4O43A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o43A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o43A01
3AV0A 3V4YA 1OIDA 1UF3A 1U32A 4I5LC 3RL5A 3THNA 3RL3A 3TGHA 3ZTVA 4V0XA 3LL8A 4O24A 5GTUA 2WDCA 3ZU0A 3E7BA 3CK2A 1HO5A 5JPFA 3AUZA 2R17A 4DT2A 3RL4A 2O8GA 5HPEA 4O4KA 3N5UA 1XZWA 3FGAC 4FBWA 3C5WC 4HD0A 4OR9A 5EQVA 3THOB 1OIEA 2Z06A 2KKNA 3JYFA 1Z2WA 2GJUA 4O43A 4H1SA 1QFCA 3HVQA 4FCXA 4ORCA 5INBA 5B8IA 2QJCA 2AHDA 3EGGA 4UWQA 4ORBA 2DFJA 4FBKA 1OI8A 2USHA 4MOYA 4MOVA 4ZVZA 3QG5C 2HY1A 3IB7A 2HYOA 2BCDA 2HYPA 3H61A 2IAEC 4H2FA 1UTEA 4UT2A 1W24A 2Z72A 2YVTA 3H60A 2WDDA 4YKEA 3E7AA 3H69A 5DNYA 4IL1A 1IT6A 2WDFA 4LU9A 1WAO1 1AUIA 2JOGA 4V0WA 3H66A 4J6OA 3RQZA 4B2OA 3C9FA 4MP0A 2NXFA 1V73A 1NNWA 2BQ8X 3QFNA 2NPPC 2P6BA 4ORAA 2A22A 4IYPC 2QFPA 4DHLA 4DSYA 4H2GA 4UT3A 2O8AA 2BDXA 4M0VA 1T70A 3EGHA 1FJMA 5J28A 3H67A 1HPUA 4UT3B 1WARA 3PSOA 3IVEA 1QHWA 5JJTA 1S3MA 4O5GA 1S70A 3PSNA 4KBPA 4LACC 3K7WC 3T1IA 1S95A 3ICFA 4LTYA 3DSDA 2CV9A 4TUIA 5F3WA 4XPNA 1USHA 1TCOA 2QFRA 4FBQA 5JPEA 2XMOA 4H2IA 4H2BA 4TUGA 1XM7A 1S3NA 3QFKA 4JA9A 5IOHA 1T71A 1G5BA 3H64A 3IB8A 4H1YP 3QFOA 1II7A 4V0VA 3K7VC 1HP1A 2WDEA 4NZVA 1MF8A 2Z1AA 4G9JA 2IE3C 5C1VA 1SU1A 2NYLC 1S3LA 1M63A 4ZX2A 1JK7A 3H68A 3GVEA 3H63A 4WWLA 1KBPA 3IVDA 3KBPA 3DW8C 4JA7A 4KKZA 2IE4C 2ZBMA 4I5NC 1Z2XA 3H62B 1S8EA 4F0ZA 2NYMC 4Q7FA 3DSCA 3QFMA 3P71C 2Q8UA
chains in the Genus database with same CATH superfamily
4IS1C 1PJTA 1KYQA 2VE7C 2CT1A 4I5LC 3IWBA 1SFEA 1Z1BA 3RL3A 3TGHA 4V0XA 1T4OA 2EM6A 4F9CB 5A6BA 2WDCA 3ZU0A 4WXDA 3E7BA 4DR7E 2EPNA 4HTGA 5HPEA 4O4KA 2V83A 4BS9A 1XZWA 3C5WC 5EQVA 4MLQA 4MLVA 1YPNA 2Z06A 1A1GA 3HXLA 2GJUA 4O43A 1PJSA 1MGTA 2B9DA 4H1SA 3VYXA 2EPUA 4GKKE 2FGGA 3MSWA 3EGGA 4ZYEA 3D03A 4B3RE 2DFJA 1UHZA 2JXPA 1OI8A 1QNTA 2V86A 4KWYA 4JI0E 1BBOA 2EOZA 4F54A 1N34E 1WHNA 4WXCA 2I13A 4H2FA 1F2IG 4LF6E 4P78A 4R2RA 3DF6A 2JP9A 4JI5E 2YZTA 2HHHE 5DNYA 3ADJA 1QU6A 2EPAA 3BF2A 3H09A 1N32E 4V0WA 4LFCE 1AUIA 2JYAA 4K0KE 2LCEA 1G2DC 3C9FA 4B2OA 5A6AA 4R2QA 5A6BD 1V73A 5KL6A 2EN6A 2HGHA 2BQ8X 3BGHA 2BBGA 2EMBA 5KL3A 2P6BA 2DIXA 4DHLA 2ODRC 2EQ3A 4UT3A 4F9AB 1T70A 2ELYA 3EGHA 2V87A 1HPUA 4UT3B 3P1XA 1PKPA 5FLXC 2EP3A 2EOOA 1WRJA 2RSMA 2YTIA 1S95A 3K7WC 2EN7A 4BHBA 2EE8A 2CV9A 2N8XA 4XPNA 2K4VA 5AASA 3EPLA 2V88A 2UXCE 4H2IA 3ADGA 4DR1E 5IOHA 2EL6A 2RQLA 2UU9E 2EOMA 4DV3E 2V8QB 2I9IA 4NZVA 1MF8A 5IXMB 4G9JA 5KL5A 1T38A 3HPSA 1LLMC 1GTKA 3ECRA 1S3LA 5A2QC 2DLQA 3H68A 2EM5A 3GVEA 4DR2E 1GZ6A 2EMYA 2IE4C 2ZBMA 2H36X 4X62E 1I94E 2LMZA 2WBUA 2EOJA 2VF1A 2YTDA 1HNWE 1U32A 1UF3A 3THNA 4X66E 4R2CA 2UXBE 2K7IA 3BIDA 3LL8A 4WX9A 2ENAA 3CK2A 1HO5A 2M4IA 3AUZA 3RL4A 2EMHA 4R2EA 2ENCA 3J7Yp 2EQ1A 3F6HA 2NUEA 2EM9A 4FBWA 2DMIA 4HD0A 4OR9A 3THOB 3VHTB 2EM3A 1IQSA 3JYFA 4BC9A 2YSPA 2EL5A 1QFCA 3C6KA 2L3JA 4NXNE 3HVQA 4FCXA 4ORCA 4WYQB 2E1MA 2EMWA 2JY9A 2AHDA 3IWDA 1FKAE 4BMJA 2YTGA 2CTDA 4FBKA 2EOQA 1YUJA 1FJGE 2EL4A 5A6KA 2HY1A 2D9HA 2IHR1 2JOXA 1A1IA 1X49A 3RMPA 5AE1A 5A69A 1UTEA 2EOHA 3HPZA 4F6NA 2YVTA 2DXNA 1TF6A 2WDDA 2G7HA 4JI2E 3RQZA 2EN8A 2DSYA 1EKZA 4MP0A 2NXFA 1GQEA 2CSHA 3EQ1A 5AE2A 1SR9A 2EM2A 4L5NC 2NPPC 2A25A 4ORAA 2M7QA 2EMCA 2JR1A 2EN3A 4BCAA 2O8AA 4B3TE 4DMIA 2BDXA 4DR3E 4DR6E 5J28A 2EN2A 3IVEA 1A1JA 2MC6A 1ZU1A 5JJTA 4O5GA 1S70A 3PSNA 2YTPA 1IBKE 1UBDC 5LMUE 2EMKA 3DSDA 2JVAA 5F3WA 2EOIA 3HTXA 2YWQA 2MDGA 2LV2A 4DUZE 2EOEA 4LF7E 2R1FA 1WXRA 3EPJA 3HQ1A 1HR0E 2ZM6E 1IBME 1IQOA 4H2BA 4B3ME 1RC7A 2MDRA 4GEQB 3M99B 5IT9C 1X6EA 2ELZA 2EMFA 5LL6R 5KL4A 2YTOA 4YHHE 1AAYA 3J80C 2UUBE 3EPHA 1HP1A 3K7VC 2L2KB 4F2JC 2E5LE 3KZYA 2LVHA 2EMIA 2RTXA 2LBSB 2LJHA 4DV0E 2NYLC 4ZX2A 2L6MA 2E72A 2ODRD 1JK2A 4WSPA 4J8ZA 4KKZA 3JAMC 4R2SA 1YZ9A 4JA7A 2V89A 2YSOA 2B3TB 4FK5C 4JI1E 4I5NC 3P71C 2YTJA 2JOBA 1WJPA 2EPRA 2DGCA 1OIDA 4Q28A 3RL5A 3LLHA 2NUFA 3ZTVA 2YRHA 1P47A 2EN4A 2L33A 2EOFA 4O24A 4BHCA 4DT2A 2R17A 4WFTA 2O8GA 1X6FA 4LF5E 2L8TA 1WHQA 1RMDA 3FGAC 2RS6A 3OTOE 1ZAAC 3L00A 2MC5A 4X9JA 2LTSA 2YPNA 1OIEA 2EPMX 4DV7E 4DKKA 4DUYE 2N3HA 4B3SE 2LRSA 1T4LB 4LF4E 2EMXA 5INBA 2DLKA 1RQ0A 5B8IA 4WSGA 1NCSA 2WBSA 2QJCA 1IBLE 3DJWA 4UWQA 2YTNA 4JI8E 2YRKA 1AH5A 1X3CA 1J5EE 1IMUA 1HNXE 2LE2A 3KZZA 2USHA 4MOYA 3QG5C 3T1HE 2PRTA 2YRMA 1G2FC 2L2NA 1JK1A 4OX9E 2EOSA 2KHXA 2EM8A 1TF3A 2BCDA 2R76A 2LUPB 2IAEC 2Z72A 3H60A 2UUCE 3E7AA 3H69A 5ADZA 4IL1A 1IT6A 4HEIA 1PDAA 1WAO1 3OMLA 2EQ0A 4J6OA 4DV5E 4JYAE 2GPIA 4R2PA 1B69A 2YU5A 2V85A 1HNZE 2WBTA 1A1FA 2YEQA 2EJ4A 3C4TA 2EPKX 4DR5E 4IYPC 1YFHA 3ADIA 2HJJA 3T1YE 4H2GA 2VQEE 2L92A 4JI4E 3E0JA 2EMAA 4DV4E 3H67A 1UILA 3PSOA 1X6HA 2EWLA 2JPAA 1QHWA 3VK6A 4BBYA 1TN9A 3IWCA 2EM7A 1YUIA 3T1IA 4KBPA 4LACC 2LT7A 1X5WA 3ICFA 1XMQE 4TUIA 1ZBQA 2NABA 1N3GA 2ADRA 1XNRE 4ZYGA 2RPCA 4AQYE 2VQFE 4RHBB 1TCOA 2QFRA 4X64E 5JPEA 2LUQA 3JTZA 2LO3A 4GZNC 4JA9A 3H64A 1G5BA 5KL7A 3IB8A 4H1YP 1II7A 2N3GA 1MEYC 2MKNA 2LJUA 4BC7A 2YT4A 1BBGA 1JK7A 2EPCA 2JWOA 4M30A 3H63A 2KONA 4WWLA 2J7JA 3IVDA 2EMLA 3LMLA 3DW8C 4R8OA 4ZYDA 2L2MA 1Z2XA 2RSIA 2YTFA 1S8EA 4F0ZA 2NYMC 4Q7FA 4LFAE 4X8WA 4RH8A 5AC5A 2DXLA 3AV0A 3V4YA 5TSEA 2EMZA 4YY3E 5GTUA 5IWAE 1A1HA 5JPFA 4KHPE 2BB8A 2EPZA 1YYOA 1ZR9A 5CFFE 2EPLX 3N5UA 2ZO9B 2B7VA 4LFBE 1ZBTA 2DRPA 2KKNA 2EM4A 5LMNE 1Z2WA 5AE3A 4JI7E 2NUGA 2F8BA 4LF9E 4IJDA 4DV2E 4F6MA 4N4RB 2ZOAA 2VRDA 2EZ6A 4ORBA 2NA2A 1XMOE 4MOVA 2LTRA 4OOGC 2UUAE 4ZVZA 2EMGA 3IB7A 4M9VC 2EORA 2HYOA 4X65E 2FTXB 2WZOA 2HYPA 3H61A 3EPKA 4DR4E 1BB8A 1EH7A 1W24A 2YTEA 2YU8A 3FLOA 1X48A 4UT2A 4L8NA 5AC4A 3J81C 1A1KA 2MKDA 4I8OA 4YKEA 4R2AA 4LU9A 2WDFA 2DB2A 2JOGA 4KZSA 3H66A 4M2ZA 1YSAC 2M1SA 3J7AG 3ADLA 1NNWA 2EM0A 3QFNA 1YYWA 4ZYHA 2KOUA 4NHRA 4P7DA 5KL2A 4JI3E 1L4SA 2A22A 2QFPA 2EOXA 4DSYA 2RS7A 3C4BA 3TQMA 1A1LA 2ENHA 1EH6A 4M0VA 1DQ3A 4JV5E 2WCC3 1J26A 5IV8B 1FJMA 1N33E 1WARA 2FV4B 1EH8A 1S3MA 2L3CA 4R2DA 4NXME 3C6MA 1KJKA 3F6GA 1DGCA 4LTYA 2B7TA 2DMYA 2EN1A 1T4NA 2GLIA 2YTQA 1UN6B 4GKJE 2M9AA 2CPNA 1USHA 3MHHC 4Q35B 5LLQA 2F4VE 2EOYA 4FBQA 3UK3C 2EPOA 3K6QA 4TUGA 2XMOA 1XM7A 1S3NA 3QFKA 3MHSC 1T71A 1YYKA 2EPXA 1STUA 4WPYA 4DV6E 1N36E 1DI2A 3QFOA 4R03A 1T39A 4V0VA 4F9BB 1NEIA 3VYYA 3KWRA 2WDEA 2Z1AA 2EPPA 3ZOQB 2IE3C 5C1VA 4LF8E 1SU1A 2HC5A 3FIGA 1PJQA 1M63A 1X47A 5T6JA 1O0WA 2GHFA 1KBPA 3KBPA 5A6JA 1XNQE 3JU0A 3BBGA 3H62B 5BR8E 2UXDE 3DSCA 3QFMA 4JI6E 2Q8UA 4DV1E
chains in the Genus database with same CATH topology
2DXLA 3AV0A 3V4YA 1OIDA 1UF3A 1U32A 4I5LC 3RL5A 3THNA 3RL3A 3TGHA 3ZTVA 4V0XA 3LL8A 4O24A 5GTUA 2WDCA 3ZU0A 3E7BA 3CK2A 1HO5A 5JPFA 3AUZA 2R17A 4DT2A 3RL4A 2O8GA 5HPEA 4O4KA 3N5UA 1XZWA 2ZO9B 3FGAC 4FBWA 4HD0A 3C5WC 4OR9A 5EQVA 3THOB 1OIEA 2Z06A 2KKNA 3JYFA 1Z2WA 2GJUA 4O43A 4H1SA 1QFCA 3HVQA 4FCXA 4ORCA 5INBA 5B8IA 2QJCA 2AHDA 3EGGA 4UWQA 2ZOAA 3D03A 4ORBA 2DFJA 4FBKA 1OI8A 2USHA 4MOYA 4MOVA 4ZVZA 3QG5C 2HY1A 3IB7A 2HYOA 2BCDA 2HYPA 3H61A 2IAEC 4H2FA 1UTEA 4UT2A 1W24A 2Z72A 2YVTA 3FLOA 3H60A 2DXNA 2WDDA 4YKEA 3E7AA 3H69A 5DNYA 4IL1A 1IT6A 2WDFA 4LU9A 1WAO1 1AUIA 2JOGA 4V0WA 3H66A 4J6OA 3RQZA 4B2OA 3C9FA 4MP0A 2NXFA 1V73A 1NNWA 2BQ8X 3QFNA 2NPPC 2P6BA 2YEQA 4ORAA 2A22A 4IYPC 2QFPA 4DHLA 4DSYA 4H2GA 3E0JA 4UT3A 2O8AA 2BDXA 4M0VA 1T70A 3EGHA 1FJMA 5J28A 3H67A 1HPUA 4UT3B 1WARA 3PSOA 3IVEA 1QHWA 5JJTA 1S3MA 4O5GA 1S70A 3PSNA 4KBPA 4LACC 3K7WC 3T1IA 1S95A 3ICFA 3DSDA 4LTYA 2CV9A 4TUIA 5F3WA 4XPNA 1USHA 1TCOA 2QFRA 4FBQA 5JPEA 2XMOA 4H2IA 4H2BA 4TUGA 1XM7A 1S3NA 3QFKA 4JA9A 5IOHA 1T71A 1G5BA 3H64A 3IB8A 4H1YP 3QFOA 1II7A 4V0VA 3K7VC 1HP1A 2WDEA 4NZVA 1MF8A 2Z1AA 4G9JA 2IE3C 5C1VA 1SU1A 2NYLC 1S3LA 1M63A 4ZX2A 1JK7A 3H68A 3GVEA 3H63A 4WWLA 1KBPA 3IVDA 3KBPA 3DW8C 4JA7A 4KKZA 2IE4C 2ZBMA 4I5NC 1Z2XA 3H62B 1S8EA 4F0ZA 2NYMC 4Q7FA 3DSCA 3QFMA 3P71C 2Q8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV0 A;  3V4Y A;  1OID A;  1UF3 A;  1U32 A;  4I5L C;  3RL5 A;  3THN A;  3RL3 A;  3TGH A;  3ZTV A;  4V0X A;  3LL8 A;  4O24 A;  5GTU A;  2WDC A;  3ZU0 A;  3E7B A;  3CK2 A;  1HO5 A;  5JPF A;  3AUZ A;  2R17 A;  4DT2 A;  3RL4 A;  2O8G A;  5HPE A;  4O4K A;  3N5U A;  1XZW A;  3FGA C;  4FBW A;  3C5W C;  4HD0 A;  4OR9 A;  5EQV A;  3THO B;  1OIE A;  2Z06 A;  2KKN A;  3JYF A;  1Z2W A;  2GJU A;  4O43 A;  4H1S A;  1QFC A;  3HVQ A;  4FCX A;  4ORC A;  5INB A;  5B8I A;  2QJC A;  2AHD A;  3EGG A;  4UWQ A;  4ORB A;  2DFJ A;  4FBK A;  1OI8 A;  2USH A;  4MOY A;  4MOV A;  4ZVZ A;  3QG5 C;  2HY1 A;  3IB7 A;  2HYO A;  2BCD A;  2HYP A;  3H61 A;  2IAE C;  4H2F A;  1UTE A;  4UT2 A;  1W24 A;  2Z72 A;  2YVT A;  3H60 A;  2WDD A;  4YKE A;  3E7A A;  3H69 A;  5DNY A;  4IL1 A;  1IT6 A;  2WDF A;  4LU9 A;  1WAO 1;  1AUI A;  2JOG A;  4V0W A;  3H66 A;  4J6O A;  3RQZ A;  4B2O A;  3C9F A;  4MP0 A;  2NXF A;  1V73 A;  1NNW A;  2BQ8 X;  3QFN A;  2NPP C;  2P6B A;  4ORA A;  2A22 A;  4IYP C;  2QFP A;  4DHL A;  4DSY A;  4H2G A;  4UT3 A;  2O8A A;  2BDX A;  4M0V A;  1T70 A;  3EGH A;  1FJM A;  5J28 A;  3H67 A;  1HPU A;  4UT3 B;  1WAR A;  3PSO A;  3IVE A;  1QHW A;  5JJT A;  1S3M A;  4O5G A;  1S70 A;  3PSN A;  4KBP A;  4LAC C;  3K7W C;  3T1I A;  1S95 A;  3ICF A;  4LTY A;  3DSD A;  2CV9 A;  4TUI A;  5F3W A;  4XPN A;  1USH A;  1TCO A;  2QFR A;  4FBQ A;  5JPE A;  2XMO A;  4H2I A;  4H2B A;  4TUG A;  1XM7 A;  1S3N A;  3QFK A;  4JA9 A;  5IOH A;  1T71 A;  1G5B A;  3H64 A;  3IB8 A;  4H1Y P;  3QFO A;  1II7 A;  4V0V A;  3K7V C;  1HP1 A;  2WDE A;  4NZV A;  1MF8 A;  2Z1A A;  4G9J A;  2IE3 C;  5C1V A;  1SU1 A;  2NYL C;  1S3L A;  1M63 A;  4ZX2 A;  1JK7 A;  3H68 A;  3GVE A;  3H63 A;  4WWL A;  1KBP A;  3IVD A;  3KBP A;  3DW8 C;  4JA7 A;  4KKZ A;  2IE4 C;  2ZBM A;  4I5N C;  1Z2X A;  3H62 B;  1S8E A;  4F0Z A;  2NYM C;  4Q7F A;  3DSC A;  3QFM A;  3P71 C;  2Q8U A; 
#chains in the Genus database with same CATH topology
 4IS1 C;  1PJT A;  1KYQ A;  2VE7 C;  2CT1 A;  4I5L C;  3IWB A;  1SFE A;  1Z1B A;  3RL3 A;  3TGH A;  4V0X A;  1T4O A;  2EM6 A;  4F9C B;  5A6B A;  2WDC A;  3ZU0 A;  4WXD A;  3E7B A;  4DR7 E;  2EPN A;  4HTG A;  5HPE A;  4O4K A;  2V83 A;  4BS9 A;  1XZW A;  3C5W C;  5EQV A;  4MLQ A;  4MLV A;  1YPN A;  2Z06 A;  1A1G A;  3HXL A;  2GJU A;  4O43 A;  1PJS A;  1MGT A;  2B9D A;  4H1S A;  3VYX A;  2EPU A;  4GKK E;  2FGG A;  3MSW A;  3EGG A;  4ZYE A;  3D03 A;  4B3R E;  2DFJ A;  1UHZ A;  2JXP A;  1OI8 A;  1QNT A;  2V86 A;  4KWY A;  4JI0 E;  1BBO A;  2EOZ A;  4F54 A;  1N34 E;  1WHN A;  4WXC A;  2I13 A;  4H2F A;  1F2I G;  4LF6 E;  4P78 A;  4R2R A;  3DF6 A;  2JP9 A;  4JI5 E;  2YZT A;  2HHH E;  5DNY A;  3ADJ A;  1QU6 A;  2EPA A;  3BF2 A;  3H09 A;  1N32 E;  4V0W A;  4LFC E;  1AUI A;  2JYA A;  4K0K E;  2LCE A;  1G2D C;  3C9F A;  4B2O A;  5A6A A;  4R2Q A;  5A6B D;  1V73 A;  5KL6 A;  2EN6 A;  2HGH A;  2BQ8 X;  3BGH A;  2BBG A;  2EMB A;  5KL3 A;  2P6B A;  2DIX A;  4DHL A;  2ODR C;  2EQ3 A;  4UT3 A;  4F9A B;  1T70 A;  2ELY A;  3EGH A;  2V87 A;  1HPU A;  4UT3 B;  3P1X A;  1PKP A;  5FLX C;  2EP3 A;  2EOO A;  1WRJ A;  2RSM A;  2YTI A;  1S95 A;  3K7W C;  2EN7 A;  4BHB A;  2EE8 A;  2CV9 A;  2N8X A;  4XPN A;  2K4V A;  5AAS A;  3EPL A;  2V88 A;  2UXC E;  4H2I A;  3ADG A;  4DR1 E;  5IOH A;  2EL6 A;  2RQL A;  2UU9 E;  2EOM A;  4DV3 E;  2V8Q B;  2I9I A;  4NZV A;  1MF8 A;  5IXM B;  4G9J A;  5KL5 A;  1T38 A;  3HPS A;  1LLM C;  1GTK A;  3ECR A;  1S3L A;  5A2Q C;  2DLQ A;  3H68 A;  2EM5 A;  3GVE A;  4DR2 E;  1GZ6 A;  2EMY A;  2IE4 C;  2ZBM A;  2H36 X;  4X62 E;  1I94 E;  2LMZ A;  2WBU A;  2EOJ A;  2VF1 A;  2YTD A;  1HNW E;  1U32 A;  1UF3 A;  3THN A;  4X66 E;  4R2C A;  2UXB E;  2K7I A;  3BID A;  3LL8 A;  4WX9 A;  2ENA A;  3CK2 A;  1HO5 A;  2M4I A;  3AUZ A;  3RL4 A;  2EMH A;  4R2E A;  2ENC A;  3J7Y p;  2EQ1 A;  3F6H A;  2NUE A;  2EM9 A;  4FBW A;  2DMI A;  4HD0 A;  4OR9 A;  3THO B;  3VHT B;  2EM3 A;  1IQS A;  3JYF A;  4BC9 A;  2YSP A;  2EL5 A;  1QFC A;  3C6K A;  2L3J A;  4NXN E;  3HVQ A;  4FCX A;  4ORC A;  4WYQ B;  2E1M A;  2EMW A;  2JY9 A;  2AHD A;  3IWD A;  1FKA E;  4BMJ A;  2YTG A;  2CTD A;  4FBK A;  2EOQ A;  1YUJ A;  1FJG E;  2EL4 A;  5A6K A;  2HY1 A;  2D9H A;  2IHR 1;  2JOX A;  1A1I A;  1X49 A;  3RMP A;  5AE1 A;  5A69 A;  1UTE A;  2EOH A;  3HPZ A;  4F6N A;  2YVT A;  2DXN A;  1TF6 A;  2WDD A;  2G7H A;  4JI2 E;  3RQZ A;  2EN8 A;  2DSY A;  1EKZ A;  4MP0 A;  2NXF A;  1GQE A;  2CSH A;  3EQ1 A;  5AE2 A;  1SR9 A;  2EM2 A;  4L5N C;  2NPP C;  2A25 A;  4ORA A;  2M7Q A;  2EMC A;  2JR1 A;  2EN3 A;  4BCA A;  2O8A A;  4B3T E;  4DMI A;  2BDX A;  4DR3 E;  4DR6 E;  5J28 A;  2EN2 A;  3IVE A;  1A1J A;  2MC6 A;  1ZU1 A;  5JJT A;  4O5G A;  1S70 A;  3PSN A;  2YTP A;  1IBK E;  1UBD C;  5LMU E;  2EMK A;  3DSD A;  2JVA A;  5F3W A;  2EOI A;  3HTX A;  2YWQ A;  2MDG A;  2LV2 A;  4DUZ E;  2EOE A;  4LF7 E;  2R1F A;  1WXR A;  3EPJ A;  3HQ1 A;  1HR0 E;  2ZM6 E;  1IBM E;  1IQO A;  4H2B A;  4B3M E;  1RC7 A;  2MDR A;  4GEQ B;  3M99 B;  5IT9 C;  1X6E A;  2ELZ A;  2EMF A;  5LL6 R;  5KL4 A;  2YTO A;  4YHH E;  1AAY A;  3J80 C;  2UUB E;  3EPH A;  1HP1 A;  3K7V C;  2L2K B;  4F2J C;  2E5L E;  3KZY A;  2LVH A;  2EMI A;  2RTX A;  2LBS B;  2LJH A;  4DV0 E;  2NYL C;  4ZX2 A;  2L6M A;  2E72 A;  2ODR D;  1JK2 A;  4WSP A;  4J8Z A;  4KKZ A;  3JAM C;  4R2S A;  1YZ9 A;  4JA7 A;  2V89 A;  2YSO A;  2B3T B;  4FK5 C;  4JI1 E;  4I5N C;  3P71 C;  2YTJ A;  2JOB A;  1WJP A;  2EPR A;  2DGC A;  1OID A;  4Q28 A;  3RL5 A;  3LLH A;  2NUF A;  3ZTV A;  2YRH A;  1P47 A;  2EN4 A;  2L33 A;  2EOF A;  4O24 A;  4BHC A;  4DT2 A;  2R17 A;  4WFT A;  2O8G A;  1X6F A;  4LF5 E;  2L8T A;  1WHQ A;  1RMD A;  3FGA C;  2RS6 A;  3OTO E;  1ZAA C;  3L00 A;  2MC5 A;  4X9J A;  2LTS A;  2YPN A;  1OIE A;  2EPM X;  4DV7 E;  4DKK A;  4DUY E;  2N3H A;  4B3S E;  2LRS A;  1T4L B;  4LF4 E;  2EMX A;  5INB A;  2DLK A;  1RQ0 A;  5B8I A;  4WSG A;  1NCS A;  2WBS A;  2QJC A;  1IBL E;  3DJW A;  4UWQ A;  2YTN A;  4JI8 E;  2YRK A;  1AH5 A;  1X3C A;  1J5E E;  1IMU A;  1HNX E;  2LE2 A;  3KZZ A;  2USH A;  4MOY A;  3QG5 C;  3T1H E;  2PRT A;  2YRM A;  1G2F C;  2L2N A;  1JK1 A;  4OX9 E;  2EOS A;  2KHX A;  2EM8 A;  1TF3 A;  2BCD A;  2R76 A;  2LUP B;  2IAE C;  2Z72 A;  3H60 A;  2UUC E;  3E7A A;  3H69 A;  5ADZ A;  4IL1 A;  1IT6 A;  4HEI A;  1PDA A;  1WAO 1;  3OML A;  2EQ0 A;  4J6O A;  4DV5 E;  4JYA E;  2GPI A;  4R2P A;  1B69 A;  2YU5 A;  2V85 A;  1HNZ E;  2WBT A;  1A1F A;  2YEQ A;  2EJ4 A;  3C4T A;  2EPK X;  4DR5 E;  4IYP C;  1YFH A;  3ADI A;  2HJJ A;  3T1Y E;  4H2G A;  2VQE E;  2L92 A;  4JI4 E;  3E0J A;  2EMA A;  4DV4 E;  3H67 A;  1UIL A;  3PSO A;  1X6H A;  2EWL A;  2JPA A;  1QHW A;  3VK6 A;  4BBY A;  1TN9 A;  3IWC A;  2EM7 A;  1YUI A;  3T1I A;  4KBP A;  4LAC C;  2LT7 A;  1X5W A;  3ICF A;  1XMQ E;  4TUI A;  1ZBQ A;  2NAB A;  1N3G A;  2ADR A;  1XNR E;  4ZYG A;  2RPC A;  4AQY E;  2VQF E;  4RHB B;  1TCO A;  2QFR A;  4X64 E;  5JPE A;  2LUQ A;  3JTZ A;  2LO3 A;  4GZN C;  4JA9 A;  3H64 A;  1G5B A;  5KL7 A;  3IB8 A;  4H1Y P;  1II7 A;  2N3G A;  1MEY C;  2MKN A;  2LJU A;  4BC7 A;  2YT4 A;  1BBG A;  1JK7 A;  2EPC A;  2JWO A;  4M30 A;  3H63 A;  2KON A;  4WWL A;  2J7J A;  3IVD A;  2EML A;  3LML A;  3DW8 C;  4R8O A;  4ZYD A;  2L2M A;  1Z2X A;  2RSI A;  2YTF A;  1S8E A;  4F0Z A;  2NYM C;  4Q7F A;  4LFA E;  4X8W A;  4RH8 A;  5AC5 A;  2DXL A;  3AV0 A;  3V4Y A;  5TSE A;  2EMZ A;  4YY3 E;  5GTU A;  5IWA E;  1A1H A;  5JPF A;  4KHP E;  2BB8 A;  2EPZ A;  1YYO A;  1ZR9 A;  5CFF E;  2EPL X;  3N5U A;  2ZO9 B;  2B7V A;  4LFB E;  1ZBT A;  2DRP A;  2KKN A;  2EM4 A;  5LMN E;  1Z2W A;  5AE3 A;  4JI7 E;  2NUG A;  2F8B A;  4LF9 E;  4IJD A;  4DV2 E;  4F6M A;  4N4R B;  2ZOA A;  2VRD A;  2EZ6 A;  4ORB A;  2NA2 A;  1XMO E;  4MOV A;  2LTR A;  4OOG C;  2UUA E;  4ZVZ A;  2EMG A;  3IB7 A;  4M9V C;  2EOR A;  2HYO A;  4X65 E;  2FTX B;  2WZO A;  2HYP A;  3H61 A;  3EPK A;  4DR4 E;  1BB8 A;  1EH7 A;  1W24 A;  2YTE A;  2YU8 A;  3FLO A;  1X48 A;  4UT2 A;  4L8N A;  5AC4 A;  3J81 C;  1A1K A;  2MKD A;  4I8O A;  4YKE A;  4R2A A;  4LU9 A;  2WDF A;  2DB2 A;  2JOG A;  4KZS A;  3H66 A;  4M2Z A;  1YSA C;  2M1S A;  3J7A G;  3ADL A;  1NNW A;  2EM0 A;  3QFN A;  1YYW A;  4ZYH A;  2KOU A;  4NHR A;  4P7D A;  5KL2 A;  4JI3 E;  1L4S A;  2A22 A;  2QFP A;  2EOX A;  4DSY A;  2RS7 A;  3C4B A;  3TQM A;  1A1L A;  2ENH A;  1EH6 A;  4M0V A;  1DQ3 A;  4JV5 E;  2WCC 3;  1J26 A;  5IV8 B;  1FJM A;  1N33 E;  1WAR A;  2FV4 B;  1EH8 A;  1S3M A;  2L3C A;  4R2D A;  4NXM E;  3C6M A;  1KJK A;  3F6G A;  1DGC A;  4LTY A;  2B7T A;  2DMY A;  2EN1 A;  1T4N A;  2GLI A;  2YTQ A;  1UN6 B;  4GKJ E;  2M9A A;  2CPN A;  1USH A;  3MHH C;  4Q35 B;  5LLQ A;  2F4V E;  2EOY A;  4FBQ A;  3UK3 C;  2EPO A;  3K6Q A;  4TUG A;  2XMO A;  1XM7 A;  1S3N A;  3QFK A;  3MHS C;  1T71 A;  1YYK A;  2EPX A;  1STU A;  4WPY A;  4DV6 E;  1N36 E;  1DI2 A;  3QFO A;  4R03 A;  1T39 A;  4V0V A;  4F9B B;  1NEI A;  3VYY A;  3KWR A;  2WDE A;  2Z1A A;  2EPP A;  3ZOQ B;  2IE3 C;  5C1V A;  4LF8 E;  1SU1 A;  2HC5 A;  3FIG A;  1PJQ A;  1M63 A;  1X47 A;  5T6J A;  1O0W A;  2GHF A;  1KBP A;  3KBP A;  5A6J A;  1XNQ E;  3JU0 A;  3BBG A;  3H62 B;  5BR8 E;  2UXD E;  3DSC A;  3QFM A;  4JI6 E;  2Q8U A;  4DV1 E; 
#chains in the Genus database with same CATH homology
 2DXL A;  3AV0 A;  3V4Y A;  1OID A;  1UF3 A;  1U32 A;  4I5L C;  3RL5 A;  3THN A;  3RL3 A;  3TGH A;  3ZTV A;  4V0X A;  3LL8 A;  4O24 A;  5GTU A;  2WDC A;  3ZU0 A;  3E7B A;  3CK2 A;  1HO5 A;  5JPF A;  3AUZ A;  2R17 A;  4DT2 A;  3RL4 A;  2O8G A;  5HPE A;  4O4K A;  3N5U A;  1XZW A;  2ZO9 B;  3FGA C;  4FBW A;  4HD0 A;  3C5W C;  4OR9 A;  5EQV A;  3THO B;  1OIE A;  2Z06 A;  2KKN A;  3JYF A;  1Z2W A;  2GJU A;  4O43 A;  4H1S A;  1QFC A;  3HVQ A;  4FCX A;  4ORC A;  5INB A;  5B8I A;  2QJC A;  2AHD A;  3EGG A;  4UWQ A;  2ZOA A;  3D03 A;  4ORB A;  2DFJ A;  4FBK A;  1OI8 A;  2USH A;  4MOY A;  4MOV A;  4ZVZ A;  3QG5 C;  2HY1 A;  3IB7 A;  2HYO A;  2BCD A;  2HYP A;  3H61 A;  2IAE C;  4H2F A;  1UTE A;  4UT2 A;  1W24 A;  2Z72 A;  2YVT A;  3FLO A;  3H60 A;  2DXN A;  2WDD A;  4YKE A;  3E7A A;  3H69 A;  5DNY A;  4IL1 A;  1IT6 A;  2WDF A;  4LU9 A;  1WAO 1;  1AUI A;  2JOG A;  4V0W A;  3H66 A;  4J6O A;  3RQZ A;  4B2O A;  3C9F A;  4MP0 A;  2NXF A;  1V73 A;  1NNW A;  2BQ8 X;  3QFN A;  2NPP C;  2P6B A;  2YEQ A;  4ORA A;  2A22 A;  4IYP C;  2QFP A;  4DHL A;  4DSY A;  4H2G A;  3E0J A;  4UT3 A;  2O8A A;  2BDX A;  4M0V A;  1T70 A;  3EGH A;  1FJM A;  5J28 A;  3H67 A;  1HPU A;  4UT3 B;  1WAR A;  3PSO A;  3IVE A;  1QHW A;  5JJT A;  1S3M A;  4O5G A;  1S70 A;  3PSN A;  4KBP A;  4LAC C;  3K7W C;  3T1I A;  1S95 A;  3ICF A;  3DSD A;  4LTY A;  2CV9 A;  4TUI A;  5F3W A;  4XPN A;  1USH A;  1TCO A;  2QFR A;  4FBQ A;  5JPE A;  2XMO A;  4H2I A;  4H2B A;  4TUG A;  1XM7 A;  1S3N A;  3QFK A;  4JA9 A;  5IOH A;  1T71 A;  1G5B A;  3H64 A;  3IB8 A;  4H1Y P;  3QFO A;  1II7 A;  4V0V A;  3K7V C;  1HP1 A;  2WDE A;  4NZV A;  1MF8 A;  2Z1A A;  4G9J A;  2IE3 C;  5C1V A;  1SU1 A;  2NYL C;  1S3L A;  1M63 A;  4ZX2 A;  1JK7 A;  3H68 A;  3GVE A;  3H63 A;  4WWL A;  1KBP A;  3IVD A;  3KBP A;  3DW8 C;  4JA7 A;  4KKZ A;  2IE4 C;  2ZBM A;  4I5N C;  1Z2X A;  3H62 B;  1S8E A;  4F0Z A;  2NYM C;  4Q7F A;  3DSC A;  3QFM A;  3P71 C;  2Q8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...