4O43A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
b'IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o43A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o43A01
2Z06A 4IYPC 4LU9A 4UT3B 3RL4A 2Z72A 4Q7FA 3THOB 4J6OA 4V0VA 2WDFA 2NYMC 4I5LC 3RQZA 4DSYA 4MP0A 3RL5A 3CK2A 3IB7A 2YVTA 4ORAA 2HYPA 3PSNA 3IVDA 3IB8A 3C9FA 4H1SA 4TUGA 5JJTA 3QG5C 3V4YA 1NNWA 3E7AA 1OIEA 2GJUA 1UTEA 4NZVA 4KBPA 1USHA 2WDCA 4FCXA 4ZVZA 4DHLA 4M0VA 3EGHA 4UWQA 3DSCA 2XMOA 2QFRA 1U32A 3E7BA 3QFNA 3K7WC 3ZU0A 1IT6A 1II7A 4HD0A 2O8GA 2Z1AA 3KBPA 4H2GA 3QFKA 4FBKA 4UT3A 1V73A 2IE3C 3QFOA 5F3WA 3AUZA 1QHWA 2BQ8X 4JA7A 1G5BA 2HYOA 3H60A 5IOHA 2Q8UA 2USHA 4H2FA 3GVEA 3IVEA 3DW8C 4V0WA 5B8IA 3H63A 5JPEA 1HP1A 1WARA 5C1VA 1AUIA 3H64A 1UF3A 2AHDA 3HVQA 4ORBA 3LL8A 3K7VC 4UT2A 2P6BA 2WDEA 4JA9A 3JYFA 4MOYA 1S95A 1S3LA 4O24A 1OIDA 3P71C 4YKEA 3RL3A 4H1YP 1Z2WA 4V0XA 4TUIA 2O8AA 2IAEC 3DSDA 4LACC 3H66A 2HY1A 1JK7A 1S70A 4ZX2A 5JPFA 4I5NC 5J28A 1W24A 2DFJA 2IE4C 1TCOA 5GTUA 4O5GA 4LTYA 3PSOA 1Z2XA 1KBPA 1MF8A 2JOGA 1HPUA 1M63A 1WAO1 3H69A 3TGHA 2QFPA 3N5UA 3C5WC 3H61A 5HPEA 1XM7A 5DNYA 1T70A 4DT2A 3H62B 4O43A 4ORCA 5EQVA 2A22A 3AV0A 3H67A 2WDDA 2KKNA 1QFCA 4WWLA 4KKZA 4FBWA 3FGAC 4FBQA 3ZTVA 5INBA 3ICFA 2BCDA 3EGGA 4O4KA 1T71A 2NPPC 2ZBMA 1HO5A 3QFMA 2QJCA 4G9JA 4IL1A 4OR9A 2NYLC 4MOVA 1S3MA 1XZWA 2CV9A 3H68A 4H2IA 4F0ZA 4XPNA 3T1IA 1S8EA 4H2BA 3THNA 2NXFA 4B2OA 1FJMA 1OI8A 2R17A 2BDXA 1SU1A 1S3NA
chains in the Genus database with same CATH superfamily
2M9AA 2Z06A 4IYPC 1DQ3A 2Z72A 4GKJE 2HJJA 4WSPA 4DMIA 4IJDA 5T6JA 5ADZA 2CTDA 4ZYGA 4R2QA 1FKAE 3IB7A 2M7QA 5KL7A 3OMLA 4F6MA 2CPNA 1PDAA 2LTSA 1XNRE 4ORAA 1TF3A 2EM2A 4TUGA 3C6MA 1YYWA 4R2RA 3QG5C 2YU8A 1NNWA 4WSGA 3TQMA 2LT7A 3MHSC 1UTEA 4F6NA 2ZO9B 1A1HA 4UWQA 3DSCA 3ZU0A 3EPLA 2LVHA 3KBPA 4LFBE 2ADRA 4FBKA 1V73A 2JXPA 2NA2A 3QFOA 2UU9E 2EN4A 1X6EA 3ADJA 4JI0E 2YSPA 2DIXA 2YPNA 5BR8E 3J80C 4DV1E 5FLXC 3H60A 1IQOA 4FK5C 1EH6A 2UUBE 3JAMC 3J81C 3RMPA 4H2FA 3IVEA 3DW8C 2EOIA 3M99B 2DLKA 2L3JA 2DSYA 5LMUE 1A1IA 2EMLA 1ZBQA 3HVQA 2E72A 2JPAA 4ZYHA 2ENAA 1G2DC 4IS1C 3LL8A 5A6JA 4HEIA 4MOYA 2EN3A 2H36X 1S3LA 1HNZE 1OIDA 5CFFE 4H1YP 2EMWA 3VK6A 2V86A 1SFEA 4JI2E 4DR4E 2EPNA 4LACC 4OX9E 2HY1A 2LO3A 1S70A 4DR3E 2K4VA 5JPFA 1BBGA 2EE8A 5J28A 2CSHA 1GZ6A 2DGCA 4JI3E 2J7JA 1TCOA 5GTUA 2EMHA 3OTOE 4DR5E 3PSOA 2EOJA 3KWRA 4DV5E 2EL4A 2KOUA 2RS6A 1T4LB 2D9HA 4YY3E 2JOGA 4NXME 4DR7E 3K6QA 4KHPE 2EM6A 2LMZA 4NHRA 1AAYA 1T70A 1HNXE 4O43A 5EQVA 1GQEA 4JI4E 4WPYA 3KZZA 2YTPA 4R2AA 2FGGA 1JK1A 3ZTVA 2JYAA 2KHXA 3IWDA 2HHHE 1UN6B 3ICFA 5INBA 3EGGA 2RQLA 4O4KA 4L5NC 2NPPC 2ZBMA 1HO5A 2ENHA 2NYLC 3IWCA 2EMIA 2HC5A 4F0ZA 5A6KA 2RPCA 3T1IA 4H2BA 2JP9A 4BCAA 4BMJA 4R2EA 1L4SA 5KL6A 2RS7A 4B2OA 2CT1A 2IHR1 2L92A 2DLQA 2LJUA 2YTDA 2YTQA 3HPSA 4DV4E 4BC9A 1S3NA 4B3RE 1A1GA 4Q7FA 5LL6R 2EM8A 4JI6E 3THOB 2EM5A 2WDFA 2EMZA 1JK2A 1UHZA 2M4IA 2V87A 3BBGA 1DI2A 2EPKX 4R2CA 3RL5A 2E5LE 2DXNA 1QU6A 3JU0A 2EM3A 2DMYA 4DUYE 4X9JA 2NUFA 1PJQA 4N4RB 4R2SA 4I8OA 4BHBA 2UXCE 1T4NA 2LUPB 1USHA 1PKPA 3UK3C 5IXMB 4ZVZA 5A2QC 4LF7E 3MSWA 1O0WA 4RHBB 2LUQA 2XMOA 3K7WC 5IWAE 1IT6A 4HD0A 4UT3A 4LFCE 2F8BA 3AUZA 1SR9A 2L2MA 4WYQB 2BQ8X 3VYXA 1RQ0A 1XMOE 3ADIA 2UUAE 2EM0A 2JOBA 4JA7A 1WHNA 4DV7E 1YFHA 2HYOA 1X6FA 2EL6A 2WBTA 2Q8UA 2MC5A 2YTJA 2YZTA 4DR1E 5JPEA 2ENCA 1HP1A 5C1VA 3H64A 2R76A 4LF6E 3ADLA 4DV6E 2RSMA 2DB2A 3P1XA 1T4OA 4F9BB 1ZAAC 2EPLX 3EPHA 2P6BA 4JA9A 3HPZA 2L6MA 3LLHA 1A1LA 4F9AB 5AASA 3EPJA 3P71C 1PJTA 3RL3A 4V0XA 1X3CA 2LE2A 2O8AA 2L33A 3DSDA 2EORA 3H66A 2B9DA 4LF5E 4ZX2A 2ZM6E 2UUCE 1EKZA 4I5NC 1GTKA 1W24A 2DFJA 1QNTA 2EMGA 2EOEA 4X8WA 2A25A 4L8NA 4RH8A 1M63A 1WAO1 4M9VC 3LMLA 2JWOA 1IBKE 3H69A 2QFPA 4B3ME 2L8TA 4DUZE 3C5WC 2YTEA 4Q35B 1XMQE 2EMAA 1XM7A 1RC7A 1ZBTA 1ZR9A 4LFAE 2EOYA 1EH7A 2EPUA 3H62B 4ORCA 1WJPA 2EOOA 2A22A 2EPZA 4M30A 2WDDA 2KKNA 2VF1A 4KKZA 2LJHA 2EP3A 4FBQA 2BCDA 1EH8A 4OR9A 2BB8A 2QJCA 1IQSA 3L00A 1WRJA 2BBGA 1N33E 2YEQA 4MOVA 1XZWA 3H68A 1YSAC 4H2IA 2EN8A 1IBLE 2EN2A 1X5WA 3THNA 2EOMA 3BIDA 3F6HA 2N3HA 2EPPA 4MLQA 5KL5A 2EOXA 2EPAA 2EOSA 1SU1A 2V85A 1STUA 4R2DA 2WBSA 4UT3B 1YPNA 3HTXA 2V8QB 1J26A 4V0VA 2GPIA 4I5LC 5AE3A 2EN6A 2LTRA 2JVAA 1NCSA 1YZ9A 4DSYA 2EPRA 2EMKA 4MP0A 1A1JA 3CK2A 1T39A 4K0KE 2YRKA 2F4VE 3IVDA 5IV8B 4H1SA 1ZU1A 5KL2A 2M1SA 4OOGC 4X64E 5JJTA 3V4YA 1X47A 2GJUA 2GHFA 4NZVA 1WHQA 2I13A 2WDCA 1UBDC 4DHLA 4M0VA 2YRHA 4F54A 1HR0E 2NUEA 3EGHA 2EPCA 2QFRA 1XNQE 2EOFA 2O8GA 4H2GA 3QFKA 2EMYA 2YWQA 2JY9A 2EWLA 1X6HA 2R1FA 1QHWA 1G5BA 4X66E 3J7Yp 2N8XA 4HTGA 2ELYA 2ELZA 5IOHA 2USHA 2EOQA 2UXDE 1YYKA 3GVEA 3DF6A 4V0WA 5B8IA 3H63A 1WARA 1WXRA 1AUIA 2EMFA 1MGTA 1A1KA 2AHDA 1FJGE 1AH5A 1BBOA 3D03A 3E0JA 4ORBA 2YU5A 4WFTA 2VRDA 2JOXA 1S95A 1YYOA 4B3TE 4NXNE 1HNWE 5IT9C 2L2NA 1IBME 2YT4A 4LF8E 4ZYEA 5AC4A 5LLQA 1Z2WA 3DJWA 3ADGA 2IAEC 2NABA 1UILA 3BF2A 2WCC3 2B7TA 3MHHC 3C4BA 2VE7C 3ZOQB 1Z1BA 1KJKA 4F2JC 4LTYA 1TF6A 1PJSA 4WX9A 1KBPA 1MF8A 3TGHA 2YSOA 3JTZA 3HXLA 3N5UA 5AE2A 3FLOA 1MEYC 2GLIA 5AE1A 3AV0A 4LF4E 4P78A 3KZYA 2DRPA 2MKNA 5LMNE 4B3SE 3FGAC 2N3GA 4IL1A 1T71A 4G9JA 2EQ0A 2MDRA 2FTXB 1S3MA 2YTOA 3H09A 4X62E 4BS9A 4WXDA 4F9CB 2LRSA 4XPNA 4MLVA 5A69A 2ZOAA 2EQ1A 2NXFA 1FJMA 4JI5E 1OI8A 1J5EE 2YTIA 4JV5E 2LV2A 4DV3E 2R17A 2BDXA 1TN9A 4LU9A 2EPXA 3RL4A 4J6OA 2NYMC 3RQZA 2WBUA 1N32E 1IMUA 2I9IA 5AC5A 2YVTA 4DR2E 3ECRA 2HYPA 3PSNA 3IB8A 3C9FA 2EM7A 2V83A 2EJ4A 3E7AA 3HQ1A 3EPKA 1N3GA 1OIEA 4KBPA 2PRTA 2MC6A 4KZSA 4FCXA 2K7IA 3FIGA 2L3CA 4DR6E 1NEIA 2RTXA 4BC7A 5KL3A 1U32A 3E7BA 2KONA 2UXBE 4JYAE 1I94E 3QFNA 1II7A 2Z1AA 4Q28A 2EM9A 2IE3C 2FV4B 5F3WA 1G2FC 1N36E 2MDGA 1A1FA 1YUIA 5TSEA 1X48A 4P7DA 4M2ZA 4JI1E 2EQ3A 2YTFA 2HGHA 2G7HA 1UF3A 2B3TB 1F2IG 4WXCA 4X65E 2YRMA 2YTGA 2EPOA 2EPMX 3K7VC 5A6AA 4UT2A 2WDEA 3C4TA 3JYFA 4BBYA 2E1MA 4R2PA 4O24A 3T1YE 4YKEA 3F6GA 1X49A 4TUIA 2L2KB 2V88A 4JI7E 2EOHA 1N34E 1JK7A 2YTNA 2IE4C 4AQYE 1DGCA 4GEQB 3EQ1A 4O5GA 2NUGA 2EM4A 3IWBA 4R03A 2EN7A 1RMDA 5KL4A 1Z2XA 5A6BD 1HPUA 2RSIA 2EL5A 2EMXA 4J8ZA 2LBSB 4GZNC 3VYYA 5A6BA 4JI8E 3H61A 5HPEA 1T38A 2EOZA 5DNYA 2DXLA 4DT2A 3T1HE 4DKKA 2VQEE 2WZOA 3BGHA 4DV0E 3H67A 3C6KA 1LLMC 1YUJA 1QFCA 2B7VA 2LCEA 4WWLA 4FBWA 4KWYA 4R8OA 4LF9E 2MKDA 2ODRD 3QFMA 2JR1A 4YHHE 2EMBA 2EN1A 2ODRC 2CV9A 4DV2E 3J7AG 2V89A 1S8EA 4GKKE 4ZYDA 1KYQA 3VHTB 1P47A 1B69A 2EZ6A 4BHCA 2EMCA 2DMIA 1BB8A 2VQFE
chains in the Genus database with same CATH topology
2Z06A 4IYPC 4LU9A 4UT3B 3RL4A 2Z72A 4Q7FA 3THOB 4J6OA 4V0VA 2WDFA 2NYMC 4I5LC 3RQZA 4DSYA 4MP0A 3RL5A 3CK2A 3IB7A 2DXNA 2YVTA 4ORAA 2HYPA 3PSNA 3IVDA 3IB8A 3C9FA 4H1SA 4TUGA 5JJTA 3QG5C 3V4YA 1NNWA 3E7AA 1OIEA 2GJUA 1UTEA 4NZVA 2ZO9B 4KBPA 1USHA 2WDCA 4FCXA 4ZVZA 4DHLA 4M0VA 3EGHA 3DSCA 4UWQA 2XMOA 1U32A 2QFRA 3E7BA 3QFNA 3K7WC 3ZU0A 1IT6A 1II7A 4HD0A 2O8GA 2Z1AA 3KBPA 4H2GA 3QFKA 4FBKA 4UT3A 1V73A 2IE3C 3QFOA 5F3WA 3AUZA 1QHWA 2BQ8X 4JA7A 1G5BA 2HYOA 3H60A 5IOHA 2Q8UA 2USHA 4H2FA 3GVEA 3IVEA 3DW8C 4V0WA 5B8IA 3H63A 5JPEA 1HP1A 1WARA 5C1VA 1AUIA 3H64A 1UF3A 2AHDA 3HVQA 3D03A 3E0JA 4ORBA 3LL8A 3K7VC 4UT2A 2P6BA 2WDEA 4JA9A 3JYFA 4MOYA 1S95A 1S3LA 4O24A 1OIDA 3P71C 4YKEA 3RL3A 4H1YP 1Z2WA 4V0XA 4TUIA 2O8AA 2IAEC 3DSDA 4LACC 3H66A 2HY1A 1JK7A 1S70A 4ZX2A 5JPFA 4I5NC 5J28A 1W24A 2DFJA 2IE4C 1TCOA 5GTUA 4O5GA 4LTYA 3PSOA 1Z2XA 1KBPA 1MF8A 2JOGA 1HPUA 1M63A 1WAO1 3H69A 3TGHA 2QFPA 3N5UA 3C5WC 3FLOA 3H61A 5HPEA 1XM7A 5DNYA 1T70A 2DXLA 4DT2A 3H62B 4O43A 4ORCA 5EQVA 2A22A 3AV0A 3H67A 2WDDA 2KKNA 1QFCA 4WWLA 4KKZA 4FBWA 3FGAC 4FBQA 3ZTVA 5INBA 3ICFA 2BCDA 3EGGA 4O4KA 1T71A 2NPPC 2ZBMA 1HO5A 3QFMA 2QJCA 4G9JA 4IL1A 4OR9A 2NYLC 2YEQA 4MOVA 1S3MA 1XZWA 2CV9A 3H68A 4H2IA 4F0ZA 4XPNA 3T1IA 1S8EA 4H2BA 3THNA 2ZOAA 2NXFA 4B2OA 1FJMA 1OI8A 2R17A 2BDXA 1SU1A 1S3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z06 A;  4IYP C;  4LU9 A;  4UT3 B;  3RL4 A;  2Z72 A;  4Q7F A;  3THO B;  4J6O A;  4V0V A;  2WDF A;  2NYM C;  4I5L C;  3RQZ A;  4DSY A;  4MP0 A;  3RL5 A;  3CK2 A;  3IB7 A;  2YVT A;  4ORA A;  2HYP A;  3PSN A;  3IVD A;  3IB8 A;  3C9F A;  4H1S A;  4TUG A;  5JJT A;  3QG5 C;  3V4Y A;  1NNW A;  3E7A A;  1OIE A;  2GJU A;  1UTE A;  4NZV A;  4KBP A;  1USH A;  2WDC A;  4FCX A;  4ZVZ A;  4DHL A;  4M0V A;  3EGH A;  4UWQ A;  3DSC A;  2XMO A;  2QFR A;  1U32 A;  3E7B A;  3QFN A;  3K7W C;  3ZU0 A;  1IT6 A;  1II7 A;  4HD0 A;  2O8G A;  2Z1A A;  3KBP A;  4H2G A;  3QFK A;  4FBK A;  4UT3 A;  1V73 A;  2IE3 C;  3QFO A;  5F3W A;  3AUZ A;  1QHW A;  2BQ8 X;  4JA7 A;  1G5B A;  2HYO A;  3H60 A;  5IOH A;  2Q8U A;  2USH A;  4H2F A;  3GVE A;  3IVE A;  3DW8 C;  4V0W A;  5B8I A;  3H63 A;  5JPE A;  1HP1 A;  1WAR A;  5C1V A;  1AUI A;  3H64 A;  1UF3 A;  2AHD A;  3HVQ A;  4ORB A;  3LL8 A;  3K7V C;  4UT2 A;  2P6B A;  2WDE A;  4JA9 A;  3JYF A;  4MOY A;  1S95 A;  1S3L A;  4O24 A;  1OID A;  3P71 C;  4YKE A;  3RL3 A;  4H1Y P;  1Z2W A;  4V0X A;  4TUI A;  2O8A A;  2IAE C;  3DSD A;  4LAC C;  3H66 A;  2HY1 A;  1JK7 A;  1S70 A;  4ZX2 A;  5JPF A;  4I5N C;  5J28 A;  1W24 A;  2DFJ A;  2IE4 C;  1TCO A;  5GTU A;  4O5G A;  4LTY A;  3PSO A;  1Z2X A;  1KBP A;  1MF8 A;  2JOG A;  1HPU A;  1M63 A;  1WAO 1;  3H69 A;  3TGH A;  2QFP A;  3N5U A;  3C5W C;  3H61 A;  5HPE A;  1XM7 A;  5DNY A;  1T70 A;  4DT2 A;  3H62 B;  4O43 A;  4ORC A;  5EQV A;  2A22 A;  3AV0 A;  3H67 A;  2WDD A;  2KKN A;  1QFC A;  4WWL A;  4KKZ A;  4FBW A;  3FGA C;  4FBQ A;  3ZTV A;  5INB A;  3ICF A;  2BCD A;  3EGG A;  4O4K A;  1T71 A;  2NPP C;  2ZBM A;  1HO5 A;  3QFM A;  2QJC A;  4G9J A;  4IL1 A;  4OR9 A;  2NYL C;  4MOV A;  1S3M A;  1XZW A;  2CV9 A;  3H68 A;  4H2I A;  4F0Z A;  4XPN A;  3T1I A;  1S8E A;  4H2B A;  3THN A;  2NXF A;  4B2O A;  1FJM A;  1OI8 A;  2R17 A;  2BDX A;  1SU1 A;  1S3N A; 
#chains in the Genus database with same CATH topology
 2M9A A;  2Z06 A;  4IYP C;  1DQ3 A;  2Z72 A;  4GKJ E;  2HJJ A;  4WSP A;  4DMI A;  4IJD A;  5T6J A;  5ADZ A;  2CTD A;  4ZYG A;  4R2Q A;  1FKA E;  3IB7 A;  2M7Q A;  5KL7 A;  3OML A;  4F6M A;  2CPN A;  1PDA A;  2LTS A;  1XNR E;  4ORA A;  1TF3 A;  2EM2 A;  4TUG A;  3C6M A;  1YYW A;  4R2R A;  3QG5 C;  2YU8 A;  1NNW A;  4WSG A;  3TQM A;  2LT7 A;  3MHS C;  1UTE A;  4F6N A;  2ZO9 B;  1A1H A;  4UWQ A;  3DSC A;  3ZU0 A;  3EPL A;  2LVH A;  3KBP A;  4LFB E;  2ADR A;  4FBK A;  1V73 A;  2JXP A;  2NA2 A;  3QFO A;  2UU9 E;  2EN4 A;  1X6E A;  3ADJ A;  4JI0 E;  2YSP A;  2DIX A;  2YPN A;  5BR8 E;  3J80 C;  4DV1 E;  5FLX C;  3H60 A;  1IQO A;  4FK5 C;  1EH6 A;  2UUB E;  3JAM C;  3J81 C;  3RMP A;  4H2F A;  3IVE A;  3DW8 C;  2EOI A;  3M99 B;  2DLK A;  2L3J A;  2DSY A;  5LMU E;  1A1I A;  2EML A;  1ZBQ A;  3HVQ A;  2E72 A;  2JPA A;  4ZYH A;  2ENA A;  1G2D C;  4IS1 C;  3LL8 A;  5A6J A;  4HEI A;  4MOY A;  2EN3 A;  2H36 X;  1S3L A;  1HNZ E;  1OID A;  5CFF E;  4H1Y P;  2EMW A;  3VK6 A;  2V86 A;  1SFE A;  4JI2 E;  4DR4 E;  2EPN A;  4LAC C;  4OX9 E;  2HY1 A;  2LO3 A;  1S70 A;  4DR3 E;  2K4V A;  5JPF A;  1BBG A;  2EE8 A;  5J28 A;  2CSH A;  1GZ6 A;  2DGC A;  4JI3 E;  2J7J A;  1TCO A;  5GTU A;  2EMH A;  3OTO E;  4DR5 E;  3PSO A;  2EOJ A;  3KWR A;  4DV5 E;  2EL4 A;  2KOU A;  2RS6 A;  1T4L B;  2D9H A;  4YY3 E;  2JOG A;  4NXM E;  4DR7 E;  3K6Q A;  4KHP E;  2EM6 A;  2LMZ A;  4NHR A;  1AAY A;  1T70 A;  1HNX E;  4O43 A;  5EQV A;  1GQE A;  4JI4 E;  4WPY A;  3KZZ A;  2YTP A;  4R2A A;  2FGG A;  1JK1 A;  3ZTV A;  2JYA A;  2KHX A;  3IWD A;  2HHH E;  1UN6 B;  3ICF A;  5INB A;  3EGG A;  2RQL A;  4O4K A;  4L5N C;  2NPP C;  2ZBM A;  1HO5 A;  2ENH A;  2NYL C;  3IWC A;  2EMI A;  2HC5 A;  4F0Z A;  5A6K A;  2RPC A;  3T1I A;  4H2B A;  2JP9 A;  4BCA A;  4BMJ A;  4R2E A;  1L4S A;  5KL6 A;  2RS7 A;  4B2O A;  2CT1 A;  2IHR 1;  2L92 A;  2DLQ A;  2LJU A;  2YTD A;  2YTQ A;  3HPS A;  4DV4 E;  4BC9 A;  1S3N A;  4B3R E;  1A1G A;  4Q7F A;  5LL6 R;  2EM8 A;  4JI6 E;  3THO B;  2EM5 A;  2WDF A;  2EMZ A;  1JK2 A;  1UHZ A;  2M4I A;  2V87 A;  3BBG A;  1DI2 A;  2EPK X;  4R2C A;  3RL5 A;  2E5L E;  2DXN A;  1QU6 A;  3JU0 A;  2EM3 A;  2DMY A;  4DUY E;  4X9J A;  2NUF A;  1PJQ A;  4N4R B;  4R2S A;  4I8O A;  4BHB A;  2UXC E;  1T4N A;  2LUP B;  1USH A;  1PKP A;  3UK3 C;  5IXM B;  4ZVZ A;  5A2Q C;  4LF7 E;  3MSW A;  1O0W A;  4RHB B;  2LUQ A;  2XMO A;  3K7W C;  5IWA E;  1IT6 A;  4HD0 A;  4UT3 A;  4LFC E;  2F8B A;  3AUZ A;  1SR9 A;  2L2M A;  4WYQ B;  2BQ8 X;  3VYX A;  1RQ0 A;  1XMO E;  3ADI A;  2UUA E;  2EM0 A;  2JOB A;  4JA7 A;  1WHN A;  4DV7 E;  1YFH A;  2HYO A;  1X6F A;  2EL6 A;  2WBT A;  2Q8U A;  2MC5 A;  2YTJ A;  2YZT A;  4DR1 E;  5JPE A;  2ENC A;  1HP1 A;  5C1V A;  3H64 A;  2R76 A;  4LF6 E;  3ADL A;  4DV6 E;  2RSM A;  2DB2 A;  3P1X A;  1T4O A;  4F9B B;  1ZAA C;  2EPL X;  3EPH A;  2P6B A;  4JA9 A;  3HPZ A;  2L6M A;  3LLH A;  1A1L A;  4F9A B;  5AAS A;  3EPJ A;  3P71 C;  1PJT A;  3RL3 A;  4V0X A;  1X3C A;  2LE2 A;  2O8A A;  2L33 A;  3DSD A;  2EOR A;  3H66 A;  2B9D A;  4LF5 E;  4ZX2 A;  2ZM6 E;  2UUC E;  1EKZ A;  4I5N C;  1GTK A;  1W24 A;  2DFJ A;  1QNT A;  2EMG A;  2EOE A;  4X8W A;  2A25 A;  4L8N A;  4RH8 A;  1M63 A;  1WAO 1;  4M9V C;  3LML A;  2JWO A;  1IBK E;  3H69 A;  2QFP A;  4B3M E;  2L8T A;  4DUZ E;  3C5W C;  2YTE A;  4Q35 B;  1XMQ E;  2EMA A;  1XM7 A;  1RC7 A;  1ZBT A;  1ZR9 A;  4LFA E;  2EOY A;  1EH7 A;  2EPU A;  3H62 B;  4ORC A;  1WJP A;  2EOO A;  2A22 A;  2EPZ A;  4M30 A;  2WDD A;  2KKN A;  2VF1 A;  4KKZ A;  2LJH A;  2EP3 A;  4FBQ A;  2BCD A;  1EH8 A;  4OR9 A;  2BB8 A;  2QJC A;  1IQS A;  3L00 A;  1WRJ A;  2BBG A;  1N33 E;  2YEQ A;  4MOV A;  1XZW A;  3H68 A;  1YSA C;  4H2I A;  2EN8 A;  1IBL E;  2EN2 A;  1X5W A;  3THN A;  2EOM A;  3BID A;  3F6H A;  2N3H A;  2EPP A;  4MLQ A;  5KL5 A;  2EOX A;  2EPA A;  2EOS A;  1SU1 A;  2V85 A;  1STU A;  4R2D A;  2WBS A;  4UT3 B;  1YPN A;  3HTX A;  2V8Q B;  1J26 A;  4V0V A;  2GPI A;  4I5L C;  5AE3 A;  2EN6 A;  2LTR A;  2JVA A;  1NCS A;  1YZ9 A;  4DSY A;  2EPR A;  2EMK A;  4MP0 A;  1A1J A;  3CK2 A;  1T39 A;  4K0K E;  2YRK A;  2F4V E;  3IVD A;  5IV8 B;  4H1S A;  1ZU1 A;  5KL2 A;  2M1S A;  4OOG C;  4X64 E;  5JJT A;  3V4Y A;  1X47 A;  2GJU A;  2GHF A;  4NZV A;  1WHQ A;  2I13 A;  2WDC A;  1UBD C;  4DHL A;  4M0V A;  2YRH A;  4F54 A;  1HR0 E;  2NUE A;  3EGH A;  2EPC A;  2QFR A;  1XNQ E;  2EOF A;  2O8G A;  4H2G A;  3QFK A;  2EMY A;  2YWQ A;  2JY9 A;  2EWL A;  1X6H A;  2R1F A;  1QHW A;  1G5B A;  4X66 E;  3J7Y p;  2N8X A;  4HTG A;  2ELY A;  2ELZ A;  5IOH A;  2USH A;  2EOQ A;  2UXD E;  1YYK A;  3GVE A;  3DF6 A;  4V0W A;  5B8I A;  3H63 A;  1WAR A;  1WXR A;  1AUI A;  2EMF A;  1MGT A;  1A1K A;  2AHD A;  1FJG E;  1AH5 A;  1BBO A;  3D03 A;  3E0J A;  4ORB A;  2YU5 A;  4WFT A;  2VRD A;  2JOX A;  1S95 A;  1YYO A;  4B3T E;  4NXN E;  1HNW E;  5IT9 C;  2L2N A;  1IBM E;  2YT4 A;  4LF8 E;  4ZYE A;  5AC4 A;  5LLQ A;  1Z2W A;  3DJW A;  3ADG A;  2IAE C;  2NAB A;  1UIL A;  3BF2 A;  2WCC 3;  2B7T A;  3MHH C;  3C4B A;  2VE7 C;  3ZOQ B;  1Z1B A;  1KJK A;  4F2J C;  4LTY A;  1TF6 A;  1PJS A;  4WX9 A;  1KBP A;  1MF8 A;  3TGH A;  2YSO A;  3JTZ A;  3HXL A;  3N5U A;  5AE2 A;  3FLO A;  1MEY C;  2GLI A;  5AE1 A;  3AV0 A;  4LF4 E;  4P78 A;  3KZY A;  2DRP A;  2MKN A;  5LMN E;  4B3S E;  3FGA C;  2N3G A;  4IL1 A;  1T71 A;  4G9J A;  2EQ0 A;  2MDR A;  2FTX B;  1S3M A;  2YTO A;  3H09 A;  4X62 E;  4BS9 A;  4WXD A;  4F9C B;  2LRS A;  4XPN A;  4MLV A;  5A69 A;  2ZOA A;  2EQ1 A;  2NXF A;  1FJM A;  4JI5 E;  1OI8 A;  1J5E E;  2YTI A;  4JV5 E;  2LV2 A;  4DV3 E;  2R17 A;  2BDX A;  1TN9 A;  4LU9 A;  2EPX A;  3RL4 A;  4J6O A;  2NYM C;  3RQZ A;  2WBU A;  1N32 E;  1IMU A;  2I9I A;  5AC5 A;  2YVT A;  4DR2 E;  3ECR A;  2HYP A;  3PSN A;  3IB8 A;  3C9F A;  2EM7 A;  2V83 A;  2EJ4 A;  3E7A A;  3HQ1 A;  3EPK A;  1N3G A;  1OIE A;  4KBP A;  2PRT A;  2MC6 A;  4KZS A;  4FCX A;  2K7I A;  3FIG A;  2L3C A;  4DR6 E;  1NEI A;  2RTX A;  4BC7 A;  5KL3 A;  1U32 A;  3E7B A;  2KON A;  2UXB E;  4JYA E;  1I94 E;  3QFN A;  1II7 A;  2Z1A A;  4Q28 A;  2EM9 A;  2IE3 C;  2FV4 B;  5F3W A;  1G2F C;  1N36 E;  2MDG A;  1A1F A;  1YUI A;  5TSE A;  1X48 A;  4P7D A;  4M2Z A;  4JI1 E;  2EQ3 A;  2YTF A;  2HGH A;  2G7H A;  1UF3 A;  2B3T B;  1F2I G;  4WXC A;  4X65 E;  2YRM A;  2YTG A;  2EPO A;  2EPM X;  3K7V C;  5A6A A;  4UT2 A;  2WDE A;  3C4T A;  3JYF A;  4BBY A;  2E1M A;  4R2P A;  4O24 A;  3T1Y E;  4YKE A;  3F6G A;  1X49 A;  4TUI A;  2L2K B;  2V88 A;  4JI7 E;  2EOH A;  1N34 E;  1JK7 A;  2YTN A;  2IE4 C;  4AQY E;  1DGC A;  4GEQ B;  3EQ1 A;  4O5G A;  2NUG A;  2EM4 A;  3IWB A;  4R03 A;  2EN7 A;  1RMD A;  5KL4 A;  1Z2X A;  5A6B D;  1HPU A;  2RSI A;  2EL5 A;  2EMX A;  4J8Z A;  2LBS B;  4GZN C;  3VYY A;  5A6B A;  4JI8 E;  3H61 A;  5HPE A;  1T38 A;  2EOZ A;  5DNY A;  2DXL A;  4DT2 A;  3T1H E;  4DKK A;  2VQE E;  2WZO A;  3BGH A;  4DV0 E;  3H67 A;  3C6K A;  1LLM C;  1YUJ A;  1QFC A;  2B7V A;  2LCE A;  4WWL A;  4FBW A;  4KWY A;  4R8O A;  4LF9 E;  2MKD A;  2ODR D;  3QFM A;  2JR1 A;  4YHH E;  2EMB A;  2EN1 A;  2ODR C;  2CV9 A;  4DV2 E;  3J7A G;  2V89 A;  1S8E A;  4GKK E;  4ZYD A;  1KYQ A;  3VHT B;  1P47 A;  1B69 A;  2EZ6 A;  4BHC A;  2EMC A;  2DMI A;  1BB8 A;  2VQF E; 
#chains in the Genus database with same CATH homology
 2Z06 A;  4IYP C;  4LU9 A;  4UT3 B;  3RL4 A;  2Z72 A;  4Q7F A;  3THO B;  4J6O A;  4V0V A;  2WDF A;  2NYM C;  4I5L C;  3RQZ A;  4DSY A;  4MP0 A;  3RL5 A;  3CK2 A;  3IB7 A;  2DXN A;  2YVT A;  4ORA A;  2HYP A;  3PSN A;  3IVD A;  3IB8 A;  3C9F A;  4H1S A;  4TUG A;  5JJT A;  3QG5 C;  3V4Y A;  1NNW A;  3E7A A;  1OIE A;  2GJU A;  1UTE A;  4NZV A;  2ZO9 B;  4KBP A;  1USH A;  2WDC A;  4FCX A;  4ZVZ A;  4DHL A;  4M0V A;  3EGH A;  3DSC A;  4UWQ A;  2XMO A;  1U32 A;  2QFR A;  3E7B A;  3QFN A;  3K7W C;  3ZU0 A;  1IT6 A;  1II7 A;  4HD0 A;  2O8G A;  2Z1A A;  3KBP A;  4H2G A;  3QFK A;  4FBK A;  4UT3 A;  1V73 A;  2IE3 C;  3QFO A;  5F3W A;  3AUZ A;  1QHW A;  2BQ8 X;  4JA7 A;  1G5B A;  2HYO A;  3H60 A;  5IOH A;  2Q8U A;  2USH A;  4H2F A;  3GVE A;  3IVE A;  3DW8 C;  4V0W A;  5B8I A;  3H63 A;  5JPE A;  1HP1 A;  1WAR A;  5C1V A;  1AUI A;  3H64 A;  1UF3 A;  2AHD A;  3HVQ A;  3D03 A;  3E0J A;  4ORB A;  3LL8 A;  3K7V C;  4UT2 A;  2P6B A;  2WDE A;  4JA9 A;  3JYF A;  4MOY A;  1S95 A;  1S3L A;  4O24 A;  1OID A;  3P71 C;  4YKE A;  3RL3 A;  4H1Y P;  1Z2W A;  4V0X A;  4TUI A;  2O8A A;  2IAE C;  3DSD A;  4LAC C;  3H66 A;  2HY1 A;  1JK7 A;  1S70 A;  4ZX2 A;  5JPF A;  4I5N C;  5J28 A;  1W24 A;  2DFJ A;  2IE4 C;  1TCO A;  5GTU A;  4O5G A;  4LTY A;  3PSO A;  1Z2X A;  1KBP A;  1MF8 A;  2JOG A;  1HPU A;  1M63 A;  1WAO 1;  3H69 A;  3TGH A;  2QFP A;  3N5U A;  3C5W C;  3FLO A;  3H61 A;  5HPE A;  1XM7 A;  5DNY A;  1T70 A;  2DXL A;  4DT2 A;  3H62 B;  4O43 A;  4ORC A;  5EQV A;  2A22 A;  3AV0 A;  3H67 A;  2WDD A;  2KKN A;  1QFC A;  4WWL A;  4KKZ A;  4FBW A;  3FGA C;  4FBQ A;  3ZTV A;  5INB A;  3ICF A;  2BCD A;  3EGG A;  4O4K A;  1T71 A;  2NPP C;  2ZBM A;  1HO5 A;  3QFM A;  2QJC A;  4G9J A;  4IL1 A;  4OR9 A;  2NYL C;  2YEQ A;  4MOV A;  1S3M A;  1XZW A;  2CV9 A;  3H68 A;  4H2I A;  4F0Z A;  4XPN A;  3T1I A;  1S8E A;  4H2B A;  3THN A;  2ZOA A;  2NXF A;  4B2O A;  1FJM A;  1OI8 A;  2R17 A;  2BDX A;  1SU1 A;  1S3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...