4O43A

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
total genus 96
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o43A02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o43A01
4LU9A 4V0VA 3AUZA 4F0ZA 4ORBA 3DSDA 2R17A 4FBWA 4KKZA 4NZVA 3RL3A 2IE3C 3E7AA 3PSNA 4OR9A 5JPFA 2JOGA 2ZBMA 4FBKA 4H1YP 3K7WC 4H2BA 2HY1A 4H2GA 4UT2A 4MP0A 1T70A 4V0XA 3IB7A 5EQVA 3RL4A 4UT3B 3ZTVA 1OIDA 3GVEA 2GJUA 3H67A 3IVDA 3QFKA 1S70A 2QJCA 2Z1AA 2DFJA 2QFPA 4YKEA 3H63A 4DSYA 5JPEA 3PSOA 2IAEC 2WDCA 1OIEA 4FCXA 1II7A 2BCDA 2NYLC 1V73A 1S3MA 1S3LA 3JYFA 1W24A 3THNA 1MF8A 2WDEA 4JA9A 2BDXA 2NXFA 1OI8A 5GTUA 4H2IA 3TGHA 3QG5C 1AUIA 2O8AA 3C5WC 1QHWA 1HPUA 2YVTA 1M63A 4HD0A 4I5LC 4TUIA 3H62B 4O43A 5B8IA 1XZWA 3H66A 3T1IA 3V4YA 1UF3A 2AHDA 1FJMA 1U32A 4IL1A 1WARA 2KKNA 1T71A 1JK7A 4ORAA 3RQZA 3DW8C 3QFNA 4UWQA 4XPNA 2NYMC 3FGAC 2Z06A 4B2OA 2CV9A 4O4KA 2XMOA 1WAO1 1IT6A 1XM7A 4G9JA 1NNWA 3LL8A 4M0VA 4J6OA 2BQ8X 3RL5A 4H1SA 3IB8A 3AV0A 3ZU0A 1HO5A 3KBPA 3N5UA 5F3WA 5DNYA 3EGGA 5INBA 1USHA 1S95A 2IE4C 4WWLA 3K7VC 2Z72A 4DT2A 5J28A 4Q7FA 3DSCA 2Q8UA 2NPPC 2O8GA 4LTYA 5IOHA 4TUGA 2QFRA 3QFOA 4H2FA 2USHA 4V0WA 1S8EA 3CK2A 4UT3A 3HVQA 3H61A 3EGHA 1Z2XA 2WDDA 3H64A 4I5NC 2HYOA 3H69A 4KBPA 3H60A 1QFCA 3C9FA 1TCOA 5C1VA 3ICFA 2WDFA 4ORCA 1S3NA 2P6BA 3IVEA 3P71C 4DHLA 1KBPA 1SU1A 3H68A 1HP1A 2A22A 4JA7A 1Z2WA 4O24A 5HPEA 1UTEA 4FBQA 1G5BA 4O5GA 4IYPC 4ZVZA 5JJTA 3E7BA 4LACC 3QFMA 3THOB 4MOYA 4ZX2A 4MOVA 2HYPA
chains in the Genus database with same CATH superfamily
4LU9A 5KL7A 4ORBA 2GPIA 2EM7A 4K0KE 2R17A 4FBWA 4KKZA 3F6GA 1HNXE 3E7AA 3PSNA 3BBGA 4DR5E 1X5WA 2JOGA 4WXDA 5A6BD 2I13A 4H1YP 4H2GA 4UT2A 4MP0A 4WSPA 3UK3C 3IB7A 3VHTB 2M7QA 2EN4A 2E5LE 2EMBA 2JWOA 2EN1A 4IS1C 1XMOE 2PRTA 2ZOAA 1A1FA 3EPKA 3ZTVA 2LUQA 1OIDA 3FLOA 3H67A 1NEIA 5KL3A 4R2RA 2H36X 4YKEA 3H63A 4DSYA 3PSOA 1YYOA 1OIEA 2LE2A 2RPCA 2NYLC 1S3MA 2L2NA 4JA9A 1RC7A 1PKPA 1YUJA 2M9AA 4OOGC 1PJTA 4HTGA 2HJJA 4F2JC 5GTUA 2V88A 2YTOA 4I5LC 4MOYA 2FTXB 2YVTA 1UHZA 4DMIA 1J5EE 4OX9E 2JYAA 1XNRE 3H66A 2EMHA 3DJWA 1JK2A 2VQFE 2AHDA 2EPRA 5IT9C 1U32A 4ZYDA 1A1IA 2LJUA 3BGHA 1T71A 2ZM6E 4ORAA 2MDGA 1L4SA 2EM4A 5LLQA 3FGAC 1A1GA 4B2OA 4AQYE 2UXBE 2EPAA 3BF2A 2EMKA 1WAO1 5IXMB 2V83A 3EPHA 4YHHE 4G9JA 2R76A 2FV4B 2N3GA 1NNWA 4MLVA 2RSMA 2L2MA 4R2AA 2EOEA 3AV0A 3ZU0A 5AE2A 1XNQE 1ZR9A 4R2QA 3EQ1A 4JI5E 5DNYA 5INBA 1USHA 1GQEA 3E0JA 4DV4E 1I94E 2Z72A 4KWYA 1KYQA 1T4LB 4BHCA 4BBYA 2EORA 2EMCA 5IOHA 2MKNA 2GHFA 4P78A 5LMNE 4UT3A 1DGCA 3EGHA 4WFTA 2L92A 2WDDA 3H64A 4M9VC 2YTPA 4FK5C 2HYOA 2ELYA 4X62E 2JOXA 2WDFA 2DRPA 1S3NA 3P71C 3IVEA 1SU1A 2KOUA 1WHQA 2WZOA 2B7VA 3F6HA 4GKKE 2HGHA 4WSGA 2YTIA 4JA7A 2CTDA 3J81C 1UTEA 4FBQA 1X49A 1AAYA 2YTGA 3VK6A 4BMJA 4IYPC 5JJTA 2K7IA 3H09A 3E7BA 4WYQB 4ZX2A 2HYPA 3K6QA 2YSOA 2JP9A 2RS6A 1A1HA 2CPNA 2YTJA 2V8QB 3RL3A 3P1XA 1STUA 1T39A 2EWLA 1GZ6A 4KHPE 2LCEA 4OR9A 5ADZA 2EMAA 4F54A 4R2DA 2HHHE 4FBKA 5KL6A 1YSAC 1TF6A 3HXLA 1LLMC 4V0XA 2A25A 3EPLA 2L33A 5EQVA 2EM2A 3HPZA 4Q35B 2EPCA 2YT4A 2QFPA 2HC5A 2EM9A 2E1MA 1N36E 2DIXA 5JPEA 2YTQA 2WBUA 4YY3E 2EMZA 4WXCA 2JY9A 5IWAE 1W24A 3THNA 2EL6A 1IBKE 1MF8A 2WDEA 2BDXA 4DV7E 1X6EA 4GKJE 3TGHA 4R03A 1AUIA 2O8AA 5B8IA 4TUIA 1PJQA 3HPSA 5LL6R 4HD0A 3DSDA 2F4VE 4DV5E 4JI6E 2B9DA 4DV2E 3T1IA 2UUBE 2JOBA 1A1KA 2YTDA 1X3CA 1MEYC 2EMXA 1FJMA 4IL1A 2KKNA 2YTFA 5AC5A 3KZYA 4JI3E 3IWDA 2EL5A 1JK1A 4BCAA 4GZNC 3T1HE 1FKAE 2DXNA 3QFNA 2Z06A 4XPNA 1NCSA 1A1LA 2YSPA 4J8ZA 4X9JA 2XMOA 3EPJA 1N3GA 1IT6A 1IQOA 4L5NC 4LF5E 1RQ0A 2CT1A 4L8NA 2EE8A 3M99B 1YYWA 3IB8A 3T1YE 5LMUE 3N5UA 3HQ1A 1SR9A 3EGGA 2EOFA 2MDRA 4R2EA 3JU0A 4Q7FA 4F6MA 1ZU1A 1UN6B 2NPPC 5KL2A 2EOQA 1WHNA 2ENHA 4LTYA 2DGCA 4H2FA 2EQ3A 2V89A 1S8EA 1F2IG 2YPNA 2EPLX 2DSYA 2VQEE 3C6MA 1DQ3A 4F9AB 3H61A 2LTRA 1X6FA 1Z2XA 2I9IA 2WBTA 3H69A 1KJKA 4KBPA 4LF8E 2LMZA 4B3RE 1QFCA 3H60A 3DF6A 1TCOA 3C6KA 5C1VA 3ICFA 2L3CA 4ORCA 2P6BA 2EM3A 1YFHA 1HNZE 1TN9A 2EOHA 1HP1A 2EQ1A 2A22A 2RS7A 4DR6E 3KZZA 1P47A 2EP3A 2YEQA 1IBLE 4ZVZA 1HR0E 2EN7A 4LF9E 2ADRA 4BHBA 4MOVA 4R2CA 2BB8A 1ZBQA 2CSHA 2N3HA 1ZAAC 4F0ZA 5A6BA 4LF6E 1YYKA 5JPFA 2YU5A 2DMIA 4HEIA 3K7WC 1ZBTA 1HNWE 2EMFA 4H2BA 2HY1A 4MLQA 1N34E 1BBGA 2YRKA 4BC9A 2EN6A 3RL4A 2NABA 4UT3B 4F9BB 2DLKA 4RHBB 3GVEA 3IVDA 3QFKA 1S70A 5IV8B 4DR4E 2QJCA 5AE1A 2DFJA 2EPMX 4DV3E 4X8WA 3ZOQB 2IAEC 2WDCA 4FCXA 5FLXC 3C4TA 1II7A 2BCDA 1YUIA 3JYFA 2YRMA 3LLHA 3LMLA 2YZTA 3MSWA 2EMLA 4H2IA 1QNTA 2KONA 3QG5C 3C5WC 1HPUA 2ENAA 2YRHA 4DR1E 2K4VA 2LBSB 4O43A 2LJHA 4ZYEA 1IMUA 2F8BA 3VYYA 4LFBE 1B69A 2UUAE 3V4YA 2WCC3 4JI8E 5A69A 4BS9A 1Z1BA 2EQ0A 4LF7E 2EOYA 4JI1E 1JK7A 2YTNA 3DW8C 4NHRA 4JI4E 3FIGA 2UU9E 2J7JA 4O4KA 4KZSA 5T6JA 3ADJA 4LFCE 4R8OA 3LL8A 4M0VA 2UXCE 4J6OA 4X64E 2BQ8X 1G2DC 4ZYHA 3C4BA 5A6KA 3KWRA 2EN3A 1HO5A 2VE7C 4M2ZA 4LF4E 4WPYA 3ADLA 4NXME 3J80C 1S95A 4WWLA 2EOZA 4JI7E 1EH8A 4LFAE 4B3SE 2EOSA 4DT2A 3DSCA 1FJGE 1TF3A 4DR7E 2EMWA 1T4OA 4IJDA 2USHA 2L6MA 1IQSA 3HTXA 5KL5A 3CK2A 3IWBA 2LUPB 4NXNE 3JTZA 2UXDE 3J7AG 3C9FA 2M4IA 2LV2A 1T4NA 4DUYE 1PDAA 4DV1E 2EN2A 2ODRC 3H68A 1XMQE 1WRJA 2EPOA 2NA2A 2L8TA 2FGGA 5TSEA 2NUFA 3D03A 2WBSA 3MHSC 2EM6A 4O5GA 4DV0E 1G5BA 2JPAA 4JI2E 2EM0A 4LACC 3QFMA 2YTEA 3THOB 2B7TA 3TQMA 2JXPA 2GLIA 4V0VA 3AUZA 2LRSA 3VYXA 2EOIA 4NZVA 1N33E 2IE3C 2MKDA 2V87A 3OMLA 5CFFE 2EM8A 4DKKA 2JVAA 2ZBMA 1T70A 3OTOE 1O0WA 2EPZA 4JV5E 2ELZA 2LTSA 3BIDA 2GJUA 1T38A 2ODRD 2Z1AA 2RSIA 1AH5A 1MGTA 4X66E 2BBGA 2G7HA 1YPNA 2IHR1 1IBME 1V73A 1S3LA 5A2QC 2B3TB 2EMIA 5AASA 1DI2A 2R1FA 2NXFA 2EMGA 1OI8A 2EL4A 4ZYGA 1WXRA 2ZO9B 1YZ9A 1QHWA 2EPKX 4DV6E 1M63A 2DMYA 5A6JA 2NUEA 4BC7A 3H62B 1UBDC 2LVHA 2MC5A 2EPXA 1UILA 2V86A 1XZWA 1X6HA 4B3ME 2EOMA 2LT7A 4RH8A 1UF3A 4JI0E 1QU6A 4N4RB 2UUCE 4B3TE 2EMYA 1WARA 2DXLA 2RQLA 4JYAE 1A1JA 2ENCA 2L2KB 3RQZA 4UWQA 4GEQB 2NYMC 1N32E 3IWCA 1GTKA 1G2FC 2CV9A 2MC6A 4R2PA 2EJ4A 3J7Yp 4F6NA 1EH6A 1PJSA 2L3JA 4WX9A 1XM7A 2EOJA 2EPPA 1EH7A 2VF1A 2DB2A 1X47A 2N8XA 2M1SA 1SFEA 3ECRA 4Q28A 4R2SA 4H1SA 3RL5A 1WJPA 2D9HA 3MHHC 2EOOA 2V85A 3KBPA 5F3WA 4F9CB 3ADGA 2YU8A 4DUZE 2IE4C 2EN8A 2EPNA 2LO3A 5BR8E 3ADIA 3K7VC 5J28A 2DLQA 5A6AA 2Q8UA 1J26A 2EPUA 2KHXA 2O8GA 4DR2E 2E72A 1BB8A 4TUGA 4P7DA 2QFRA 1EKZA 3QFOA 4V0WA 2RTXA 3HVQA 2EM5A 4I5NC 2VRDA 2EOXA 4X65E 5AC4A 4DHLA 1KBPA 3RMPA 1RMDA 3JAMC 1BBOA 3L00A 5KL4A 1Z2WA 5AE3A 4O24A 2YWQA 2EZ6A 5HPEA 4DR3E 1X48A 2JR1A 4M30A 4I8OA 2NUGA
chains in the Genus database with same CATH topology
4LU9A 4V0VA 3AUZA 4F0ZA 4ORBA 2R17A 4FBWA 4KKZA 4NZVA 3RL3A 2IE3C 3E7AA 3PSNA 4OR9A 5JPFA 2JOGA 2ZBMA 4FBKA 4H1YP 3K7WC 4H2BA 2HY1A 4H2GA 4UT2A 4MP0A 1T70A 4V0XA 3IB7A 5EQVA 3RL4A 2ZOAA 4UT3B 3ZTVA 1OIDA 3FLOA 2GJUA 3GVEA 3H67A 3IVDA 3QFKA 1S70A 2QJCA 2Z1AA 2DFJA 2QFPA 4YKEA 3H63A 4DSYA 5JPEA 3PSOA 2IAEC 2WDCA 1OIEA 4FCXA 1II7A 2BCDA 2NYLC 1V73A 1S3MA 1S3LA 3JYFA 1W24A 3THNA 1MF8A 2WDEA 4JA9A 2BDXA 2NXFA 1OI8A 5GTUA 2ZO9B 4H2IA 3TGHA 3QG5C 3DSDA 2O8AA 1AUIA 1QHWA 1HPUA 2YVTA 1M63A 4HD0A 3C5WC 4TUIA 3H62B 4O43A 5B8IA 1XZWA 3H66A 3T1IA 3V4YA 1UF3A 2AHDA 1FJMA 1U32A 4IL1A 1WARA 2KKNA 2DXLA 1T71A 1JK7A 4ORAA 3RQZA 3DW8C 3QFNA 4UWQA 4XPNA 2NYMC 2DXNA 3FGAC 2Z06A 4B2OA 2CV9A 4O4KA 2XMOA 1WAO1 1IT6A 1XM7A 4G9JA 1NNWA 3LL8A 4M0VA 4J6OA 2BQ8X 4I5LC 3RL5A 4H1SA 3IB8A 3AV0A 3ZU0A 1HO5A 3KBPA 3N5UA 5F3WA 5DNYA 3EGGA 5INBA 1USHA 2IE4C 1S95A 3E0JA 4WWLA 3K7VC 2Z72A 4DT2A 5J28A 4Q7FA 3DSCA 2Q8UA 2NPPC 2O8GA 4LTYA 5IOHA 4TUGA 2QFRA 3QFOA 4H2FA 2USHA 4V0WA 1S8EA 3CK2A 4UT3A 3HVQA 3H61A 3EGHA 1Z2XA 2WDDA 3H64A 4I5NC 2HYOA 3H69A 4KBPA 3H60A 1QFCA 3C9FA 1TCOA 5C1VA 3ICFA 2WDFA 4ORCA 1S3NA 2P6BA 3IVEA 3P71C 4DHLA 1KBPA 1SU1A 3H68A 1HP1A 2A22A 4JA7A 1Z2WA 3D03A 4O24A 5HPEA 1UTEA 4FBQA 2YEQA 1G5BA 4O5GA 4IYPC 4ZVZA 5JJTA 3E7BA 4LACC 3QFMA 3THOB 4MOYA 4ZX2A 4MOVA 2HYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LU9 A;  4V0V A;  3AUZ A;  4F0Z A;  4ORB A;  3DSD A;  2R17 A;  4FBW A;  4KKZ A;  4NZV A;  3RL3 A;  2IE3 C;  3E7A A;  3PSN A;  4OR9 A;  5JPF A;  2JOG A;  2ZBM A;  4FBK A;  4H1Y P;  3K7W C;  4H2B A;  2HY1 A;  4H2G A;  4UT2 A;  4MP0 A;  1T70 A;  4V0X A;  3IB7 A;  5EQV A;  3RL4 A;  4UT3 B;  3ZTV A;  1OID A;  3GVE A;  2GJU A;  3H67 A;  3IVD A;  3QFK A;  1S70 A;  2QJC A;  2Z1A A;  2DFJ A;  2QFP A;  4YKE A;  3H63 A;  4DSY A;  5JPE A;  3PSO A;  2IAE C;  2WDC A;  1OIE A;  4FCX A;  1II7 A;  2BCD A;  2NYL C;  1V73 A;  1S3M A;  1S3L A;  3JYF A;  1W24 A;  3THN A;  1MF8 A;  2WDE A;  4JA9 A;  2BDX A;  2NXF A;  1OI8 A;  5GTU A;  4H2I A;  3TGH A;  3QG5 C;  1AUI A;  2O8A A;  3C5W C;  1QHW A;  1HPU A;  2YVT A;  1M63 A;  4HD0 A;  4I5L C;  4TUI A;  3H62 B;  4O43 A;  5B8I A;  1XZW A;  3H66 A;  3T1I A;  3V4Y A;  1UF3 A;  2AHD A;  1FJM A;  1U32 A;  4IL1 A;  1WAR A;  2KKN A;  1T71 A;  1JK7 A;  4ORA A;  3RQZ A;  3DW8 C;  3QFN A;  4UWQ A;  4XPN A;  2NYM C;  3FGA C;  2Z06 A;  4B2O A;  2CV9 A;  4O4K A;  2XMO A;  1WAO 1;  1IT6 A;  1XM7 A;  4G9J A;  1NNW A;  3LL8 A;  4M0V A;  4J6O A;  2BQ8 X;  3RL5 A;  4H1S A;  3IB8 A;  3AV0 A;  3ZU0 A;  1HO5 A;  3KBP A;  3N5U A;  5F3W A;  5DNY A;  3EGG A;  5INB A;  1USH A;  1S95 A;  2IE4 C;  4WWL A;  3K7V C;  2Z72 A;  4DT2 A;  5J28 A;  4Q7F A;  3DSC A;  2Q8U A;  2NPP C;  2O8G A;  4LTY A;  5IOH A;  4TUG A;  2QFR A;  3QFO A;  4H2F A;  2USH A;  4V0W A;  1S8E A;  3CK2 A;  4UT3 A;  3HVQ A;  3H61 A;  3EGH A;  1Z2X A;  2WDD A;  3H64 A;  4I5N C;  2HYO A;  3H69 A;  4KBP A;  3H60 A;  1QFC A;  3C9F A;  1TCO A;  5C1V A;  3ICF A;  2WDF A;  4ORC A;  1S3N A;  2P6B A;  3IVE A;  3P71 C;  4DHL A;  1KBP A;  1SU1 A;  3H68 A;  1HP1 A;  2A22 A;  4JA7 A;  1Z2W A;  4O24 A;  5HPE A;  1UTE A;  4FBQ A;  1G5B A;  4O5G A;  4IYP C;  4ZVZ A;  5JJT A;  3E7B A;  4LAC C;  3QFM A;  3THO B;  4MOY A;  4ZX2 A;  4MOV A;  2HYP A; 
#chains in the Genus database with same CATH topology
 4LU9 A;  5KL7 A;  4ORB A;  2GPI A;  2EM7 A;  4K0K E;  2R17 A;  4FBW A;  4KKZ A;  3F6G A;  1HNX E;  3E7A A;  3PSN A;  3BBG A;  4DR5 E;  1X5W A;  2JOG A;  4WXD A;  5A6B D;  2I13 A;  4H1Y P;  4H2G A;  4UT2 A;  4MP0 A;  4WSP A;  3UK3 C;  3IB7 A;  3VHT B;  2M7Q A;  2EN4 A;  2E5L E;  2EMB A;  2JWO A;  2EN1 A;  4IS1 C;  1XMO E;  2PRT A;  2ZOA A;  1A1F A;  3EPK A;  3ZTV A;  2LUQ A;  1OID A;  3FLO A;  3H67 A;  1NEI A;  5KL3 A;  4R2R A;  2H36 X;  4YKE A;  3H63 A;  4DSY A;  3PSO A;  1YYO A;  1OIE A;  2LE2 A;  2RPC A;  2NYL C;  1S3M A;  2L2N A;  4JA9 A;  1RC7 A;  1PKP A;  1YUJ A;  2M9A A;  4OOG C;  1PJT A;  4HTG A;  2HJJ A;  4F2J C;  5GTU A;  2V88 A;  2YTO A;  4I5L C;  4MOY A;  2FTX B;  2YVT A;  1UHZ A;  4DMI A;  1J5E E;  4OX9 E;  2JYA A;  1XNR E;  3H66 A;  2EMH A;  3DJW A;  1JK2 A;  2VQF E;  2AHD A;  2EPR A;  5IT9 C;  1U32 A;  4ZYD A;  1A1I A;  2LJU A;  3BGH A;  1T71 A;  2ZM6 E;  4ORA A;  2MDG A;  1L4S A;  2EM4 A;  5LLQ A;  3FGA C;  1A1G A;  4B2O A;  4AQY E;  2UXB E;  2EPA A;  3BF2 A;  2EMK A;  1WAO 1;  5IXM B;  2V83 A;  3EPH A;  4YHH E;  4G9J A;  2R76 A;  2FV4 B;  2N3G A;  1NNW A;  4MLV A;  2RSM A;  2L2M A;  4R2A A;  2EOE A;  3AV0 A;  3ZU0 A;  5AE2 A;  1XNQ E;  1ZR9 A;  4R2Q A;  3EQ1 A;  4JI5 E;  5DNY A;  5INB A;  1USH A;  1GQE A;  3E0J A;  4DV4 E;  1I94 E;  2Z72 A;  4KWY A;  1KYQ A;  1T4L B;  4BHC A;  4BBY A;  2EOR A;  2EMC A;  5IOH A;  2MKN A;  2GHF A;  4P78 A;  5LMN E;  4UT3 A;  1DGC A;  3EGH A;  4WFT A;  2L92 A;  2WDD A;  3H64 A;  4M9V C;  2YTP A;  4FK5 C;  2HYO A;  2ELY A;  4X62 E;  2JOX A;  2WDF A;  2DRP A;  1S3N A;  3P71 C;  3IVE A;  1SU1 A;  2KOU A;  1WHQ A;  2WZO A;  2B7V A;  3F6H A;  4GKK E;  2HGH A;  4WSG A;  2YTI A;  4JA7 A;  2CTD A;  3J81 C;  1UTE A;  4FBQ A;  1X49 A;  1AAY A;  2YTG A;  3VK6 A;  4BMJ A;  4IYP C;  5JJT A;  2K7I A;  3H09 A;  3E7B A;  4WYQ B;  4ZX2 A;  2HYP A;  3K6Q A;  2YSO A;  2JP9 A;  2RS6 A;  1A1H A;  2CPN A;  2YTJ A;  2V8Q B;  3RL3 A;  3P1X A;  1STU A;  1T39 A;  2EWL A;  1GZ6 A;  4KHP E;  2LCE A;  4OR9 A;  5ADZ A;  2EMA A;  4F54 A;  4R2D A;  2HHH E;  4FBK A;  5KL6 A;  1YSA C;  1TF6 A;  3HXL A;  1LLM C;  4V0X A;  2A25 A;  3EPL A;  2L33 A;  5EQV A;  2EM2 A;  3HPZ A;  4Q35 B;  2EPC A;  2YT4 A;  2QFP A;  2HC5 A;  2EM9 A;  2E1M A;  1N36 E;  2DIX A;  5JPE A;  2YTQ A;  2WBU A;  4YY3 E;  2EMZ A;  4WXC A;  2JY9 A;  5IWA E;  1W24 A;  3THN A;  2EL6 A;  1IBK E;  1MF8 A;  2WDE A;  2BDX A;  4DV7 E;  1X6E A;  4GKJ E;  3TGH A;  4R03 A;  1AUI A;  2O8A A;  5B8I A;  4TUI A;  1PJQ A;  3HPS A;  5LL6 R;  4HD0 A;  3DSD A;  2F4V E;  4DV5 E;  4JI6 E;  2B9D A;  4DV2 E;  3T1I A;  2UUB E;  2JOB A;  1A1K A;  2YTD A;  1X3C A;  1MEY C;  2EMX A;  1FJM A;  4IL1 A;  2KKN A;  2YTF A;  5AC5 A;  3KZY A;  4JI3 E;  3IWD A;  2EL5 A;  1JK1 A;  4BCA A;  4GZN C;  3T1H E;  1FKA E;  2DXN A;  3QFN A;  2Z06 A;  4XPN A;  1NCS A;  1A1L A;  2YSP A;  4J8Z A;  4X9J A;  2XMO A;  3EPJ A;  1N3G A;  1IT6 A;  1IQO A;  4L5N C;  4LF5 E;  1RQ0 A;  2CT1 A;  4L8N A;  2EE8 A;  3M99 B;  1YYW A;  3IB8 A;  3T1Y E;  5LMU E;  3N5U A;  3HQ1 A;  1SR9 A;  3EGG A;  2EOF A;  2MDR A;  4R2E A;  3JU0 A;  4Q7F A;  4F6M A;  1ZU1 A;  1UN6 B;  2NPP C;  5KL2 A;  2EOQ A;  1WHN A;  2ENH A;  4LTY A;  2DGC A;  4H2F A;  2EQ3 A;  2V89 A;  1S8E A;  1F2I G;  2YPN A;  2EPL X;  2DSY A;  2VQE E;  3C6M A;  1DQ3 A;  4F9A B;  3H61 A;  2LTR A;  1X6F A;  1Z2X A;  2I9I A;  2WBT A;  3H69 A;  1KJK A;  4KBP A;  4LF8 E;  2LMZ A;  4B3R E;  1QFC A;  3H60 A;  3DF6 A;  1TCO A;  3C6K A;  5C1V A;  3ICF A;  2L3C A;  4ORC A;  2P6B A;  2EM3 A;  1YFH A;  1HNZ E;  1TN9 A;  2EOH A;  1HP1 A;  2EQ1 A;  2A22 A;  2RS7 A;  4DR6 E;  3KZZ A;  1P47 A;  2EP3 A;  2YEQ A;  1IBL E;  4ZVZ A;  1HR0 E;  2EN7 A;  4LF9 E;  2ADR A;  4BHB A;  4MOV A;  4R2C A;  2BB8 A;  1ZBQ A;  2CSH A;  2N3H A;  1ZAA C;  4F0Z A;  5A6B A;  4LF6 E;  1YYK A;  5JPF A;  2YU5 A;  2DMI A;  4HEI A;  3K7W C;  1ZBT A;  1HNW E;  2EMF A;  4H2B A;  2HY1 A;  4MLQ A;  1N34 E;  1BBG A;  2YRK A;  4BC9 A;  2EN6 A;  3RL4 A;  2NAB A;  4UT3 B;  4F9B B;  2DLK A;  4RHB B;  3GVE A;  3IVD A;  3QFK A;  1S70 A;  5IV8 B;  4DR4 E;  2QJC A;  5AE1 A;  2DFJ A;  2EPM X;  4DV3 E;  4X8W A;  3ZOQ B;  2IAE C;  2WDC A;  4FCX A;  5FLX C;  3C4T A;  1II7 A;  2BCD A;  1YUI A;  3JYF A;  2YRM A;  3LLH A;  3LML A;  2YZT A;  3MSW A;  2EML A;  4H2I A;  1QNT A;  2KON A;  3QG5 C;  3C5W C;  1HPU A;  2ENA A;  2YRH A;  4DR1 E;  2K4V A;  2LBS B;  4O43 A;  2LJH A;  4ZYE A;  1IMU A;  2F8B A;  3VYY A;  4LFB E;  1B69 A;  2UUA E;  3V4Y A;  2WCC 3;  4JI8 E;  5A69 A;  4BS9 A;  1Z1B A;  2EQ0 A;  4LF7 E;  2EOY A;  4JI1 E;  1JK7 A;  2YTN A;  3DW8 C;  4NHR A;  4JI4 E;  3FIG A;  2UU9 E;  2J7J A;  4O4K A;  4KZS A;  5T6J A;  3ADJ A;  4LFC E;  4R8O A;  3LL8 A;  4M0V A;  2UXC E;  4J6O A;  4X64 E;  2BQ8 X;  1G2D C;  4ZYH A;  3C4B A;  5A6K A;  3KWR A;  2EN3 A;  1HO5 A;  2VE7 C;  4M2Z A;  4LF4 E;  4WPY A;  3ADL A;  4NXM E;  3J80 C;  1S95 A;  4WWL A;  2EOZ A;  4JI7 E;  1EH8 A;  4LFA E;  4B3S E;  2EOS A;  4DT2 A;  3DSC A;  1FJG E;  1TF3 A;  4DR7 E;  2EMW A;  1T4O A;  4IJD A;  2USH A;  2L6M A;  1IQS A;  3HTX A;  5KL5 A;  3CK2 A;  3IWB A;  2LUP B;  4NXN E;  3JTZ A;  2UXD E;  3J7A G;  3C9F A;  2M4I A;  2LV2 A;  1T4N A;  4DUY E;  1PDA A;  4DV1 E;  2EN2 A;  2ODR C;  3H68 A;  1XMQ E;  1WRJ A;  2EPO A;  2NA2 A;  2L8T A;  2FGG A;  5TSE A;  2NUF A;  3D03 A;  2WBS A;  3MHS C;  2EM6 A;  4O5G A;  4DV0 E;  1G5B A;  2JPA A;  4JI2 E;  2EM0 A;  4LAC C;  3QFM A;  2YTE A;  3THO B;  2B7T A;  3TQM A;  2JXP A;  2GLI A;  4V0V A;  3AUZ A;  2LRS A;  3VYX A;  2EOI A;  4NZV A;  1N33 E;  2IE3 C;  2MKD A;  2V87 A;  3OML A;  5CFF E;  2EM8 A;  4DKK A;  2JVA A;  2ZBM A;  1T70 A;  3OTO E;  1O0W A;  2EPZ A;  4JV5 E;  2ELZ A;  2LTS A;  3BID A;  2GJU A;  1T38 A;  2ODR D;  2Z1A A;  2RSI A;  1AH5 A;  1MGT A;  4X66 E;  2BBG A;  2G7H A;  1YPN A;  2IHR 1;  1IBM E;  1V73 A;  1S3L A;  5A2Q C;  2B3T B;  2EMI A;  5AAS A;  1DI2 A;  2R1F A;  2NXF A;  2EMG A;  1OI8 A;  2EL4 A;  4ZYG A;  1WXR A;  2ZO9 B;  1YZ9 A;  1QHW A;  2EPK X;  4DV6 E;  1M63 A;  2DMY A;  5A6J A;  2NUE A;  4BC7 A;  3H62 B;  1UBD C;  2LVH A;  2MC5 A;  2EPX A;  1UIL A;  2V86 A;  1XZW A;  1X6H A;  4B3M E;  2EOM A;  2LT7 A;  4RH8 A;  1UF3 A;  4JI0 E;  1QU6 A;  4N4R B;  2UUC E;  4B3T E;  2EMY A;  1WAR A;  2DXL A;  2RQL A;  4JYA E;  1A1J A;  2ENC A;  2L2K B;  3RQZ A;  4UWQ A;  4GEQ B;  2NYM C;  1N32 E;  3IWC A;  1GTK A;  1G2F C;  2CV9 A;  2MC6 A;  4R2P A;  2EJ4 A;  3J7Y p;  4F6N A;  1EH6 A;  1PJS A;  2L3J A;  4WX9 A;  1XM7 A;  2EOJ A;  2EPP A;  1EH7 A;  2VF1 A;  2DB2 A;  1X47 A;  2N8X A;  2M1S A;  1SFE A;  3ECR A;  4Q28 A;  4R2S A;  4H1S A;  3RL5 A;  1WJP A;  2D9H A;  3MHH C;  2EOO A;  2V85 A;  3KBP A;  5F3W A;  4F9C B;  3ADG A;  2YU8 A;  4DUZ E;  2IE4 C;  2EN8 A;  2EPN A;  2LO3 A;  5BR8 E;  3ADI A;  3K7V C;  5J28 A;  2DLQ A;  5A6A A;  2Q8U A;  1J26 A;  2EPU A;  2KHX A;  2O8G A;  4DR2 E;  2E72 A;  1BB8 A;  4TUG A;  4P7D A;  2QFR A;  1EKZ A;  3QFO A;  4V0W A;  2RTX A;  3HVQ A;  2EM5 A;  4I5N C;  2VRD A;  2EOX A;  4X65 E;  5AC4 A;  4DHL A;  1KBP A;  3RMP A;  1RMD A;  3JAM C;  1BBO A;  3L00 A;  5KL4 A;  1Z2W A;  5AE3 A;  4O24 A;  2YWQ A;  2EZ6 A;  5HPE A;  4DR3 E;  1X48 A;  2JR1 A;  4M30 A;  4I8O A;  2NUG A; 
#chains in the Genus database with same CATH homology
 4LU9 A;  4V0V A;  3AUZ A;  4F0Z A;  4ORB A;  2R17 A;  4FBW A;  4KKZ A;  4NZV A;  3RL3 A;  2IE3 C;  3E7A A;  3PSN A;  4OR9 A;  5JPF A;  2JOG A;  2ZBM A;  4FBK A;  4H1Y P;  3K7W C;  4H2B A;  2HY1 A;  4H2G A;  4UT2 A;  4MP0 A;  1T70 A;  4V0X A;  3IB7 A;  5EQV A;  3RL4 A;  2ZOA A;  4UT3 B;  3ZTV A;  1OID A;  3FLO A;  2GJU A;  3GVE A;  3H67 A;  3IVD A;  3QFK A;  1S70 A;  2QJC A;  2Z1A A;  2DFJ A;  2QFP A;  4YKE A;  3H63 A;  4DSY A;  5JPE A;  3PSO A;  2IAE C;  2WDC A;  1OIE A;  4FCX A;  1II7 A;  2BCD A;  2NYL C;  1V73 A;  1S3M A;  1S3L A;  3JYF A;  1W24 A;  3THN A;  1MF8 A;  2WDE A;  4JA9 A;  2BDX A;  2NXF A;  1OI8 A;  5GTU A;  2ZO9 B;  4H2I A;  3TGH A;  3QG5 C;  3DSD A;  2O8A A;  1AUI A;  1QHW A;  1HPU A;  2YVT A;  1M63 A;  4HD0 A;  3C5W C;  4TUI A;  3H62 B;  4O43 A;  5B8I A;  1XZW A;  3H66 A;  3T1I A;  3V4Y A;  1UF3 A;  2AHD A;  1FJM A;  1U32 A;  4IL1 A;  1WAR A;  2KKN A;  2DXL A;  1T71 A;  1JK7 A;  4ORA A;  3RQZ A;  3DW8 C;  3QFN A;  4UWQ A;  4XPN A;  2NYM C;  2DXN A;  3FGA C;  2Z06 A;  4B2O A;  2CV9 A;  4O4K A;  2XMO A;  1WAO 1;  1IT6 A;  1XM7 A;  4G9J A;  1NNW A;  3LL8 A;  4M0V A;  4J6O A;  2BQ8 X;  4I5L C;  3RL5 A;  4H1S A;  3IB8 A;  3AV0 A;  3ZU0 A;  1HO5 A;  3KBP A;  3N5U A;  5F3W A;  5DNY A;  3EGG A;  5INB A;  1USH A;  2IE4 C;  1S95 A;  3E0J A;  4WWL A;  3K7V C;  2Z72 A;  4DT2 A;  5J28 A;  4Q7F A;  3DSC A;  2Q8U A;  2NPP C;  2O8G A;  4LTY A;  5IOH A;  4TUG A;  2QFR A;  3QFO A;  4H2F A;  2USH A;  4V0W A;  1S8E A;  3CK2 A;  4UT3 A;  3HVQ A;  3H61 A;  3EGH A;  1Z2X A;  2WDD A;  3H64 A;  4I5N C;  2HYO A;  3H69 A;  4KBP A;  3H60 A;  1QFC A;  3C9F A;  1TCO A;  5C1V A;  3ICF A;  2WDF A;  4ORC A;  1S3N A;  2P6B A;  3IVE A;  3P71 C;  4DHL A;  1KBP A;  1SU1 A;  3H68 A;  1HP1 A;  2A22 A;  4JA7 A;  1Z2W A;  3D03 A;  4O24 A;  5HPE A;  1UTE A;  4FBQ A;  2YEQ A;  1G5B A;  4O5G A;  4IYP C;  4ZVZ A;  5JJT A;  3E7B A;  4LAC C;  3QFM A;  3THO B;  4MOY A;  4ZX2 A;  4MOV A;  2HYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...