3N5UA

Crystal structure of an rb c-terminal peptide bound to the catalytic subunit of pp1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transcription regulation
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title An overlapping kinase and phosphatase docking site regulates activity of the retinoblastoma protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3n5uA00
4JA9A 1WARA 1AUIA 3FGAC 3QFKA 4HD0A 4Q7FA 4UT3A 3H60A 1JK7A 4JA7A 3TGHA 1QFCA 2NXFA 2NYMC 2O8AA 4IYPC 2BCDA 3DW8C 3ZU0A 1G5BA 3DSDA 2DFJA 5J28A 4UWQA 4M0VA 4B2OA 3QFNA 5GTUA 2Q8UA 5EQVA 5JPFA 1NNWA 1WAO1 2A22A 4ORAA 2XMOA 2QFPA 3EGGA 4V0WA 5DNYA 4NZVA 4LU9A 1S95A 1S3NA 2IAEC 2IE3C 4H1SA 3GVEA 3QG5C 5JJTA 1QHWA 2AHDA 5F3WA 3E7BA 2CV9A 3IB7A 3K7VC 3KBPA 5C1VA 1W24A 3ICFA 5INBA 2BQ8X 3H62B 4LACC 3LL8A 1OIDA 1HP1A 3ZTVA 4DSYA 2Z1AA 1II7A 1Z2WA 4MOVA 1S3MA 2Z06A 4H1YP 2IE4C 4O4KA 2WDEA 3CK2A 1S8EA 4TUIA 1S70A 3THNA 4V0VA 3RL5A 1M63A 4UT3B 1TCOA 4H2IA 4ZVZA 2ZBMA 1MF8A 1T70A 2Z72A 2HY1A 2P6BA 4J6OA 3V4YA 5HPEA 2HYOA 3DSCA 4V0XA 1T71A 3PSOA 4DHLA 3RL4A 2QJCA 3QFMA 4O24A 1OIEA 3AUZA 1U32A 3K7WC 4FBWA 4FBKA 3IVDA 2R17A 1USHA 3PSNA 4KKZA 3E7AA 3N5UA 3H63A 4I5NC 3H68A 5IOHA 4WWLA 2WDDA 1S3LA 4XPNA 3IVEA 2USHA 3RQZA 1SU1A 1XM7A 4YKEA 2QFRA 3THOB 4TUGA 3P71C 2HYPA 5B8IA 4O5GA 4ORCA 4DT2A 2O8GA 3T1IA 3IB8A 4H2GA 3AV0A 4FCXA 3JYFA 4MOYA 1IT6A 1HPUA 3HVQA 1V73A 1HO5A 3H61A 3H64A 4H2BA 4LTYA 3RL3A 4UT2A 1OI8A 3EGHA 1UTEA 2NYLC 4G9JA 4I5LC 5JPEA 4H2FA 1XZWA 1Z2XA 3H69A 2KKNA 2WDFA 4O43A 4ZX2A 4OR9A 3H66A 4IL1A 2YVTA 2GJUA 3C9FA 2BDXA 2JOGA 3H67A 4FBQA 4KBPA 4MP0A 4F0ZA 1UF3A 4ORBA 3C5WC 1FJMA 2WDCA 2NPPC 3QFOA 1KBPA
chains in the Genus database with same CATH superfamily
4JA9A 1WARA 1AUIA 3FGAC 3QFKA 4HD0A 4Q7FA 4UT3A 3H60A 1JK7A 4JA7A 3TGHA 1QFCA 2NXFA 2NYMC 2O8AA 4IYPC 2BCDA 3DW8C 3ZU0A 1G5BA 3DSDA 2DFJA 5J28A 4UWQA 4M0VA 4B2OA 3QFNA 5GTUA 2Q8UA 5EQVA 5JPFA 1NNWA 1WAO1 2A22A 4ORAA 2XMOA 2QFPA 3EGGA 4V0WA 5DNYA 4NZVA 2ZO9B 4LU9A 1S95A 1S3NA 2IAEC 2IE3C 4H1SA 3GVEA 3QG5C 5JJTA 1QHWA 2AHDA 5F3WA 3E7BA 2CV9A 3IB7A 3K7VC 3KBPA 5C1VA 1W24A 3ICFA 5INBA 2BQ8X 3H62B 4LACC 3LL8A 1OIDA 1HP1A 3ZTVA 4DSYA 2Z1AA 1II7A 1Z2WA 4MOVA 1S3MA 2Z06A 4H1YP 2IE4C 4O4KA 2WDEA 3CK2A 1S8EA 4TUIA 1S70A 3THNA 4V0VA 3RL5A 1M63A 4UT3B 1TCOA 4H2IA 4ZVZA 2ZBMA 1MF8A 1T70A 2Z72A 2HY1A 2P6BA 4J6OA 3V4YA 5HPEA 2HYOA 3DSCA 4V0XA 1T71A 3PSOA 4DHLA 3RL4A 2QJCA 3QFMA 4O24A 3D03A 1OIEA 3AUZA 1U32A 3K7WC 4FBWA 4FBKA 3IVDA 2YEQA 2R17A 1USHA 3PSNA 4KKZA 3E7AA 3N5UA 3H63A 4I5NC 3H68A 5IOHA 4WWLA 2WDDA 1S3LA 4XPNA 3IVEA 2USHA 3RQZA 1SU1A 1XM7A 4YKEA 2QFRA 3THOB 4TUGA 3P71C 2DXLA 2HYPA 4O5GA 4ORCA 5B8IA 4DT2A 3FLOA 2O8GA 3T1IA 2ZOAA 3IB8A 4H2GA 3AV0A 4FCXA 3JYFA 4MOYA 1IT6A 1HPUA 3HVQA 1V73A 1HO5A 3H61A 3H64A 4H2BA 4LTYA 3RL3A 4UT2A 1OI8A 3EGHA 2DXNA 1UTEA 2NYLC 4G9JA 4I5LC 5JPEA 4H2FA 1XZWA 1Z2XA 3H69A 2KKNA 2WDFA 4O43A 4ZX2A 3E0JA 4OR9A 3H66A 4IL1A 2YVTA 2GJUA 3C9FA 2BDXA 2JOGA 3H67A 4FBQA 4KBPA 4MP0A 4F0ZA 1UF3A 4ORBA 3C5WC 1FJMA 2WDCA 2NPPC 3QFOA 1KBPA
chains in the Genus database with same CATH topology
4JA9A 1WARA 1AUIA 3FGAC 3QFKA 4HD0A 4Q7FA 4UT3A 3H60A 1JK7A 4JA7A 3TGHA 1QFCA 2NXFA 2NYMC 2O8AA 4IYPC 2BCDA 3DW8C 3ZU0A 1G5BA 3DSDA 2DFJA 5J28A 4UWQA 4M0VA 4B2OA 3QFNA 5GTUA 2Q8UA 5EQVA 5JPFA 1NNWA 1WAO1 2A22A 4ORAA 2XMOA 2QFPA 3EGGA 4V0WA 5DNYA 4NZVA 2ZO9B 4LU9A 1S95A 1S3NA 2IAEC 2IE3C 4H1SA 3GVEA 3QG5C 5JJTA 1QHWA 2AHDA 5F3WA 3E7BA 2CV9A 3IB7A 3K7VC 3KBPA 5C1VA 1W24A 3ICFA 5INBA 2BQ8X 3H62B 4LACC 3LL8A 1OIDA 1HP1A 3ZTVA 4DSYA 2Z1AA 1II7A 1Z2WA 4MOVA 1S3MA 2Z06A 4H1YP 2IE4C 4O4KA 2WDEA 3CK2A 1S8EA 4TUIA 1S70A 3THNA 4V0VA 3RL5A 1M63A 4UT3B 1TCOA 4H2IA 4ZVZA 2ZBMA 1MF8A 1T70A 2Z72A 2HY1A 2P6BA 4J6OA 3V4YA 5HPEA 2HYOA 3DSCA 4V0XA 1T71A 3PSOA 4DHLA 3RL4A 2QJCA 3QFMA 4O24A 3D03A 1OIEA 3AUZA 1U32A 3K7WC 4FBWA 4FBKA 3IVDA 2YEQA 2R17A 1USHA 3PSNA 4KKZA 3E7AA 3N5UA 3H63A 4I5NC 3H68A 5IOHA 4WWLA 2WDDA 1S3LA 4XPNA 3IVEA 2USHA 3RQZA 1SU1A 1XM7A 4YKEA 2QFRA 3THOB 4TUGA 3P71C 2DXLA 2HYPA 4O5GA 4ORCA 5B8IA 4DT2A 3FLOA 2O8GA 3T1IA 2ZOAA 3IB8A 4H2GA 3AV0A 4FCXA 3JYFA 4MOYA 1IT6A 1HPUA 3HVQA 1V73A 1HO5A 3H61A 3H64A 4H2BA 4LTYA 3RL3A 4UT2A 1OI8A 3EGHA 2DXNA 1UTEA 2NYLC 4G9JA 4I5LC 5JPEA 4H2FA 1XZWA 1Z2XA 3H69A 2KKNA 2WDFA 4O43A 4ZX2A 3E0JA 4OR9A 3H66A 4IL1A 2YVTA 2GJUA 3C9FA 2BDXA 2JOGA 3H67A 4FBQA 4KBPA 4MP0A 4F0ZA 1UF3A 4ORBA 3C5WC 1FJMA 2WDCA 2NPPC 3QFOA 1KBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JA9 A;  1WAR A;  1AUI A;  3FGA C;  3QFK A;  4HD0 A;  4Q7F A;  4UT3 A;  3H60 A;  1JK7 A;  4JA7 A;  3TGH A;  1QFC A;  2NXF A;  2NYM C;  2O8A A;  4IYP C;  2BCD A;  3DW8 C;  3ZU0 A;  1G5B A;  3DSD A;  2DFJ A;  5J28 A;  4UWQ A;  4M0V A;  4B2O A;  3QFN A;  5GTU A;  2Q8U A;  5EQV A;  5JPF A;  1NNW A;  1WAO 1;  2A22 A;  4ORA A;  2XMO A;  2QFP A;  3EGG A;  4V0W A;  5DNY A;  4NZV A;  4LU9 A;  1S95 A;  1S3N A;  2IAE C;  2IE3 C;  4H1S A;  3GVE A;  3QG5 C;  5JJT A;  1QHW A;  2AHD A;  5F3W A;  3E7B A;  2CV9 A;  3IB7 A;  3K7V C;  3KBP A;  5C1V A;  1W24 A;  3ICF A;  5INB A;  2BQ8 X;  3H62 B;  4LAC C;  3LL8 A;  1OID A;  1HP1 A;  3ZTV A;  4DSY A;  2Z1A A;  1II7 A;  1Z2W A;  4MOV A;  1S3M A;  2Z06 A;  4H1Y P;  2IE4 C;  4O4K A;  2WDE A;  3CK2 A;  1S8E A;  4TUI A;  1S70 A;  3THN A;  4V0V A;  3RL5 A;  1M63 A;  4UT3 B;  1TCO A;  4H2I A;  4ZVZ A;  2ZBM A;  1MF8 A;  1T70 A;  2Z72 A;  2HY1 A;  2P6B A;  4J6O A;  3V4Y A;  5HPE A;  2HYO A;  3DSC A;  4V0X A;  1T71 A;  3PSO A;  4DHL A;  3RL4 A;  2QJC A;  3QFM A;  4O24 A;  1OIE A;  3AUZ A;  1U32 A;  3K7W C;  4FBW A;  4FBK A;  3IVD A;  2R17 A;  1USH A;  3PSN A;  4KKZ A;  3E7A A;  3N5U A;  3H63 A;  4I5N C;  3H68 A;  5IOH A;  4WWL A;  2WDD A;  1S3L A;  4XPN A;  3IVE A;  2USH A;  3RQZ A;  1SU1 A;  1XM7 A;  4YKE A;  2QFR A;  3THO B;  4TUG A;  3P71 C;  2HYP A;  5B8I A;  4O5G A;  4ORC A;  4DT2 A;  2O8G A;  3T1I A;  3IB8 A;  4H2G A;  3AV0 A;  4FCX A;  3JYF A;  4MOY A;  1IT6 A;  1HPU A;  3HVQ A;  1V73 A;  1HO5 A;  3H61 A;  3H64 A;  4H2B A;  4LTY A;  3RL3 A;  4UT2 A;  1OI8 A;  3EGH A;  1UTE A;  2NYL C;  4G9J A;  4I5L C;  5JPE A;  4H2F A;  1XZW A;  1Z2X A;  3H69 A;  2KKN A;  2WDF A;  4O43 A;  4ZX2 A;  4OR9 A;  3H66 A;  4IL1 A;  2YVT A;  2GJU A;  3C9F A;  2BDX A;  2JOG A;  3H67 A;  4FBQ A;  4KBP A;  4MP0 A;  4F0Z A;  1UF3 A;  4ORB A;  3C5W C;  1FJM A;  2WDC A;  2NPP C;  3QFO A;  1KBP A; 
#chains in the Genus database with same CATH topology
 4JA9 A;  1WAR A;  1AUI A;  3FGA C;  3QFK A;  4HD0 A;  4Q7F A;  4UT3 A;  3H60 A;  1JK7 A;  4JA7 A;  3TGH A;  1QFC A;  2NXF A;  2NYM C;  2O8A A;  4IYP C;  2BCD A;  3DW8 C;  3ZU0 A;  1G5B A;  3DSD A;  2DFJ A;  5J28 A;  4UWQ A;  4M0V A;  4B2O A;  3QFN A;  5GTU A;  2Q8U A;  5EQV A;  5JPF A;  1NNW A;  1WAO 1;  2A22 A;  4ORA A;  2XMO A;  2QFP A;  3EGG A;  4V0W A;  5DNY A;  4NZV A;  2ZO9 B;  4LU9 A;  1S95 A;  1S3N A;  2IAE C;  2IE3 C;  4H1S A;  3GVE A;  3QG5 C;  5JJT A;  1QHW A;  2AHD A;  5F3W A;  3E7B A;  2CV9 A;  3IB7 A;  3K7V C;  3KBP A;  5C1V A;  1W24 A;  3ICF A;  5INB A;  2BQ8 X;  3H62 B;  4LAC C;  3LL8 A;  1OID A;  1HP1 A;  3ZTV A;  4DSY A;  2Z1A A;  1II7 A;  1Z2W A;  4MOV A;  1S3M A;  2Z06 A;  4H1Y P;  2IE4 C;  4O4K A;  2WDE A;  3CK2 A;  1S8E A;  4TUI A;  1S70 A;  3THN A;  4V0V A;  3RL5 A;  1M63 A;  4UT3 B;  1TCO A;  4H2I A;  4ZVZ A;  2ZBM A;  1MF8 A;  1T70 A;  2Z72 A;  2HY1 A;  2P6B A;  4J6O A;  3V4Y A;  5HPE A;  2HYO A;  3DSC A;  4V0X A;  1T71 A;  3PSO A;  4DHL A;  3RL4 A;  2QJC A;  3QFM A;  4O24 A;  3D03 A;  1OIE A;  3AUZ A;  1U32 A;  3K7W C;  4FBW A;  4FBK A;  3IVD A;  2YEQ A;  2R17 A;  1USH A;  3PSN A;  4KKZ A;  3E7A A;  3N5U A;  3H63 A;  4I5N C;  3H68 A;  5IOH A;  4WWL A;  2WDD A;  1S3L A;  4XPN A;  3IVE A;  2USH A;  3RQZ A;  1SU1 A;  1XM7 A;  4YKE A;  2QFR A;  3THO B;  4TUG A;  3P71 C;  2DXL A;  2HYP A;  4O5G A;  4ORC A;  5B8I A;  4DT2 A;  3FLO A;  2O8G A;  3T1I A;  2ZOA A;  3IB8 A;  4H2G A;  3AV0 A;  4FCX A;  3JYF A;  4MOY A;  1IT6 A;  1HPU A;  3HVQ A;  1V73 A;  1HO5 A;  3H61 A;  3H64 A;  4H2B A;  4LTY A;  3RL3 A;  4UT2 A;  1OI8 A;  3EGH A;  2DXN A;  1UTE A;  2NYL C;  4G9J A;  4I5L C;  5JPE A;  4H2F A;  1XZW A;  1Z2X A;  3H69 A;  2KKN A;  2WDF A;  4O43 A;  4ZX2 A;  3E0J A;  4OR9 A;  3H66 A;  4IL1 A;  2YVT A;  2GJU A;  3C9F A;  2BDX A;  2JOG A;  3H67 A;  4FBQ A;  4KBP A;  4MP0 A;  4F0Z A;  1UF3 A;  4ORB A;  3C5W C;  1FJM A;  2WDC A;  2NPP C;  3QFO A;  1KBP A; 
#chains in the Genus database with same CATH homology
 4JA9 A;  1WAR A;  1AUI A;  3FGA C;  3QFK A;  4HD0 A;  4Q7F A;  4UT3 A;  3H60 A;  1JK7 A;  4JA7 A;  3TGH A;  1QFC A;  2NXF A;  2NYM C;  2O8A A;  4IYP C;  2BCD A;  3DW8 C;  3ZU0 A;  1G5B A;  3DSD A;  2DFJ A;  5J28 A;  4UWQ A;  4M0V A;  4B2O A;  3QFN A;  5GTU A;  2Q8U A;  5EQV A;  5JPF A;  1NNW A;  1WAO 1;  2A22 A;  4ORA A;  2XMO A;  2QFP A;  3EGG A;  4V0W A;  5DNY A;  4NZV A;  2ZO9 B;  4LU9 A;  1S95 A;  1S3N A;  2IAE C;  2IE3 C;  4H1S A;  3GVE A;  3QG5 C;  5JJT A;  1QHW A;  2AHD A;  5F3W A;  3E7B A;  2CV9 A;  3IB7 A;  3K7V C;  3KBP A;  5C1V A;  1W24 A;  3ICF A;  5INB A;  2BQ8 X;  3H62 B;  4LAC C;  3LL8 A;  1OID A;  1HP1 A;  3ZTV A;  4DSY A;  2Z1A A;  1II7 A;  1Z2W A;  4MOV A;  1S3M A;  2Z06 A;  4H1Y P;  2IE4 C;  4O4K A;  2WDE A;  3CK2 A;  1S8E A;  4TUI A;  1S70 A;  3THN A;  4V0V A;  3RL5 A;  1M63 A;  4UT3 B;  1TCO A;  4H2I A;  4ZVZ A;  2ZBM A;  1MF8 A;  1T70 A;  2Z72 A;  2HY1 A;  2P6B A;  4J6O A;  3V4Y A;  5HPE A;  2HYO A;  3DSC A;  4V0X A;  1T71 A;  3PSO A;  4DHL A;  3RL4 A;  2QJC A;  3QFM A;  4O24 A;  3D03 A;  1OIE A;  3AUZ A;  1U32 A;  3K7W C;  4FBW A;  4FBK A;  3IVD A;  2YEQ A;  2R17 A;  1USH A;  3PSN A;  4KKZ A;  3E7A A;  3N5U A;  3H63 A;  4I5N C;  3H68 A;  5IOH A;  4WWL A;  2WDD A;  1S3L A;  4XPN A;  3IVE A;  2USH A;  3RQZ A;  1SU1 A;  1XM7 A;  4YKE A;  2QFR A;  3THO B;  4TUG A;  3P71 C;  2DXL A;  2HYP A;  4O5G A;  4ORC A;  5B8I A;  4DT2 A;  3FLO A;  2O8G A;  3T1I A;  2ZOA A;  3IB8 A;  4H2G A;  3AV0 A;  4FCX A;  3JYF A;  4MOY A;  1IT6 A;  1HPU A;  3HVQ A;  1V73 A;  1HO5 A;  3H61 A;  3H64 A;  4H2B A;  4LTY A;  3RL3 A;  4UT2 A;  1OI8 A;  3EGH A;  2DXN A;  1UTE A;  2NYL C;  4G9J A;  4I5L C;  5JPE A;  4H2F A;  1XZW A;  1Z2X A;  3H69 A;  2KKN A;  2WDF A;  4O43 A;  4ZX2 A;  3E0J A;  4OR9 A;  3H66 A;  4IL1 A;  2YVT A;  2GJU A;  3C9F A;  2BDX A;  2JOG A;  3H67 A;  4FBQ A;  4KBP A;  4MP0 A;  4F0Z A;  1UF3 A;  4ORB A;  3C5W C;  1FJM A;  2WDC A;  2NPP C;  3QFO A;  1KBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...