3FGAC

Structural basis of pp2a and sgo interaction
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
303
Chain Sequence
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVNRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRTRRTPDYFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the PP2A-shugoshin interaction
pubmed doi rcsb
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
molecule tags Hydrolase/hydrolase inhibitor
source organism Mus musculus
total genus 99
structure length 303
sequence length 308
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3fgaC00
4O43A 1XM7A 4WWLA 3IVDA 4XPNA 1OI8A 3C5WC 1T70A 3P71C 4ZVZA 5DNYA 2Z06A 3GVEA 3ZU0A 4MOVA 5EQVA 3QG5C 2IE4C 3E7BA 4B2OA 3LL8A 3H61A 2A22A 2DFJA 2XMOA 3H63A 1S3NA 2R17A 2WDCA 2GJUA 4I5LC 5IOHA 4G9JA 3IB7A 4KBPA 2Q8UA 1OIDA 1WAO1 2BQ8X 2Z72A 4O24A 5GTUA 4ZX2A 1Z2WA 1MF8A 4DT2A 2YVTA 4H2BA 3H68A 3V4YA 3THNA 3DW8C 3K7VC 4OR9A 1FJMA 1V73A 3PSOA 2Z1AA 3RL4A 4MP0A 2CV9A 3H62B 4LU9A 3IB8A 4LACC 4FBWA 4H1YP 1KBPA 2QJCA 1II7A 1W24A 3H64A 4HD0A 4UWQA 1S3MA 3HVQA 5B8IA 4V0WA 4V0VA 4KKZA 4H2FA 2HYPA 4H1SA 3RQZA 1Z2XA 2IE3C 1UF3A 2NPPC 2QFPA 2QFRA 1AUIA 1NNWA 2IAEC 1S70A 4TUGA 1TCOA 3H60A 3IVEA 5JPFA 4UT2A 4Q7FA 1S8EA 5JPEA 4IYPC 3H69A 3EGGA 3E7AA 4V0XA 3K7WC 1WARA 1JK7A 1T71A 2USHA 1HO5A 3ICFA 1USHA 3DSCA 3FGAC 5J28A 2NYLC 4YKEA 2O8GA 3TGHA 3EGHA 1HPUA 3QFOA 3DSDA 1M63A 4ORAA 4DHLA 4H2GA 1S95A 4NZVA 1HP1A 2KKNA 2NXFA 2WDFA 1SU1A 2WDDA 4O4KA 1UTEA 4TUIA 5HPEA 2BDXA 1QHWA 4I5NC 2HY1A 4H2IA 1IT6A 3ZTVA 4MOYA 2AHDA 3QFNA 3THOB 5INBA 3KBPA 5C1VA 3C9FA 2O8AA 4LTYA 2JOGA 2P6BA 2NYMC 4JA7A 3RL5A 4FCXA 3N5UA 3JYFA 3QFMA 3RL3A 4DSYA 5F3WA 5JJTA 4FBQA 3H66A 4F0ZA 2ZBMA 4ORBA 1OIEA 1G5BA 4FBKA 4JA9A 1QFCA 3AV0A 2WDEA 3AUZA 4J6OA 4M0VA 2HYOA 4UT3B 1XZWA 2BCDA 3PSNA 1S3LA 4IL1A 4O5GA 4UT3A 1U32A 4ORCA 3QFKA 3CK2A 3T1IA 3H67A
chains in the Genus database with same CATH superfamily
4O43A 2DXLA 1XM7A 4WWLA 3IVDA 4XPNA 1OI8A 3C5WC 1T70A 3P71C 4ZVZA 5DNYA 2Z06A 3GVEA 3ZU0A 2ZO9B 4MOVA 5EQVA 3QG5C 2IE4C 3E7BA 4B2OA 3LL8A 3H61A 2A22A 2DFJA 2XMOA 3H63A 1S3NA 2R17A 3FLOA 2WDCA 2GJUA 4I5LC 5IOHA 4G9JA 3IB7A 4KBPA 2Q8UA 1OIDA 1WAO1 2BQ8X 2Z72A 4O24A 2YEQA 5GTUA 4ZX2A 1Z2WA 1MF8A 4DT2A 2YVTA 4H2BA 3H68A 3V4YA 3THNA 3DW8C 3K7VC 4OR9A 1FJMA 1V73A 3PSOA 2Z1AA 3RL4A 2DXNA 4MP0A 2CV9A 3H62B 4LU9A 3IB8A 4LACC 4FBWA 4H1YP 1KBPA 2QJCA 1II7A 1W24A 3H64A 4HD0A 4UWQA 1S3MA 3HVQA 5B8IA 4V0WA 4V0VA 4KKZA 4H2FA 2HYPA 4H1SA 3RQZA 1Z2XA 2IE3C 1UF3A 2NPPC 2QFPA 2QFRA 1AUIA 1NNWA 2IAEC 1S70A 4TUGA 1TCOA 3H60A 3IVEA 2ZOAA 4UT2A 4Q7FA 5JPFA 1S8EA 5JPEA 4IYPC 3H69A 3EGGA 3E7AA 4V0XA 3K7WC 1WARA 1JK7A 1T71A 2USHA 1HO5A 3ICFA 1USHA 3DSCA 3FGAC 5J28A 2NYLC 4YKEA 2O8GA 3TGHA 3EGHA 1HPUA 3QFOA 3DSDA 1M63A 4ORAA 4DHLA 4H2GA 1S95A 4NZVA 1HP1A 2KKNA 2NXFA 2WDFA 1SU1A 2WDDA 4O4KA 1UTEA 3E0JA 4TUIA 5HPEA 2BDXA 1QHWA 4I5NC 2HY1A 4H2IA 1IT6A 3ZTVA 4MOYA 2AHDA 3QFNA 3THOB 5INBA 3KBPA 5C1VA 3C9FA 2O8AA 4LTYA 2JOGA 2P6BA 2NYMC 4JA7A 3RL5A 4FCXA 3N5UA 3JYFA 3QFMA 3RL3A 4DSYA 5F3WA 5JJTA 4FBQA 3H66A 4F0ZA 2ZBMA 4ORBA 3D03A 1OIEA 1G5BA 4FBKA 4JA9A 1QFCA 3AV0A 2WDEA 3AUZA 4J6OA 4M0VA 2HYOA 4UT3B 1XZWA 2BCDA 3PSNA 1S3LA 4IL1A 4O5GA 4UT3A 1U32A 4ORCA 3QFKA 3CK2A 3T1IA 3H67A
chains in the Genus database with same CATH topology
4O43A 2DXLA 1XM7A 4WWLA 3IVDA 4XPNA 1OI8A 3C5WC 1T70A 3P71C 4ZVZA 5DNYA 2Z06A 3GVEA 3ZU0A 2ZO9B 4MOVA 5EQVA 3QG5C 2IE4C 3E7BA 4B2OA 3LL8A 3H61A 2A22A 2DFJA 2XMOA 3H63A 1S3NA 2R17A 3FLOA 2WDCA 2GJUA 4I5LC 5IOHA 4G9JA 3IB7A 4KBPA 2Q8UA 1OIDA 1WAO1 2BQ8X 2Z72A 4O24A 2YEQA 5GTUA 4ZX2A 1Z2WA 1MF8A 4DT2A 2YVTA 4H2BA 3H68A 3V4YA 3THNA 3DW8C 3K7VC 4OR9A 1FJMA 1V73A 3PSOA 2Z1AA 3RL4A 2DXNA 4MP0A 2CV9A 3H62B 4LU9A 3IB8A 4LACC 4FBWA 4H1YP 1KBPA 2QJCA 1II7A 1W24A 3H64A 4HD0A 4UWQA 1S3MA 3HVQA 5B8IA 4V0WA 4V0VA 4KKZA 4H2FA 2HYPA 4H1SA 3RQZA 1Z2XA 2IE3C 1UF3A 2NPPC 2QFPA 2QFRA 1AUIA 1NNWA 2IAEC 1S70A 4TUGA 1TCOA 3H60A 3IVEA 2ZOAA 4UT2A 4Q7FA 5JPFA 1S8EA 5JPEA 4IYPC 3H69A 3EGGA 3E7AA 4V0XA 3K7WC 1WARA 1JK7A 1T71A 2USHA 1HO5A 3ICFA 1USHA 3DSCA 3FGAC 5J28A 2NYLC 4YKEA 2O8GA 3TGHA 3EGHA 1HPUA 3QFOA 3DSDA 1M63A 4ORAA 4DHLA 4H2GA 1S95A 4NZVA 1HP1A 2KKNA 2NXFA 2WDFA 1SU1A 2WDDA 4O4KA 1UTEA 3E0JA 4TUIA 5HPEA 2BDXA 1QHWA 4I5NC 2HY1A 4H2IA 1IT6A 3ZTVA 4MOYA 2AHDA 3QFNA 3THOB 5INBA 3KBPA 5C1VA 3C9FA 2O8AA 4LTYA 2JOGA 2P6BA 2NYMC 4JA7A 3RL5A 4FCXA 3N5UA 3JYFA 3QFMA 3RL3A 4DSYA 5F3WA 5JJTA 4FBQA 3H66A 4F0ZA 2ZBMA 4ORBA 3D03A 1OIEA 1G5BA 4FBKA 4JA9A 1QFCA 3AV0A 2WDEA 3AUZA 4J6OA 4M0VA 2HYOA 4UT3B 1XZWA 2BCDA 3PSNA 1S3LA 4IL1A 4O5GA 4UT3A 1U32A 4ORCA 3QFKA 3CK2A 3T1IA 3H67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O43 A;  1XM7 A;  4WWL A;  3IVD A;  4XPN A;  1OI8 A;  3C5W C;  1T70 A;  3P71 C;  4ZVZ A;  5DNY A;  2Z06 A;  3GVE A;  3ZU0 A;  4MOV A;  5EQV A;  3QG5 C;  2IE4 C;  3E7B A;  4B2O A;  3LL8 A;  3H61 A;  2A22 A;  2DFJ A;  2XMO A;  3H63 A;  1S3N A;  2R17 A;  2WDC A;  2GJU A;  4I5L C;  5IOH A;  4G9J A;  3IB7 A;  4KBP A;  2Q8U A;  1OID A;  1WAO 1;  2BQ8 X;  2Z72 A;  4O24 A;  5GTU A;  4ZX2 A;  1Z2W A;  1MF8 A;  4DT2 A;  2YVT A;  4H2B A;  3H68 A;  3V4Y A;  3THN A;  3DW8 C;  3K7V C;  4OR9 A;  1FJM A;  1V73 A;  3PSO A;  2Z1A A;  3RL4 A;  4MP0 A;  2CV9 A;  3H62 B;  4LU9 A;  3IB8 A;  4LAC C;  4FBW A;  4H1Y P;  1KBP A;  2QJC A;  1II7 A;  1W24 A;  3H64 A;  4HD0 A;  4UWQ A;  1S3M A;  3HVQ A;  5B8I A;  4V0W A;  4V0V A;  4KKZ A;  4H2F A;  2HYP A;  4H1S A;  3RQZ A;  1Z2X A;  2IE3 C;  1UF3 A;  2NPP C;  2QFP A;  2QFR A;  1AUI A;  1NNW A;  2IAE C;  1S70 A;  4TUG A;  1TCO A;  3H60 A;  3IVE A;  5JPF A;  4UT2 A;  4Q7F A;  1S8E A;  5JPE A;  4IYP C;  3H69 A;  3EGG A;  3E7A A;  4V0X A;  3K7W C;  1WAR A;  1JK7 A;  1T71 A;  2USH A;  1HO5 A;  3ICF A;  1USH A;  3DSC A;  3FGA C;  5J28 A;  2NYL C;  4YKE A;  2O8G A;  3TGH A;  3EGH A;  1HPU A;  3QFO A;  3DSD A;  1M63 A;  4ORA A;  4DHL A;  4H2G A;  1S95 A;  4NZV A;  1HP1 A;  2KKN A;  2NXF A;  2WDF A;  1SU1 A;  2WDD A;  4O4K A;  1UTE A;  4TUI A;  5HPE A;  2BDX A;  1QHW A;  4I5N C;  2HY1 A;  4H2I A;  1IT6 A;  3ZTV A;  4MOY A;  2AHD A;  3QFN A;  3THO B;  5INB A;  3KBP A;  5C1V A;  3C9F A;  2O8A A;  4LTY A;  2JOG A;  2P6B A;  2NYM C;  4JA7 A;  3RL5 A;  4FCX A;  3N5U A;  3JYF A;  3QFM A;  3RL3 A;  4DSY A;  5F3W A;  5JJT A;  4FBQ A;  3H66 A;  4F0Z A;  2ZBM A;  4ORB A;  1OIE A;  1G5B A;  4FBK A;  4JA9 A;  1QFC A;  3AV0 A;  2WDE A;  3AUZ A;  4J6O A;  4M0V A;  2HYO A;  4UT3 B;  1XZW A;  2BCD A;  3PSN A;  1S3L A;  4IL1 A;  4O5G A;  4UT3 A;  1U32 A;  4ORC A;  3QFK A;  3CK2 A;  3T1I A;  3H67 A; 
#chains in the Genus database with same CATH topology
 4O43 A;  2DXL A;  1XM7 A;  4WWL A;  3IVD A;  4XPN A;  1OI8 A;  3C5W C;  1T70 A;  3P71 C;  4ZVZ A;  5DNY A;  2Z06 A;  3GVE A;  3ZU0 A;  2ZO9 B;  4MOV A;  5EQV A;  3QG5 C;  2IE4 C;  3E7B A;  4B2O A;  3LL8 A;  3H61 A;  2A22 A;  2DFJ A;  2XMO A;  3H63 A;  1S3N A;  2R17 A;  3FLO A;  2WDC A;  2GJU A;  4I5L C;  5IOH A;  4G9J A;  3IB7 A;  4KBP A;  2Q8U A;  1OID A;  1WAO 1;  2BQ8 X;  2Z72 A;  4O24 A;  2YEQ A;  5GTU A;  4ZX2 A;  1Z2W A;  1MF8 A;  4DT2 A;  2YVT A;  4H2B A;  3H68 A;  3V4Y A;  3THN A;  3DW8 C;  3K7V C;  4OR9 A;  1FJM A;  1V73 A;  3PSO A;  2Z1A A;  3RL4 A;  2DXN A;  4MP0 A;  2CV9 A;  3H62 B;  4LU9 A;  3IB8 A;  4LAC C;  4FBW A;  4H1Y P;  1KBP A;  2QJC A;  1II7 A;  1W24 A;  3H64 A;  4HD0 A;  4UWQ A;  1S3M A;  3HVQ A;  5B8I A;  4V0W A;  4V0V A;  4KKZ A;  4H2F A;  2HYP A;  4H1S A;  3RQZ A;  1Z2X A;  2IE3 C;  1UF3 A;  2NPP C;  2QFP A;  2QFR A;  1AUI A;  1NNW A;  2IAE C;  1S70 A;  4TUG A;  1TCO A;  3H60 A;  3IVE A;  2ZOA A;  4UT2 A;  4Q7F A;  5JPF A;  1S8E A;  5JPE A;  4IYP C;  3H69 A;  3EGG A;  3E7A A;  4V0X A;  3K7W C;  1WAR A;  1JK7 A;  1T71 A;  2USH A;  1HO5 A;  3ICF A;  1USH A;  3DSC A;  3FGA C;  5J28 A;  2NYL C;  4YKE A;  2O8G A;  3TGH A;  3EGH A;  1HPU A;  3QFO A;  3DSD A;  1M63 A;  4ORA A;  4DHL A;  4H2G A;  1S95 A;  4NZV A;  1HP1 A;  2KKN A;  2NXF A;  2WDF A;  1SU1 A;  2WDD A;  4O4K A;  1UTE A;  3E0J A;  4TUI A;  5HPE A;  2BDX A;  1QHW A;  4I5N C;  2HY1 A;  4H2I A;  1IT6 A;  3ZTV A;  4MOY A;  2AHD A;  3QFN A;  3THO B;  5INB A;  3KBP A;  5C1V A;  3C9F A;  2O8A A;  4LTY A;  2JOG A;  2P6B A;  2NYM C;  4JA7 A;  3RL5 A;  4FCX A;  3N5U A;  3JYF A;  3QFM A;  3RL3 A;  4DSY A;  5F3W A;  5JJT A;  4FBQ A;  3H66 A;  4F0Z A;  2ZBM A;  4ORB A;  3D03 A;  1OIE A;  1G5B A;  4FBK A;  4JA9 A;  1QFC A;  3AV0 A;  2WDE A;  3AUZ A;  4J6O A;  4M0V A;  2HYO A;  4UT3 B;  1XZW A;  2BCD A;  3PSN A;  1S3L A;  4IL1 A;  4O5G A;  4UT3 A;  1U32 A;  4ORC A;  3QFK A;  3CK2 A;  3T1I A;  3H67 A; 
#chains in the Genus database with same CATH homology
 4O43 A;  2DXL A;  1XM7 A;  4WWL A;  3IVD A;  4XPN A;  1OI8 A;  3C5W C;  1T70 A;  3P71 C;  4ZVZ A;  5DNY A;  2Z06 A;  3GVE A;  3ZU0 A;  2ZO9 B;  4MOV A;  5EQV A;  3QG5 C;  2IE4 C;  3E7B A;  4B2O A;  3LL8 A;  3H61 A;  2A22 A;  2DFJ A;  2XMO A;  3H63 A;  1S3N A;  2R17 A;  3FLO A;  2WDC A;  2GJU A;  4I5L C;  5IOH A;  4G9J A;  3IB7 A;  4KBP A;  2Q8U A;  1OID A;  1WAO 1;  2BQ8 X;  2Z72 A;  4O24 A;  2YEQ A;  5GTU A;  4ZX2 A;  1Z2W A;  1MF8 A;  4DT2 A;  2YVT A;  4H2B A;  3H68 A;  3V4Y A;  3THN A;  3DW8 C;  3K7V C;  4OR9 A;  1FJM A;  1V73 A;  3PSO A;  2Z1A A;  3RL4 A;  2DXN A;  4MP0 A;  2CV9 A;  3H62 B;  4LU9 A;  3IB8 A;  4LAC C;  4FBW A;  4H1Y P;  1KBP A;  2QJC A;  1II7 A;  1W24 A;  3H64 A;  4HD0 A;  4UWQ A;  1S3M A;  3HVQ A;  5B8I A;  4V0W A;  4V0V A;  4KKZ A;  4H2F A;  2HYP A;  4H1S A;  3RQZ A;  1Z2X A;  2IE3 C;  1UF3 A;  2NPP C;  2QFP A;  2QFR A;  1AUI A;  1NNW A;  2IAE C;  1S70 A;  4TUG A;  1TCO A;  3H60 A;  3IVE A;  2ZOA A;  4UT2 A;  4Q7F A;  5JPF A;  1S8E A;  5JPE A;  4IYP C;  3H69 A;  3EGG A;  3E7A A;  4V0X A;  3K7W C;  1WAR A;  1JK7 A;  1T71 A;  2USH A;  1HO5 A;  3ICF A;  1USH A;  3DSC A;  3FGA C;  5J28 A;  2NYL C;  4YKE A;  2O8G A;  3TGH A;  3EGH A;  1HPU A;  3QFO A;  3DSD A;  1M63 A;  4ORA A;  4DHL A;  4H2G A;  1S95 A;  4NZV A;  1HP1 A;  2KKN A;  2NXF A;  2WDF A;  1SU1 A;  2WDD A;  4O4K A;  1UTE A;  3E0J A;  4TUI A;  5HPE A;  2BDX A;  1QHW A;  4I5N C;  2HY1 A;  4H2I A;  1IT6 A;  3ZTV A;  4MOY A;  2AHD A;  3QFN A;  3THO B;  5INB A;  3KBP A;  5C1V A;  3C9F A;  2O8A A;  4LTY A;  2JOG A;  2P6B A;  2NYM C;  4JA7 A;  3RL5 A;  4FCX A;  3N5U A;  3JYF A;  3QFM A;  3RL3 A;  4DSY A;  5F3W A;  5JJT A;  4FBQ A;  3H66 A;  4F0Z A;  2ZBM A;  4ORB A;  3D03 A;  1OIE A;  1G5B A;  4FBK A;  4JA9 A;  1QFC A;  3AV0 A;  2WDE A;  3AUZ A;  4J6O A;  4M0V A;  2HYO A;  4UT3 B;  1XZW A;  2BCD A;  3PSN A;  1S3L A;  4IL1 A;  4O5G A;  4UT3 A;  1U32 A;  4ORC A;  3QFK A;  3CK2 A;  3T1I A;  3H67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...