4O43A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
b'IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o43A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o43A01
1S3LA 2BCDA 3DSDA 1FJMA 1HP1A 1U32A 3K7WC 4M0VA 1II7A 4ZX2A 4O24A 1IT6A 1Z2WA 1XM7A 3IVDA 3RQZA 1AUIA 1S3MA 3IB8A 3RL5A 3PSNA 4I5LC 4IL1A 4KBPA 3TGHA 4H2FA 4H2GA 4ZVZA 1MF8A 1QFCA 2IE4C 1WAO1 3QFMA 4B2OA 2A22A 4UT3A 5HPEA 3IVEA 5EQVA 1JK7A 2HY1A 1USHA 3C9FA 4H2BA 4LTYA 5GTUA 3H64A 4WWLA 1UTEA 3ZTVA 2O8GA 4V0XA 4FBKA 2DFJA 3CK2A 3H66A 3T1IA 3E7BA 2XMOA 4O4KA 2BQ8X 3THNA 4XPNA 4MOVA 3QFOA 3DSCA 1T71A 3QFNA 2USHA 1W24A 1SU1A 4UT3B 4V0WA 4KKZA 2WDEA 4TUIA 4F0ZA 5DNYA 2KKNA 3QFKA 1TCOA 3IB7A 4MP0A 1S8EA 1G5BA 2QJCA 2Q8UA 3C5WC 1Z2XA 1HPUA 2R17A 3P71C 5C1VA 1OIDA 2HYOA 1HO5A 2IE3C 4UT2A 4ORCA 4H2IA 2CV9A 2NPPC 1WARA 1UF3A 2P6BA 3K7VC 3AV0A 3KBPA 3H67A 1V73A 4FCXA 4J6OA 2GJUA 3JYFA 5JPEA 3EGGA 3THOB 2YVTA 2WDCA 4LACC 3EGHA 3ZU0A 4IYPC 2BDXA 3HVQA 3FGAC 4NZVA 3E7AA 5F3WA 4FBWA 2NYLC 3LL8A 2WDDA 1M63A 4O43A 4UWQA 4DSYA 3RL3A 4I5NC 4OR9A 1S95A 4DHLA 4ORBA 1S70A 2Z72A 2QFRA 2HYPA 2ZBMA 3H63A 4V0VA 1S3NA 2JOGA 4H1SA 3QG5C 3H69A 2NXFA 4LU9A 2QFPA 1QHWA 4JA7A 5JPFA 2WDFA 3DW8C 2AHDA 1OI8A 5IOHA 4YKEA 3H60A 2O8AA 3N5UA 4O5GA 1XZWA 2Z06A 3H61A 4Q7FA 3H62B 3ICFA 2IAEC 4HD0A 4TUGA 3PSOA 1KBPA 3GVEA 4FBQA 4JA9A 4ORAA 5INBA 1NNWA 2NYMC 3AUZA 3RL4A 1T70A 3H68A 5J28A 3V4YA 4MOYA 5B8IA 4H1YP 4G9JA 1OIEA 5JJTA 2Z1AA 4DT2A
chains in the Genus database with same CATH superfamily
3DSDA 1FJMA 1U32A 2EN6A 3K7WC 5A6AA 5A6BA 1DGCA 4O24A 5A6BD 1XM7A 4WXCA 4JI1E 5LL6R 1BBGA 3IVDA 2RQLA 2DLKA 4N4RB 2LVHA 3PSNA 4BHBA 2RS6A 4P78A 4KBPA 3EPJA 3RMPA 2DLQA 3IWCA 4F9AB 3QFMA 4KZSA 4B2OA 2EQ1A 4R2DA 4M9VC 2A22A 2ZM6E 2EM8A 2EQ0A 4H2BA 3ADJA 5GTUA 4WWLA 3ZTVA 1L4SA 2O8GA 2RTXA 4FBKA 2L33A 2FTXB 2UUAE 4V0XA 5BR8E 2EL4A 2EOEA 3HQ1A 4O4KA 2RS7A 3F6GA 3DSCA 3C6MA 2USHA 4UT3B 1WXRA 2EOMA 1TN9A 2EOFA 4YY3E 4DV7E 2EM5A 4RH8A 1TCOA 2A25A 2DIXA 1HNWE 1IMUA 2QJCA 3MHHC 4JV5E 2E72A 1X49A 3J81C 2CPNA 5C1VA 1OIDA 1HO5A 1G2FC 1YYKA 1HR0E 1IBME 5KL2A 1XNQE 2ZOAA 1ZU1A 1UN6B 2ZO9B 4DV5E 2EN3A 2JOBA 2CV9A 3H09A 4DV6E 1YYWA 3K7VC 3AV0A 2LE2A 1V73A 4J6OA 2GJUA 2YWQA 3JYFA 2NUFA 5JPEA 4WSPA 4WYQB 1QNTA 5KL5A 3VYYA 4F6MA 4LF4E 2UXCE 1EH8A 2EJ4A 2EWLA 3ADGA 2DRPA 2WBSA 4NZVA 2V88A 4ZYHA 2YTJA 5F3WA 4FBWA 2EOOA 2WBTA 2ODRD 5ADZA 4M2ZA 1M63A 2YEQA 2EPAA 2EORA 2KOUA 3OMLA 4I8OA 1YFHA 4X64E 5KL6A 2BB8A 4R2QA 4GKJE 1S70A 3ECRA 2QFRA 3H63A 2EMCA 2EPLX 2YTDA 2JOGA 2LV2A 3JU0A 1N32E 1QHWA 3DW8C 3F6HA 4X65E 2MKNA 4YKEA 3H60A 4IS1C 2L92A 1XZWA 4R2PA 4NXME 2ELYA 4DV2E 3ICFA 1A1FA 2EMZA 2KONA 2EPMX 5INBA 5J28A 2NYMC 3D03A 3IWBA 2YTFA 4MOYA 4H1YP 2EP3A 2EMBA 2LTSA 2EM2A 2YTNA 4DR2E 1OIEA 4G9JA 2YU8A 4ZYGA 2L3CA 2M1SA 4X62E 1KYQA 4M0VA 2MDRA 1II7A 2H36X 4ZX2A 1PJQA 1X3CA 2ELZA 2EN1A 2GLIA 1IT6A 4DR6E 2V85A 2EL5A 4F9CB 4JYAE 1AUIA 1JK1A 4DUZE 1KJKA 1YUIA 1XMQE 4ZYEA 1XMOE 2WBUA 2EPCA 3VYXA 2IE4C 2LJHA 2LT7A 2ENHA 1YPNA 5IV8B 2EM0A 1IBKE 4UT3A 2KHXA 2EN4A 5IXMB 2HY1A 1USHA 3C9FA 1GQEA 4BS9A 4R8OA 2UUCE 3H64A 4DV0E 1A1HA 2LMZA 4WSGA 2DFJA 3T1IA 4DKKA 3E7BA 4MLQA 2DGCA 4B3TE 2BQ8X 2LTRA 2JVAA 2XMOA 4XPNA 2CTDA 1HNZE 1N33E 1PJTA 2UXDE 1SU1A 4OOGC 2JR1A 2DMIA 2V83A 4TUIA 2NUGA 2YSOA 1STUA 1A1LA 3QFKA 1ZR9A 2EOYA 3IB7A 3HPSA 4LF8E 2RSIA 3EQ1A 3BF2A 2HHHE 2EMKA 5T6JA 1G5BA 5FLXC 4ZYDA 2EMYA 2Q8UA 2JP9A 2GPIA 3IWDA 4YHHE 3KZYA 4WXDA 5LLQA 2IE3C 4UT2A 2V86A 3E0JA 2EOIA 2JY9A 3J7Yp 1WARA 1UF3A 3KBPA 3HPZA 4Q35B 1FKAE 2UXBE 2UUBE 3EGGA 3THOB 2YVTA 3EGHA 2LBSB 4IYPC 3MSWA 2NUEA 2EOHA 5KL7A 1YYOA 3E7AA 2EQ3A 2DB2A 3T1YE 4DSYA 1IQOA 3RL3A 1G2DC 2L2MA 1S95A 2EOZA 2IHR1 2Z72A 1YZ9A 4OX9E 2ZBMA 4LF5E 3DJWA 1A1JA 1BB8A 2F4VE 2D9HA 5IWAE 2EN2A 2LRSA 4JA7A 2WDFA 2JWOA 3JTZA 1JK2A 4DR5E 1PJSA 1GZ6A 2EL6A 1OI8A 2L2NA 4O5GA 2Z06A 2EE8A 1ZBQA 5A6JA 4IJDA 2IAEC 5KL3A 2VQFE 5LMUE 4JA9A 4DR3E 4F6NA 4Q28A 1F2IG 2DXLA 4ORAA 1DQ3A 1BBOA 5AE3A 1NNWA 3RL4A 3H68A 3LLHA 3FIGA 1PDAA 3FLOA 5JJTA 4LFBE 2LUPB 2CT1A 1S3LA 1HP1A 4WX9A 5IT9C 4DMIA 5AE1A 1SR9A 4WFTA 1A1KA 1A1IA 4KHPE 2YRHA 2MC6A 3C4TA 4L5NC 3IB8A 3RL5A 2FGGA 4BMJA 2VE7C 3MHSC 3T1HE 4P7DA 3TGHA 2F8BA 4GEQB 4H2FA 1MF8A 2EOJA 1TF6A 2K4VA 4JI2E 3EPHA 1X48A 2NA2A 5EQVA 4B3RE 1JK7A 2YTEA 5A2QC 4JI4E 1AAYA 3CK2A 3H66A 1PKPA 4LF9E 2ADRA 4JI3E 2FV4B 4HEIA 3THNA 1GTKA 2YTOA 3K6QA 2L3JA 1J5EE 1B69A 4LF7E 4V0WA 2WDEA 2K7IA 2EPKX 3HXLA 2KKNA 2EOQA 1Z1BA 2YTGA 1X6HA 1S8EA 3L00A 4LFCE 2EPZA 1EKZA 3DF6A 4BCAA 1EH6A 2LO3A 2EM4A 5TSEA 4DUYE 5AE2A 1Z2XA 3C5WC 2LJUA 3P71C 2UU9E 4ORCA 4X66E 4R2AA 2NPPC 3JAMC 2CSHA 2M7QA 4JI5E 3ADIA 2WDCA 1IBLE 4LACC 2EZ6A 4B3SE 2HC5A 2NABA 2E1MA 3HVQA 4WPYA 2EM3A 1NCSA 1AH5A 4DV3E 1XNRE 2NYLC 3OTOE 1UILA 2WDDA 2M4IA 1X5WA 1EH7A 4UWQA 5A6KA 3ADLA 2JOXA 5KL4A 4OR9A 1P47A 3J7AG 2HYPA 3J80C 2EPUA 3HTXA 1S3NA 4H1SA 4KWYA 2R1FA 2YU5A 2LUQA 1YSAC 2NXFA 2YPNA 2B7TA 5AASA 1T4NA 2DSYA 2ENAA 5JPFA 2YRKA 3ZOQB 1LLMC 2B7VA 4GZNC 2YRMA 2WCC3 1UBDC 4FK5C 2G7HA 2EN8A 4NHRA 2M9AA 4GKKE 1I94E 2RPCA 1SFEA 4HD0A 5AC4A 2EMHA 4FBQA 5CFFE 4DR1E 3KWRA 2VRDA 2JPAA 3AUZA 4BC7A 1T70A 4X9JA 3V4YA 4JI0E 1O0WA 5B8IA 2EMIA 4BBYA 3LMLA 4DT2A 2EPNA 2GHFA 1ZAAC 4X8WA 2BCDA 1N34E 2YT4A 4DR7E 4R2SA 1X47A 4NXNE 1QU6A 2MC5A 2LCEA 1WJPA 2EN7A 4J8ZA 1Z2WA 3M99B 1DI2A 3RQZA 1TF3A 1S3MA 2EPPA 4I5LC 5A69A 4IL1A 2EMXA 4H2GA 4ZVZA 2ENCA 2DMYA 4DV4E 1QFCA 3TQMA 1WAO1 1FJGE 1WHNA 3BGHA 2L2KB 5HPEA 3VK6A 3IVEA 3P1XA 4LTYA 1NEIA 1UTEA 1RQ0A 2EM6A 4F9BB 4MOVA 3QFOA 1T71A 2I13A 3QFNA 1W24A 2RSMA 4KKZA 4L8NA 2EMLA 4HTGA 5LMNE 2EMGA 2PRTA 4F0ZA 5DNYA 2VF1A 2YTPA 3C4BA 4DR4E 1N3GA 4F2JC 4MP0A 3EPKA 2V89A 2JXPA 2EOXA 2BBGA 3UK3C 4R2EA 1HPUA 2R17A 2DXNA 4JI6E 2J7JA 2HYOA 4B3ME 2EPXA 4H2IA 2EMAA 2EMFA 4R2CA 2B9DA 3EPLA 4AQYE 2P6BA 3H67A 1WRJA 2YSPA 4FCXA 4K0KE 1N36E 2L8TA 4RHBB 1T4OA 2JYAA 3KZZA 2V87A 1T38A 3ZU0A 4R03A 2YZTA 2BDXA 2B3TB 3FGAC 4M30A 1T39A 1T4LB 2EMWA 1MEYC 3LL8A 2MDGA 4JI7E 4O43A 4I5NC 2YTIA 1RMDA 4DHLA 4ORBA 2L6MA 2N8XA 4V0VA 2EPRA 2N3GA 3QG5C 3H69A 2EPOA 2R76A 3BIDA 1UHZA 4LU9A 2HGHA 2QFPA 2VQEE 2I9IA 2N3HA 1J26A 2AHDA 4JI8E 2YTQA 2E5LE 5IOHA 1A1GA 4LF6E 2EM9A 1X6EA 2O8AA 3N5UA 3H61A 1RC7A 4Q7FA 4LFAE 3H62B 4BC9A 2WZOA 1ZBTA 1WHQA 4R2RA 2MKDA 4TUGA 1KBPA 3GVEA 3PSOA 2EM7A 4F54A 2V8QB 3VHTB 1HNXE 4DV1E 4MLVA 3C6KA 1MGTA 2EOSA 4BHCA 1IQSA 5AC5A 3BBGA 2ODRC 1YUJA 1X6FA 2HJJA 2Z1AA
chains in the Genus database with same CATH topology
3DSDA 1S3LA 2BCDA 1FJMA 1HP1A 1U32A 3K7WC 4M0VA 1II7A 4ZX2A 4O24A 1IT6A 1Z2WA 1XM7A 3IVDA 3RQZA 1AUIA 1S3MA 3IB8A 3RL5A 3PSNA 4I5LC 4IL1A 4KBPA 3TGHA 4H2FA 4H2GA 4ZVZA 1MF8A 1QFCA 2IE4C 1WAO1 3QFMA 4B2OA 2A22A 4UT3A 5HPEA 3IVEA 5EQVA 1JK7A 2HY1A 1USHA 3C9FA 4H2BA 4LTYA 5GTUA 3H64A 4WWLA 1UTEA 3ZTVA 2O8GA 4V0XA 4FBKA 2DFJA 3CK2A 3H66A 3T1IA 3E7BA 2XMOA 4O4KA 2BQ8X 3THNA 4XPNA 3DSCA 3QFOA 4MOVA 1T71A 3QFNA 2USHA 1W24A 1SU1A 4UT3B 4V0WA 4KKZA 2WDEA 4TUIA 4F0ZA 5DNYA 2KKNA 3QFKA 1TCOA 3IB7A 4MP0A 1S8EA 1G5BA 2QJCA 2Q8UA 3C5WC 1Z2XA 1HPUA 2R17A 2DXNA 3P71C 5C1VA 1OIDA 2HYOA 1HO5A 2IE3C 4UT2A 4ORCA 3E0JA 4H2IA 2ZOAA 2ZO9B 2CV9A 2NPPC 1WARA 1UF3A 2P6BA 3K7VC 3AV0A 3KBPA 3H67A 1V73A 4FCXA 4J6OA 2GJUA 3JYFA 5JPEA 3EGGA 3THOB 2YVTA 2WDCA 4LACC 3EGHA 3ZU0A 4IYPC 2BDXA 3HVQA 3FGAC 4NZVA 3E7AA 5F3WA 4FBWA 2NYLC 3LL8A 2WDDA 1M63A 2YEQA 4O43A 4UWQA 4DSYA 3RL3A 4I5NC 4OR9A 1S95A 4DHLA 4ORBA 1S70A 2Z72A 2QFRA 2HYPA 2ZBMA 3H63A 4V0VA 1S3NA 2JOGA 4H1SA 3QG5C 3H69A 2NXFA 4LU9A 2QFPA 1QHWA 4JA7A 5JPFA 2WDFA 3DW8C 2AHDA 1OI8A 5IOHA 4YKEA 3H60A 2O8AA 3N5UA 4O5GA 1XZWA 2Z06A 3H61A 4Q7FA 3H62B 3ICFA 2IAEC 4HD0A 4TUGA 3PSOA 1KBPA 3GVEA 4FBQA 4JA9A 2DXLA 4ORAA 5INBA 1NNWA 2NYMC 3AUZA 3RL4A 1T70A 3H68A 5J28A 3V4YA 3D03A 4MOYA 5B8IA 4H1YP 4G9JA 1OIEA 3FLOA 2Z1AA 5JJTA 4DT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3L A;  2BCD A;  3DSD A;  1FJM A;  1HP1 A;  1U32 A;  3K7W C;  4M0V A;  1II7 A;  4ZX2 A;  4O24 A;  1IT6 A;  1Z2W A;  1XM7 A;  3IVD A;  3RQZ A;  1AUI A;  1S3M A;  3IB8 A;  3RL5 A;  3PSN A;  4I5L C;  4IL1 A;  4KBP A;  3TGH A;  4H2F A;  4H2G A;  4ZVZ A;  1MF8 A;  1QFC A;  2IE4 C;  1WAO 1;  3QFM A;  4B2O A;  2A22 A;  4UT3 A;  5HPE A;  3IVE A;  5EQV A;  1JK7 A;  2HY1 A;  1USH A;  3C9F A;  4H2B A;  4LTY A;  5GTU A;  3H64 A;  4WWL A;  1UTE A;  3ZTV A;  2O8G A;  4V0X A;  4FBK A;  2DFJ A;  3CK2 A;  3H66 A;  3T1I A;  3E7B A;  2XMO A;  4O4K A;  2BQ8 X;  3THN A;  4XPN A;  4MOV A;  3QFO A;  3DSC A;  1T71 A;  3QFN A;  2USH A;  1W24 A;  1SU1 A;  4UT3 B;  4V0W A;  4KKZ A;  2WDE A;  4TUI A;  4F0Z A;  5DNY A;  2KKN A;  3QFK A;  1TCO A;  3IB7 A;  4MP0 A;  1S8E A;  1G5B A;  2QJC A;  2Q8U A;  3C5W C;  1Z2X A;  1HPU A;  2R17 A;  3P71 C;  5C1V A;  1OID A;  2HYO A;  1HO5 A;  2IE3 C;  4UT2 A;  4ORC A;  4H2I A;  2CV9 A;  2NPP C;  1WAR A;  1UF3 A;  2P6B A;  3K7V C;  3AV0 A;  3KBP A;  3H67 A;  1V73 A;  4FCX A;  4J6O A;  2GJU A;  3JYF A;  5JPE A;  3EGG A;  3THO B;  2YVT A;  2WDC A;  4LAC C;  3EGH A;  3ZU0 A;  4IYP C;  2BDX A;  3HVQ A;  3FGA C;  4NZV A;  3E7A A;  5F3W A;  4FBW A;  2NYL C;  3LL8 A;  2WDD A;  1M63 A;  4O43 A;  4UWQ A;  4DSY A;  3RL3 A;  4I5N C;  4OR9 A;  1S95 A;  4DHL A;  4ORB A;  1S70 A;  2Z72 A;  2QFR A;  2HYP A;  2ZBM A;  3H63 A;  4V0V A;  1S3N A;  2JOG A;  4H1S A;  3QG5 C;  3H69 A;  2NXF A;  4LU9 A;  2QFP A;  1QHW A;  4JA7 A;  5JPF A;  2WDF A;  3DW8 C;  2AHD A;  1OI8 A;  5IOH A;  4YKE A;  3H60 A;  2O8A A;  3N5U A;  4O5G A;  1XZW A;  2Z06 A;  3H61 A;  4Q7F A;  3H62 B;  3ICF A;  2IAE C;  4HD0 A;  4TUG A;  3PSO A;  1KBP A;  3GVE A;  4FBQ A;  4JA9 A;  4ORA A;  5INB A;  1NNW A;  2NYM C;  3AUZ A;  3RL4 A;  1T70 A;  3H68 A;  5J28 A;  3V4Y A;  4MOY A;  5B8I A;  4H1Y P;  4G9J A;  1OIE A;  5JJT A;  2Z1A A;  4DT2 A; 
#chains in the Genus database with same CATH topology
 3DSD A;  1FJM A;  1U32 A;  2EN6 A;  3K7W C;  5A6A A;  5A6B A;  1DGC A;  4O24 A;  5A6B D;  1XM7 A;  4WXC A;  4JI1 E;  5LL6 R;  1BBG A;  3IVD A;  2RQL A;  2DLK A;  4N4R B;  2LVH A;  3PSN A;  4BHB A;  2RS6 A;  4P78 A;  4KBP A;  3EPJ A;  3RMP A;  2DLQ A;  3IWC A;  4F9A B;  3QFM A;  4KZS A;  4B2O A;  2EQ1 A;  4R2D A;  4M9V C;  2A22 A;  2ZM6 E;  2EM8 A;  2EQ0 A;  4H2B A;  3ADJ A;  5GTU A;  4WWL A;  3ZTV A;  1L4S A;  2O8G A;  2RTX A;  4FBK A;  2L33 A;  2FTX B;  2UUA E;  4V0X A;  5BR8 E;  2EL4 A;  2EOE A;  3HQ1 A;  4O4K A;  2RS7 A;  3F6G A;  3DSC A;  3C6M A;  2USH A;  4UT3 B;  1WXR A;  2EOM A;  1TN9 A;  2EOF A;  4YY3 E;  4DV7 E;  2EM5 A;  4RH8 A;  1TCO A;  2A25 A;  2DIX A;  1HNW E;  1IMU A;  2QJC A;  3MHH C;  4JV5 E;  2E72 A;  1X49 A;  3J81 C;  2CPN A;  5C1V A;  1OID A;  1HO5 A;  1G2F C;  1YYK A;  1HR0 E;  1IBM E;  5KL2 A;  1XNQ E;  2ZOA A;  1ZU1 A;  1UN6 B;  2ZO9 B;  4DV5 E;  2EN3 A;  2JOB A;  2CV9 A;  3H09 A;  4DV6 E;  1YYW A;  3K7V C;  3AV0 A;  2LE2 A;  1V73 A;  4J6O A;  2GJU A;  2YWQ A;  3JYF A;  2NUF A;  5JPE A;  4WSP A;  4WYQ B;  1QNT A;  5KL5 A;  3VYY A;  4F6M A;  4LF4 E;  2UXC E;  1EH8 A;  2EJ4 A;  2EWL A;  3ADG A;  2DRP A;  2WBS A;  4NZV A;  2V88 A;  4ZYH A;  2YTJ A;  5F3W A;  4FBW A;  2EOO A;  2WBT A;  2ODR D;  5ADZ A;  4M2Z A;  1M63 A;  2YEQ A;  2EPA A;  2EOR A;  2KOU A;  3OML A;  4I8O A;  1YFH A;  4X64 E;  5KL6 A;  2BB8 A;  4R2Q A;  4GKJ E;  1S70 A;  3ECR A;  2QFR A;  3H63 A;  2EMC A;  2EPL X;  2YTD A;  2JOG A;  2LV2 A;  3JU0 A;  1N32 E;  1QHW A;  3DW8 C;  3F6H A;  4X65 E;  2MKN A;  4YKE A;  3H60 A;  4IS1 C;  2L92 A;  1XZW A;  4R2P A;  4NXM E;  2ELY A;  4DV2 E;  3ICF A;  1A1F A;  2EMZ A;  2KON A;  2EPM X;  5INB A;  5J28 A;  2NYM C;  3D03 A;  3IWB A;  2YTF A;  4MOY A;  4H1Y P;  2EP3 A;  2EMB A;  2LTS A;  2EM2 A;  2YTN A;  4DR2 E;  1OIE A;  4G9J A;  2YU8 A;  4ZYG A;  2L3C A;  2M1S A;  4X62 E;  1KYQ A;  4M0V A;  2MDR A;  1II7 A;  2H36 X;  4ZX2 A;  1PJQ A;  1X3C A;  2ELZ A;  2EN1 A;  2GLI A;  1IT6 A;  4DR6 E;  2V85 A;  2EL5 A;  4F9C B;  4JYA E;  1AUI A;  1JK1 A;  4DUZ E;  1KJK A;  1YUI A;  1XMQ E;  4ZYE A;  1XMO E;  2WBU A;  2EPC A;  3VYX A;  2IE4 C;  2LJH A;  2LT7 A;  2ENH A;  1YPN A;  5IV8 B;  2EM0 A;  1IBK E;  4UT3 A;  2KHX A;  2EN4 A;  5IXM B;  2HY1 A;  1USH A;  3C9F A;  1GQE A;  4BS9 A;  4R8O A;  2UUC E;  3H64 A;  4DV0 E;  1A1H A;  2LMZ A;  4WSG A;  2DFJ A;  3T1I A;  4DKK A;  3E7B A;  4MLQ A;  2DGC A;  4B3T E;  2BQ8 X;  2LTR A;  2JVA A;  2XMO A;  4XPN A;  2CTD A;  1HNZ E;  1N33 E;  1PJT A;  2UXD E;  1SU1 A;  4OOG C;  2JR1 A;  2DMI A;  2V83 A;  4TUI A;  2NUG A;  2YSO A;  1STU A;  1A1L A;  3QFK A;  1ZR9 A;  2EOY A;  3IB7 A;  3HPS A;  4LF8 E;  2RSI A;  3EQ1 A;  3BF2 A;  2HHH E;  2EMK A;  5T6J A;  1G5B A;  5FLX C;  4ZYD A;  2EMY A;  2Q8U A;  2JP9 A;  2GPI A;  3IWD A;  4YHH E;  3KZY A;  4WXD A;  5LLQ A;  2IE3 C;  4UT2 A;  2V86 A;  3E0J A;  2EOI A;  2JY9 A;  3J7Y p;  1WAR A;  1UF3 A;  3KBP A;  3HPZ A;  4Q35 B;  1FKA E;  2UXB E;  2UUB E;  3EGG A;  3THO B;  2YVT A;  3EGH A;  2LBS B;  4IYP C;  3MSW A;  2NUE A;  2EOH A;  5KL7 A;  1YYO A;  3E7A A;  2EQ3 A;  2DB2 A;  3T1Y E;  4DSY A;  1IQO A;  3RL3 A;  1G2D C;  2L2M A;  1S95 A;  2EOZ A;  2IHR 1;  2Z72 A;  1YZ9 A;  4OX9 E;  2ZBM A;  4LF5 E;  3DJW A;  1A1J A;  1BB8 A;  2F4V E;  2D9H A;  5IWA E;  2EN2 A;  2LRS A;  4JA7 A;  2WDF A;  2JWO A;  3JTZ A;  1JK2 A;  4DR5 E;  1PJS A;  1GZ6 A;  2EL6 A;  1OI8 A;  2L2N A;  4O5G A;  2Z06 A;  2EE8 A;  1ZBQ A;  5A6J A;  4IJD A;  2IAE C;  5KL3 A;  2VQF E;  5LMU E;  4JA9 A;  4DR3 E;  4F6N A;  4Q28 A;  1F2I G;  2DXL A;  4ORA A;  1DQ3 A;  1BBO A;  5AE3 A;  1NNW A;  3RL4 A;  3H68 A;  3LLH A;  3FIG A;  1PDA A;  3FLO A;  5JJT A;  4LFB E;  2LUP B;  2CT1 A;  1S3L A;  1HP1 A;  4WX9 A;  5IT9 C;  4DMI A;  5AE1 A;  1SR9 A;  4WFT A;  1A1K A;  1A1I A;  4KHP E;  2YRH A;  2MC6 A;  3C4T A;  4L5N C;  3IB8 A;  3RL5 A;  2FGG A;  4BMJ A;  2VE7 C;  3MHS C;  3T1H E;  4P7D A;  3TGH A;  2F8B A;  4GEQ B;  4H2F A;  1MF8 A;  2EOJ A;  1TF6 A;  2K4V A;  4JI2 E;  3EPH A;  1X48 A;  2NA2 A;  5EQV A;  4B3R E;  1JK7 A;  2YTE A;  5A2Q C;  4JI4 E;  1AAY A;  3CK2 A;  3H66 A;  1PKP A;  4LF9 E;  2ADR A;  4JI3 E;  2FV4 B;  4HEI A;  3THN A;  1GTK A;  2YTO A;  3K6Q A;  2L3J A;  1J5E E;  1B69 A;  4LF7 E;  4V0W A;  2WDE A;  2K7I A;  2EPK X;  3HXL A;  2KKN A;  2EOQ A;  1Z1B A;  2YTG A;  1X6H A;  1S8E A;  3L00 A;  4LFC E;  2EPZ A;  1EKZ A;  3DF6 A;  4BCA A;  1EH6 A;  2LO3 A;  2EM4 A;  5TSE A;  4DUY E;  5AE2 A;  1Z2X A;  3C5W C;  2LJU A;  3P71 C;  2UU9 E;  4ORC A;  4X66 E;  4R2A A;  2NPP C;  3JAM C;  2CSH A;  2M7Q A;  4JI5 E;  3ADI A;  2WDC A;  1IBL E;  4LAC C;  2EZ6 A;  4B3S E;  2HC5 A;  2NAB A;  2E1M A;  3HVQ A;  4WPY A;  2EM3 A;  1NCS A;  1AH5 A;  4DV3 E;  1XNR E;  2NYL C;  3OTO E;  1UIL A;  2WDD A;  2M4I A;  1X5W A;  1EH7 A;  4UWQ A;  5A6K A;  3ADL A;  2JOX A;  5KL4 A;  4OR9 A;  1P47 A;  3J7A G;  2HYP A;  3J80 C;  2EPU A;  3HTX A;  1S3N A;  4H1S A;  4KWY A;  2R1F A;  2YU5 A;  2LUQ A;  1YSA C;  2NXF A;  2YPN A;  2B7T A;  5AAS A;  1T4N A;  2DSY A;  2ENA A;  5JPF A;  2YRK A;  3ZOQ B;  1LLM C;  2B7V A;  4GZN C;  2YRM A;  2WCC 3;  1UBD C;  4FK5 C;  2G7H A;  2EN8 A;  4NHR A;  2M9A A;  4GKK E;  1I94 E;  2RPC A;  1SFE A;  4HD0 A;  5AC4 A;  2EMH A;  4FBQ A;  5CFF E;  4DR1 E;  3KWR A;  2VRD A;  2JPA A;  3AUZ A;  4BC7 A;  1T70 A;  4X9J A;  3V4Y A;  4JI0 E;  1O0W A;  5B8I A;  2EMI A;  4BBY A;  3LML A;  4DT2 A;  2EPN A;  2GHF A;  1ZAA C;  4X8W A;  2BCD A;  1N34 E;  2YT4 A;  4DR7 E;  4R2S A;  1X47 A;  4NXN E;  1QU6 A;  2MC5 A;  2LCE A;  1WJP A;  2EN7 A;  4J8Z A;  1Z2W A;  3M99 B;  1DI2 A;  3RQZ A;  1TF3 A;  1S3M A;  2EPP A;  4I5L C;  5A69 A;  4IL1 A;  2EMX A;  4H2G A;  4ZVZ A;  2ENC A;  2DMY A;  4DV4 E;  1QFC A;  3TQM A;  1WAO 1;  1FJG E;  1WHN A;  3BGH A;  2L2K B;  5HPE A;  3VK6 A;  3IVE A;  3P1X A;  4LTY A;  1NEI A;  1UTE A;  1RQ0 A;  2EM6 A;  4F9B B;  4MOV A;  3QFO A;  1T71 A;  2I13 A;  3QFN A;  1W24 A;  2RSM A;  4KKZ A;  4L8N A;  2EML A;  4HTG A;  5LMN E;  2EMG A;  2PRT A;  4F0Z A;  5DNY A;  2VF1 A;  2YTP A;  3C4B A;  4DR4 E;  1N3G A;  4F2J C;  4MP0 A;  3EPK A;  2V89 A;  2JXP A;  2EOX A;  2BBG A;  3UK3 C;  4R2E A;  1HPU A;  2R17 A;  2DXN A;  4JI6 E;  2J7J A;  2HYO A;  4B3M E;  2EPX A;  4H2I A;  2EMA A;  2EMF A;  4R2C A;  2B9D A;  3EPL A;  4AQY E;  2P6B A;  3H67 A;  1WRJ A;  2YSP A;  4FCX A;  4K0K E;  1N36 E;  2L8T A;  4RHB B;  1T4O A;  2JYA A;  3KZZ A;  2V87 A;  1T38 A;  3ZU0 A;  4R03 A;  2YZT A;  2BDX A;  2B3T B;  3FGA C;  4M30 A;  1T39 A;  1T4L B;  2EMW A;  1MEY C;  3LL8 A;  2MDG A;  4JI7 E;  4O43 A;  4I5N C;  2YTI A;  1RMD A;  4DHL A;  4ORB A;  2L6M A;  2N8X A;  4V0V A;  2EPR A;  2N3G A;  3QG5 C;  3H69 A;  2EPO A;  2R76 A;  3BID A;  1UHZ A;  4LU9 A;  2HGH A;  2QFP A;  2VQE E;  2I9I A;  2N3H A;  1J26 A;  2AHD A;  4JI8 E;  2YTQ A;  2E5L E;  5IOH A;  1A1G A;  4LF6 E;  2EM9 A;  1X6E A;  2O8A A;  3N5U A;  3H61 A;  1RC7 A;  4Q7F A;  4LFA E;  3H62 B;  4BC9 A;  2WZO A;  1ZBT A;  1WHQ A;  4R2R A;  2MKD A;  4TUG A;  1KBP A;  3GVE A;  3PSO A;  2EM7 A;  4F54 A;  2V8Q B;  3VHT B;  1HNX E;  4DV1 E;  4MLV A;  3C6K A;  1MGT A;  2EOS A;  4BHC A;  1IQS A;  5AC5 A;  3BBG A;  2ODR C;  1YUJ A;  1X6F A;  2HJJ A;  2Z1A A; 
#chains in the Genus database with same CATH homology
 3DSD A;  1S3L A;  2BCD A;  1FJM A;  1HP1 A;  1U32 A;  3K7W C;  4M0V A;  1II7 A;  4ZX2 A;  4O24 A;  1IT6 A;  1Z2W A;  1XM7 A;  3IVD A;  3RQZ A;  1AUI A;  1S3M A;  3IB8 A;  3RL5 A;  3PSN A;  4I5L C;  4IL1 A;  4KBP A;  3TGH A;  4H2F A;  4H2G A;  4ZVZ A;  1MF8 A;  1QFC A;  2IE4 C;  1WAO 1;  3QFM A;  4B2O A;  2A22 A;  4UT3 A;  5HPE A;  3IVE A;  5EQV A;  1JK7 A;  2HY1 A;  1USH A;  3C9F A;  4H2B A;  4LTY A;  5GTU A;  3H64 A;  4WWL A;  1UTE A;  3ZTV A;  2O8G A;  4V0X A;  4FBK A;  2DFJ A;  3CK2 A;  3H66 A;  3T1I A;  3E7B A;  2XMO A;  4O4K A;  2BQ8 X;  3THN A;  4XPN A;  3DSC A;  3QFO A;  4MOV A;  1T71 A;  3QFN A;  2USH A;  1W24 A;  1SU1 A;  4UT3 B;  4V0W A;  4KKZ A;  2WDE A;  4TUI A;  4F0Z A;  5DNY A;  2KKN A;  3QFK A;  1TCO A;  3IB7 A;  4MP0 A;  1S8E A;  1G5B A;  2QJC A;  2Q8U A;  3C5W C;  1Z2X A;  1HPU A;  2R17 A;  2DXN A;  3P71 C;  5C1V A;  1OID A;  2HYO A;  1HO5 A;  2IE3 C;  4UT2 A;  4ORC A;  3E0J A;  4H2I A;  2ZOA A;  2ZO9 B;  2CV9 A;  2NPP C;  1WAR A;  1UF3 A;  2P6B A;  3K7V C;  3AV0 A;  3KBP A;  3H67 A;  1V73 A;  4FCX A;  4J6O A;  2GJU A;  3JYF A;  5JPE A;  3EGG A;  3THO B;  2YVT A;  2WDC A;  4LAC C;  3EGH A;  3ZU0 A;  4IYP C;  2BDX A;  3HVQ A;  3FGA C;  4NZV A;  3E7A A;  5F3W A;  4FBW A;  2NYL C;  3LL8 A;  2WDD A;  1M63 A;  2YEQ A;  4O43 A;  4UWQ A;  4DSY A;  3RL3 A;  4I5N C;  4OR9 A;  1S95 A;  4DHL A;  4ORB A;  1S70 A;  2Z72 A;  2QFR A;  2HYP A;  2ZBM A;  3H63 A;  4V0V A;  1S3N A;  2JOG A;  4H1S A;  3QG5 C;  3H69 A;  2NXF A;  4LU9 A;  2QFP A;  1QHW A;  4JA7 A;  5JPF A;  2WDF A;  3DW8 C;  2AHD A;  1OI8 A;  5IOH A;  4YKE A;  3H60 A;  2O8A A;  3N5U A;  4O5G A;  1XZW A;  2Z06 A;  3H61 A;  4Q7F A;  3H62 B;  3ICF A;  2IAE C;  4HD0 A;  4TUG A;  3PSO A;  1KBP A;  3GVE A;  4FBQ A;  4JA9 A;  2DXL A;  4ORA A;  5INB A;  1NNW A;  2NYM C;  3AUZ A;  3RL4 A;  1T70 A;  3H68 A;  5J28 A;  3V4Y A;  3D03 A;  4MOY A;  5B8I A;  4H1Y P;  4G9J A;  1OIE A;  3FLO A;  2Z1A A;  5JJT A;  4DT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...