3N5UA

Crystal structure of an rb c-terminal peptide bound to the catalytic subunit of pp1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title An overlapping kinase and phosphatase docking site regulates activity of the retinoblastoma protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, transcription regulation
total genus 103
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3n5uA00
1M63A 3IVEA 1TCOA 2ZBMA 1HO5A 2QJCA 3H66A 3QFNA 3TGHA 1QFCA 2BDXA 1USHA 5JJTA 1UTEA 3H60A 1UF3A 2HYPA 3GVEA 1IT6A 3THNA 2BCDA 2P6BA 4O43A 3RL3A 5C1VA 1S3MA 1V73A 4WWLA 2A22A 2IAEC 4MOVA 3QFKA 1S8EA 1AUIA 2Q8UA 4FBKA 5HPEA 3C9FA 3H63A 2GJUA 2BQ8X 2NPPC 1HP1A 2HYOA 4I5LC 3JYFA 5J28A 4ORBA 4ZVZA 3H64A 3AUZA 3E7BA 5JPFA 1WARA 4O5GA 4TUIA 2NYLC 4V0VA 4KKZA 5EQVA 3IB8A 1S95A 3PSNA 4J6OA 4DHLA 3K7WC 3EGHA 4FBQA 1Z2XA 2IE4C 2Z06A 3IB7A 4IL1A 3ZTVA 1S3LA 1XM7A 4UT3B 4LTYA 3DSCA 4M0VA 4JA9A 4H1YP 5GTUA 2WDEA 4H2GA 3V4YA 2QFPA 4IYPC 4OR9A 1QHWA 4O24A 2USHA 2CV9A 4ORCA 4B2OA 1KBPA 3HVQA 4H2IA 3EGGA 3AV0A 4G9JA 4KBPA 5INBA 1XZWA 1S3NA 1WAO1 2NYMC 2JOGA 4I5NC 3QFOA 2KKNA 2HY1A 2Z72A 3H69A 3RL4A 3QFMA 4F0ZA 2WDFA 4DT2A 1NNWA 4V0XA 2O8AA 4UWQA 3KBPA 4Q7FA 1HPUA 4O4KA 4DSYA 3IVDA 4JA7A 4UT3A 4UT2A 4FBWA 2Z1AA 1OIEA 4MP0A 4TUGA 4H2BA 3K7VC 5DNYA 1W24A 3PSOA 1Z2WA 3LL8A 4HD0A 3FGAC 4H1SA 3H68A 2XMOA 1U32A 3H61A 2WDCA 3E7AA 4LU9A 4ORAA 1OI8A 2R17A 5B8IA 3ZU0A 3T1IA 2AHDA 2NXFA 3CK2A 4ZX2A 1OIDA 1T71A 2YVTA 3H62B 4YKEA 1T70A 2O8GA 3RQZA 3RL5A 2DFJA 3DW8C 3P71C 1JK7A 1II7A 1S70A 3ICFA 4V0WA 5JPEA 4FCXA 4MOYA 2IE3C 4LACC 3THOB 5IOHA 1SU1A 2WDDA 3H67A 2QFRA 3QG5C 5F3WA 4H2FA 4NZVA 3N5UA 4XPNA 1FJMA 1MF8A 3DSDA 3C5WC 1G5BA
chains in the Genus database with same CATH superfamily
1M63A 3D03A 1TCOA 2ZBMA 1HO5A 2QJCA 3H66A 3IVEA 3QFNA 1QFCA 2BDXA 1USHA 3TGHA 5JJTA 1UTEA 3H60A 1UF3A 2HYPA 3GVEA 1IT6A 3THNA 2BCDA 2P6BA 4O43A 3RL3A 5C1VA 1S3MA 1V73A 4WWLA 2A22A 2IAEC 4MOVA 3QFKA 1S8EA 1AUIA 2Q8UA 4FBKA 5HPEA 3C9FA 3H63A 2GJUA 2BQ8X 2NPPC 1HP1A 2HYOA 4I5LC 3FLOA 2ZO9B 3JYFA 5J28A 4ORBA 4ZVZA 3H64A 3AUZA 3E7BA 5JPFA 1WARA 4O5GA 4TUIA 2NYLC 4V0VA 4KKZA 5EQVA 3IB8A 1S95A 3PSNA 4J6OA 4DHLA 3K7WC 3EGHA 4FBQA 1Z2XA 2IE4C 2Z06A 3IB7A 4IL1A 3ZTVA 1S3LA 1XM7A 4UT3B 2YEQA 4LTYA 3DSCA 4M0VA 2DXLA 4JA9A 4H1YP 5GTUA 2WDEA 4H2GA 3V4YA 2QFPA 4IYPC 4OR9A 1QHWA 4O24A 2USHA 2CV9A 4ORCA 4B2OA 1KBPA 3HVQA 4H2IA 3EGGA 3AV0A 4G9JA 4KBPA 5INBA 1XZWA 1S3NA 1WAO1 2NYMC 2JOGA 4I5NC 3QFOA 2KKNA 2HY1A 2Z72A 3H69A 3RL4A 3QFMA 4F0ZA 2WDFA 4DT2A 1NNWA 4V0XA 2O8AA 4UWQA 3KBPA 4Q7FA 1HPUA 4O4KA 4DSYA 3IVDA 4JA7A 2ZOAA 4UT3A 4UT2A 4FBWA 2Z1AA 1OIEA 4MP0A 4TUGA 4H2BA 3K7VC 5DNYA 1W24A 3PSOA 1Z2WA 3LL8A 4HD0A 3FGAC 4H1SA 3H68A 2XMOA 1U32A 3H61A 2WDCA 3E7AA 4LU9A 4ORAA 1OI8A 2R17A 5B8IA 3ZU0A 3T1IA 2AHDA 2NXFA 3CK2A 4ZX2A 1OIDA 1T71A 2YVTA 3H62B 4YKEA 1T70A 3E0JA 2O8GA 3RQZA 3RL5A 2DFJA 3DW8C 3P71C 1JK7A 1II7A 1S70A 3ICFA 4V0WA 5JPEA 4FCXA 4MOYA 2IE3C 2DXNA 4LACC 3THOB 5IOHA 1SU1A 2WDDA 3H67A 2QFRA 3QG5C 5F3WA 4H2FA 4NZVA 3N5UA 4XPNA 1FJMA 1MF8A 3DSDA 3C5WC 1G5BA
chains in the Genus database with same CATH topology
1M63A 3D03A 1TCOA 2ZBMA 1HO5A 2QJCA 3H66A 3IVEA 3QFNA 1QFCA 2BDXA 1USHA 3TGHA 5JJTA 1UTEA 3H60A 1UF3A 2HYPA 3GVEA 1IT6A 3THNA 2BCDA 2P6BA 4O43A 3RL3A 5C1VA 1S3MA 1V73A 4WWLA 2A22A 2IAEC 4MOVA 3QFKA 1S8EA 1AUIA 2Q8UA 4FBKA 5HPEA 3C9FA 3H63A 2GJUA 2BQ8X 2NPPC 1HP1A 2HYOA 4I5LC 3FLOA 2ZO9B 3JYFA 5J28A 4ORBA 4ZVZA 3H64A 3AUZA 3E7BA 5JPFA 1WARA 4O5GA 4TUIA 2NYLC 4V0VA 4KKZA 5EQVA 3IB8A 1S95A 3PSNA 4J6OA 4DHLA 3K7WC 3EGHA 4FBQA 1Z2XA 2IE4C 2Z06A 3IB7A 4IL1A 3ZTVA 1S3LA 1XM7A 4UT3B 2YEQA 4LTYA 3DSCA 4M0VA 2DXLA 4JA9A 4H1YP 5GTUA 2WDEA 4H2GA 3V4YA 2QFPA 4IYPC 4OR9A 1QHWA 4O24A 2USHA 2CV9A 4ORCA 4B2OA 1KBPA 3HVQA 4H2IA 3EGGA 3AV0A 4G9JA 4KBPA 5INBA 1XZWA 1S3NA 1WAO1 2NYMC 2JOGA 4I5NC 3QFOA 2KKNA 2HY1A 2Z72A 3H69A 3RL4A 3QFMA 4F0ZA 2WDFA 4DT2A 1NNWA 4V0XA 2O8AA 4UWQA 3KBPA 4Q7FA 1HPUA 4O4KA 4DSYA 3IVDA 4JA7A 2ZOAA 4UT3A 4UT2A 4FBWA 2Z1AA 1OIEA 4MP0A 4TUGA 4H2BA 3K7VC 5DNYA 1W24A 3PSOA 1Z2WA 3LL8A 4HD0A 3FGAC 4H1SA 3H68A 2XMOA 1U32A 3H61A 2WDCA 3E7AA 4LU9A 4ORAA 1OI8A 2R17A 5B8IA 3ZU0A 3T1IA 2AHDA 2NXFA 3CK2A 4ZX2A 1OIDA 1T71A 2YVTA 3H62B 4YKEA 1T70A 3E0JA 2O8GA 3RQZA 3RL5A 2DFJA 3DW8C 3P71C 1JK7A 1II7A 1S70A 3ICFA 4V0WA 5JPEA 4FCXA 4MOYA 2IE3C 2DXNA 4LACC 3THOB 5IOHA 1SU1A 2WDDA 3H67A 2QFRA 3QG5C 5F3WA 4H2FA 4NZVA 3N5UA 4XPNA 1FJMA 1MF8A 3DSDA 3C5WC 1G5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M63 A;  3IVE A;  1TCO A;  2ZBM A;  1HO5 A;  2QJC A;  3H66 A;  3QFN A;  3TGH A;  1QFC A;  2BDX A;  1USH A;  5JJT A;  1UTE A;  3H60 A;  1UF3 A;  2HYP A;  3GVE A;  1IT6 A;  3THN A;  2BCD A;  2P6B A;  4O43 A;  3RL3 A;  5C1V A;  1S3M A;  1V73 A;  4WWL A;  2A22 A;  2IAE C;  4MOV A;  3QFK A;  1S8E A;  1AUI A;  2Q8U A;  4FBK A;  5HPE A;  3C9F A;  3H63 A;  2GJU A;  2BQ8 X;  2NPP C;  1HP1 A;  2HYO A;  4I5L C;  3JYF A;  5J28 A;  4ORB A;  4ZVZ A;  3H64 A;  3AUZ A;  3E7B A;  5JPF A;  1WAR A;  4O5G A;  4TUI A;  2NYL C;  4V0V A;  4KKZ A;  5EQV A;  3IB8 A;  1S95 A;  3PSN A;  4J6O A;  4DHL A;  3K7W C;  3EGH A;  4FBQ A;  1Z2X A;  2IE4 C;  2Z06 A;  3IB7 A;  4IL1 A;  3ZTV A;  1S3L A;  1XM7 A;  4UT3 B;  4LTY A;  3DSC A;  4M0V A;  4JA9 A;  4H1Y P;  5GTU A;  2WDE A;  4H2G A;  3V4Y A;  2QFP A;  4IYP C;  4OR9 A;  1QHW A;  4O24 A;  2USH A;  2CV9 A;  4ORC A;  4B2O A;  1KBP A;  3HVQ A;  4H2I A;  3EGG A;  3AV0 A;  4G9J A;  4KBP A;  5INB A;  1XZW A;  1S3N A;  1WAO 1;  2NYM C;  2JOG A;  4I5N C;  3QFO A;  2KKN A;  2HY1 A;  2Z72 A;  3H69 A;  3RL4 A;  3QFM A;  4F0Z A;  2WDF A;  4DT2 A;  1NNW A;  4V0X A;  2O8A A;  4UWQ A;  3KBP A;  4Q7F A;  1HPU A;  4O4K A;  4DSY A;  3IVD A;  4JA7 A;  4UT3 A;  4UT2 A;  4FBW A;  2Z1A A;  1OIE A;  4MP0 A;  4TUG A;  4H2B A;  3K7V C;  5DNY A;  1W24 A;  3PSO A;  1Z2W A;  3LL8 A;  4HD0 A;  3FGA C;  4H1S A;  3H68 A;  2XMO A;  1U32 A;  3H61 A;  2WDC A;  3E7A A;  4LU9 A;  4ORA A;  1OI8 A;  2R17 A;  5B8I A;  3ZU0 A;  3T1I A;  2AHD A;  2NXF A;  3CK2 A;  4ZX2 A;  1OID A;  1T71 A;  2YVT A;  3H62 B;  4YKE A;  1T70 A;  2O8G A;  3RQZ A;  3RL5 A;  2DFJ A;  3DW8 C;  3P71 C;  1JK7 A;  1II7 A;  1S70 A;  3ICF A;  4V0W A;  5JPE A;  4FCX A;  4MOY A;  2IE3 C;  4LAC C;  3THO B;  5IOH A;  1SU1 A;  2WDD A;  3H67 A;  2QFR A;  3QG5 C;  5F3W A;  4H2F A;  4NZV A;  3N5U A;  4XPN A;  1FJM A;  1MF8 A;  3DSD A;  3C5W C;  1G5B A; 
#chains in the Genus database with same CATH topology
 1M63 A;  3D03 A;  1TCO A;  2ZBM A;  1HO5 A;  2QJC A;  3H66 A;  3IVE A;  3QFN A;  1QFC A;  2BDX A;  1USH A;  3TGH A;  5JJT A;  1UTE A;  3H60 A;  1UF3 A;  2HYP A;  3GVE A;  1IT6 A;  3THN A;  2BCD A;  2P6B A;  4O43 A;  3RL3 A;  5C1V A;  1S3M A;  1V73 A;  4WWL A;  2A22 A;  2IAE C;  4MOV A;  3QFK A;  1S8E A;  1AUI A;  2Q8U A;  4FBK A;  5HPE A;  3C9F A;  3H63 A;  2GJU A;  2BQ8 X;  2NPP C;  1HP1 A;  2HYO A;  4I5L C;  3FLO A;  2ZO9 B;  3JYF A;  5J28 A;  4ORB A;  4ZVZ A;  3H64 A;  3AUZ A;  3E7B A;  5JPF A;  1WAR A;  4O5G A;  4TUI A;  2NYL C;  4V0V A;  4KKZ A;  5EQV A;  3IB8 A;  1S95 A;  3PSN A;  4J6O A;  4DHL A;  3K7W C;  3EGH A;  4FBQ A;  1Z2X A;  2IE4 C;  2Z06 A;  3IB7 A;  4IL1 A;  3ZTV A;  1S3L A;  1XM7 A;  4UT3 B;  2YEQ A;  4LTY A;  3DSC A;  4M0V A;  2DXL A;  4JA9 A;  4H1Y P;  5GTU A;  2WDE A;  4H2G A;  3V4Y A;  2QFP A;  4IYP C;  4OR9 A;  1QHW A;  4O24 A;  2USH A;  2CV9 A;  4ORC A;  4B2O A;  1KBP A;  3HVQ A;  4H2I A;  3EGG A;  3AV0 A;  4G9J A;  4KBP A;  5INB A;  1XZW A;  1S3N A;  1WAO 1;  2NYM C;  2JOG A;  4I5N C;  3QFO A;  2KKN A;  2HY1 A;  2Z72 A;  3H69 A;  3RL4 A;  3QFM A;  4F0Z A;  2WDF A;  4DT2 A;  1NNW A;  4V0X A;  2O8A A;  4UWQ A;  3KBP A;  4Q7F A;  1HPU A;  4O4K A;  4DSY A;  3IVD A;  4JA7 A;  2ZOA A;  4UT3 A;  4UT2 A;  4FBW A;  2Z1A A;  1OIE A;  4MP0 A;  4TUG A;  4H2B A;  3K7V C;  5DNY A;  1W24 A;  3PSO A;  1Z2W A;  3LL8 A;  4HD0 A;  3FGA C;  4H1S A;  3H68 A;  2XMO A;  1U32 A;  3H61 A;  2WDC A;  3E7A A;  4LU9 A;  4ORA A;  1OI8 A;  2R17 A;  5B8I A;  3ZU0 A;  3T1I A;  2AHD A;  2NXF A;  3CK2 A;  4ZX2 A;  1OID A;  1T71 A;  2YVT A;  3H62 B;  4YKE A;  1T70 A;  3E0J A;  2O8G A;  3RQZ A;  3RL5 A;  2DFJ A;  3DW8 C;  3P71 C;  1JK7 A;  1II7 A;  1S70 A;  3ICF A;  4V0W A;  5JPE A;  4FCX A;  4MOY A;  2IE3 C;  2DXN A;  4LAC C;  3THO B;  5IOH A;  1SU1 A;  2WDD A;  3H67 A;  2QFR A;  3QG5 C;  5F3W A;  4H2F A;  4NZV A;  3N5U A;  4XPN A;  1FJM A;  1MF8 A;  3DSD A;  3C5W C;  1G5B A; 
#chains in the Genus database with same CATH homology
 1M63 A;  3D03 A;  1TCO A;  2ZBM A;  1HO5 A;  2QJC A;  3H66 A;  3IVE A;  3QFN A;  1QFC A;  2BDX A;  1USH A;  3TGH A;  5JJT A;  1UTE A;  3H60 A;  1UF3 A;  2HYP A;  3GVE A;  1IT6 A;  3THN A;  2BCD A;  2P6B A;  4O43 A;  3RL3 A;  5C1V A;  1S3M A;  1V73 A;  4WWL A;  2A22 A;  2IAE C;  4MOV A;  3QFK A;  1S8E A;  1AUI A;  2Q8U A;  4FBK A;  5HPE A;  3C9F A;  3H63 A;  2GJU A;  2BQ8 X;  2NPP C;  1HP1 A;  2HYO A;  4I5L C;  3FLO A;  2ZO9 B;  3JYF A;  5J28 A;  4ORB A;  4ZVZ A;  3H64 A;  3AUZ A;  3E7B A;  5JPF A;  1WAR A;  4O5G A;  4TUI A;  2NYL C;  4V0V A;  4KKZ A;  5EQV A;  3IB8 A;  1S95 A;  3PSN A;  4J6O A;  4DHL A;  3K7W C;  3EGH A;  4FBQ A;  1Z2X A;  2IE4 C;  2Z06 A;  3IB7 A;  4IL1 A;  3ZTV A;  1S3L A;  1XM7 A;  4UT3 B;  2YEQ A;  4LTY A;  3DSC A;  4M0V A;  2DXL A;  4JA9 A;  4H1Y P;  5GTU A;  2WDE A;  4H2G A;  3V4Y A;  2QFP A;  4IYP C;  4OR9 A;  1QHW A;  4O24 A;  2USH A;  2CV9 A;  4ORC A;  4B2O A;  1KBP A;  3HVQ A;  4H2I A;  3EGG A;  3AV0 A;  4G9J A;  4KBP A;  5INB A;  1XZW A;  1S3N A;  1WAO 1;  2NYM C;  2JOG A;  4I5N C;  3QFO A;  2KKN A;  2HY1 A;  2Z72 A;  3H69 A;  3RL4 A;  3QFM A;  4F0Z A;  2WDF A;  4DT2 A;  1NNW A;  4V0X A;  2O8A A;  4UWQ A;  3KBP A;  4Q7F A;  1HPU A;  4O4K A;  4DSY A;  3IVD A;  4JA7 A;  2ZOA A;  4UT3 A;  4UT2 A;  4FBW A;  2Z1A A;  1OIE A;  4MP0 A;  4TUG A;  4H2B A;  3K7V C;  5DNY A;  1W24 A;  3PSO A;  1Z2W A;  3LL8 A;  4HD0 A;  3FGA C;  4H1S A;  3H68 A;  2XMO A;  1U32 A;  3H61 A;  2WDC A;  3E7A A;  4LU9 A;  4ORA A;  1OI8 A;  2R17 A;  5B8I A;  3ZU0 A;  3T1I A;  2AHD A;  2NXF A;  3CK2 A;  4ZX2 A;  1OID A;  1T71 A;  2YVT A;  3H62 B;  4YKE A;  1T70 A;  3E0J A;  2O8G A;  3RQZ A;  3RL5 A;  2DFJ A;  3DW8 C;  3P71 C;  1JK7 A;  1II7 A;  1S70 A;  3ICF A;  4V0W A;  5JPE A;  4FCX A;  4MOY A;  2IE3 C;  2DXN A;  4LAC C;  3THO B;  5IOH A;  1SU1 A;  2WDD A;  3H67 A;  2QFR A;  3QG5 C;  5F3W A;  4H2F A;  4NZV A;  3N5U A;  4XPN A;  1FJM A;  1MF8 A;  3DSD A;  3C5W C;  1G5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...