFA 3H61A 3LL8A 2YVTA 2QJCA 4H2GA 3AUZA 4F0ZA 2NYMC 5B8IA 3DSDA 2QFPA 4O5GA 3RL4A 3ZU0A 4LTYA 2Z1AA 1OIDA 1XZWA 2IE4C 2BCDA 2NXFA 2IE3C 4B2OA 1HO5A 4MOYA 4XPNA 2CV9A 3K7WC 5F3WA 3HVQA 4ORBA 3N5UA 1QFCA 4IYPC 4LU9A 4V0WA 3QG5C 4HD0A 3E0JA 3H66A 5EQVA 2P6BA 1T71A 1W24A 1SU1A 2WDDA 4OR9A 2USHA 1WAO1 3QFOA 2Z06A 4V0VA 4FBQA 1FJMA 4ORCA 4ZVZA 3TGHA 1NNWA 1MF8A 2A22A 2WDCA 3H69A 4DHLA 2R17A 3H62B 2DFJA 2O8GA 2O8AA 3C5WC 2QFRA 3E7AA 1QHWA 3IB7A 1UF3A 4LACC 4H1YP 3CK2A 3T1IA 1U32A 1AUIA 3AV0A 3ZTVA 2GJUA 4M0VA 2IAEC 1G5BA 1JK7A 3DW8C 4H2BA 2DXNA 2HY1A 2BDXA 4G9JA 4H2IA 4FCXA 1V73A 3THOB 5GTUA 4YKEA 3RL3A 1S3NA 2HYOA 5JPFA 4WWLA 1OI8A 3H60A 3H63A 3D03A 3QFMA 5JPEA 1II7A 2WDFA 4UT3B 1HP1A 3IB8A 2ZOAA 1T70A 4I5NC 2NYLC 4Q7FA 4JA9A 3V4YA 5HPEA 3QFNA
chains in the Genus database with same CATH topology
3PSOA 4TUIA 3ICFA 4MP0A 2ZBMA 2ZO9B 5IOHA 4J6OA 4H1SA 1HPUA 3E7BA 2Q8UA 4DSYA 3K7VC 4H2FA 4UT3A 2Z72A 1KBPA 1S70A 3H67A 4O24A 4O4KA 3H64A 1S3LA 1S95A 3FGAC 4I5LC 4KKZA 2DXLA 1Z2WA 3EGHA 3DSCA 3GVEA 4ORAA 4ZX2A 1XM7A 4UWQA 5JJTA 3QFKA 3PSNA 3IVDA 3FLOA 2HYPA 2WDEA 3RQZA 4KBPA 3RL5A 1S3MA 1S8EA 4FBKA 4UT2A 2JOGA 2NPPC 1IT6A 4FBWA 1M63A 3C9FA 5J28A 3EGGA 2YEQA 4JA7A 1USHA 1WARA 4DT2A 3THNA 2KKNA 5DNYA 4O43A 4V0XA 3P71C 3KBPA 5INBA 2BQ8X 3IVEA 4IL1A 4NZVA 5C1VA 2XMOA 1OIEA 1Z2XA 1TCOA 3H68A 2AHDA 4MOVA 1UTEA 4TUGA 3JYFA 3H61A 3LL8A 2YVTA 2QJCA 4H2GA 3AUZA 4F0ZA 2NYMC 5B8IA 3DSDA 2QFPA 4O5GA 3RL4A 3ZU0A 4LTYA 2Z1AA 1OIDA 1XZWA 2IE4C 2BCDA 2NXFA 2IE3C 4B2OA 1HO5A 4MOYA 4XPNA 2CV9A 3K7WC 5F3WA 3HVQA 4ORBA 3N5UA 1QFCA 4IYPC 4LU9A 4V0WA 3QG5C 4HD0A 3E0JA 3H66A 5EQVA 2P6BA 1T71A 1W24A 1SU1A 2WDDA 4OR9A 2USHA 1WAO1 3QFOA 2Z06A 4V0VA 4FBQA 1FJMA 4ORCA 4ZVZA 3TGHA 1NNWA 1MF8A 2A22A 2WDCA 3H69A 4DHLA 2R17A 3H62B 2DFJA 2O8GA 2O8AA 3C5WC 2QFRA 3E7AA 1QHWA 3IB7A 1UF3A 4LACC 4H1YP 3CK2A 3T1IA 1U32A 1AUIA 3AV0A 3ZTVA 2GJUA 4M0VA 2IAEC 1G5BA 1JK7A 3DW8C 4H2BA 2DXNA 2HY1A 2BDXA 4G9JA 4H2IA 4FCXA 1V73A 3THOB 5GTUA 4YKEA 3RL3A 1S3NA 2HYOA 5JPFA 4WWLA 1OI8A 3H60A 3H63A 3D03A 3QFMA 5JPEA 1II7A 2WDFA 4UT3B 1HP1A 3IB8A 2ZOAA 1T70A 4I5NC 2NYLC 4Q7FA 4JA9A 3V4YA 5HPEA 3QFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSO A;  4TUI A;  3ICF A;  4MP0 A;  2ZBM A;  5IOH A;  4J6O A;  4H1S A;  1HPU A;  3E7B A;  2Q8U A;  4DSY A;  3K7V C;  4H2F A;  4UT3 A;  2Z72 A;  1KBP A;  1S70 A;  3H67 A;  4O24 A;  4O4K A;  3H64 A;  1S3L A;  1S95 A;  3FGA C;  4I5L C;  4KKZ A;  1Z2W A;  3EGH A;  3DSC A;  3GVE A;  4ORA A;  4ZX2 A;  1XM7 A;  4UWQ A;  5JJT A;  3QFK A;  3PSN A;  3IVD A;  3RQZ A;  2HYP A;  2WDE A;  4KBP A;  3RL5 A;  1S3M A;  1S8E A;  4FBK A;  4UT2 A;  2JOG A;  2NPP C;  1IT6 A;  4FBW A;  1M63 A;  3C9F A;  5J28 A;  3EGG A;  4JA7 A;  1USH A;  1WAR A;  4DT2 A;  3THN A;  2KKN A;  5DNY A;  4O43 A;  4V0X A;  3P71 C;  3KBP A;  5INB A;  2BQ8 X;  3IVE A;  4IL1 A;  4NZV A;  5C1V A;  2XMO A;  1OIE A;  1Z2X A;  1TCO A;  3H68 A;  2AHD A;  4MOV A;  1UTE A;  4TUG A;  3JYF A;  3H61 A;  3LL8 A;  2YVT A;  2QJC A;  4H2G A;  3AUZ A;  4F0Z A;  2NYM C;  5B8I A;  3DSD A;  2QFP A;  4O5G A;  3RL4 A;  3ZU0 A;  4LTY A;  2Z1A A;  1OID A;  1XZW A;  2IE4 C;  2BCD A;  2NXF A;  2IE3 C;  4B2O A;  1HO5 A;  4MOY A;  4XPN A;  2CV9 A;  3K7W C;  5F3W A;  3HVQ A;  4ORB A;  3N5U A;  1QFC A;  4IYP C;  4LU9 A;  4V0W A;  3QG5 C;  4HD0 A;  3H66 A;  5EQV A;  2P6B A;  1T71 A;  1W24 A;  1SU1 A;  2WDD A;  4OR9 A;  2USH A;  1WAO 1;  3QFO A;  2Z06 A;  4V0V A;  4FBQ A;  1FJM A;  4ORC A;  4ZVZ A;  3TGH A;  1NNW A;  1MF8 A;  2A22 A;  2WDC A;  3H69 A;  4DHL A;  2R17 A;  3H62 B;  2DFJ A;  2O8G A;  2O8A A;  3C5W C;  2QFR A;  3E7A A;  1QHW A;  3IB7 A;  1UF3 A;  4LAC C;  4H1Y P;  3CK2 A;  3T1I A;  1U32 A;  1AUI A;  3AV0 A;  3ZTV A;  2GJU A;  4M0V A;  2IAE C;  1G5B A;  1JK7 A;  3DW8 C;  4H2B A;  4G9J A;  2HY1 A;  2BDX A;  4H2I A;  3THO B;  4FCX A;  1V73 A;  5GTU A;  4YKE A;  3RL3 A;  1S3N A;  2HYO A;  5JPF A;  4WWL A;  1OI8 A;  3H60 A;  3H63 A;  3QFM A;  5JPE A;  1II7 A;  2WDF A;  4UT3 B;  1HP1 A;  3IB8 A;  1T70 A;  4I5N C;  2NYL C;  4Q7F A;  4JA9 A;  3V4Y A;  5HPE A;  3QFN A; 
#chains in the Genus database with same CATH topology
 3PSO A;  4TUI A;  3ICF A;  4MP0 A;  2ZBM A;  2ZO9 B;  5IOH A;  4J6O A;  4H1S A;  1HPU A;  3E7B A;  2Q8U A;  4DSY A;  3K7V C;  4H2F A;  4UT3 A;  2Z72 A;  1KBP A;  1S70 A;  3H67 A;  4O24 A;  4O4K A;  3H64 A;  1S3L A;  1S95 A;  3FGA C;  4I5L C;  4KKZ A;  2DXL A;  1Z2W A;  3EGH A;  3DSC A;  3GVE A;  4ORA A;  4ZX2 A;  1XM7 A;  4UWQ A;  5JJT A;  3QFK A;  3PSN A;  3IVD A;  3FLO A;  2HYP A;  2WDE A;  3RQZ A;  4KBP A;  3RL5 A;  1S3M A;  1S8E A;  4FBK A;  4UT2 A;  2JOG A;  2NPP C;  1IT6 A;  4FBW A;  1M63 A;  3C9F A;  5J28 A;  3EGG A;  2YEQ A;  4JA7 A;  1USH A;  1WAR A;  4DT2 A;  3THN A;  2KKN A;  5DNY A;  4O43 A;  4V0X A;  3P71 C;  3KBP A;  5INB A;  2BQ8 X;  3IVE A;  4IL1 A;  4NZV A;  5C1V A;  2XMO A;  1OIE A;  1Z2X A;  1TCO A;  3H68 A;  2AHD A;  4MOV A;  1UTE A;  4TUG A;  3JYF A;  3H61 A;  3LL8 A;  2YVT A;  2QJC A;  4H2G A;  3AUZ A;  4F0Z A;  2NYM C;  5B8I A;  3DSD A;  2QFP A;  4O5G A;  3RL4 A;  3ZU0 A;  4LTY A;  2Z1A A;  1OID A;  1XZW A;  2IE4 C;  2BCD A;  2NXF A;  2IE3 C;  4B2O A;  1HO5 A;  4MOY A;  4XPN A;  2CV9 A;  3K7W C;  5F3W A;  3HVQ A;  4ORB A;  3N5U A;  1QFC A;  4IYP C;  4LU9 A;  4V0W A;  3QG5 C;  4HD0 A;  3E0J A;  3H66 A;  5EQV A;  2P6B A;  1T71 A;  1W24 A;  1SU1 A;  2WDD A;  4OR9 A;  2USH A;  1WAO 1;  3QFO A;  2Z06 A;  4V0V A;  4FBQ A;  1FJM A;  4ORC A;  4ZVZ A;  3TGH A;  1NNW A;  1MF8 A;  2A22 A;  2WDC A;  3H69 A;  4DHL A;  2R17 A;  3H62 B;  2DFJ A;  2O8G A;  2O8A A;  3C5W C;  2QFR A;  3E7A A;  1QHW A;  3IB7 A;  1UF3 A;  4LAC C;  4H1Y P;  3CK2 A;  3T1I A;  1U32 A;  1AUI A;  3AV0 A;  3ZTV A;  2GJU A;  4M0V A;  2IAE C;  1G5B A;  1JK7 A;  3DW8 C;  4H2B A;  2DXN A;  2HY1 A;  2BDX A;  4G9J A;  4H2I A;  4FCX A;  1V73 A;  3THO B;  5GTU A;  4YKE A;  3RL3 A;  1S3N A;  2HYO A;  5JPF A;  4WWL A;  1OI8 A;  3H60 A;  3H63 A;  3D03 A;  3QFM A;  5JPE A;  1II7 A;  2WDF A;  4UT3 B;  1HP1 A;  3IB8 A;  2ZOA A;  1T70 A;  4I5N C;  2NYL C;  4Q7F A;  4JA9 A;  3V4Y A;  5HPE A;  3QFN A; 
#chains in the Genus database with same CATH homology
 3PSO A;  4TUI A;  3ICF A;  4MP0 A;  2ZBM A;  2ZO9 B;  5IOH A;  4J6O A;  4H1S A;  1HPU A;  3E7B A;  2Q8U A;  4DSY A;  3K7V C;  4H2F A;  4UT3 A;  2Z72 A;  1KBP A;  1S70 A;  3H67 A;  4O24 A;  4O4K A;  3H64 A;  1S3L A;  1S95 A;  3FGA C;  4I5L C;  4KKZ A;  2DXL A;  1Z2W A;  3EGH A;  3DSC A;  3GVE A;  4ORA A;  4ZX2 A;  1XM7 A;  4UWQ A;  5JJT A;  3QFK A;  3PSN A;  3IVD A;  3FLO A;  2HYP A;  2WDE A;  3RQZ A;  4KBP A;  3RL5 A;  1S3M A;  1S8E A;  4FBK A;  4UT2 A;  2JOG A;  2NPP C;  1IT6 A;  4FBW A;  1M63 A;  3C9F A;  5J28 A;  3EGG A;  2YEQ A;  4JA7 A;  1USH A;  1WAR A;  4DT2 A;  3THN A;  2KKN A;  5DNY A;  4O43 A;  4V0X A;  3P71 C;  3KBP A;  5INB A;  2BQ8 X;  3IVE A;  4IL1 A;  4NZV A;  5C1V A;  2XMO A;  1OIE A;  1Z2X A;  1TCO A;  3H68 A;  2AHD A;  4MOV A;  1UTE A;  4TUG A;  3JYF A;  3H61 A;  3LL8 A;  2YVT A;  2QJC A;  4H2G A;  3AUZ A;  4F0Z A;  2NYM C;  5B8I A;  3DSD A;  2QFP A;  4O5G A;  3RL4 A;  3ZU0 A;  4LTY A;  2Z1A A;  1OID A;  1XZW A;  2IE4 C;  2BCD A;  2NXF A;  2IE3 C;  4B2O A;  1HO5 A;  4MOY A;  4XPN A;  2CV9 A;  3K7W C;  5F3W A;  3HVQ A;  4ORB A;  3N5U A;  1QFC A;  4IYP C;  4LU9 A;  4V0W A;  3QG5 C;  4HD0 A;  3E0J A;  3H66 A;  5EQV A;  2P6B A;  1T71 A;  1W24 A;  1SU1 A;  2WDD A;  4OR9 A;  2USH A;  1WAO 1;  3QFO A;  2Z06 A;  4V0V A;  4FBQ A;  1FJM A;  4ORC A;  4ZVZ A;  3TGH A;  1NNW A;  1MF8 A;  2A22 A;  2WDC A;  3H69 A;  4DHL A;  2R17 A;  3H62 B;  2DFJ A;  2O8G A;  2O8A A;  3C5W C;  2QFR A;  3E7A A;  1QHW A;  3IB7 A;  1UF3 A;  4LAC C;  4H1Y P;  3CK2 A;  3T1I A;  1U32 A;  1AUI A;  3AV0 A;  3ZTV A;  2GJU A;  4M0V A;  2IAE C;  1G5B A;  1JK7 A;  3DW8 C;  4H2B A;  2DXN A;  2HY1 A;  2BDX A;  4G9J A;  4H2I A;  4FCX A;  1V73 A;  3THO B;  5GTU A;  4YKE A;  3RL3 A;  1S3N A;  2HYO A;  5JPF A;  4WWL A;  1OI8 A;  3H60 A;  3H63 A;  3D03 A;  3QFM A;  5JPE A;  1II7 A;  2WDF A;  4UT3 B;  1HP1 A;  3IB8 A;  2ZOA A;  1T70 A;  4I5N C;  2NYL C;  4Q7F A;  4JA9 A;  3V4Y A;  5HPE A;  3QFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...