2IE3C

Structure of the protein phosphatase 2a core enzyme bound to tumor-inducing toxins
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
288
structure length
288
Chain Sequence
b'FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Protein Phosphatase 2A Core Enzyme Bound to Tumor-Inducing Toxins
pubmed doi rcsb
molecule keywords Protein Phosphatase 2, regulatory subunit A (PR 65), alpha i
source organism Homo sapiens
molecule tags Hydrolase/toxin
total genus 104
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2ie3C00
3E7BA 3DSDA 1S3MA 2BDXA 4FBWA 3THNA 4MOYA 4B2OA 2Z06A 1MF8A 2BCDA 3H66A 3H64A 3EGGA 3QFKA 3RQZA 5JPEA 1M63A 2P6BA 3H68A 4MOVA 4ORAA 1S95A 1V73A 3QFNA 2QFRA 4H2GA 4G9JA 1XM7A 3H67A 5JPFA 4LTYA 1S3LA 4XPNA 4ORCA 4TUGA 1T70A 3RL4A 1QHWA 1S70A 4H2IA 4NZVA 4YKEA 4JA9A 4O43A 2HY1A 2IAEC 1IT6A 3IB8A 3THOB 3CK2A 3JYFA 3PSNA 1HP1A 2Q8UA 2ZBMA 4V0XA 1QFCA 3DW8C 3HVQA 2XMOA 3ICFA 3E7AA 1UF3A 1TCOA 2QJCA 4J6OA 5JJTA 4IL1A 1WAO1 2YVTA 5GTUA 3TGHA 3RL3A 3IVEA 3QFMA 1KBPA 1XZWA 4FBKA 2WDDA 4HD0A 3RL5A 1OIEA 3QFOA 3PSOA 4LU9A 2O8GA 3FGAC 2CV9A 1USHA 2IE4C 2WDCA 4M0VA 3V4YA 4WWLA 2DFJA 3H60A 2HYPA 1G5BA 2NXFA 4FCXA 4JA7A 3AUZA 4O24A 4UT3B 5DNYA 1W24A 4UT2A 1AUIA 2Z1AA 4ZVZA 1NNWA 1U32A 3DSCA 3ZU0A 3H61A 2QFPA 3IB7A 2O8AA 2AHDA 2BQ8X 4IYPC 5F3WA 1JK7A 2HYOA 2NYMC 3H63A 2GJUA 2WDEA 3K7VC 4V0VA 4O5GA 4UWQA 2NPPC 4DT2A 3H62B 2R17A 4H1YP 1UTEA 5J28A 2USHA 3LL8A 1OIDA 4KBPA 5C1VA 2Z72A 2IE3C 4H2BA 4LACC 4DHLA 4FBQA 4H1SA 1OI8A 3AV0A 4MP0A 1FJMA 4O4KA 3H69A 1T71A 2JOGA 4KKZA 5EQVA 3N5UA 4H2FA 1Z2WA 2KKNA 3EGHA 4OR9A 4ORBA 3P71C 1SU1A 2A22A 3C5WC 4DSYA 1S3NA 1S8EA 5B8IA 4TUIA 3T1IA 4V0WA 3ZTVA 4UT3A 4I5LC 4F0ZA 1Z2XA 2NYLC 3K7WC 5INBA 4Q7FA 3C9FA 1II7A 4ZX2A 5HPEA 3GVEA 1HPUA 2WDFA 4I5NC 3QG5C 5IOHA 1WARA 3IVDA 1HO5A 3KBPA
chains in the Genus database with same CATH superfamily
3E7BA 3E0JA 3DSDA 1S3MA 2BDXA 4FBWA 3THNA 4MOYA 4B2OA 2Z06A 1MF8A 2BCDA 3H66A 3H64A 3EGGA 3QFKA 3RQZA 5JPEA 1M63A 2P6BA 3H68A 4MOVA 4ORAA 2ZOAA 1S95A 1V73A 3QFNA 2QFRA 3D03A 4H2GA 4G9JA 1XM7A 3H67A 5JPFA 4LTYA 2YEQA 1S3LA 4XPNA 4ORCA 4TUGA 1T70A 3RL4A 1QHWA 1S70A 4H2IA 4NZVA 4YKEA 4JA9A 4O43A 2HY1A 2IAEC 1IT6A 3IB8A 3THOB 3CK2A 3JYFA 3PSNA 1HP1A 2Q8UA 2ZBMA 4V0XA 1QFCA 3DW8C 3HVQA 2XMOA 3ICFA 3E7AA 1UF3A 1TCOA 2QJCA 4J6OA 5JJTA 3FLOA 4IL1A 1WAO1 2YVTA 5GTUA 3TGHA 3RL3A 3IVEA 3QFMA 1KBPA 1XZWA 4FBKA 2WDDA 4HD0A 3RL5A 1OIEA 3QFOA 3PSOA 4LU9A 2O8GA 3FGAC 2CV9A 1USHA 2IE4C 2WDCA 4M0VA 3V4YA 4WWLA 2DFJA 3H60A 2HYPA 1G5BA 2NXFA 4FCXA 4JA7A 3AUZA 4O24A 4UT3B 5DNYA 1W24A 4UT2A 1AUIA 2Z1AA 4ZVZA 1NNWA 1U32A 3DSCA 3ZU0A 3H61A 2QFPA 3IB7A 2O8AA 2AHDA 2BQ8X 4IYPC 5F3WA 1JK7A 2HYOA 2NYMC 3H63A 2GJUA 2WDEA 3K7VC 4V0VA 4O5GA 4UWQA 2NPPC 4DT2A 3H62B 2R17A 4H1YP 1UTEA 5J28A 2USHA 3LL8A 1OIDA 4KBPA 5C1VA 2Z72A 2IE3C 4H2BA 4LACC 2DXLA 2ZO9B 4DHLA 2DXNA 4FBQA 4H1SA 1OI8A 3AV0A 4MP0A 1FJMA 4O4KA 3H69A 1T71A 2JOGA 4KKZA 5EQVA 3N5UA 4H2FA 1Z2WA 2KKNA 3EGHA 4OR9A 4ORBA 3P71C 1SU1A 2A22A 3C5WC 4DSYA 1S3NA 1S8EA 5B8IA 4TUIA 3T1IA 4V0WA 3ZTVA 4UT3A 4I5LC 4F0ZA 1Z2XA 2NYLC 3K7WC 5INBA 4Q7FA 3C9FA 1II7A 4ZX2A 5HPEA 3GVEA 1HPUA 2WDFA 4I5NC 3QG5C 5IOHA 1WARA 3IVDA 1HO5A 3KBPA
chains in the Genus database with same CATH topology
3E7BA 3E0JA 3DSDA 1S3MA 2BDXA 4FBWA 3THNA 4MOYA 4B2OA 2Z06A 1MF8A 2BCDA 3H66A 3H64A 3EGGA 3QFKA 3RQZA 5JPEA 1M63A 2P6BA 3H68A 4MOVA 4ORAA 2ZOAA 1S95A 1V73A 3QFNA 2QFRA 3D03A 4H2GA 4G9JA 1XM7A 3H67A 5JPFA 4LTYA 2YEQA 1S3LA 4XPNA 4ORCA 4TUGA 1T70A 3RL4A 1QHWA 1S70A 4H2IA 4NZVA 4YKEA 4JA9A 4O43A 2HY1A 2IAEC 1IT6A 3IB8A 3THOB 3CK2A 3JYFA 3PSNA 1HP1A 2Q8UA 2ZBMA 4V0XA 1QFCA 3DW8C 3HVQA 2XMOA 3ICFA 3E7AA 1UF3A 1TCOA 2QJCA 4J6OA 5JJTA 3FLOA 4IL1A 1WAO1 2YVTA 5GTUA 3TGHA 3RL3A 3IVEA 3QFMA 1KBPA 1XZWA 4FBKA 2WDDA 4HD0A 3RL5A 1OIEA 3QFOA 3PSOA 4LU9A 2O8GA 3FGAC 2CV9A 1USHA 2IE4C 2WDCA 4M0VA 3V4YA 4WWLA 2DFJA 3H60A 2HYPA 1G5BA 2NXFA 4FCXA 4JA7A 3AUZA 4O24A 4UT3B 5DNYA 1W24A 4UT2A 1AUIA 2Z1AA 4ZVZA 1NNWA 1U32A 3DSCA 3ZU0A 3H61A 2QFPA 3IB7A 2O8AA 2AHDA 2BQ8X 4IYPC 5F3WA 1JK7A 2HYOA 2NYMC 3H63A 2GJUA 2WDEA 3K7VC 4V0VA 4O5GA 4UWQA 2NPPC 4DT2A 3H62B 2R17A 4H1YP 1UTEA 5J28A 2USHA 3LL8A 1OIDA 4KBPA 5C1VA 2Z72A 2IE3C 4H2BA 4LACC 2DXLA 2ZO9B 4DHLA 2DXNA 4FBQA 4H1SA 1OI8A 3AV0A 4MP0A 1FJMA 4O4KA 3H69A 1T71A 2JOGA 4KKZA 5EQVA 3N5UA 4H2FA 1Z2WA 2KKNA 3EGHA 4OR9A 4ORBA 3P71C 1SU1A 2A22A 3C5WC 4DSYA 1S3NA 1S8EA 5B8IA 4TUIA 3T1IA 4V0WA 3ZTVA 4UT3A 4I5LC 4F0ZA 1Z2XA 2NYLC 3K7WC 5INBA 4Q7FA 3C9FA 1II7A 4ZX2A 5HPEA 3GVEA 1HPUA 2WDFA 4I5NC 3QG5C 5IOHA 1WARA 3IVDA 1HO5A 3KBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E7B A;  3DSD A;  1S3M A;  2BDX A;  4FBW A;  3THN A;  4MOY A;  4B2O A;  2Z06 A;  1MF8 A;  2BCD A;  3H66 A;  3H64 A;  3EGG A;  3QFK A;  3RQZ A;  5JPE A;  1M63 A;  2P6B A;  3H68 A;  4MOV A;  4ORA A;  1S95 A;  1V73 A;  3QFN A;  2QFR A;  4H2G A;  4G9J A;  1XM7 A;  3H67 A;  5JPF A;  4LTY A;  1S3L A;  4XPN A;  4ORC A;  4TUG A;  1T70 A;  3RL4 A;  1QHW A;  1S70 A;  4H2I A;  4NZV A;  4YKE A;  4JA9 A;  4O43 A;  2HY1 A;  2IAE C;  1IT6 A;  3IB8 A;  3THO B;  3CK2 A;  3JYF A;  3PSN A;  1HP1 A;  2Q8U A;  2ZBM A;  4V0X A;  1QFC A;  3DW8 C;  3HVQ A;  2XMO A;  3ICF A;  3E7A A;  1UF3 A;  1TCO A;  2QJC A;  4J6O A;  5JJT A;  4IL1 A;  1WAO 1;  2YVT A;  5GTU A;  3TGH A;  3RL3 A;  3IVE A;  3QFM A;  1KBP A;  1XZW A;  4FBK A;  2WDD A;  4HD0 A;  3RL5 A;  1OIE A;  3QFO A;  3PSO A;  4LU9 A;  2O8G A;  3FGA C;  2CV9 A;  1USH A;  2IE4 C;  2WDC A;  4M0V A;  3V4Y A;  4WWL A;  2DFJ A;  3H60 A;  2HYP A;  1G5B A;  2NXF A;  4FCX A;  4JA7 A;  3AUZ A;  4O24 A;  4UT3 B;  5DNY A;  1W24 A;  4UT2 A;  1AUI A;  2Z1A A;  4ZVZ A;  1NNW A;  1U32 A;  3DSC A;  3ZU0 A;  3H61 A;  2QFP A;  3IB7 A;  2O8A A;  2AHD A;  2BQ8 X;  4IYP C;  5F3W A;  1JK7 A;  2HYO A;  2NYM C;  3H63 A;  2GJU A;  2WDE A;  3K7V C;  4V0V A;  4O5G A;  4UWQ A;  2NPP C;  4DT2 A;  3H62 B;  2R17 A;  4H1Y P;  1UTE A;  5J28 A;  2USH A;  3LL8 A;  1OID A;  4KBP A;  5C1V A;  2Z72 A;  2IE3 C;  4H2B A;  4LAC C;  4DHL A;  4FBQ A;  4H1S A;  1OI8 A;  3AV0 A;  4MP0 A;  1FJM A;  4O4K A;  3H69 A;  1T71 A;  2JOG A;  4KKZ A;  5EQV A;  3N5U A;  4H2F A;  1Z2W A;  2KKN A;  3EGH A;  4OR9 A;  4ORB A;  3P71 C;  1SU1 A;  2A22 A;  3C5W C;  4DSY A;  1S3N A;  1S8E A;  5B8I A;  4TUI A;  3T1I A;  4V0W A;  3ZTV A;  4UT3 A;  4I5L C;  4F0Z A;  1Z2X A;  2NYL C;  3K7W C;  5INB A;  4Q7F A;  3C9F A;  1II7 A;  4ZX2 A;  5HPE A;  3GVE A;  1HPU A;  2WDF A;  4I5N C;  3QG5 C;  5IOH A;  1WAR A;  3IVD A;  1HO5 A;  3KBP A; 
#chains in the Genus database with same CATH topology
 3E7B A;  3E0J A;  3DSD A;  1S3M A;  2BDX A;  4FBW A;  3THN A;  4MOY A;  4B2O A;  2Z06 A;  1MF8 A;  2BCD A;  3H66 A;  3H64 A;  3EGG A;  3QFK A;  3RQZ A;  5JPE A;  1M63 A;  2P6B A;  3H68 A;  4MOV A;  4ORA A;  2ZOA A;  1S95 A;  1V73 A;  3QFN A;  2QFR A;  3D03 A;  4H2G A;  4G9J A;  1XM7 A;  3H67 A;  5JPF A;  4LTY A;  2YEQ A;  1S3L A;  4XPN A;  4ORC A;  4TUG A;  1T70 A;  3RL4 A;  1QHW A;  1S70 A;  4H2I A;  4NZV A;  4YKE A;  4JA9 A;  4O43 A;  2HY1 A;  2IAE C;  1IT6 A;  3IB8 A;  3THO B;  3CK2 A;  3JYF A;  3PSN A;  1HP1 A;  2Q8U A;  2ZBM A;  4V0X A;  1QFC A;  3DW8 C;  3HVQ A;  2XMO A;  3ICF A;  3E7A A;  1UF3 A;  1TCO A;  2QJC A;  4J6O A;  5JJT A;  3FLO A;  4IL1 A;  1WAO 1;  2YVT A;  5GTU A;  3TGH A;  3RL3 A;  3IVE A;  3QFM A;  1KBP A;  1XZW A;  4FBK A;  2WDD A;  4HD0 A;  3RL5 A;  1OIE A;  3QFO A;  3PSO A;  4LU9 A;  2O8G A;  3FGA C;  2CV9 A;  1USH A;  2IE4 C;  2WDC A;  4M0V A;  3V4Y A;  4WWL A;  2DFJ A;  3H60 A;  2HYP A;  1G5B A;  2NXF A;  4FCX A;  4JA7 A;  3AUZ A;  4O24 A;  4UT3 B;  5DNY A;  1W24 A;  4UT2 A;  1AUI A;  2Z1A A;  4ZVZ A;  1NNW A;  1U32 A;  3DSC A;  3ZU0 A;  3H61 A;  2QFP A;  3IB7 A;  2O8A A;  2AHD A;  2BQ8 X;  4IYP C;  5F3W A;  1JK7 A;  2HYO A;  2NYM C;  3H63 A;  2GJU A;  2WDE A;  3K7V C;  4V0V A;  4O5G A;  4UWQ A;  2NPP C;  4DT2 A;  3H62 B;  2R17 A;  4H1Y P;  1UTE A;  5J28 A;  2USH A;  3LL8 A;  1OID A;  4KBP A;  5C1V A;  2Z72 A;  2IE3 C;  4H2B A;  4LAC C;  2DXL A;  2ZO9 B;  4DHL A;  2DXN A;  4FBQ A;  4H1S A;  1OI8 A;  3AV0 A;  4MP0 A;  1FJM A;  4O4K A;  3H69 A;  1T71 A;  2JOG A;  4KKZ A;  5EQV A;  3N5U A;  4H2F A;  1Z2W A;  2KKN A;  3EGH A;  4OR9 A;  4ORB A;  3P71 C;  1SU1 A;  2A22 A;  3C5W C;  4DSY A;  1S3N A;  1S8E A;  5B8I A;  4TUI A;  3T1I A;  4V0W A;  3ZTV A;  4UT3 A;  4I5L C;  4F0Z A;  1Z2X A;  2NYL C;  3K7W C;  5INB A;  4Q7F A;  3C9F A;  1II7 A;  4ZX2 A;  5HPE A;  3GVE A;  1HPU A;  2WDF A;  4I5N C;  3QG5 C;  5IOH A;  1WAR A;  3IVD A;  1HO5 A;  3KBP A; 
#chains in the Genus database with same CATH homology
 3E7B A;  3E0J A;  3DSD A;  1S3M A;  2BDX A;  4FBW A;  3THN A;  4MOY A;  4B2O A;  2Z06 A;  1MF8 A;  2BCD A;  3H66 A;  3H64 A;  3EGG A;  3QFK A;  3RQZ A;  5JPE A;  1M63 A;  2P6B A;  3H68 A;  4MOV A;  4ORA A;  2ZOA A;  1S95 A;  1V73 A;  3QFN A;  2QFR A;  3D03 A;  4H2G A;  4G9J A;  1XM7 A;  3H67 A;  5JPF A;  4LTY A;  2YEQ A;  1S3L A;  4XPN A;  4ORC A;  4TUG A;  1T70 A;  3RL4 A;  1QHW A;  1S70 A;  4H2I A;  4NZV A;  4YKE A;  4JA9 A;  4O43 A;  2HY1 A;  2IAE C;  1IT6 A;  3IB8 A;  3THO B;  3CK2 A;  3JYF A;  3PSN A;  1HP1 A;  2Q8U A;  2ZBM A;  4V0X A;  1QFC A;  3DW8 C;  3HVQ A;  2XMO A;  3ICF A;  3E7A A;  1UF3 A;  1TCO A;  2QJC A;  4J6O A;  5JJT A;  3FLO A;  4IL1 A;  1WAO 1;  2YVT A;  5GTU A;  3TGH A;  3RL3 A;  3IVE A;  3QFM A;  1KBP A;  1XZW A;  4FBK A;  2WDD A;  4HD0 A;  3RL5 A;  1OIE A;  3QFO A;  3PSO A;  4LU9 A;  2O8G A;  3FGA C;  2CV9 A;  1USH A;  2IE4 C;  2WDC A;  4M0V A;  3V4Y A;  4WWL A;  2DFJ A;  3H60 A;  2HYP A;  1G5B A;  2NXF A;  4FCX A;  4JA7 A;  3AUZ A;  4O24 A;  4UT3 B;  5DNY A;  1W24 A;  4UT2 A;  1AUI A;  2Z1A A;  4ZVZ A;  1NNW A;  1U32 A;  3DSC A;  3ZU0 A;  3H61 A;  2QFP A;  3IB7 A;  2O8A A;  2AHD A;  2BQ8 X;  4IYP C;  5F3W A;  1JK7 A;  2HYO A;  2NYM C;  3H63 A;  2GJU A;  2WDE A;  3K7V C;  4V0V A;  4O5G A;  4UWQ A;  2NPP C;  4DT2 A;  3H62 B;  2R17 A;  4H1Y P;  1UTE A;  5J28 A;  2USH A;  3LL8 A;  1OID A;  4KBP A;  5C1V A;  2Z72 A;  2IE3 C;  4H2B A;  4LAC C;  2DXL A;  2ZO9 B;  4DHL A;  2DXN A;  4FBQ A;  4H1S A;  1OI8 A;  3AV0 A;  4MP0 A;  1FJM A;  4O4K A;  3H69 A;  1T71 A;  2JOG A;  4KKZ A;  5EQV A;  3N5U A;  4H2F A;  1Z2W A;  2KKN A;  3EGH A;  4OR9 A;  4ORB A;  3P71 C;  1SU1 A;  2A22 A;  3C5W C;  4DSY A;  1S3N A;  1S8E A;  5B8I A;  4TUI A;  3T1I A;  4V0W A;  3ZTV A;  4UT3 A;  4I5L C;  4F0Z A;  1Z2X A;  2NYL C;  3K7W C;  5INB A;  4Q7F A;  3C9F A;  1II7 A;  4ZX2 A;  5HPE A;  3GVE A;  1HPU A;  2WDF A;  4I5N C;  3QG5 C;  5IOH A;  1WAR A;  3IVD A;  1HO5 A;  3KBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...