3RL3A

Rat metallophosphodiesterase mpped2
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
276
Chain Sequence
VTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGTMTDGYTTYINASTCTVSFQPTNPPIIFDLPNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique utilization of a phosphoprotein phosphatase fold by a mammalian phosphodiesterase associated with WAGR syndrome.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Metallophosphoesterase MPPED2
total genus 86
structure length 276
sequence length 281
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3rl3A00
4UWQA 2WDCA 1HPUA 2KKNA 3TGHA 1OIDA 3RL3A 1M63A 5F3WA 1II7A 3DW8C 1FJMA 1NNWA 2QJCA 3N5UA 4H1YP 4DSYA 5INBA 5J28A 2NXFA 3PSNA 3H62B 4TUIA 1JK7A 4ZVZA 4LACC 5DNYA 4OR9A 4O24A 1Z2XA 3QFNA 3AUZA 4ORBA 1TCOA 1S70A 2R17A 3H69A 3IB8A 3K7VC 4G9JA 2WDFA 3ICFA 1UTEA 3RL4A 4FBQA 4V0WA 1HO5A 5HPEA 3HVQA 2IAEC 3T1IA 4MOYA 1HP1A 4KBPA 4M0VA 3LL8A 3DSDA 2IE4C 2Z72A 3PSOA 4IYPC 3AV0A 1Z2WA 4YKEA 1USHA 2HY1A 1OIEA 2O8GA 1SU1A 4I5LC 5B8IA 3QG5C 4JA9A 3H67A 4V0VA 2WDDA 1XZWA 2DFJA 4UT3B 2Q8UA 3V4YA 2HYOA 4H2GA 4IL1A 2HYPA 1WARA 5EQVA 4ZX2A 2AHDA 4KKZA 3RL5A 5JPEA 4FBKA 4DT2A 4LU9A 2O8AA 4H2IA 2IE3C 4HD0A 3E7AA 1XM7A 4H2FA 1QFCA 3H63A 3GVEA 1KBPA 3H60A 2A22A 4O4KA 5JJTA 1S3MA 4FBWA 4B2OA 4FCXA 2ZBMA 3EGHA 1OI8A 4DHLA 1MF8A 4TUGA 4O43A 4XPNA 4H2BA 2Z1AA 3ZTVA 2XMOA 3C9FA 1T70A 3DSCA 2CV9A 1T71A 3IB7A 5JPFA 2JOGA 3THOB 1V73A 3JYFA 3THNA 4MP0A 2QFPA 2Z06A 3C5WC 3H68A 1W24A 1AUIA 2NYLC 4LTYA 4NZVA 3E7BA 3H61A 4JA7A 2P6BA 3QFMA 3QFOA 4O5GA 5IOHA 1S3LA 4I5NC 4Q7FA 4J6OA 4V0XA 3FGAC 4F0ZA 4UT3A 1U32A 3IVEA 1S3NA 2NPPC 3EGGA 1S8EA 3K7WC 1IT6A 2BDXA 2BCDA 2QFRA 2BQ8X 3H66A 5C1VA 2GJUA 3QFKA 1UF3A 3IVDA 2YVTA 1S95A 4UT2A 3ZU0A 1WAO1 4WWLA 3H64A 4ORAA 5GTUA 3KBPA 4MOVA 2NYMC 2WDEA 3CK2A 4H1SA 4ORCA 1QHWA 3P71C 1G5BA 2USHA 3RQZA
chains in the Genus database with same CATH superfamily
4UWQA 2WDCA 1HPUA 2KKNA 3TGHA 1OIDA 3RL3A 1M63A 5F3WA 1II7A 3DW8C 1FJMA 1NNWA 2QJCA 3N5UA 4H1YP 4DSYA 5INBA 5J28A 2NXFA 3PSNA 3H62B 4TUIA 1JK7A 4ZVZA 4LACC 5DNYA 4OR9A 4O24A 1Z2XA 3QFNA 3AUZA 4ORBA 1TCOA 1S70A 2R17A 3H69A 3IB8A 3K7VC 4G9JA 2WDFA 3ICFA 1UTEA 3RL4A 4FBQA 4V0WA 1HO5A 5HPEA 3HVQA 2IAEC 3T1IA 4MOYA 1HP1A 4KBPA 4M0VA 3LL8A 3DSDA 2IE4C 2Z72A 3PSOA 4IYPC 3AV0A 1Z2WA 2ZO9B 4YKEA 1USHA 2HY1A 1OIEA 2O8GA 1SU1A 4I5LC 5B8IA 3QG5C 4JA9A 3H67A 4V0VA 2WDDA 1XZWA 2DFJA 4UT3B 2Q8UA 3V4YA 2HYOA 4H2GA 4IL1A 2HYPA 1WARA 5EQVA 4ZX2A 2AHDA 4KKZA 3RL5A 5JPEA 4FBKA 4DT2A 4LU9A 2O8AA 4H2IA 2IE3C 4HD0A 3E7AA 1XM7A 4H2FA 1QFCA 3H63A 3GVEA 1KBPA 3H60A 2A22A 4O4KA 5JJTA 1S3MA 4FBWA 4B2OA 4FCXA 2ZBMA 3EGHA 1OI8A 4DHLA 1MF8A 4TUGA 4O43A 4XPNA 4H2BA 2Z1AA 3ZTVA 2XMOA 3C9FA 1T70A 3DSCA 2CV9A 1T71A 2ZOAA 3IB7A 5JPFA 2JOGA 3THOB 1V73A 3JYFA 2DXNA 3THNA 4MP0A 2QFPA 2Z06A 3C5WC 3H68A 1W24A 1AUIA 2NYLC 4LTYA 4NZVA 2YEQA 3E7BA 3H61A 4JA7A 2P6BA 3QFMA 3FLOA 3QFOA 4O5GA 3D03A 5IOHA 1S3LA 4I5NC 4Q7FA 4J6OA 4V0XA 3FGAC 4F0ZA 4UT3A 1U32A 3IVEA 1S3NA 2NPPC 3EGGA 1S8EA 3K7WC 1IT6A 2BDXA 2BCDA 2QFRA 2BQ8X 3H66A 5C1VA 2GJUA 3QFKA 1UF3A 3IVDA 2YVTA 1S95A 4UT2A 3ZU0A 1WAO1 4WWLA 3H64A 4ORAA 5GTUA 3E0JA 3KBPA 4MOVA 2NYMC 2WDEA 3CK2A 4H1SA 4ORCA 1QHWA 3P71C 2DXLA 1G5BA 2USHA 3RQZA
chains in the Genus database with same CATH topology
4UWQA 2WDCA 1HPUA 2KKNA 3TGHA 1OIDA 3RL3A 1M63A 5F3WA 1II7A 3DW8C 1FJMA 1NNWA 2QJCA 3N5UA 4H1YP 4DSYA 5INBA 5J28A 2NXFA 3PSNA 3H62B 4TUIA 1JK7A 4ZVZA 4LACC 5DNYA 4OR9A 4O24A 1Z2XA 3QFNA 3AUZA 4ORBA 1TCOA 1S70A 2R17A 3H69A 3IB8A 3K7VC 4G9JA 2WDFA 3ICFA 1UTEA 3RL4A 4FBQA 4V0WA 1HO5A 5HPEA 3HVQA 2IAEC 3T1IA 4MOYA 1HP1A 4KBPA 4M0VA 3LL8A 3DSDA 2IE4C 2Z72A 3PSOA 4IYPC 3AV0A 1Z2WA 2ZO9B 4YKEA 1USHA 2HY1A 1OIEA 2O8GA 1SU1A 4I5LC 5B8IA 3QG5C 4JA9A 3H67A 4V0VA 2WDDA 1XZWA 2DFJA 4UT3B 2Q8UA 3V4YA 2HYOA 4H2GA 4IL1A 2HYPA 1WARA 5EQVA 4ZX2A 2AHDA 4KKZA 3RL5A 5JPEA 4FBKA 4DT2A 4LU9A 2O8AA 4H2IA 2IE3C 4HD0A 3E7AA 1XM7A 4H2FA 1QFCA 3H63A 3GVEA 1KBPA 3H60A 2A22A 4O4KA 5JJTA 1S3MA 4FBWA 4B2OA 4FCXA 2ZBMA 3EGHA 1OI8A 4DHLA 1MF8A 4TUGA 4O43A 4XPNA 4H2BA 2Z1AA 3ZTVA 2XMOA 3C9FA 1T70A 3DSCA 2CV9A 1T71A 2ZOAA 3IB7A 5JPFA 2JOGA 3THOB 1V73A 3JYFA 2DXNA 3THNA 4MP0A 2QFPA 2Z06A 3C5WC 3H68A 1W24A 1AUIA 2NYLC 4LTYA 4NZVA 2YEQA 3E7BA 3H61A 4JA7A 2P6BA 3QFMA 3FLOA 3QFOA 4O5GA 3D03A 5IOHA 1S3LA 4I5NC 4Q7FA 4J6OA 4V0XA 3FGAC 4F0ZA 4UT3A 1U32A 3IVEA 1S3NA 2NPPC 3EGGA 1S8EA 3K7WC 1IT6A 2BDXA 2BCDA 2QFRA 2BQ8X 3H66A 5C1VA 2GJUA 3QFKA 1UF3A 3IVDA 2YVTA 1S95A 4UT2A 3ZU0A 1WAO1 4WWLA 3H64A 4ORAA 5GTUA 3E0JA 3KBPA 4MOVA 2NYMC 2WDEA 3CK2A 4H1SA 4ORCA 1QHWA 3P71C 2DXLA 1G5BA 2USHA 3RQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWQ A;  2WDC A;  1HPU A;  2KKN A;  3TGH A;  1OID A;  3RL3 A;  1M63 A;  5F3W A;  1II7 A;  3DW8 C;  1FJM A;  1NNW A;  2QJC A;  3N5U A;  4H1Y P;  4DSY A;  5INB A;  5J28 A;  2NXF A;  3PSN A;  3H62 B;  4TUI A;  1JK7 A;  4ZVZ A;  4LAC C;  5DNY A;  4OR9 A;  4O24 A;  1Z2X A;  3QFN A;  3AUZ A;  4ORB A;  1TCO A;  1S70 A;  2R17 A;  3H69 A;  3IB8 A;  3K7V C;  4G9J A;  2WDF A;  3ICF A;  1UTE A;  3RL4 A;  4FBQ A;  4V0W A;  1HO5 A;  5HPE A;  3HVQ A;  2IAE C;  3T1I A;  4MOY A;  1HP1 A;  4KBP A;  4M0V A;  3LL8 A;  3DSD A;  2IE4 C;  2Z72 A;  3PSO A;  4IYP C;  3AV0 A;  1Z2W A;  4YKE A;  1USH A;  2HY1 A;  1OIE A;  2O8G A;  1SU1 A;  4I5L C;  5B8I A;  3QG5 C;  4JA9 A;  3H67 A;  4V0V A;  2WDD A;  1XZW A;  2DFJ A;  4UT3 B;  2Q8U A;  3V4Y A;  2HYO A;  4H2G A;  4IL1 A;  2HYP A;  1WAR A;  5EQV A;  4ZX2 A;  2AHD A;  4KKZ A;  3RL5 A;  5JPE A;  4FBK A;  4DT2 A;  4LU9 A;  2O8A A;  4H2I A;  2IE3 C;  4HD0 A;  3E7A A;  1XM7 A;  4H2F A;  1QFC A;  3H63 A;  3GVE A;  1KBP A;  3H60 A;  2A22 A;  4O4K A;  5JJT A;  1S3M A;  4FBW A;  4B2O A;  4FCX A;  2ZBM A;  3EGH A;  1OI8 A;  4DHL A;  1MF8 A;  4TUG A;  4O43 A;  4XPN A;  4H2B A;  2Z1A A;  3ZTV A;  2XMO A;  3C9F A;  1T70 A;  3DSC A;  2CV9 A;  1T71 A;  3IB7 A;  5JPF A;  2JOG A;  3THO B;  1V73 A;  3JYF A;  3THN A;  4MP0 A;  2QFP A;  2Z06 A;  3C5W C;  3H68 A;  1W24 A;  1AUI A;  2NYL C;  4LTY A;  4NZV A;  3E7B A;  3H61 A;  4JA7 A;  2P6B A;  3QFM A;  3QFO A;  4O5G A;  5IOH A;  1S3L A;  4I5N C;  4Q7F A;  4J6O A;  4V0X A;  3FGA C;  4F0Z A;  4UT3 A;  1U32 A;  3IVE A;  1S3N A;  2NPP C;  3EGG A;  1S8E A;  3K7W C;  1IT6 A;  2BDX A;  2BCD A;  2QFR A;  2BQ8 X;  3H66 A;  5C1V A;  2GJU A;  3QFK A;  1UF3 A;  3IVD A;  2YVT A;  1S95 A;  4UT2 A;  3ZU0 A;  1WAO 1;  4WWL A;  3H64 A;  4ORA A;  5GTU A;  3KBP A;  4MOV A;  2NYM C;  2WDE A;  3CK2 A;  4H1S A;  4ORC A;  1QHW A;  3P71 C;  1G5B A;  2USH A;  3RQZ A; 
#chains in the Genus database with same CATH topology
 4UWQ A;  2WDC A;  1HPU A;  2KKN A;  3TGH A;  1OID A;  3RL3 A;  1M63 A;  5F3W A;  1II7 A;  3DW8 C;  1FJM A;  1NNW A;  2QJC A;  3N5U A;  4H1Y P;  4DSY A;  5INB A;  5J28 A;  2NXF A;  3PSN A;  3H62 B;  4TUI A;  1JK7 A;  4ZVZ A;  4LAC C;  5DNY A;  4OR9 A;  4O24 A;  1Z2X A;  3QFN A;  3AUZ A;  4ORB A;  1TCO A;  1S70 A;  2R17 A;  3H69 A;  3IB8 A;  3K7V C;  4G9J A;  2WDF A;  3ICF A;  1UTE A;  3RL4 A;  4FBQ A;  4V0W A;  1HO5 A;  5HPE A;  3HVQ A;  2IAE C;  3T1I A;  4MOY A;  1HP1 A;  4KBP A;  4M0V A;  3LL8 A;  3DSD A;  2IE4 C;  2Z72 A;  3PSO A;  4IYP C;  3AV0 A;  1Z2W A;  2ZO9 B;  4YKE A;  1USH A;  2HY1 A;  1OIE A;  2O8G A;  1SU1 A;  4I5L C;  5B8I A;  3QG5 C;  4JA9 A;  3H67 A;  4V0V A;  2WDD A;  1XZW A;  2DFJ A;  4UT3 B;  2Q8U A;  3V4Y A;  2HYO A;  4H2G A;  4IL1 A;  2HYP A;  1WAR A;  5EQV A;  4ZX2 A;  2AHD A;  4KKZ A;  3RL5 A;  5JPE A;  4FBK A;  4DT2 A;  4LU9 A;  2O8A A;  4H2I A;  2IE3 C;  4HD0 A;  3E7A A;  1XM7 A;  4H2F A;  1QFC A;  3H63 A;  3GVE A;  1KBP A;  3H60 A;  2A22 A;  4O4K A;  5JJT A;  1S3M A;  4FBW A;  4B2O A;  4FCX A;  2ZBM A;  3EGH A;  1OI8 A;  4DHL A;  1MF8 A;  4TUG A;  4O43 A;  4XPN A;  4H2B A;  2Z1A A;  3ZTV A;  2XMO A;  3C9F A;  1T70 A;  3DSC A;  2CV9 A;  1T71 A;  2ZOA A;  3IB7 A;  5JPF A;  2JOG A;  3THO B;  1V73 A;  3JYF A;  2DXN A;  3THN A;  4MP0 A;  2QFP A;  2Z06 A;  3C5W C;  3H68 A;  1W24 A;  1AUI A;  2NYL C;  4LTY A;  4NZV A;  2YEQ A;  3E7B A;  3H61 A;  4JA7 A;  2P6B A;  3QFM A;  3FLO A;  3QFO A;  4O5G A;  3D03 A;  5IOH A;  1S3L A;  4I5N C;  4Q7F A;  4J6O A;  4V0X A;  3FGA C;  4F0Z A;  4UT3 A;  1U32 A;  3IVE A;  1S3N A;  2NPP C;  3EGG A;  1S8E A;  3K7W C;  1IT6 A;  2BDX A;  2BCD A;  2QFR A;  2BQ8 X;  3H66 A;  5C1V A;  2GJU A;  3QFK A;  1UF3 A;  3IVD A;  2YVT A;  1S95 A;  4UT2 A;  3ZU0 A;  1WAO 1;  4WWL A;  3H64 A;  4ORA A;  5GTU A;  3E0J A;  3KBP A;  4MOV A;  2NYM C;  2WDE A;  3CK2 A;  4H1S A;  4ORC A;  1QHW A;  3P71 C;  2DXL A;  1G5B A;  2USH A;  3RQZ A; 
#chains in the Genus database with same CATH homology
 4UWQ A;  2WDC A;  1HPU A;  2KKN A;  3TGH A;  1OID A;  3RL3 A;  1M63 A;  5F3W A;  1II7 A;  3DW8 C;  1FJM A;  1NNW A;  2QJC A;  3N5U A;  4H1Y P;  4DSY A;  5INB A;  5J28 A;  2NXF A;  3PSN A;  3H62 B;  4TUI A;  1JK7 A;  4ZVZ A;  4LAC C;  5DNY A;  4OR9 A;  4O24 A;  1Z2X A;  3QFN A;  3AUZ A;  4ORB A;  1TCO A;  1S70 A;  2R17 A;  3H69 A;  3IB8 A;  3K7V C;  4G9J A;  2WDF A;  3ICF A;  1UTE A;  3RL4 A;  4FBQ A;  4V0W A;  1HO5 A;  5HPE A;  3HVQ A;  2IAE C;  3T1I A;  4MOY A;  1HP1 A;  4KBP A;  4M0V A;  3LL8 A;  3DSD A;  2IE4 C;  2Z72 A;  3PSO A;  4IYP C;  3AV0 A;  1Z2W A;  2ZO9 B;  4YKE A;  1USH A;  2HY1 A;  1OIE A;  2O8G A;  1SU1 A;  4I5L C;  5B8I A;  3QG5 C;  4JA9 A;  3H67 A;  4V0V A;  2WDD A;  1XZW A;  2DFJ A;  4UT3 B;  2Q8U A;  3V4Y A;  2HYO A;  4H2G A;  4IL1 A;  2HYP A;  1WAR A;  5EQV A;  4ZX2 A;  2AHD A;  4KKZ A;  3RL5 A;  5JPE A;  4FBK A;  4DT2 A;  4LU9 A;  2O8A A;  4H2I A;  2IE3 C;  4HD0 A;  3E7A A;  1XM7 A;  4H2F A;  1QFC A;  3H63 A;  3GVE A;  1KBP A;  3H60 A;  2A22 A;  4O4K A;  5JJT A;  1S3M A;  4FBW A;  4B2O A;  4FCX A;  2ZBM A;  3EGH A;  1OI8 A;  4DHL A;  1MF8 A;  4TUG A;  4O43 A;  4XPN A;  4H2B A;  2Z1A A;  3ZTV A;  2XMO A;  3C9F A;  1T70 A;  3DSC A;  2CV9 A;  1T71 A;  2ZOA A;  3IB7 A;  5JPF A;  2JOG A;  3THO B;  1V73 A;  3JYF A;  2DXN A;  3THN A;  4MP0 A;  2QFP A;  2Z06 A;  3C5W C;  3H68 A;  1W24 A;  1AUI A;  2NYL C;  4LTY A;  4NZV A;  2YEQ A;  3E7B A;  3H61 A;  4JA7 A;  2P6B A;  3QFM A;  3FLO A;  3QFO A;  4O5G A;  3D03 A;  5IOH A;  1S3L A;  4I5N C;  4Q7F A;  4J6O A;  4V0X A;  3FGA C;  4F0Z A;  4UT3 A;  1U32 A;  3IVE A;  1S3N A;  2NPP C;  3EGG A;  1S8E A;  3K7W C;  1IT6 A;  2BDX A;  2BCD A;  2QFR A;  2BQ8 X;  3H66 A;  5C1V A;  2GJU A;  3QFK A;  1UF3 A;  3IVD A;  2YVT A;  1S95 A;  4UT2 A;  3ZU0 A;  1WAO 1;  4WWL A;  3H64 A;  4ORA A;  5GTU A;  3E0J A;  3KBP A;  4MOV A;  2NYM C;  2WDE A;  3CK2 A;  4H1S A;  4ORC A;  1QHW A;  3P71 C;  2DXL A;  1G5B A;  2USH A;  3RQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...