4O43A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o43A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o43A01
2GJUA 3EGGA 4H2FA 1S3NA 4UWQA 4UT2A 4WWLA 1V73A 2O8GA 5JJTA 1HP1A 5J28A 5DNYA 4ZX2A 3FGAC 2WDEA 2A22A 3GVEA 5INBA 3H63A 4MOVA 5JPFA 3THOB 3H66A 4H2BA 1S8EA 2DFJA 5HPEA 2NPPC 1FJMA 2P6BA 4O24A 3QFKA 4FBQA 3IB7A 3H61A 3AV0A 1XM7A 2O8AA 4MOYA 2BCDA 2HYOA 2IE3C 3CK2A 2WDCA 4IYPC 1UF3A 4UT3A 3N5UA 4KKZA 3HVQA 3K7WC 4ORBA 4LTYA 1S3LA 2NYMC 4NZVA 2XMOA 4MP0A 2IE4C 1HPUA 3TGHA 3EGHA 5JPEA 2QFRA 1UTEA 2Q8UA 1JK7A 4UT3B 3IVEA 4O5GA 1KBPA 1OIDA 2ZBMA 2BQ8X 3IVDA 2WDDA 4ORAA 3PSNA 2CV9A 4FCXA 2KKNA 4H2IA 4XPNA 4O4KA 3PSOA 3T1IA 1S3MA 1NNWA 3V4YA 1OIEA 1OI8A 4I5NC 2IAEC 1S70A 3ZTVA 3THNA 1Z2XA 2Z72A 4V0WA 1T71A 1QHWA 2NYLC 2Z06A 1IT6A 3DW8C 3H60A 4FBKA 5B8IA 4Q7FA 5IOHA 4V0XA 3KBPA 3K7VC 2HYPA 4ZVZA 4KBPA 5GTUA 3ICFA 1T70A 4DSYA 4TUIA 3C9FA 1M63A 3QFNA 4JA9A 5F3WA 3RL4A 1SU1A 3E7AA 1II7A 3DSDA 3AUZA 3IB8A 4TUGA 1S95A 4I5LC 3QFMA 2HY1A 3H64A 3JYFA 5EQVA 2NXFA 4M0VA 3QG5C 3H68A 3H69A 3RL5A 4DHLA 1TCOA 1WAO1 4J6OA 4LACC 3RQZA 4V0VA 3ZU0A 3E7BA 4O43A 5C1VA 4H1YP 3RL3A 3P71C 1WARA 4G9JA 1W24A 2Z1AA 3C5WC 2QFPA 4IL1A 4ORCA 4DT2A 1QFCA 1USHA 3LL8A 2AHDA 4B2OA 1Z2WA 4JA7A 1G5BA 3DSCA 3H67A 2USHA 4HD0A 2WDFA 3H62B 4FBWA 4OR9A 4H2GA 2BDXA 3QFOA 1AUIA 2JOGA 4YKEA 4H1SA 1U32A 4LU9A 2YVTA 1MF8A 1XZWA 2QJCA 1HO5A 4F0ZA 2R17A
chains in the Genus database with same CATH superfamily
4WPYA 1YUJA 5KL2A 2L33A 4HEIA 2GJUA 1S3NA 2JVAA 2WBTA 4UWQA 4MLVA 1UHZA 4UT2A 1ZAAC 2O8GA 2MDGA 1HNWE 1F2IG 5DNYA 4ZX2A 3FGAC 3EPLA 5INBA 2YPNA 1AH5A 3J7Yp 1N34E 3THOB 1GTKA 4JI2E 1L4SA 2EPMX 2NPPC 1T39A 4O24A 2LUQA 4FK5C 4FBQA 2E5LE 3IB7A 3FIGA 3BF2A 3AV0A 4BS9A 2O8AA 2BCDA 3CK2A 4BCAA 2YTGA 2L8TA 1X5WA 2MC6A 5A2QC 4UT3A 1ZU1A 2DMIA 3JU0A 4KKZA 2R76A 2CTDA 5LMNE 2V85A 2XMOA 5JPEA 2IE4C 4DV4E 2F8BA 1EH7A 4DMIA 2BBGA 1XNQE 2EOMA 3IVDA 2V86A 2EPKX 2IHR1 3JAMC 4ORAA 2EPCA 4FCXA 4JV5E 2RSMA 4L8NA 4WXDA 1GQEA 1S3MA 2K7IA 5A6AA 3VHTB 2YEQA 1EH8A 5BR8E 3VYYA 4M2ZA 2ELZA 2Z72A 5A69A 5AE1A 2FGGA 5IOHA 3UK3C 2HYPA 2YTNA 1PJQA 1T70A 1WXRA 2CSHA 1KYQA 3QFNA 2GPIA 3EPHA 5F3WA 2ENAA 2YU8A 1YYKA 1II7A 1I94E 2EM3A 2EE8A 2UUAE 5IWAE 5IXMB 3IB8A 2EOHA 4HTGA 1YPNA 4F9CB 2WBUA 3FLOA 1YFHA 4DV7E 4DHLA 4DR1E 2L3JA 3ADJA 4J6OA 3J80C 1SR9A 4X65E 3RQZA 3BGHA 2KOUA 3E7BA 4B3ME 2ZOAA 2DIXA 4G9JA 1WARA 2YRKA 1W24A 2YSPA 3F6GA 2EJ4A 2QFPA 2EL4A 2EPOA 1QFCA 4F9BB 3DSCA 3L00A 2EMKA 1HNZE 4BMJA 2EMXA 2L92A 2BDXA 3HPZA 4K0KE 1U32A 4L5NC 2WBSA 4LU9A 4Q35B 4JI0E 2NUGA 4DR6E 2RS6A 1NCSA 1A1KA 1XMOE 1T4LB 4WX9A 2R17A 2JOXA 1T4OA 3EGGA 2LO3A 4GEQB 4H2FA 5KL3A 2ENCA 4WWLA 3JTZA 1UBDC 1HP1A 4GZNC 4I8OA 4RHBB 2WDEA 1JK1A 4MOVA 1MEYC 2DSYA 1S8EA 2DFJA 5HPEA 2ENHA 3E0JA 1IMUA 2LV2A 4R2RA 1DQ3A 3H61A 4P7DA 4M30A 1XM7A 2WZOA 2LTSA 1A1IA 1QNTA 2EN1A 1UF3A 4DV5E 4JI7E 1FKAE 5IT9C 4BBYA 1EKZA 3K7WC 3HPSA 4LTYA 4ZYDA 1S3LA 2EMFA 1HPUA 3TGHA 3IWCA 2QFRA 2EP3A 3HQ1A 2Q8UA 3TQMA 3T1YE 1J5EE 1JK7A 1A1JA 1N36E 2BQ8X 2M4IA 1A1LA 3PSNA 4JI1E 2KKNA 2YTIA 5LLQA 2EL5A 4O4KA 3T1IA 2YTFA 4OX9E 5AE2A 5AC5A 2EL6A 1NNWA 2EM7A 2EOZA 1OI8A 1TF6A 3THNA 3ADLA 1Z2XA 2DMYA 1PDAA 1T71A 3KZYA 3OTOE 4R8OA 2Z06A 4FBKA 2VF1A 4V0XA 3KZZA 4KBPA 3ICFA 1A1HA 1IBLE 2EN7A 2LRSA 1STUA 2EM2A 2LCEA 5KL6A 1YSAC 1SU1A 3DSDA 2EM4A 3AUZA 2B3TB 2EM9A 2FTXB 4RH8A 4JI6E 3IWDA 3RMPA 2YTPA 4KWYA 2JR1A 2V8QB 4JI8E 1HNXE 2YTJA 2EOYA 3H64A 4OOGC 4NHRA 1IBME 3C4TA 5EQVA 2EN6A 2EOJA 3QG5C 3H68A 2E72A 4X62E 2N8XA 2EOOA 4LF6E 1YZ9A 2WCC3 2EMYA 3K6QA 1TCOA 1X48A 5TSEA 4LACC 2RTXA 4J8ZA 1N33E 4DV1E 2EPXA 1PKPA 4DV6E 4V0VA 3ZU0A 2YTEA 4O43A 2CT1A 4H1YP 2VE7C 3P71C 2NUEA 4LF7E 4LF5E 3EPKA 4DT2A 2L2MA 1USHA 3IWBA 3LL8A 4X66E 2HGHA 4JA7A 1G5BA 1QU6A 3H67A 2ADRA 5A6BD 4FBWA 4F9AB 2LT7A 1TF3A 2UXBE 1IQSA 1FJGE 1XMQE 4F6MA 1PJTA 1HO5A 4F0ZA 1SFEA 4JI5E 4R2AA 2YZTA 2YU5A 4JI3E 2EOEA 2YTDA 3DF6A 2EN3A 5LMUE 5JJTA 4DUZE 2LJUA 5KL4A 5J28A 5JPFA 2NABA 2PRTA 2F4VE 2A22A 1WJPA 2E1MA 3H63A 3H66A 2P6BA 1FJMA 2M9AA 1X3CA 3MHSC 2ODRC 2HYOA 3EPJA 2IE3C 2DLKA 4IYPC 1GZ6A 2RQLA 2BB8A 2MKDA 2EPNA 3HTXA 2KHXA 2B9DA 3DJWA 2EMGA 2NYMC 1ZR9A 4ZYHA 4F2JC 3EGHA 5A6JA 2ELYA 4R2PA 4BHCA 4UT3B 3IVEA 4O5GA 1OIDA 2EWLA 2ZBMA 2WDDA 1XNRE 4GKKE 2CV9A 2EPRA 2EOQA 5CFFE 2NUFA 1X6EA 4H2IA 4XPNA 2R1FA 2EQ0A 3PSOA 4B3TE 4LF8E 2N3HA 3KWRA 4X64E 1OIEA 2UUCE 4I5NC 3ZTVA 2JXPA 2HJJA 2EPAA 5A6BA 4V0WA 2EM0A 3ADIA 1QHWA 4NXNE 2J7JA 2NYLC 4BC7A 5B8IA 2EN4A 4Q7FA 2YTOA 1ZBQA 2I9IA 4F6NA 4ZVZA 2EOFA 4R2CA 5GTUA 4WSPA 4R2SA 4DSYA 4TUIA 1BBOA 1UILA 2EM5A 4JA9A 4AQYE 2LTRA 3E7AA 4DR5E 2LUPB 2ZM6E 1TN9A 4TUGA 1RQ0A 1EH6A 4KHPE 4R2EA 2EMCA 2ZO9B 2EPUA 2EPZA 2HY1A 2EM8A 3H09A 3JYFA 1X47A 1BB8A 4M0VA 1PJSA 3ADGA 2EOXA 1DGCA 1WAO1 5IV8B 4JYAE 2DRPA 1WHQA 5C1VA 1YYWA 2L6MA 3D03A 4X8WA 2EN8A 1T4NA 1G2FC 2ODRD 4LFBE 5A6KA 2Z1AA 3C5WC 4IL1A 4ORCA 4Q28A 2USHA 2D9HA 2EMHA 4HD0A 4OR9A 4R2QA 2LVHA 3QFOA 1MGTA 2NA2A 1AUIA 4H1SA 4YKEA 5T6JA 4WSGA 2EMLA 2EQ1A 3C6MA 2EZ6A 2UXCE 2EPPA 4DV2E 4ZYEA 2GLIA 1MF8A 1XZWA 4IJDA 2MDRA 2H36X 2V89A 4KZSA 2MC5A 3M99B 4R03A 5ADZA 1UN6B 2DB2A 3C4BA 2HHHE 3ECRA 3VYXA 1V73A 4DR4E 2JPAA 3P1XA 2UU9E 1KJKA 3GVEA 4YY3E 4IS1C 4H2BA 4MLQA 2GHFA 2YSOA 3T1HE 3C6KA 4N4RB 4BC9A 4DKKA 3QFKA 2DXNA 2VRDA 1X6FA 1X6HA 2RPCA 4MOYA 3MSWA 4B3SE 2EMBA 2WDCA 4LFAE 2L2NA 3BIDA 2M1SA 2G7HA 2EORA 4P78A 2DLQA 2B7TA 1B69A 3N5UA 1G2DC 4NXME 3HVQA 2JP9A 4ORBA 5KL7A 2YRHA 4WYQB 2EOIA 4NZVA 4DUYE 4MP0A 2CPNA 3MHHC 2VQFE 1T38A 1UTEA 3BBGA 1IQOA 2B7VA 3F6HA 1KBPA 2DXLA 2EQ3A 4DR3E 4GKJE 1NEIA 2VQEE 2L3CA 2EMIA 2HC5A 4R2DA 3EQ1A 1AAYA 3V4YA 1A1GA 4M9VC 2RSIA 5AE3A 4LFCE 4JI4E 2EM6A 2KONA 2L2KB 1S70A 2IAEC 2YT4A 1N3GA 4LF4E 2EMWA 1ZBTA 2JOBA 1IT6A 3DW8C 3H60A 2UXDE 2LE2A 3KBPA 3K7VC 2A25A 2M7QA 2JYAA 3VK6A 3C9FA 1M63A 2MKNA 1P47A 4X9JA 3RL4A 2EPLX 2EMZA 1YYOA 2V87A 4DR2E 1A1FA 2LBSB 2I13A 4F54A 3LLHA 3J81C 2N3GA 1S95A 2EMAA 4I5LC 2YRMA 4DV3E 3QFMA 1YUIA 3OMLA 2V88A 2JWOA 2JY9A 2LJHA 4YHHE 2YWQA 1RMDA 4BHBA 2NXFA 4WFTA 3H69A 3RL5A 1WHNA 2EOSA 4DV0E 5KL5A 2V83A 1BBGA 5LL6R 4LF9E 4ZYGA 2K4VA 2LMZA 3LMLA 4WXCA 4DR7E 2EN2A 1IBKE 1O0WA 3ZOQB 4B3RE 3HXLA 3RL3A 1LLMC 1X49A 1JK2A 1RC7A 2AHDA 4B2OA 1Z2WA 5FLXC 2UUBE 3J7AG 2WDFA 3H62B 1HR0E 2YTQA 5AC4A 2RS7A 4H2GA 2JOGA 1N32E 2FV4B 5AASA 1J26A 1WRJA 2YVTA 2QJCA 1Z1BA 2DGCA 1DI2A
chains in the Genus database with same CATH topology
2GJUA 3EGGA 4H2FA 1S3NA 4UWQA 4UT2A 4WWLA 1V73A 2O8GA 5JJTA 1HP1A 5J28A 5DNYA 4ZX2A 3FGAC 2WDEA 2A22A 3GVEA 5INBA 3H63A 4MOVA 5JPFA 3THOB 3H66A 4H2BA 1S8EA 2DFJA 5HPEA 2NPPC 1FJMA 2P6BA 3E0JA 4O24A 3QFKA 2DXNA 4FBQA 3IB7A 3H61A 3AV0A 1XM7A 2O8AA 4MOYA 2BCDA 2HYOA 2IE3C 3CK2A 2WDCA 4IYPC 1UF3A 4UT3A 3N5UA 4KKZA 3HVQA 3K7WC 4ORBA 4LTYA 1S3LA 2NYMC 4NZVA 2XMOA 4MP0A 2IE4C 1HPUA 3TGHA 3EGHA 5JPEA 2QFRA 1UTEA 2Q8UA 1JK7A 4UT3B 3IVEA 4O5GA 1KBPA 1OIDA 2DXLA 2BQ8X 2ZBMA 3IVDA 2WDDA 4ORAA 3PSNA 2CV9A 4FCXA 2KKNA 4H2IA 4XPNA 4O4KA 3PSOA 3T1IA 1S3MA 1NNWA 2YEQA 3V4YA 1OIEA 1OI8A 4I5NC 2IAEC 1S70A 3ZTVA 3THNA 1Z2XA 2Z72A 4V0WA 1T71A 1QHWA 2NYLC 2Z06A 1IT6A 3DW8C 3H60A 4FBKA 5B8IA 4Q7FA 5IOHA 4V0XA 3KBPA 3K7VC 2HYPA 4ZVZA 4KBPA 5GTUA 3ICFA 1T70A 4DSYA 4TUIA 3C9FA 1M63A 3QFNA 4JA9A 5F3WA 3RL4A 1SU1A 3E7AA 1II7A 3DSDA 3AUZA 3IB8A 4TUGA 1S95A 4I5LC 3QFMA 2ZO9B 2HY1A 3H64A 3JYFA 5EQVA 2NXFA 4M0VA 3QG5C 3H68A 3H69A 3FLOA 3RL5A 4DHLA 1TCOA 1WAO1 4J6OA 4LACC 3RQZA 4V0VA 3ZU0A 3E7BA 4O43A 5C1VA 4H1YP 3RL3A 2ZOAA 3D03A 1WARA 3P71C 1W24A 2Z1AA 4G9JA 3C5WC 2QFPA 4IL1A 4ORCA 4DT2A 1QFCA 1USHA 3LL8A 2AHDA 4B2OA 1Z2WA 4JA7A 1G5BA 3DSCA 3H67A 2USHA 4HD0A 2WDFA 3H62B 4FBWA 4OR9A 4H2GA 2BDXA 3QFOA 1AUIA 2JOGA 4YKEA 4H1SA 1U32A 4LU9A 2YVTA 1MF8A 1XZWA 2QJCA 1HO5A 4F0ZA 2R17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJU A;  3EGG A;  4H2F A;  1S3N A;  4UWQ A;  4UT2 A;  4WWL A;  1V73 A;  2O8G A;  5JJT A;  1HP1 A;  5J28 A;  5DNY A;  4ZX2 A;  3FGA C;  2WDE A;  2A22 A;  3GVE A;  5INB A;  3H63 A;  4MOV A;  5JPF A;  3THO B;  3H66 A;  4H2B A;  1S8E A;  2DFJ A;  5HPE A;  2NPP C;  1FJM A;  2P6B A;  4O24 A;  3QFK A;  4FBQ A;  3IB7 A;  3H61 A;  3AV0 A;  1XM7 A;  2O8A A;  4MOY A;  2BCD A;  2HYO A;  2IE3 C;  3CK2 A;  2WDC A;  4IYP C;  1UF3 A;  4UT3 A;  3N5U A;  4KKZ A;  3HVQ A;  3K7W C;  4ORB A;  4LTY A;  1S3L A;  2NYM C;  4NZV A;  2XMO A;  4MP0 A;  2IE4 C;  1HPU A;  3TGH A;  3EGH A;  5JPE A;  2QFR A;  1UTE A;  2Q8U A;  1JK7 A;  4UT3 B;  3IVE A;  4O5G A;  1KBP A;  1OID A;  2ZBM A;  2BQ8 X;  3IVD A;  2WDD A;  4ORA A;  3PSN A;  2CV9 A;  4FCX A;  2KKN A;  4H2I A;  4XPN A;  4O4K A;  3PSO A;  3T1I A;  1S3M A;  1NNW A;  3V4Y A;  1OIE A;  1OI8 A;  4I5N C;  2IAE C;  1S70 A;  3ZTV A;  3THN A;  1Z2X A;  2Z72 A;  4V0W A;  1T71 A;  1QHW A;  2NYL C;  2Z06 A;  1IT6 A;  3DW8 C;  3H60 A;  4FBK A;  5B8I A;  4Q7F A;  5IOH A;  4V0X A;  3KBP A;  3K7V C;  2HYP A;  4ZVZ A;  4KBP A;  5GTU A;  3ICF A;  1T70 A;  4DSY A;  4TUI A;  3C9F A;  1M63 A;  3QFN A;  4JA9 A;  5F3W A;  3RL4 A;  1SU1 A;  3E7A A;  1II7 A;  3DSD A;  3AUZ A;  3IB8 A;  4TUG A;  1S95 A;  4I5L C;  3QFM A;  2HY1 A;  3H64 A;  3JYF A;  5EQV A;  2NXF A;  4M0V A;  3QG5 C;  3H68 A;  3H69 A;  3RL5 A;  4DHL A;  1TCO A;  1WAO 1;  4J6O A;  4LAC C;  3RQZ A;  4V0V A;  3ZU0 A;  3E7B A;  4O43 A;  5C1V A;  4H1Y P;  3RL3 A;  3P71 C;  1WAR A;  4G9J A;  1W24 A;  2Z1A A;  3C5W C;  2QFP A;  4IL1 A;  4ORC A;  4DT2 A;  1QFC A;  1USH A;  3LL8 A;  2AHD A;  4B2O A;  1Z2W A;  4JA7 A;  1G5B A;  3DSC A;  3H67 A;  2USH A;  4HD0 A;  2WDF A;  3H62 B;  4FBW A;  4OR9 A;  4H2G A;  2BDX A;  3QFO A;  1AUI A;  2JOG A;  4YKE A;  4H1S A;  1U32 A;  4LU9 A;  2YVT A;  1MF8 A;  1XZW A;  2QJC A;  1HO5 A;  4F0Z A;  2R17 A; 
#chains in the Genus database with same CATH topology
 4WPY A;  1YUJ A;  5KL2 A;  2L33 A;  4HEI A;  2GJU A;  1S3N A;  2JVA A;  2WBT A;  4UWQ A;  4MLV A;  1UHZ A;  4UT2 A;  1ZAA C;  2O8G A;  2MDG A;  1HNW E;  1F2I G;  5DNY A;  4ZX2 A;  3FGA C;  3EPL A;  5INB A;  2YPN A;  1AH5 A;  3J7Y p;  1N34 E;  3THO B;  1GTK A;  4JI2 E;  1L4S A;  2EPM X;  2NPP C;  1T39 A;  4O24 A;  2LUQ A;  4FK5 C;  4FBQ A;  2E5L E;  3IB7 A;  3FIG A;  3BF2 A;  3AV0 A;  4BS9 A;  2O8A A;  2BCD A;  3CK2 A;  4BCA A;  2YTG A;  2L8T A;  1X5W A;  2MC6 A;  5A2Q C;  4UT3 A;  1ZU1 A;  2DMI A;  3JU0 A;  4KKZ A;  2R76 A;  2CTD A;  5LMN E;  2V85 A;  2XMO A;  5JPE A;  2IE4 C;  4DV4 E;  2F8B A;  1EH7 A;  4DMI A;  2BBG A;  1XNQ E;  2EOM A;  3IVD A;  2V86 A;  2EPK X;  2IHR 1;  3JAM C;  4ORA A;  2EPC A;  4FCX A;  4JV5 E;  2RSM A;  4L8N A;  4WXD A;  1GQE A;  1S3M A;  2K7I A;  5A6A A;  3VHT B;  2YEQ A;  1EH8 A;  5BR8 E;  3VYY A;  4M2Z A;  2ELZ A;  2Z72 A;  5A69 A;  5AE1 A;  2FGG A;  5IOH A;  3UK3 C;  2HYP A;  2YTN A;  1PJQ A;  1T70 A;  1WXR A;  2CSH A;  1KYQ A;  3QFN A;  2GPI A;  3EPH A;  5F3W A;  2ENA A;  2YU8 A;  1YYK A;  1II7 A;  1I94 E;  2EM3 A;  2EE8 A;  2UUA E;  5IWA E;  5IXM B;  3IB8 A;  2EOH A;  4HTG A;  1YPN A;  4F9C B;  2WBU A;  3FLO A;  1YFH A;  4DV7 E;  4DHL A;  4DR1 E;  2L3J A;  3ADJ A;  4J6O A;  3J80 C;  1SR9 A;  4X65 E;  3RQZ A;  3BGH A;  2KOU A;  3E7B A;  4B3M E;  2ZOA A;  2DIX A;  4G9J A;  1WAR A;  2YRK A;  1W24 A;  2YSP A;  3F6G A;  2EJ4 A;  2QFP A;  2EL4 A;  2EPO A;  1QFC A;  4F9B B;  3DSC A;  3L00 A;  2EMK A;  1HNZ E;  4BMJ A;  2EMX A;  2L92 A;  2BDX A;  3HPZ A;  4K0K E;  1U32 A;  4L5N C;  2WBS A;  4LU9 A;  4Q35 B;  4JI0 E;  2NUG A;  4DR6 E;  2RS6 A;  1NCS A;  1A1K A;  1XMO E;  1T4L B;  4WX9 A;  2R17 A;  2JOX A;  1T4O A;  3EGG A;  2LO3 A;  4GEQ B;  4H2F A;  5KL3 A;  2ENC A;  4WWL A;  3JTZ A;  1UBD C;  1HP1 A;  4GZN C;  4I8O A;  4RHB B;  2WDE A;  1JK1 A;  4MOV A;  1MEY C;  2DSY A;  1S8E A;  2DFJ A;  5HPE A;  2ENH A;  3E0J A;  1IMU A;  2LV2 A;  4R2R A;  1DQ3 A;  3H61 A;  4P7D A;  4M30 A;  1XM7 A;  2WZO A;  2LTS A;  1A1I A;  1QNT A;  2EN1 A;  1UF3 A;  4DV5 E;  4JI7 E;  1FKA E;  5IT9 C;  4BBY A;  1EKZ A;  3K7W C;  3HPS A;  4LTY A;  4ZYD A;  1S3L A;  2EMF A;  1HPU A;  3TGH A;  3IWC A;  2QFR A;  2EP3 A;  3HQ1 A;  2Q8U A;  3TQM A;  3T1Y E;  1J5E E;  1JK7 A;  1A1J A;  1N36 E;  2BQ8 X;  2M4I A;  1A1L A;  3PSN A;  4JI1 E;  2KKN A;  2YTI A;  5LLQ A;  2EL5 A;  4O4K A;  3T1I A;  2YTF A;  4OX9 E;  5AE2 A;  5AC5 A;  2EL6 A;  1NNW A;  2EM7 A;  2EOZ A;  1OI8 A;  1TF6 A;  3THN A;  3ADL A;  1Z2X A;  2DMY A;  1PDA A;  1T71 A;  3KZY A;  3OTO E;  4R8O A;  2Z06 A;  4FBK A;  2VF1 A;  4V0X A;  3KZZ A;  4KBP A;  3ICF A;  1A1H A;  1IBL E;  2EN7 A;  2LRS A;  1STU A;  2EM2 A;  2LCE A;  5KL6 A;  1YSA C;  1SU1 A;  3DSD A;  2EM4 A;  3AUZ A;  2B3T B;  2EM9 A;  2FTX B;  4RH8 A;  4JI6 E;  3IWD A;  3RMP A;  2YTP A;  4KWY A;  2JR1 A;  2V8Q B;  4JI8 E;  1HNX E;  2YTJ A;  2EOY A;  3H64 A;  4OOG C;  4NHR A;  1IBM E;  3C4T A;  5EQV A;  2EN6 A;  2EOJ A;  3QG5 C;  3H68 A;  2E72 A;  4X62 E;  2N8X A;  2EOO A;  4LF6 E;  1YZ9 A;  2WCC 3;  2EMY A;  3K6Q A;  1TCO A;  1X48 A;  5TSE A;  4LAC C;  2RTX A;  4J8Z A;  1N33 E;  4DV1 E;  2EPX A;  1PKP A;  4DV6 E;  4V0V A;  3ZU0 A;  2YTE A;  4O43 A;  2CT1 A;  4H1Y P;  2VE7 C;  3P71 C;  2NUE A;  4LF7 E;  4LF5 E;  3EPK A;  4DT2 A;  2L2M A;  1USH A;  3IWB A;  3LL8 A;  4X66 E;  2HGH A;  4JA7 A;  1G5B A;  1QU6 A;  3H67 A;  2ADR A;  5A6B D;  4FBW A;  4F9A B;  2LT7 A;  1TF3 A;  2UXB E;  1IQS A;  1FJG E;  1XMQ E;  4F6M A;  1PJT A;  1HO5 A;  4F0Z A;  1SFE A;  4JI5 E;  4R2A A;  2YZT A;  2YU5 A;  4JI3 E;  2EOE A;  2YTD A;  3DF6 A;  2EN3 A;  5LMU E;  5JJT A;  4DUZ E;  2LJU A;  5KL4 A;  5J28 A;  5JPF A;  2NAB A;  2PRT A;  2F4V E;  2A22 A;  1WJP A;  2E1M A;  3H63 A;  3H66 A;  2P6B A;  1FJM A;  2M9A A;  1X3C A;  3MHS C;  2ODR C;  2HYO A;  3EPJ A;  2IE3 C;  2DLK A;  4IYP C;  1GZ6 A;  2RQL A;  2BB8 A;  2MKD A;  2EPN A;  3HTX A;  2KHX A;  2B9D A;  3DJW A;  2EMG A;  2NYM C;  1ZR9 A;  4ZYH A;  4F2J C;  3EGH A;  5A6J A;  2ELY A;  4R2P A;  4BHC A;  4UT3 B;  3IVE A;  4O5G A;  1OID A;  2EWL A;  2ZBM A;  2WDD A;  1XNR E;  4GKK E;  2CV9 A;  2EPR A;  2EOQ A;  5CFF E;  2NUF A;  1X6E A;  4H2I A;  4XPN A;  2R1F A;  2EQ0 A;  3PSO A;  4B3T E;  4LF8 E;  2N3H A;  3KWR A;  4X64 E;  1OIE A;  2UUC E;  4I5N C;  3ZTV A;  2JXP A;  2HJJ A;  2EPA A;  5A6B A;  4V0W A;  2EM0 A;  3ADI A;  1QHW A;  4NXN E;  2J7J A;  2NYL C;  4BC7 A;  5B8I A;  2EN4 A;  4Q7F A;  2YTO A;  1ZBQ A;  2I9I A;  4F6N A;  4ZVZ A;  2EOF A;  4R2C A;  5GTU A;  4WSP A;  4R2S A;  4DSY A;  4TUI A;  1BBO A;  1UIL A;  2EM5 A;  4JA9 A;  4AQY E;  2LTR A;  3E7A A;  4DR5 E;  2LUP B;  2ZM6 E;  1TN9 A;  4TUG A;  1RQ0 A;  1EH6 A;  4KHP E;  4R2E A;  2EMC A;  2ZO9 B;  2EPU A;  2EPZ A;  2HY1 A;  2EM8 A;  3H09 A;  3JYF A;  1X47 A;  1BB8 A;  4M0V A;  1PJS A;  3ADG A;  2EOX A;  1DGC A;  1WAO 1;  5IV8 B;  4JYA E;  2DRP A;  1WHQ A;  5C1V A;  1YYW A;  2L6M A;  3D03 A;  4X8W A;  2EN8 A;  1T4N A;  1G2F C;  2ODR D;  4LFB E;  5A6K A;  2Z1A A;  3C5W C;  4IL1 A;  4ORC A;  4Q28 A;  2USH A;  2D9H A;  2EMH A;  4HD0 A;  4OR9 A;  4R2Q A;  2LVH A;  3QFO A;  1MGT A;  2NA2 A;  1AUI A;  4H1S A;  4YKE A;  5T6J A;  4WSG A;  2EML A;  2EQ1 A;  3C6M A;  2EZ6 A;  2UXC E;  2EPP A;  4DV2 E;  4ZYE A;  2GLI A;  1MF8 A;  1XZW A;  4IJD A;  2MDR A;  2H36 X;  2V89 A;  4KZS A;  2MC5 A;  3M99 B;  4R03 A;  5ADZ A;  1UN6 B;  2DB2 A;  3C4B A;  2HHH E;  3ECR A;  3VYX A;  1V73 A;  4DR4 E;  2JPA A;  3P1X A;  2UU9 E;  1KJK A;  3GVE A;  4YY3 E;  4IS1 C;  4H2B A;  4MLQ A;  2GHF A;  2YSO A;  3T1H E;  3C6K A;  4N4R B;  4BC9 A;  4DKK A;  3QFK A;  2DXN A;  2VRD A;  1X6F A;  1X6H A;  2RPC A;  4MOY A;  3MSW A;  4B3S E;  2EMB A;  2WDC A;  4LFA E;  2L2N A;  3BID A;  2M1S A;  2G7H A;  2EOR A;  4P78 A;  2DLQ A;  2B7T A;  1B69 A;  3N5U A;  1G2D C;  4NXM E;  3HVQ A;  2JP9 A;  4ORB A;  5KL7 A;  2YRH A;  4WYQ B;  2EOI A;  4NZV A;  4DUY E;  4MP0 A;  2CPN A;  3MHH C;  2VQF E;  1T38 A;  1UTE A;  3BBG A;  1IQO A;  2B7V A;  3F6H A;  1KBP A;  2DXL A;  2EQ3 A;  4DR3 E;  4GKJ E;  1NEI A;  2VQE E;  2L3C A;  2EMI A;  2HC5 A;  4R2D A;  3EQ1 A;  1AAY A;  3V4Y A;  1A1G A;  4M9V C;  2RSI A;  5AE3 A;  4LFC E;  4JI4 E;  2EM6 A;  2KON A;  2L2K B;  1S70 A;  2IAE C;  2YT4 A;  1N3G A;  4LF4 E;  2EMW A;  1ZBT A;  2JOB A;  1IT6 A;  3DW8 C;  3H60 A;  2UXD E;  2LE2 A;  3KBP A;  3K7V C;  2A25 A;  2M7Q A;  2JYA A;  3VK6 A;  3C9F A;  1M63 A;  2MKN A;  1P47 A;  4X9J A;  3RL4 A;  2EPL X;  2EMZ A;  1YYO A;  2V87 A;  4DR2 E;  1A1F A;  2LBS B;  2I13 A;  4F54 A;  3LLH A;  3J81 C;  2N3G A;  1S95 A;  2EMA A;  4I5L C;  2YRM A;  4DV3 E;  3QFM A;  1YUI A;  3OML A;  2V88 A;  2JWO A;  2JY9 A;  2LJH A;  4YHH E;  2YWQ A;  1RMD A;  4BHB A;  2NXF A;  4WFT A;  3H69 A;  3RL5 A;  1WHN A;  2EOS A;  4DV0 E;  5KL5 A;  2V83 A;  1BBG A;  5LL6 R;  4LF9 E;  4ZYG A;  2K4V A;  2LMZ A;  3LML A;  4WXC A;  4DR7 E;  2EN2 A;  1IBK E;  1O0W A;  3ZOQ B;  4B3R E;  3HXL A;  3RL3 A;  1LLM C;  1X49 A;  1JK2 A;  1RC7 A;  2AHD A;  4B2O A;  1Z2W A;  5FLX C;  2UUB E;  3J7A G;  2WDF A;  3H62 B;  1HR0 E;  2YTQ A;  5AC4 A;  2RS7 A;  4H2G A;  2JOG A;  1N32 E;  2FV4 B;  5AAS A;  1J26 A;  1WRJ A;  2YVT A;  2QJC A;  1Z1B A;  2DGC A;  1DI2 A; 
#chains in the Genus database with same CATH homology
 2GJU A;  3EGG A;  4H2F A;  1S3N A;  4UWQ A;  4UT2 A;  4WWL A;  1V73 A;  2O8G A;  5JJT A;  1HP1 A;  5J28 A;  5DNY A;  4ZX2 A;  3FGA C;  2WDE A;  2A22 A;  3GVE A;  5INB A;  3H63 A;  4MOV A;  5JPF A;  3THO B;  3H66 A;  4H2B A;  1S8E A;  2DFJ A;  5HPE A;  2NPP C;  1FJM A;  2P6B A;  3E0J A;  4O24 A;  3QFK A;  2DXN A;  4FBQ A;  3IB7 A;  3H61 A;  3AV0 A;  1XM7 A;  2O8A A;  4MOY A;  2BCD A;  2HYO A;  2IE3 C;  3CK2 A;  2WDC A;  4IYP C;  1UF3 A;  4UT3 A;  3N5U A;  4KKZ A;  3HVQ A;  3K7W C;  4ORB A;  4LTY A;  1S3L A;  2NYM C;  4NZV A;  2XMO A;  4MP0 A;  2IE4 C;  1HPU A;  3TGH A;  3EGH A;  5JPE A;  2QFR A;  1UTE A;  2Q8U A;  1JK7 A;  4UT3 B;  3IVE A;  4O5G A;  1KBP A;  1OID A;  2DXL A;  2BQ8 X;  2ZBM A;  3IVD A;  2WDD A;  4ORA A;  3PSN A;  2CV9 A;  4FCX A;  2KKN A;  4H2I A;  4XPN A;  4O4K A;  3PSO A;  3T1I A;  1S3M A;  1NNW A;  2YEQ A;  3V4Y A;  1OIE A;  1OI8 A;  4I5N C;  2IAE C;  1S70 A;  3ZTV A;  3THN A;  1Z2X A;  2Z72 A;  4V0W A;  1T71 A;  1QHW A;  2NYL C;  2Z06 A;  1IT6 A;  3DW8 C;  3H60 A;  4FBK A;  5B8I A;  4Q7F A;  5IOH A;  4V0X A;  3KBP A;  3K7V C;  2HYP A;  4ZVZ A;  4KBP A;  5GTU A;  3ICF A;  1T70 A;  4DSY A;  4TUI A;  3C9F A;  1M63 A;  3QFN A;  4JA9 A;  5F3W A;  3RL4 A;  1SU1 A;  3E7A A;  1II7 A;  3DSD A;  3AUZ A;  3IB8 A;  4TUG A;  1S95 A;  4I5L C;  3QFM A;  2ZO9 B;  2HY1 A;  3H64 A;  3JYF A;  5EQV A;  2NXF A;  4M0V A;  3QG5 C;  3H68 A;  3H69 A;  3FLO A;  3RL5 A;  4DHL A;  1TCO A;  1WAO 1;  4J6O A;  4LAC C;  3RQZ A;  4V0V A;  3ZU0 A;  3E7B A;  4O43 A;  5C1V A;  4H1Y P;  3RL3 A;  2ZOA A;  3D03 A;  1WAR A;  3P71 C;  1W24 A;  2Z1A A;  4G9J A;  3C5W C;  2QFP A;  4IL1 A;  4ORC A;  4DT2 A;  1QFC A;  1USH A;  3LL8 A;  2AHD A;  4B2O A;  1Z2W A;  4JA7 A;  1G5B A;  3DSC A;  3H67 A;  2USH A;  4HD0 A;  2WDF A;  3H62 B;  4FBW A;  4OR9 A;  4H2G A;  2BDX A;  3QFO A;  1AUI A;  2JOG A;  4YKE A;  4H1S A;  1U32 A;  4LU9 A;  2YVT A;  1MF8 A;  1XZW A;  2QJC A;  1HO5 A;  4F0Z A;  2R17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...