4O43A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o43A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o43A01
2NYMC 2YVTA 4ORAA 4MOVA 4WWLA 2QJCA 2HYPA 3T1IA 4HD0A 1XM7A 3DW8C 3H68A 4G9JA 3H62B 5GTUA 3H69A 4DHLA 5HPEA 2WDEA 3ZU0A 5DNYA 3ICFA 4V0VA 1QFCA 3HVQA 4V0XA 4H1YP 4MOYA 3EGGA 4KBPA 2KKNA 2NPPC 4V0WA 5EQVA 4B2OA 1T70A 1Z2XA 3RQZA 4FBKA 4UWQA 3H61A 5C1VA 1UF3A 4LTYA 2Z72A 3V4YA 4O24A 1S95A 1SU1A 1OI8A 3H63A 2XMOA 1IT6A 1UTEA 3RL3A 3JYFA 3IVEA 4DSYA 1V73A 3KBPA 1OIEA 2QFPA 2WDDA 3PSNA 1FJMA 2WDFA 3H64A 4OR9A 1TCOA 3GVEA 4IL1A 3RL4A 3FGAC 2R17A 2O8AA 1HO5A 4UT2A 5B8IA 1S8EA 3H67A 2NYLC 1S3LA 3P71C 3THOB 1WAO1 3H60A 1HPUA 1W24A 4Q7FA 4LACC 2A22A 1T71A 4MP0A 3QFOA 3QFKA 1WARA 4FCXA 1S70A 2IAEC 3AUZA 2NXFA 2BQ8X 3DSCA 2Q8UA 3N5UA 2DFJA 4F0ZA 4XPNA 3E7BA 2USHA 2Z1AA 3H66A 3K7WC 1NNWA 3AV0A 2BCDA 1G5BA 3IVDA 4H2BA 4J6OA 3DSDA 4I5NC 1S3MA 3E7AA 2Z06A 3CK2A 3RL5A 1XZWA 2AHDA 3LL8A 4H2FA 2IE3C 3TGHA 5F3WA 4LU9A 1AUIA 2HYOA 4DT2A 4UT3A 5IOHA 3THNA 1M63A 3ZTVA 4IYPC 2JOGA 2CV9A 4UT3B 2HY1A 2GJUA 5INBA 1II7A 3IB7A 1QHWA 4TUIA 3IB8A 4O4KA 3QFMA 1S3NA 1Z2WA 1HP1A 3PSOA 4NZVA 1MF8A 5JPEA 4ZX2A 3C9FA 4M0VA 1USHA 1U32A 4JA9A 4H2GA 4ORBA 4YKEA 4I5LC 1KBPA 4ZVZA 3EGHA 1JK7A 1OIDA 2P6BA 2ZBMA 4ORCA 4FBQA 4TUGA 5JJTA 2WDCA 4KKZA 3K7VC 2IE4C 3QFNA 2QFRA 4O5GA 3QG5C 5J28A 4H2IA 4H1SA 5JPFA 3C5WC 4O43A 2BDXA 4JA7A 4FBWA 2O8GA
chains in the Genus database with same CATH superfamily
4WSGA 2B7VA 1X47A 1YFHA 4DV7E 3EPHA 2EMAA 1GZ6A 2MKDA 2K4VA 2YU8A 1A1KA 4I8OA 2QJCA 5AE3A 3DW8C 3H68A 4G9JA 2UU9E 4LF8E 2EMLA 2ENHA 4B3RE 2JYAA 1X49A 2YTIA 1JK2A 2G7HA 2EN2A 3E0JA 1EH8A 4JI5E 2L2KB 1QFCA 2EN8A 3EPJA 1FKAE 4H1YP 4RH8A 3EGGA 2NPPC 4KBPA 4NHRA 3OTOE 2DSYA 1T4OA 3EQ1A 3V4YA 1SU1A 1OI8A 2BDXA 4M9VC 5KL7A 1IT6A 1N33E 1IMUA 4ZYHA 4MLQA 3RL3A 5KL2A 4DSYA 3P1XA 1OIEA 2WDDA 3PSNA 2EOHA 1WHQA 4K0KE 2WDFA 3H64A 2LMZA 2B7TA 3FGAC 1A1GA 2EMKA 1HR0E 3HPSA 2L3JA 3C6MA 4LFCE 1S3LA 3THOB 1G2DC 1SFEA 3F6GA 1HPUA 1W24A 3H60A 3QFOA 5AC5A 1WARA 1S70A 5A6KA 1YPNA 3MSWA 2EM5A 2BQ8X 2EM6A 1PKPA 3JU0A 4R2CA 2DFJA 4YY3E 4F0ZA 1N32E 4XPNA 1BBOA 2EMYA 4BHBA 3H66A 1IBME 2L8TA 1NNWA 4WSPA 2EMFA 2ODRC 3MHSC 5KL4A 4J6OA 3F6HA 3HXLA 1S3MA 1HNWE 1G2FC 2DXLA 3ADIA 2Z06A 1SR9A 4H2FA 4ZYGA 2EQ1A 2RS6A 5F3WA 4JI2E 2EPRA 2V8QB 1PJQA 4KZSA 2EPMX 2K7IA 2RQLA 4F9CB 5IXMB 1X6HA 1HNXE 4F9BB 4OX9E 3ZTVA 2EPAA 2KHXA 2CV9A 2D9HA 2KOUA 1T39A 2L33A 2EOEA 3J7AG 2B3TB 1S3NA 2DMIA 2DLQA 1Z2WA 4ZX2A 4DKKA 4M0VA 1QU6A 2N3GA 2HJJA 4H2GA 1BBGA 2EL4A 4I5LC 2WZOA 4P7DA 2HC5A 5A6JA 2YRHA 3TQMA 2EQ3A 4ZVZA 5A69A 2F8BA 3KZZA 2L2MA 2YPNA 4JV5E 2WBSA 2N3HA 3KZYA 3HTXA 3QFNA 5LLQA 2EOQA 4WYQB 2EQ0A 3MHHC 2EN4A 3QG5C 4DV3E 2KONA 4JI7E 5JPFA 4R2QA 1YYWA 4R2DA 4R2PA 4B3ME 3BBGA 4ORAA 2V85A 3VYYA 4B3TE 1T4LB 2EN6A 4F6NA 3BIDA 5AE2A 4M2ZA 2LE2A 1T38A 4LFBE 5A6AA 2FV4B 2N8XA 3VK6A 1UILA 2E5LE 1YYKA 2HYPA 4DV5E 3H62B 4DHLA 2ELZA 4DR2E 3ZU0A 4BC7A 4V0VA 3ADGA 4L5NC 4R2EA 4LF9E 2EPOA 2L3CA 2LV2A 2MC6A 3HVQA 4BS9A 2LCEA 4MOYA 2FGGA 4J8ZA 4LF5E 4V0WA 1IBLE 4B2OA 1AAYA 3RQZA 4BCAA 4UWQA 3H61A 2YT4A 1UF3A 4O24A 3H63A 3IWBA 1XMQE 2XMOA 2EORA 2UUBE 5KL6A 1XNQE 1IBKE 4X64E 1FJGE 3ZOQB 2YU5A 1YUJA 3JTZA 2EPKX 2M7QA 1GQEA 1TCOA 2EMZA 3RL4A 2WBTA 2R17A 1KJKA 2JR1A 1B69A 4R03A 2ZO9B 3T1HE 1WRJA 3P71C 2V87A 2JOXA 1WAO1 4LACC 1Z1BA 4FCXA 2VQFE 3AUZA 2IAEC 2EOZA 2GHFA 2YSOA 4Q28A 2PRTA 4IS1C 2LRSA 3N5UA 1ZR9A 1ZAAC 2V89A 2YZTA 2Z1AA 4F54A 2EM8A 3AV0A 2EMCA 2YRMA 4FK5C 3IVDA 3FIGA 1QNTA 4WPYA 2EL6A 3E7AA 2AHDA 4ZYEA 5KL3A 1MEYC 3C4BA 4LFAE 5IOHA 4JI0E 1NCSA 4DR4E 3UK3C 2HY1A 2CSHA 5INBA 3IB7A 1BB8A 4TUIA 5IWAE 1QHWA 3IB8A 4O4KA 2LBSB 2UXCE 4ZYDA 4P78A 4NZVA 1MF8A 5JPEA 2UXDE 2EJ4A 2JVAA 1U32A 4ORBA 3J81C 4R2AA 1KBPA 2V88A 5AC4A 2EMIA 1I94E 1NEIA 3EGHA 4WFTA 1JK7A 2P6BA 4ORCA 2M9AA 4HEIA 4R8OA 4DV2E 1WJPA 1X6FA 1IQSA 1A1HA 2IE4C 2DRPA 2YSPA 1A1LA 5J28A 4H2IA 3DF6A 4X8WA 4MLVA 5T6JA 4JI4E 2EOJA 4BHCA 3J80C 2UXBE 2L6MA 1P47A 4JA7A 1LLMC 2NYMC 4GKJE 2YVTA 4WX9A 2EMXA 2EOFA 3M99B 2R76A 4BBYA 2GPIA 2HGHA 3C6KA 4X9JA 2WBUA 2NUGA 1XM7A 4HD0A 5GTUA 3H69A 1PJTA 5HPEA 4LF4E 1IQOA 2DLKA 1WXRA 5DNYA 2EMGA 2DGCA 3T1YE 3ICFA 2VQEE 2DIXA 5IV8B 3OMLA 4RHBB 3ADLA 3LLHA 2A25A 2JPAA 1L4SA 2KKNA 4R2SA 1T70A 4L8NA 1Z2XA 1STUA 2L92A 3VYXA 3RMPA 2YTFA 4FBKA 5C1VA 4B3SE 2MDGA 4LTYA 1A1JA 5LL6R 3ADJA 4KHPE 2E72A 1UHZA 1UTEA 2VF1A 4HTGA 3JYFA 3IVEA 2EZ6A 1V73A 3KBPA 2EN3A 2QFPA 2V86A 2MDRA 4OR9A 2EM4A 3H09A 2ENCA 3EPLA 4JI8E 1HO5A 1X48A 2YRKA 5KL5A 5B8IA 2YTDA 4GEQB 1S8EA 2NYLC 4F2JC 1TF6A 4Q7FA 2EM9A 2EOMA 1DGCA 2HHHE 3QFKA 2I13A 4N4RB 2EE8A 2LJUA 2NXFA 3J7Yp 4LF6E 3DSCA 2H36X 3BF2A 3E7BA 2YTOA 3K7WC 4BC9A 4JYAE 2EN1A 2EM3A 2EPZA 2LUQA 1G5BA 1N3GA 3DSDA 4I5NC 2EOIA 2JOBA 1GTKA 2EM2A 2EOXA 3CK2A 4DR7E 2ADRA 4KWYA 4LU9A 2YWQA 1AUIA 2UUCE 2HYOA 4DT2A 4BMJA 1YZ9A 2EMHA 4IYPC 1X6EA 4DR1E 2EPPA 1KYQA 2EMWA 2VE7C 1O0WA 2YTQA 3FLOA 1X3CA 1X5WA 2BB8A 2EPLX 4WXDA 5LMNE 4DUYE 3QFMA 2LTSA 4IJDA 5BR8E 4JI1E 2B9DA 3C9FA 1MGTA 2RSIA 4JA9A 2JXPA 1A1FA 4Q35B 2EOYA 2RTXA 2BBGA 1DQ3A 1AH5A 4DV6E 1JK1A 2ZBMA 1ZBQA 2EMBA 4FBQA 4TUGA 2EWLA 2ODRD 4KKZA 2CPNA 2EL5A 4O5GA 2M4IA 2CT1A 3C5WC 4O43A 3IWCA 3ECRA 3C4TA 2JP9A 3HQ1A 2RPCA 2A22A 2LUPB 2I9IA 2MKNA 4X65E 4OOGC 4YHHE 4MOVA 4WWLA 3KWRA 3T1IA 1HNZE 1TN9A 2RSMA 1PDAA 3JAMC 5LMUE 2GLIA 2WDEA 2E1MA 4JI3E 4X66E 2RS7A 1RC7A 1N36E 2EPCA 2EPUA 4GZNC 4NXNE 4AQYE 4V0XA 4DV1E 1YYOA 1J26A 5EQVA 1XMOE 4DV0E 2DXNA 5AASA 2L2NA 3IWDA 2ZOAA 1J5EE 1YUIA 2NUFA 2EP3A 2WCC3 2V83A 2Z72A 1RMDA 1S95A 1UN6B 5IT9C 2YTNA 2NUEA 5A2QC 4WXCA 1FJMA 3GVEA 4IL1A 2JWOA 3HPZA 4M30A 2R1FA 2O8AA 2F4VE 4DUZE 4UT2A 1N34E 3H67A 2EPNA 4MP0A 2EPXA 1T71A 1EH6A 2YTPA 5A6BA 1ZBTA 2YTJA 2UUAE 2YTEA 1TF3A 2FTXB 3L00A 3LMLA 2IHR1 1EH7A 2LVHA 2LO3A 2CTDA 2Q8UA 5ADZA 5FLXC 2LT7A 2YTGA 4DR3E 1A1IA 2USHA 1XNRE 2M1SA 2BCDA 1EKZA 1UBDC 3D03A 4H2BA 1YSAC 4DV4E 2ELYA 3RL5A 1XZWA 2NA2A 3LL8A 5CFFE 2IE3C 3TGHA 4DR6E 1F2IG 5A6BD 4GKKE 4DMIA 4UT3A 4F9AB 3THNA 1ZU1A 2YEQA 1M63A 2JOGA 1PJSA 4UT3B 2MC5A 2GJUA 1II7A 5TSEA 4X62E 3VHTB 4LF7E 2EOOA 3PSOA 1HP1A 1DI2A 3BGHA 1T4NA 2ZM6E 2NABA 2LJHA 1USHA 4YKEA 2DB2A 4NXME 2EM0A 2LTRA 3EPKA 1OIDA 2ENAA 2EOSA 3K6QA 1RQ0A 5JJTA 2WDCA 4F6MA 3K7VC 2DMYA 3DJWA 5AE1A 2QFRA 2EM7A 4H1SA 2JY9A 1WHNA 4R2RA 2EN7A 4FBWA 4JI6E 2J7JA 2VRDA 4DR5E 2O8GA
chains in the Genus database with same CATH topology
2NYMC 2YVTA 4ORAA 4MOVA 4WWLA 2QJCA 2HYPA 3T1IA 4HD0A 1XM7A 3DW8C 3H68A 4G9JA 3H62B 5GTUA 3H69A 4DHLA 5HPEA 2WDEA 3ZU0A 5DNYA 3ICFA 4V0VA 3E0JA 1QFCA 3HVQA 4V0XA 4H1YP 4MOYA 3EGGA 4KBPA 2KKNA 2NPPC 4V0WA 5EQVA 4B2OA 1T70A 1Z2XA 2DXNA 3RQZA 2ZOAA 4FBKA 4UWQA 3H61A 5C1VA 1UF3A 4LTYA 2Z72A 3V4YA 4O24A 1S95A 1SU1A 1OI8A 3H63A 2XMOA 1IT6A 1UTEA 3RL3A 3JYFA 3IVEA 4DSYA 1V73A 3KBPA 1OIEA 2QFPA 2WDDA 3PSNA 1FJMA 2WDFA 3H64A 4OR9A 1TCOA 3GVEA 4IL1A 3RL4A 3FGAC 2R17A 2O8AA 1HO5A 4UT2A 5B8IA 2ZO9B 1S8EA 3H67A 2NYLC 1S3LA 3P71C 3THOB 1WAO1 3H60A 1HPUA 1W24A 4Q7FA 4LACC 2A22A 1T71A 4MP0A 3QFOA 3QFKA 1WARA 4FCXA 1S70A 2IAEC 3AUZA 2NXFA 2BQ8X 3DSCA 2Q8UA 3N5UA 2DFJA 4F0ZA 4XPNA 3E7BA 2USHA 2Z1AA 3H66A 3K7WC 1NNWA 3AV0A 2BCDA 1G5BA 3IVDA 3DSDA 3D03A 4H2BA 4I5NC 4J6OA 1S3MA 3E7AA 2DXLA 2Z06A 3CK2A 3RL5A 1XZWA 2AHDA 3LL8A 4H2FA 2IE3C 3TGHA 5F3WA 4LU9A 1AUIA 2HYOA 4DT2A 4UT3A 5IOHA 3THNA 2YEQA 1M63A 3ZTVA 4IYPC 2JOGA 2CV9A 4UT3B 2HY1A 2GJUA 5INBA 1II7A 3IB7A 3FLOA 1QHWA 4TUIA 3IB8A 4O4KA 3QFMA 1S3NA 1Z2WA 1HP1A 3PSOA 4NZVA 1MF8A 5JPEA 4ZX2A 3C9FA 4M0VA 1USHA 1U32A 4JA9A 4H2GA 4ORBA 4YKEA 4I5LC 1KBPA 4ZVZA 3EGHA 1JK7A 1OIDA 2P6BA 2ZBMA 4ORCA 4FBQA 4TUGA 5JJTA 2WDCA 4KKZA 3K7VC 2IE4C 3QFNA 2QFRA 4O5GA 3QG5C 5J28A 4H2IA 4H1SA 5JPFA 3C5WC 4O43A 2BDXA 4JA7A 4FBWA 2O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYM C;  2YVT A;  4ORA A;  4MOV A;  4WWL A;  2QJC A;  2HYP A;  3T1I A;  4HD0 A;  1XM7 A;  3DW8 C;  3H68 A;  4G9J A;  3H62 B;  5GTU A;  3H69 A;  4DHL A;  5HPE A;  2WDE A;  3ZU0 A;  5DNY A;  3ICF A;  4V0V A;  1QFC A;  3HVQ A;  4V0X A;  4H1Y P;  4MOY A;  3EGG A;  4KBP A;  2KKN A;  2NPP C;  4V0W A;  5EQV A;  4B2O A;  1T70 A;  1Z2X A;  3RQZ A;  4FBK A;  4UWQ A;  3H61 A;  5C1V A;  1UF3 A;  4LTY A;  2Z72 A;  3V4Y A;  4O24 A;  1S95 A;  1SU1 A;  1OI8 A;  3H63 A;  2XMO A;  1IT6 A;  1UTE A;  3RL3 A;  3JYF A;  3IVE A;  4DSY A;  1V73 A;  3KBP A;  1OIE A;  2QFP A;  2WDD A;  3PSN A;  1FJM A;  2WDF A;  3H64 A;  4OR9 A;  1TCO A;  3GVE A;  4IL1 A;  3RL4 A;  3FGA C;  2R17 A;  2O8A A;  1HO5 A;  4UT2 A;  5B8I A;  1S8E A;  3H67 A;  2NYL C;  1S3L A;  3P71 C;  3THO B;  1WAO 1;  3H60 A;  1HPU A;  1W24 A;  4Q7F A;  4LAC C;  2A22 A;  1T71 A;  4MP0 A;  3QFO A;  3QFK A;  1WAR A;  4FCX A;  1S70 A;  2IAE C;  3AUZ A;  2NXF A;  2BQ8 X;  3DSC A;  2Q8U A;  3N5U A;  2DFJ A;  4F0Z A;  4XPN A;  3E7B A;  2USH A;  2Z1A A;  3H66 A;  3K7W C;  1NNW A;  3AV0 A;  2BCD A;  1G5B A;  3IVD A;  4H2B A;  4J6O A;  3DSD A;  4I5N C;  1S3M A;  3E7A A;  2Z06 A;  3CK2 A;  3RL5 A;  1XZW A;  2AHD A;  3LL8 A;  4H2F A;  2IE3 C;  3TGH A;  5F3W A;  4LU9 A;  1AUI A;  2HYO A;  4DT2 A;  4UT3 A;  5IOH A;  3THN A;  1M63 A;  3ZTV A;  4IYP C;  2JOG A;  2CV9 A;  4UT3 B;  2HY1 A;  2GJU A;  5INB A;  1II7 A;  3IB7 A;  1QHW A;  4TUI A;  3IB8 A;  4O4K A;  3QFM A;  1S3N A;  1Z2W A;  1HP1 A;  3PSO A;  4NZV A;  1MF8 A;  5JPE A;  4ZX2 A;  3C9F A;  4M0V A;  1USH A;  1U32 A;  4JA9 A;  4H2G A;  4ORB A;  4YKE A;  4I5L C;  1KBP A;  4ZVZ A;  3EGH A;  1JK7 A;  1OID A;  2P6B A;  2ZBM A;  4ORC A;  4FBQ A;  4TUG A;  5JJT A;  2WDC A;  4KKZ A;  3K7V C;  2IE4 C;  3QFN A;  2QFR A;  4O5G A;  3QG5 C;  5J28 A;  4H2I A;  4H1S A;  5JPF A;  3C5W C;  4O43 A;  2BDX A;  4JA7 A;  4FBW A;  2O8G A; 
#chains in the Genus database with same CATH topology
 4WSG A;  2B7V A;  1X47 A;  1YFH A;  4DV7 E;  3EPH A;  2EMA A;  1GZ6 A;  2MKD A;  2K4V A;  2YU8 A;  1A1K A;  4I8O A;  2QJC A;  5AE3 A;  3DW8 C;  3H68 A;  4G9J A;  2UU9 E;  4LF8 E;  2EML A;  2ENH A;  4B3R E;  2JYA A;  1X49 A;  2YTI A;  1JK2 A;  2G7H A;  2EN2 A;  3E0J A;  1EH8 A;  4JI5 E;  2L2K B;  1QFC A;  2EN8 A;  3EPJ A;  1FKA E;  4H1Y P;  4RH8 A;  3EGG A;  2NPP C;  4KBP A;  4NHR A;  3OTO E;  2DSY A;  1T4O A;  3EQ1 A;  3V4Y A;  1SU1 A;  1OI8 A;  2BDX A;  4M9V C;  5KL7 A;  1IT6 A;  1N33 E;  1IMU A;  4ZYH A;  4MLQ A;  3RL3 A;  5KL2 A;  4DSY A;  3P1X A;  1OIE A;  2WDD A;  3PSN A;  2EOH A;  1WHQ A;  4K0K E;  2WDF A;  3H64 A;  2LMZ A;  2B7T A;  3FGA C;  1A1G A;  2EMK A;  1HR0 E;  3HPS A;  2L3J A;  3C6M A;  4LFC E;  1S3L A;  3THO B;  1G2D C;  1SFE A;  3F6G A;  1HPU A;  1W24 A;  3H60 A;  3QFO A;  5AC5 A;  1WAR A;  1S70 A;  5A6K A;  1YPN A;  3MSW A;  2EM5 A;  2BQ8 X;  2EM6 A;  1PKP A;  3JU0 A;  4R2C A;  2DFJ A;  4YY3 E;  4F0Z A;  1N32 E;  4XPN A;  1BBO A;  2EMY A;  4BHB A;  3H66 A;  1IBM E;  2L8T A;  1NNW A;  4WSP A;  2EMF A;  2ODR C;  3MHS C;  5KL4 A;  4J6O A;  3F6H A;  3HXL A;  1S3M A;  1HNW E;  1G2F C;  2DXL A;  3ADI A;  2Z06 A;  1SR9 A;  4H2F A;  4ZYG A;  2EQ1 A;  2RS6 A;  5F3W A;  4JI2 E;  2EPR A;  2V8Q B;  1PJQ A;  4KZS A;  2EPM X;  2K7I A;  2RQL A;  4F9C B;  5IXM B;  1X6H A;  1HNX E;  4F9B B;  4OX9 E;  3ZTV A;  2EPA A;  2KHX A;  2CV9 A;  2D9H A;  2KOU A;  1T39 A;  2L33 A;  2EOE A;  3J7A G;  2B3T B;  1S3N A;  2DMI A;  2DLQ A;  1Z2W A;  4ZX2 A;  4DKK A;  4M0V A;  1QU6 A;  2N3G A;  2HJJ A;  4H2G A;  1BBG A;  2EL4 A;  4I5L C;  2WZO A;  4P7D A;  2HC5 A;  5A6J A;  2YRH A;  3TQM A;  2EQ3 A;  4ZVZ A;  5A69 A;  2F8B A;  3KZZ A;  2L2M A;  2YPN A;  4JV5 E;  2WBS A;  2N3H A;  3KZY A;  3HTX A;  3QFN A;  5LLQ A;  2EOQ A;  4WYQ B;  2EQ0 A;  3MHH C;  2EN4 A;  3QG5 C;  4DV3 E;  2KON A;  4JI7 E;  5JPF A;  4R2Q A;  1YYW A;  4R2D A;  4R2P A;  4B3M E;  3BBG A;  4ORA A;  2V85 A;  3VYY A;  4B3T E;  1T4L B;  2EN6 A;  4F6N A;  3BID A;  5AE2 A;  4M2Z A;  2LE2 A;  1T38 A;  4LFB E;  5A6A A;  2FV4 B;  2N8X A;  3VK6 A;  1UIL A;  2E5L E;  1YYK A;  2HYP A;  4DV5 E;  3H62 B;  4DHL A;  2ELZ A;  4DR2 E;  3ZU0 A;  4BC7 A;  4V0V A;  3ADG A;  4L5N C;  4R2E A;  4LF9 E;  2EPO A;  2L3C A;  2LV2 A;  2MC6 A;  3HVQ A;  4BS9 A;  2LCE A;  4MOY A;  2FGG A;  4J8Z A;  4LF5 E;  4V0W A;  1IBL E;  4B2O A;  1AAY A;  3RQZ A;  4BCA A;  4UWQ A;  3H61 A;  2YT4 A;  1UF3 A;  4O24 A;  3H63 A;  3IWB A;  1XMQ E;  2XMO A;  2EOR A;  2UUB E;  5KL6 A;  1XNQ E;  1IBK E;  4X64 E;  1FJG E;  3ZOQ B;  2YU5 A;  1YUJ A;  3JTZ A;  2EPK X;  2M7Q A;  1GQE A;  1TCO A;  2EMZ A;  3RL4 A;  2WBT A;  2R17 A;  1KJK A;  2JR1 A;  1B69 A;  4R03 A;  2ZO9 B;  3T1H E;  1WRJ A;  3P71 C;  2V87 A;  2JOX A;  1WAO 1;  4LAC C;  1Z1B A;  4FCX A;  2VQF E;  3AUZ A;  2IAE C;  2EOZ A;  2GHF A;  2YSO A;  4Q28 A;  2PRT A;  4IS1 C;  2LRS A;  3N5U A;  1ZR9 A;  1ZAA C;  2V89 A;  2YZT A;  2Z1A A;  4F54 A;  2EM8 A;  3AV0 A;  2EMC A;  2YRM A;  4FK5 C;  3IVD A;  3FIG A;  1QNT A;  4WPY A;  2EL6 A;  3E7A A;  2AHD A;  4ZYE A;  5KL3 A;  1MEY C;  3C4B A;  4LFA E;  5IOH A;  4JI0 E;  1NCS A;  4DR4 E;  3UK3 C;  2HY1 A;  2CSH A;  5INB A;  3IB7 A;  1BB8 A;  4TUI A;  5IWA E;  1QHW A;  3IB8 A;  4O4K A;  2LBS B;  2UXC E;  4ZYD A;  4P78 A;  4NZV A;  1MF8 A;  5JPE A;  2UXD E;  2EJ4 A;  2JVA A;  1U32 A;  4ORB A;  3J81 C;  4R2A A;  1KBP A;  2V88 A;  5AC4 A;  2EMI A;  1I94 E;  1NEI A;  3EGH A;  4WFT A;  1JK7 A;  2P6B A;  4ORC A;  2M9A A;  4HEI A;  4R8O A;  4DV2 E;  1WJP A;  1X6F A;  1IQS A;  1A1H A;  2IE4 C;  2DRP A;  2YSP A;  1A1L A;  5J28 A;  4H2I A;  3DF6 A;  4X8W A;  4MLV A;  5T6J A;  4JI4 E;  2EOJ A;  4BHC A;  3J80 C;  2UXB E;  2L6M A;  1P47 A;  4JA7 A;  1LLM C;  2NYM C;  4GKJ E;  2YVT A;  4WX9 A;  2EMX A;  2EOF A;  3M99 B;  2R76 A;  4BBY A;  2GPI A;  2HGH A;  3C6K A;  4X9J A;  2WBU A;  2NUG A;  1XM7 A;  4HD0 A;  5GTU A;  3H69 A;  1PJT A;  5HPE A;  4LF4 E;  1IQO A;  2DLK A;  1WXR A;  5DNY A;  2EMG A;  2DGC A;  3T1Y E;  3ICF A;  2VQE E;  2DIX A;  5IV8 B;  3OML A;  4RHB B;  3ADL A;  3LLH A;  2A25 A;  2JPA A;  1L4S A;  2KKN A;  4R2S A;  1T70 A;  4L8N A;  1Z2X A;  1STU A;  2L92 A;  3VYX A;  3RMP A;  2YTF A;  4FBK A;  5C1V A;  4B3S E;  2MDG A;  4LTY A;  1A1J A;  5LL6 R;  3ADJ A;  4KHP E;  2E72 A;  1UHZ A;  1UTE A;  2VF1 A;  4HTG A;  3JYF A;  3IVE A;  2EZ6 A;  1V73 A;  3KBP A;  2EN3 A;  2QFP A;  2V86 A;  2MDR A;  4OR9 A;  2EM4 A;  3H09 A;  2ENC A;  3EPL A;  4JI8 E;  1HO5 A;  1X48 A;  2YRK A;  5KL5 A;  5B8I A;  2YTD A;  4GEQ B;  1S8E A;  2NYL C;  4F2J C;  1TF6 A;  4Q7F A;  2EM9 A;  2EOM A;  1DGC A;  2HHH E;  3QFK A;  2I13 A;  4N4R B;  2EE8 A;  2LJU A;  2NXF A;  3J7Y p;  4LF6 E;  3DSC A;  2H36 X;  3BF2 A;  3E7B A;  2YTO A;  3K7W C;  4BC9 A;  4JYA E;  2EN1 A;  2EM3 A;  2EPZ A;  2LUQ A;  1G5B A;  1N3G A;  3DSD A;  4I5N C;  2EOI A;  2JOB A;  1GTK A;  2EM2 A;  2EOX A;  3CK2 A;  4DR7 E;  2ADR A;  4KWY A;  4LU9 A;  2YWQ A;  1AUI A;  2UUC E;  2HYO A;  4DT2 A;  4BMJ A;  1YZ9 A;  2EMH A;  4IYP C;  1X6E A;  4DR1 E;  2EPP A;  1KYQ A;  2EMW A;  2VE7 C;  1O0W A;  2YTQ A;  3FLO A;  1X3C A;  1X5W A;  2BB8 A;  2EPL X;  4WXD A;  5LMN E;  4DUY E;  3QFM A;  2LTS A;  4IJD A;  5BR8 E;  4JI1 E;  2B9D A;  3C9F A;  1MGT A;  2RSI A;  4JA9 A;  2JXP A;  1A1F A;  4Q35 B;  2EOY A;  2RTX A;  2BBG A;  1DQ3 A;  1AH5 A;  4DV6 E;  1JK1 A;  2ZBM A;  1ZBQ A;  2EMB A;  4FBQ A;  4TUG A;  2EWL A;  2ODR D;  4KKZ A;  2CPN A;  2EL5 A;  4O5G A;  2M4I A;  2CT1 A;  3C5W C;  4O43 A;  3IWC A;  3ECR A;  3C4T A;  2JP9 A;  3HQ1 A;  2RPC A;  2A22 A;  2LUP B;  2I9I A;  2MKN A;  4X65 E;  4OOG C;  4YHH E;  4MOV A;  4WWL A;  3KWR A;  3T1I A;  1HNZ E;  1TN9 A;  2RSM A;  1PDA A;  3JAM C;  5LMU E;  2GLI A;  2WDE A;  2E1M A;  4JI3 E;  4X66 E;  2RS7 A;  1RC7 A;  1N36 E;  2EPC A;  2EPU A;  4GZN C;  4NXN E;  4AQY E;  4V0X A;  4DV1 E;  1YYO A;  1J26 A;  5EQV A;  1XMO E;  4DV0 E;  2DXN A;  5AAS A;  2L2N A;  3IWD A;  2ZOA A;  1J5E E;  1YUI A;  2NUF A;  2EP3 A;  2WCC 3;  2V83 A;  2Z72 A;  1RMD A;  1S95 A;  1UN6 B;  5IT9 C;  2YTN A;  2NUE A;  5A2Q C;  4WXC A;  1FJM A;  3GVE A;  4IL1 A;  2JWO A;  3HPZ A;  4M30 A;  2R1F A;  2O8A A;  2F4V E;  4DUZ E;  4UT2 A;  1N34 E;  3H67 A;  2EPN A;  4MP0 A;  2EPX A;  1T71 A;  1EH6 A;  2YTP A;  5A6B A;  1ZBT A;  2YTJ A;  2UUA E;  2YTE A;  1TF3 A;  2FTX B;  3L00 A;  3LML A;  2IHR 1;  1EH7 A;  2LVH A;  2LO3 A;  2CTD A;  2Q8U A;  5ADZ A;  5FLX C;  2LT7 A;  2YTG A;  4DR3 E;  1A1I A;  2USH A;  1XNR E;  2M1S A;  2BCD A;  1EKZ A;  1UBD C;  3D03 A;  4H2B A;  1YSA C;  4DV4 E;  2ELY A;  3RL5 A;  1XZW A;  2NA2 A;  3LL8 A;  5CFF E;  2IE3 C;  3TGH A;  4DR6 E;  1F2I G;  5A6B D;  4GKK E;  4DMI A;  4UT3 A;  4F9A B;  3THN A;  1ZU1 A;  2YEQ A;  1M63 A;  2JOG A;  1PJS A;  4UT3 B;  2MC5 A;  2GJU A;  1II7 A;  5TSE A;  4X62 E;  3VHT B;  4LF7 E;  2EOO A;  3PSO A;  1HP1 A;  1DI2 A;  3BGH A;  1T4N A;  2ZM6 E;  2NAB A;  2LJH A;  1USH A;  4YKE A;  2DB2 A;  4NXM E;  2EM0 A;  2LTR A;  3EPK A;  1OID A;  2ENA A;  2EOS A;  3K6Q A;  1RQ0 A;  5JJT A;  2WDC A;  4F6M A;  3K7V C;  2DMY A;  3DJW A;  5AE1 A;  2QFR A;  2EM7 A;  4H1S A;  2JY9 A;  1WHN A;  4R2R A;  2EN7 A;  4FBW A;  4JI6 E;  2J7J A;  2VRD A;  4DR5 E;  2O8G A; 
#chains in the Genus database with same CATH homology
 2NYM C;  2YVT A;  4ORA A;  4MOV A;  4WWL A;  2QJC A;  2HYP A;  3T1I A;  4HD0 A;  1XM7 A;  3DW8 C;  3H68 A;  4G9J A;  3H62 B;  5GTU A;  3H69 A;  4DHL A;  5HPE A;  2WDE A;  3ZU0 A;  5DNY A;  3ICF A;  4V0V A;  3E0J A;  1QFC A;  3HVQ A;  4V0X A;  4H1Y P;  4MOY A;  3EGG A;  4KBP A;  2KKN A;  2NPP C;  4V0W A;  5EQV A;  4B2O A;  1T70 A;  1Z2X A;  2DXN A;  3RQZ A;  2ZOA A;  4FBK A;  4UWQ A;  3H61 A;  5C1V A;  1UF3 A;  4LTY A;  2Z72 A;  3V4Y A;  4O24 A;  1S95 A;  1SU1 A;  1OI8 A;  3H63 A;  2XMO A;  1IT6 A;  1UTE A;  3RL3 A;  3JYF A;  3IVE A;  4DSY A;  1V73 A;  3KBP A;  1OIE A;  2QFP A;  2WDD A;  3PSN A;  1FJM A;  2WDF A;  3H64 A;  4OR9 A;  1TCO A;  3GVE A;  4IL1 A;  3RL4 A;  3FGA C;  2R17 A;  2O8A A;  1HO5 A;  4UT2 A;  5B8I A;  2ZO9 B;  1S8E A;  3H67 A;  2NYL C;  1S3L A;  3P71 C;  3THO B;  1WAO 1;  3H60 A;  1HPU A;  1W24 A;  4Q7F A;  4LAC C;  2A22 A;  1T71 A;  4MP0 A;  3QFO A;  3QFK A;  1WAR A;  4FCX A;  1S70 A;  2IAE C;  3AUZ A;  2NXF A;  2BQ8 X;  3DSC A;  2Q8U A;  3N5U A;  2DFJ A;  4F0Z A;  4XPN A;  3E7B A;  2USH A;  2Z1A A;  3H66 A;  3K7W C;  1NNW A;  3AV0 A;  2BCD A;  1G5B A;  3IVD A;  3DSD A;  3D03 A;  4H2B A;  4I5N C;  4J6O A;  1S3M A;  3E7A A;  2DXL A;  2Z06 A;  3CK2 A;  3RL5 A;  1XZW A;  2AHD A;  3LL8 A;  4H2F A;  2IE3 C;  3TGH A;  5F3W A;  4LU9 A;  1AUI A;  2HYO A;  4DT2 A;  4UT3 A;  5IOH A;  3THN A;  2YEQ A;  1M63 A;  3ZTV A;  4IYP C;  2JOG A;  2CV9 A;  4UT3 B;  2HY1 A;  2GJU A;  5INB A;  1II7 A;  3IB7 A;  3FLO A;  1QHW A;  4TUI A;  3IB8 A;  4O4K A;  3QFM A;  1S3N A;  1Z2W A;  1HP1 A;  3PSO A;  4NZV A;  1MF8 A;  5JPE A;  4ZX2 A;  3C9F A;  4M0V A;  1USH A;  1U32 A;  4JA9 A;  4H2G A;  4ORB A;  4YKE A;  4I5L C;  1KBP A;  4ZVZ A;  3EGH A;  1JK7 A;  1OID A;  2P6B A;  2ZBM A;  4ORC A;  4FBQ A;  4TUG A;  5JJT A;  2WDC A;  4KKZ A;  3K7V C;  2IE4 C;  3QFN A;  2QFR A;  4O5G A;  3QG5 C;  5J28 A;  4H2I A;  4H1S A;  5JPF A;  3C5W C;  4O43 A;  2BDX A;  4JA7 A;  4FBW A;  2O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...