3N5UA

Crystal structure of an rb c-terminal peptide bound to the catalytic subunit of pp1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An overlapping kinase and phosphatase docking site regulates activity of the retinoblastoma protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, transcription regulation
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 103
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3n5uA00
1AUIA 3H62B 2R17A 2NYLC 2P6BA 5GTUA 2QFRA 5DNYA 4M0VA 3C5WC 3C9FA 1USHA 1W24A 3T1IA 1OIDA 1UF3A 5INBA 4KBPA 4ORCA 2Z72A 3KBPA 2A22A 1U32A 4FBQA 4B2OA 4UT3B 2BQ8X 3AUZA 4OR9A 4H1YP 3RL5A 2NYMC 2AHDA 5B8IA 4O5GA 4H1SA 3H64A 4I5NC 4ORBA 2Q8UA 1II7A 1S95A 4F0ZA 3FGAC 2ZBMA 3IB8A 3V4YA 1WAO1 2BDXA 4XPNA 4DSYA 3H68A 4UWQA 2HYPA 1S3NA 4WWLA 3PSNA 2O8AA 4LACC 3H61A 3RL3A 3H69A 4DT2A 4O4KA 2NXFA 3PSOA 1S3MA 3H67A 4I5LC 4MOVA 3TGHA 3QG5C 4TUIA 3QFOA 1QHWA 3GVEA 3DSCA 4IL1A 3ICFA 3N5UA 2QFPA 4V0XA 3THOB 1WARA 3H63A 5IOHA 1Z2XA 1UTEA 4DHLA 1T70A 4V0VA 4UT2A 1HPUA 2IE3C 2BCDA 4G9JA 3RL4A 5J28A 1Z2WA 2QJCA 2WDEA 3E7AA 4FBWA 3THNA 3QFNA 2Z1AA 2NPPC 5EQVA 4ORAA 2JOGA 3IB7A 1G5BA 2KKNA 1HO5A 1QFCA 3CK2A 4KKZA 3QFMA 2IAEC 3P71C 3K7WC 3IVDA 3K7VC 1V73A 2WDDA 2XMOA 3AV0A 3DW8C 4NZVA 4J6OA 2DFJA 1S70A 2WDCA 3EGGA 2GJUA 5C1VA 5HPEA 1M63A 5F3WA 4MOYA 3ZTVA 3LL8A 4MP0A 1JK7A 4TUGA 1S8EA 1T71A 4H2IA 4ZX2A 2Z06A 1KBPA 4JA9A 2HY1A 3RQZA 2HYOA 1HP1A 3QFKA 1TCOA 1NNWA 2WDFA 4H2BA 4H2GA 1S3LA 1IT6A 4LTYA 2CV9A 3H66A 2YVTA 3IVEA 4IYPC 4V0WA 4UT3A 3H60A 3ZU0A 2O8GA 4YKEA 2IE4C 4LU9A 4ZVZA 3DSDA 4FCXA 1XM7A 5JPEA 1XZWA 1OI8A 4HD0A 4O24A 4FBKA 3HVQA 5JJTA 3E7BA 3EGHA 1SU1A 3JYFA 4H2FA 4JA7A 5JPFA 4Q7FA 1OIEA 1FJMA 4O43A 1MF8A 2USHA
chains in the Genus database with same CATH superfamily
1AUIA 3H62B 2R17A 2NYLC 2P6BA 5GTUA 2QFRA 5DNYA 4M0VA 3C5WC 3C9FA 1USHA 1W24A 3T1IA 1OIDA 1UF3A 5INBA 4KBPA 4ORCA 2Z72A 3KBPA 2A22A 1U32A 4FBQA 4B2OA 4UT3B 2BQ8X 3AUZA 4OR9A 4H1YP 3RL5A 2NYMC 2AHDA 5B8IA 4O5GA 4H1SA 3H64A 2DXLA 3D03A 4I5NC 4ORBA 2Q8UA 1II7A 1S95A 4F0ZA 3FGAC 2ZBMA 3IB8A 3V4YA 1WAO1 2BDXA 4XPNA 4DSYA 3H68A 4UWQA 2HYPA 1S3NA 4WWLA 3PSNA 3FLOA 2O8AA 4LACC 3H61A 3RL3A 3H69A 4DT2A 4O4KA 2NXFA 3PSOA 1S3MA 3H67A 4I5LC 4MOVA 3TGHA 3QG5C 4TUIA 3QFOA 1QHWA 3GVEA 3DSCA 4IL1A 3ICFA 3N5UA 2QFPA 4V0XA 3THOB 1WARA 3H63A 5IOHA 1Z2XA 1UTEA 4DHLA 1T70A 4V0VA 4UT2A 1HPUA 2IE3C 3E0JA 2BCDA 4G9JA 3RL4A 5J28A 1Z2WA 2QJCA 2WDEA 3E7AA 4FBWA 3THNA 3QFNA 2Z1AA 2NPPC 5EQVA 4ORAA 2JOGA 3IB7A 1G5BA 2KKNA 2ZOAA 1HO5A 1QFCA 3CK2A 4KKZA 3QFMA 2IAEC 3P71C 3K7WC 3IVDA 3K7VC 1V73A 2WDDA 2XMOA 3AV0A 3DW8C 4NZVA 4J6OA 2DFJA 1S70A 2WDCA 3EGGA 2GJUA 5C1VA 5HPEA 1M63A 2YEQA 5F3WA 4MOYA 3ZTVA 3LL8A 4MP0A 1JK7A 4TUGA 1S8EA 1T71A 4H2IA 4ZX2A 2Z06A 1KBPA 4JA9A 2HY1A 3RQZA 2HYOA 1HP1A 3QFKA 1TCOA 1NNWA 2WDFA 4H2BA 4H2GA 1S3LA 1IT6A 4LTYA 2CV9A 3H66A 2YVTA 3IVEA 4IYPC 4V0WA 4UT3A 3H60A 3ZU0A 2O8GA 4YKEA 2IE4C 4LU9A 2DXNA 4ZVZA 3DSDA 4FCXA 1XM7A 2ZO9B 5JPEA 1XZWA 1OI8A 4HD0A 4O24A 4FBKA 3HVQA 5JJTA 3E7BA 3EGHA 1SU1A 3JYFA 4H2FA 4JA7A 5JPFA 4Q7FA 1OIEA 1FJMA 4O43A 1MF8A 2USHA
chains in the Genus database with same CATH topology
1AUIA 3H62B 2R17A 2NYLC 2P6BA 5GTUA 2QFRA 5DNYA 4M0VA 3C5WC 3C9FA 1USHA 1W24A 3T1IA 1OIDA 1UF3A 5INBA 4KBPA 4ORCA 2Z72A 3KBPA 2A22A 1U32A 4FBQA 4B2OA 4UT3B 2BQ8X 3AUZA 4OR9A 4H1YP 3RL5A 2NYMC 2AHDA 5B8IA 4O5GA 4H1SA 3H64A 2DXLA 3D03A 4I5NC 4ORBA 2Q8UA 1II7A 1S95A 4F0ZA 3FGAC 2ZBMA 3IB8A 3V4YA 1WAO1 2BDXA 4XPNA 4DSYA 3H68A 4UWQA 2HYPA 1S3NA 4WWLA 3PSNA 3FLOA 2O8AA 4LACC 3H61A 3RL3A 3H69A 4DT2A 4O4KA 2NXFA 3PSOA 1S3MA 3H67A 4I5LC 4MOVA 3TGHA 3QG5C 4TUIA 3QFOA 1QHWA 3GVEA 3DSCA 4IL1A 3ICFA 3N5UA 2QFPA 4V0XA 3THOB 1WARA 3H63A 5IOHA 1Z2XA 1UTEA 4DHLA 1T70A 4V0VA 4UT2A 1HPUA 2IE3C 3E0JA 2BCDA 4G9JA 3RL4A 5J28A 1Z2WA 2QJCA 2WDEA 3E7AA 4FBWA 3THNA 3QFNA 2Z1AA 2NPPC 5EQVA 4ORAA 2JOGA 3IB7A 1G5BA 2KKNA 2ZOAA 1HO5A 1QFCA 3CK2A 4KKZA 3QFMA 2IAEC 3P71C 3K7WC 3IVDA 3K7VC 1V73A 2WDDA 2XMOA 3AV0A 3DW8C 4NZVA 4J6OA 2DFJA 1S70A 2WDCA 3EGGA 2GJUA 5C1VA 5HPEA 1M63A 2YEQA 5F3WA 4MOYA 3ZTVA 3LL8A 4MP0A 1JK7A 4TUGA 1S8EA 1T71A 4H2IA 4ZX2A 2Z06A 1KBPA 4JA9A 2HY1A 3RQZA 2HYOA 1HP1A 3QFKA 1TCOA 1NNWA 2WDFA 4H2BA 4H2GA 1S3LA 1IT6A 4LTYA 2CV9A 3H66A 2YVTA 3IVEA 4IYPC 4V0WA 4UT3A 3H60A 3ZU0A 2O8GA 4YKEA 2IE4C 4LU9A 2DXNA 4ZVZA 3DSDA 4FCXA 1XM7A 2ZO9B 5JPEA 1XZWA 1OI8A 4HD0A 4O24A 4FBKA 3HVQA 5JJTA 3E7BA 3EGHA 1SU1A 3JYFA 4H2FA 4JA7A 5JPFA 4Q7FA 1OIEA 1FJMA 4O43A 1MF8A 2USHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUI A;  3H62 B;  2R17 A;  2NYL C;  2P6B A;  5GTU A;  2QFR A;  5DNY A;  4M0V A;  3C5W C;  3C9F A;  1USH A;  1W24 A;  3T1I A;  1OID A;  1UF3 A;  5INB A;  4KBP A;  4ORC A;  2Z72 A;  3KBP A;  2A22 A;  1U32 A;  4FBQ A;  4B2O A;  4UT3 B;  2BQ8 X;  3AUZ A;  4OR9 A;  4H1Y P;  3RL5 A;  2NYM C;  2AHD A;  5B8I A;  4O5G A;  4H1S A;  3H64 A;  4I5N C;  4ORB A;  2Q8U A;  1II7 A;  1S95 A;  4F0Z A;  3FGA C;  2ZBM A;  3IB8 A;  3V4Y A;  1WAO 1;  2BDX A;  4XPN A;  4DSY A;  3H68 A;  4UWQ A;  2HYP A;  1S3N A;  4WWL A;  3PSN A;  2O8A A;  4LAC C;  3H61 A;  3RL3 A;  3H69 A;  4DT2 A;  4O4K A;  2NXF A;  3PSO A;  1S3M A;  3H67 A;  4I5L C;  4MOV A;  3TGH A;  3QG5 C;  4TUI A;  3QFO A;  1QHW A;  3GVE A;  3DSC A;  4IL1 A;  3ICF A;  3N5U A;  2QFP A;  4V0X A;  3THO B;  1WAR A;  3H63 A;  5IOH A;  1Z2X A;  1UTE A;  4DHL A;  1T70 A;  4V0V A;  4UT2 A;  1HPU A;  2IE3 C;  2BCD A;  4G9J A;  3RL4 A;  5J28 A;  1Z2W A;  2QJC A;  2WDE A;  3E7A A;  4FBW A;  3THN A;  3QFN A;  2Z1A A;  2NPP C;  5EQV A;  4ORA A;  2JOG A;  3IB7 A;  1G5B A;  2KKN A;  1HO5 A;  1QFC A;  3CK2 A;  4KKZ A;  3QFM A;  2IAE C;  3P71 C;  3K7W C;  3IVD A;  3K7V C;  1V73 A;  2WDD A;  2XMO A;  3AV0 A;  3DW8 C;  4NZV A;  4J6O A;  2DFJ A;  1S70 A;  2WDC A;  3EGG A;  2GJU A;  5C1V A;  5HPE A;  1M63 A;  5F3W A;  4MOY A;  3ZTV A;  3LL8 A;  4MP0 A;  1JK7 A;  4TUG A;  1S8E A;  1T71 A;  4H2I A;  4ZX2 A;  2Z06 A;  1KBP A;  4JA9 A;  2HY1 A;  3RQZ A;  2HYO A;  1HP1 A;  3QFK A;  1TCO A;  1NNW A;  2WDF A;  4H2B A;  4H2G A;  1S3L A;  1IT6 A;  4LTY A;  2CV9 A;  3H66 A;  2YVT A;  3IVE A;  4IYP C;  4V0W A;  4UT3 A;  3H60 A;  3ZU0 A;  2O8G A;  4YKE A;  2IE4 C;  4LU9 A;  4ZVZ A;  3DSD A;  4FCX A;  1XM7 A;  5JPE A;  1XZW A;  1OI8 A;  4HD0 A;  4O24 A;  4FBK A;  3HVQ A;  5JJT A;  3E7B A;  3EGH A;  1SU1 A;  3JYF A;  4H2F A;  4JA7 A;  5JPF A;  4Q7F A;  1OIE A;  1FJM A;  4O43 A;  1MF8 A;  2USH A; 
#chains in the Genus database with same CATH topology
 1AUI A;  3H62 B;  2R17 A;  2NYL C;  2P6B A;  5GTU A;  2QFR A;  5DNY A;  4M0V A;  3C5W C;  3C9F A;  1USH A;  1W24 A;  3T1I A;  1OID A;  1UF3 A;  5INB A;  4KBP A;  4ORC A;  2Z72 A;  3KBP A;  2A22 A;  1U32 A;  4FBQ A;  4B2O A;  4UT3 B;  2BQ8 X;  3AUZ A;  4OR9 A;  4H1Y P;  3RL5 A;  2NYM C;  2AHD A;  5B8I A;  4O5G A;  4H1S A;  3H64 A;  2DXL A;  3D03 A;  4I5N C;  4ORB A;  2Q8U A;  1II7 A;  1S95 A;  4F0Z A;  3FGA C;  2ZBM A;  3IB8 A;  3V4Y A;  1WAO 1;  2BDX A;  4XPN A;  4DSY A;  3H68 A;  4UWQ A;  2HYP A;  1S3N A;  4WWL A;  3PSN A;  3FLO A;  2O8A A;  4LAC C;  3H61 A;  3RL3 A;  3H69 A;  4DT2 A;  4O4K A;  2NXF A;  3PSO A;  1S3M A;  3H67 A;  4I5L C;  4MOV A;  3TGH A;  3QG5 C;  4TUI A;  3QFO A;  1QHW A;  3GVE A;  3DSC A;  4IL1 A;  3ICF A;  3N5U A;  2QFP A;  4V0X A;  3THO B;  1WAR A;  3H63 A;  5IOH A;  1Z2X A;  1UTE A;  4DHL A;  1T70 A;  4V0V A;  4UT2 A;  1HPU A;  2IE3 C;  3E0J A;  2BCD A;  4G9J A;  3RL4 A;  5J28 A;  1Z2W A;  2QJC A;  2WDE A;  3E7A A;  4FBW A;  3THN A;  3QFN A;  2Z1A A;  2NPP C;  5EQV A;  4ORA A;  2JOG A;  3IB7 A;  1G5B A;  2KKN A;  2ZOA A;  1HO5 A;  1QFC A;  3CK2 A;  4KKZ A;  3QFM A;  2IAE C;  3P71 C;  3K7W C;  3IVD A;  3K7V C;  1V73 A;  2WDD A;  2XMO A;  3AV0 A;  3DW8 C;  4NZV A;  4J6O A;  2DFJ A;  1S70 A;  2WDC A;  3EGG A;  2GJU A;  5C1V A;  5HPE A;  1M63 A;  2YEQ A;  5F3W A;  4MOY A;  3ZTV A;  3LL8 A;  4MP0 A;  1JK7 A;  4TUG A;  1S8E A;  1T71 A;  4H2I A;  4ZX2 A;  2Z06 A;  1KBP A;  4JA9 A;  2HY1 A;  3RQZ A;  2HYO A;  1HP1 A;  3QFK A;  1TCO A;  1NNW A;  2WDF A;  4H2B A;  4H2G A;  1S3L A;  1IT6 A;  4LTY A;  2CV9 A;  3H66 A;  2YVT A;  3IVE A;  4IYP C;  4V0W A;  4UT3 A;  3H60 A;  3ZU0 A;  2O8G A;  4YKE A;  2IE4 C;  4LU9 A;  2DXN A;  4ZVZ A;  3DSD A;  4FCX A;  1XM7 A;  2ZO9 B;  5JPE A;  1XZW A;  1OI8 A;  4HD0 A;  4O24 A;  4FBK A;  3HVQ A;  5JJT A;  3E7B A;  3EGH A;  1SU1 A;  3JYF A;  4H2F A;  4JA7 A;  5JPF A;  4Q7F A;  1OIE A;  1FJM A;  4O43 A;  1MF8 A;  2USH A; 
#chains in the Genus database with same CATH homology
 1AUI A;  3H62 B;  2R17 A;  2NYL C;  2P6B A;  5GTU A;  2QFR A;  5DNY A;  4M0V A;  3C5W C;  3C9F A;  1USH A;  1W24 A;  3T1I A;  1OID A;  1UF3 A;  5INB A;  4KBP A;  4ORC A;  2Z72 A;  3KBP A;  2A22 A;  1U32 A;  4FBQ A;  4B2O A;  4UT3 B;  2BQ8 X;  3AUZ A;  4OR9 A;  4H1Y P;  3RL5 A;  2NYM C;  2AHD A;  5B8I A;  4O5G A;  4H1S A;  3H64 A;  2DXL A;  3D03 A;  4I5N C;  4ORB A;  2Q8U A;  1II7 A;  1S95 A;  4F0Z A;  3FGA C;  2ZBM A;  3IB8 A;  3V4Y A;  1WAO 1;  2BDX A;  4XPN A;  4DSY A;  3H68 A;  4UWQ A;  2HYP A;  1S3N A;  4WWL A;  3PSN A;  3FLO A;  2O8A A;  4LAC C;  3H61 A;  3RL3 A;  3H69 A;  4DT2 A;  4O4K A;  2NXF A;  3PSO A;  1S3M A;  3H67 A;  4I5L C;  4MOV A;  3TGH A;  3QG5 C;  4TUI A;  3QFO A;  1QHW A;  3GVE A;  3DSC A;  4IL1 A;  3ICF A;  3N5U A;  2QFP A;  4V0X A;  3THO B;  1WAR A;  3H63 A;  5IOH A;  1Z2X A;  1UTE A;  4DHL A;  1T70 A;  4V0V A;  4UT2 A;  1HPU A;  2IE3 C;  3E0J A;  2BCD A;  4G9J A;  3RL4 A;  5J28 A;  1Z2W A;  2QJC A;  2WDE A;  3E7A A;  4FBW A;  3THN A;  3QFN A;  2Z1A A;  2NPP C;  5EQV A;  4ORA A;  2JOG A;  3IB7 A;  1G5B A;  2KKN A;  2ZOA A;  1HO5 A;  1QFC A;  3CK2 A;  4KKZ A;  3QFM A;  2IAE C;  3P71 C;  3K7W C;  3IVD A;  3K7V C;  1V73 A;  2WDD A;  2XMO A;  3AV0 A;  3DW8 C;  4NZV A;  4J6O A;  2DFJ A;  1S70 A;  2WDC A;  3EGG A;  2GJU A;  5C1V A;  5HPE A;  1M63 A;  2YEQ A;  5F3W A;  4MOY A;  3ZTV A;  3LL8 A;  4MP0 A;  1JK7 A;  4TUG A;  1S8E A;  1T71 A;  4H2I A;  4ZX2 A;  2Z06 A;  1KBP A;  4JA9 A;  2HY1 A;  3RQZ A;  2HYO A;  1HP1 A;  3QFK A;  1TCO A;  1NNW A;  2WDF A;  4H2B A;  4H2G A;  1S3L A;  1IT6 A;  4LTY A;  2CV9 A;  3H66 A;  2YVT A;  3IVE A;  4IYP C;  4V0W A;  4UT3 A;  3H60 A;  3ZU0 A;  2O8G A;  4YKE A;  2IE4 C;  4LU9 A;  2DXN A;  4ZVZ A;  3DSD A;  4FCX A;  1XM7 A;  2ZO9 B;  5JPE A;  1XZW A;  1OI8 A;  4HD0 A;  4O24 A;  4FBK A;  3HVQ A;  5JJT A;  3E7B A;  3EGH A;  1SU1 A;  3JYF A;  4H2F A;  4JA7 A;  5JPF A;  4Q7F A;  1OIE A;  1FJM A;  4O43 A;  1MF8 A;  2USH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...