2IE3C

Structure of the protein phosphatase 2a core enzyme bound to tumor-inducing toxins
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Protein Phosphatase 2A Core Enzyme Bound to Tumor-Inducing Toxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/toxin
molecule keywords Protein Phosphatase 2, regulatory subunit A (PR 65), alpha i
total genus 104
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2ie3C00
4I5NC 3H69A 3PSOA 3TGHA 2Z06A 3QFMA 1S95A 4H2IA 3T1IA 3DSCA 3H64A 1FJMA 2NYMC 2NYLC 1G5BA 4FBKA 4ZX2A 1V73A 2Z72A 3K7WC 1XM7A 2WDCA 3C9FA 5J28A 3IVEA 4H2FA 4UT3A 2IE3C 3H63A 3H68A 4OR9A 4M0VA 4WWLA 3P71C 4IYPC 2HY1A 2Z1AA 3KBPA 3RQZA 4UT2A 2CV9A 2Q8UA 2WDDA 3IB7A 5JJTA 1UTEA 2BDXA 5F3WA 3H62B 2ZBMA 1W24A 2YVTA 3PSNA 1II7A 1Z2WA 4JA9A 4FBQA 5GTUA 3JYFA 4TUIA 5INBA 1OI8A 3GVEA 5HPEA 4H1YP 3H61A 2IE4C 4ZVZA 1AUIA 3H67A 3K7VC 4YKEA 2DFJA 5B8IA 4MOYA 3THNA 2QFRA 3DW8C 1USHA 1QFCA 5DNYA 2BQ8X 4I5LC 4LTYA 4O4KA 3LL8A 4H2BA 1T70A 4H2GA 3QFOA 3QFKA 4O43A 3IB8A 3QFNA 3EGHA 4FCXA 3RL4A 3V4YA 2IAEC 4DHLA 3E7BA 3EGGA 4MOVA 2NXFA 1HO5A 4V0XA 4H1SA 4G9JA 1M63A 3QG5C 3CK2A 3ZTVA 2WDFA 4JA7A 1XZWA 1U32A 1S3LA 2P6BA 2XMOA 1NNWA 2GJUA 5JPFA 3H66A 1HP1A 2AHDA 2O8AA 4ORAA 2R17A 4F0ZA 3N5UA 3THOB 4FBWA 1S8EA 2A22A 1OIDA 1Z2XA 3AUZA 3IVDA 4O5GA 4ORBA 1SU1A 4UWQA 3DSDA 2BCDA 4NZVA 1S3NA 2JOGA 1T71A 4Q7FA 1WARA 4HD0A 4MP0A 5JPEA 4LACC 3H60A 3E7AA 1S3MA 2QJCA 2KKNA 2WDEA 4O24A 1JK7A 5C1VA 4J6OA 2QFPA 4TUGA 3HVQA 2HYPA 5IOHA 4V0WA 3ICFA 1HPUA 2O8GA 1S70A 1UF3A 4IL1A 1QHWA 1TCOA 4ORCA 3RL3A 2USHA 3RL5A 1WAO1 2HYOA 3C5WC 4KBPA 3ZU0A 3FGAC 3AV0A 4V0VA 1OIEA 4UT3B 1IT6A 4LU9A 4KKZA 1KBPA 5EQVA 4XPNA 1MF8A 4DT2A 4DSYA 2NPPC 4B2OA
chains in the Genus database with same CATH superfamily
4I5NC 3H69A 3PSOA 3TGHA 2Z06A 3QFMA 1S95A 4H2IA 3T1IA 3DSCA 3H64A 1FJMA 2NYMC 2NYLC 1G5BA 4FBKA 4ZX2A 1V73A 2Z72A 3K7WC 1XM7A 2WDCA 3C9FA 2ZO9B 5J28A 3IVEA 4H2FA 4UT3A 2IE3C 3H63A 3H68A 4OR9A 4M0VA 4WWLA 3P71C 4IYPC 2HY1A 2Z1AA 3KBPA 3RQZA 4UT2A 2CV9A 2Q8UA 2WDDA 3IB7A 5JJTA 1UTEA 2BDXA 5F3WA 3H62B 2ZBMA 1W24A 2YVTA 3PSNA 1II7A 1Z2WA 4JA9A 4FBQA 5GTUA 3JYFA 3FLOA 4TUIA 5INBA 1OI8A 3GVEA 5HPEA 4H1YP 3H61A 2IE4C 4ZVZA 1AUIA 3H67A 3K7VC 4YKEA 2DFJA 5B8IA 4MOYA 3THNA 2QFRA 3DW8C 1USHA 1QFCA 5DNYA 2BQ8X 4I5LC 4LTYA 4O4KA 3LL8A 4H2BA 2DXNA 1T70A 4H2GA 3QFOA 3QFKA 4O43A 3IB8A 3QFNA 3EGHA 4FCXA 3RL4A 3V4YA 2IAEC 4DHLA 3E7BA 3D03A 3EGGA 4MOVA 2NXFA 1HO5A 4V0XA 4H1SA 4G9JA 1M63A 3QG5C 3CK2A 3ZTVA 2WDFA 4JA7A 1XZWA 1U32A 1S3LA 2P6BA 2XMOA 1NNWA 2GJUA 5JPFA 3H66A 1HP1A 2AHDA 2O8AA 2YEQA 4ORAA 2R17A 4F0ZA 3N5UA 3THOB 4FBWA 1S8EA 2A22A 1OIDA 1Z2XA 3AUZA 3IVDA 4O5GA 4ORBA 1SU1A 4UWQA 3DSDA 2BCDA 4NZVA 1S3NA 2ZOAA 2JOGA 1T71A 4Q7FA 1WARA 4HD0A 4MP0A 5JPEA 4LACC 3H60A 3E7AA 1S3MA 2QJCA 2KKNA 2WDEA 4O24A 1JK7A 5C1VA 4J6OA 2QFPA 4TUGA 3HVQA 4B2OA 2DXLA 2HYPA 5IOHA 4V0WA 3ICFA 1HPUA 2O8GA 1S70A 1UF3A 4IL1A 1QHWA 1TCOA 4ORCA 3RL3A 2USHA 3RL5A 1WAO1 2HYOA 3C5WC 4KBPA 3ZU0A 3FGAC 3AV0A 4V0VA 1OIEA 4UT3B 1IT6A 4LU9A 4KKZA 1KBPA 5EQVA 4XPNA 1MF8A 4DT2A 4DSYA 2NPPC 3E0JA
chains in the Genus database with same CATH topology
4I5NC 3H69A 3PSOA 3TGHA 2Z06A 3QFMA 1S95A 4H2IA 3T1IA 3DSCA 3H64A 1FJMA 2NYMC 2NYLC 1G5BA 4FBKA 4ZX2A 1V73A 2Z72A 3K7WC 1XM7A 2WDCA 3C9FA 2ZO9B 5J28A 3IVEA 4H2FA 4UT3A 2IE3C 3H63A 3H68A 4OR9A 4M0VA 4WWLA 3P71C 4IYPC 2HY1A 2Z1AA 3KBPA 3RQZA 4UT2A 2CV9A 2Q8UA 2WDDA 3IB7A 5JJTA 1UTEA 2BDXA 5F3WA 3H62B 2ZBMA 1W24A 2YVTA 3PSNA 1II7A 1Z2WA 4JA9A 4FBQA 5GTUA 3JYFA 3FLOA 4TUIA 5INBA 1OI8A 3GVEA 5HPEA 4H1YP 3H61A 2IE4C 4ZVZA 1AUIA 3H67A 3K7VC 4YKEA 2DFJA 5B8IA 4MOYA 3THNA 2QFRA 3DW8C 1USHA 1QFCA 5DNYA 2BQ8X 4I5LC 4LTYA 4O4KA 3LL8A 4H2BA 2DXNA 1T70A 4H2GA 3QFOA 3QFKA 4O43A 3IB8A 3QFNA 3EGHA 4FCXA 3RL4A 3V4YA 2IAEC 4DHLA 3E7BA 3D03A 3EGGA 4MOVA 2NXFA 1HO5A 4V0XA 4H1SA 4G9JA 1M63A 3QG5C 3CK2A 3ZTVA 2WDFA 4JA7A 1XZWA 1U32A 1S3LA 2P6BA 2XMOA 1NNWA 2GJUA 5JPFA 3H66A 1HP1A 2AHDA 2O8AA 2YEQA 4ORAA 2R17A 4F0ZA 3N5UA 3THOB 4FBWA 1S8EA 2A22A 1OIDA 1Z2XA 3AUZA 3IVDA 4O5GA 4ORBA 1SU1A 4UWQA 3DSDA 2BCDA 4NZVA 1S3NA 2ZOAA 2JOGA 1T71A 4Q7FA 1WARA 4HD0A 4MP0A 5JPEA 4LACC 3H60A 3E7AA 1S3MA 2QJCA 2KKNA 2WDEA 4O24A 1JK7A 5C1VA 4J6OA 2QFPA 4TUGA 3HVQA 4B2OA 2DXLA 2HYPA 5IOHA 4V0WA 3ICFA 1HPUA 2O8GA 1S70A 1UF3A 4IL1A 1QHWA 1TCOA 4ORCA 3RL3A 2USHA 3RL5A 1WAO1 2HYOA 3C5WC 4KBPA 3ZU0A 3FGAC 3AV0A 4V0VA 1OIEA 4UT3B 1IT6A 4LU9A 4KKZA 1KBPA 5EQVA 4XPNA 1MF8A 4DT2A 4DSYA 2NPPC 3E0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5N C;  3H69 A;  3PSO A;  3TGH A;  2Z06 A;  3QFM A;  1S95 A;  4H2I A;  3T1I A;  3DSC A;  3H64 A;  1FJM A;  2NYM C;  2NYL C;  1G5B A;  4FBK A;  4ZX2 A;  1V73 A;  2Z72 A;  3K7W C;  1XM7 A;  2WDC A;  3C9F A;  5J28 A;  3IVE A;  4H2F A;  4UT3 A;  2IE3 C;  3H63 A;  3H68 A;  4OR9 A;  4M0V A;  4WWL A;  3P71 C;  4IYP C;  2HY1 A;  2Z1A A;  3KBP A;  3RQZ A;  4UT2 A;  2CV9 A;  2Q8U A;  2WDD A;  3IB7 A;  5JJT A;  1UTE A;  2BDX A;  5F3W A;  3H62 B;  2ZBM A;  1W24 A;  2YVT A;  3PSN A;  1II7 A;  1Z2W A;  4JA9 A;  4FBQ A;  5GTU A;  3JYF A;  4TUI A;  5INB A;  1OI8 A;  3GVE A;  5HPE A;  4H1Y P;  3H61 A;  2IE4 C;  4ZVZ A;  1AUI A;  3H67 A;  3K7V C;  4YKE A;  2DFJ A;  5B8I A;  4MOY A;  3THN A;  2QFR A;  3DW8 C;  1USH A;  1QFC A;  5DNY A;  2BQ8 X;  4I5L C;  4LTY A;  4O4K A;  3LL8 A;  4H2B A;  1T70 A;  4H2G A;  3QFO A;  3QFK A;  4O43 A;  3IB8 A;  3QFN A;  3EGH A;  4FCX A;  3RL4 A;  3V4Y A;  2IAE C;  4DHL A;  3E7B A;  3EGG A;  4MOV A;  2NXF A;  1HO5 A;  4V0X A;  4H1S A;  4G9J A;  1M63 A;  3QG5 C;  3CK2 A;  3ZTV A;  2WDF A;  4JA7 A;  1XZW A;  1U32 A;  1S3L A;  2P6B A;  2XMO A;  1NNW A;  2GJU A;  5JPF A;  3H66 A;  1HP1 A;  2AHD A;  2O8A A;  4ORA A;  2R17 A;  4F0Z A;  3N5U A;  3THO B;  4FBW A;  1S8E A;  2A22 A;  1OID A;  1Z2X A;  3AUZ A;  3IVD A;  4O5G A;  4ORB A;  1SU1 A;  4UWQ A;  3DSD A;  2BCD A;  4NZV A;  1S3N A;  2JOG A;  1T71 A;  4Q7F A;  1WAR A;  4HD0 A;  4MP0 A;  5JPE A;  4LAC C;  3H60 A;  3E7A A;  1S3M A;  2QJC A;  2KKN A;  2WDE A;  4O24 A;  1JK7 A;  5C1V A;  4J6O A;  2QFP A;  4TUG A;  3HVQ A;  2HYP A;  5IOH A;  4V0W A;  3ICF A;  1HPU A;  2O8G A;  1S70 A;  1UF3 A;  4IL1 A;  1QHW A;  1TCO A;  4ORC A;  3RL3 A;  2USH A;  3RL5 A;  1WAO 1;  2HYO A;  3C5W C;  4KBP A;  3ZU0 A;  3FGA C;  3AV0 A;  4V0V A;  1OIE A;  4UT3 B;  1IT6 A;  4LU9 A;  4KKZ A;  1KBP A;  5EQV A;  4XPN A;  1MF8 A;  4DT2 A;  4DSY A;  2NPP C;  4B2O A; 
#chains in the Genus database with same CATH topology
 4I5N C;  3H69 A;  3PSO A;  3TGH A;  2Z06 A;  3QFM A;  1S95 A;  4H2I A;  3T1I A;  3DSC A;  3H64 A;  1FJM A;  2NYM C;  2NYL C;  1G5B A;  4FBK A;  4ZX2 A;  1V73 A;  2Z72 A;  3K7W C;  1XM7 A;  2WDC A;  3C9F A;  2ZO9 B;  5J28 A;  3IVE A;  4H2F A;  4UT3 A;  2IE3 C;  3H63 A;  3H68 A;  4OR9 A;  4M0V A;  4WWL A;  3P71 C;  4IYP C;  2HY1 A;  2Z1A A;  3KBP A;  3RQZ A;  4UT2 A;  2CV9 A;  2Q8U A;  2WDD A;  3IB7 A;  5JJT A;  1UTE A;  2BDX A;  5F3W A;  3H62 B;  2ZBM A;  1W24 A;  2YVT A;  3PSN A;  1II7 A;  1Z2W A;  4JA9 A;  4FBQ A;  5GTU A;  3JYF A;  3FLO A;  4TUI A;  5INB A;  1OI8 A;  3GVE A;  5HPE A;  4H1Y P;  3H61 A;  2IE4 C;  4ZVZ A;  1AUI A;  3H67 A;  3K7V C;  4YKE A;  2DFJ A;  5B8I A;  4MOY A;  3THN A;  2QFR A;  3DW8 C;  1USH A;  1QFC A;  5DNY A;  2BQ8 X;  4I5L C;  4LTY A;  4O4K A;  3LL8 A;  4H2B A;  2DXN A;  1T70 A;  4H2G A;  3QFO A;  3QFK A;  4O43 A;  3IB8 A;  3QFN A;  3EGH A;  4FCX A;  3RL4 A;  3V4Y A;  2IAE C;  4DHL A;  3E7B A;  3D03 A;  3EGG A;  4MOV A;  2NXF A;  1HO5 A;  4V0X A;  4H1S A;  4G9J A;  1M63 A;  3QG5 C;  3CK2 A;  3ZTV A;  2WDF A;  4JA7 A;  1XZW A;  1U32 A;  1S3L A;  2P6B A;  2XMO A;  1NNW A;  2GJU A;  5JPF A;  3H66 A;  1HP1 A;  2AHD A;  2O8A A;  2YEQ A;  4ORA A;  2R17 A;  4F0Z A;  3N5U A;  3THO B;  4FBW A;  1S8E A;  2A22 A;  1OID A;  1Z2X A;  3AUZ A;  3IVD A;  4O5G A;  4ORB A;  1SU1 A;  4UWQ A;  3DSD A;  2BCD A;  4NZV A;  1S3N A;  2ZOA A;  2JOG A;  1T71 A;  4Q7F A;  1WAR A;  4HD0 A;  4MP0 A;  5JPE A;  4LAC C;  3H60 A;  3E7A A;  1S3M A;  2QJC A;  2KKN A;  2WDE A;  4O24 A;  1JK7 A;  5C1V A;  4J6O A;  2QFP A;  4TUG A;  3HVQ A;  4B2O A;  2DXL A;  2HYP A;  5IOH A;  4V0W A;  3ICF A;  1HPU A;  2O8G A;  1S70 A;  1UF3 A;  4IL1 A;  1QHW A;  1TCO A;  4ORC A;  3RL3 A;  2USH A;  3RL5 A;  1WAO 1;  2HYO A;  3C5W C;  4KBP A;  3ZU0 A;  3FGA C;  3AV0 A;  4V0V A;  1OIE A;  4UT3 B;  1IT6 A;  4LU9 A;  4KKZ A;  1KBP A;  5EQV A;  4XPN A;  1MF8 A;  4DT2 A;  4DSY A;  2NPP C;  3E0J A; 
#chains in the Genus database with same CATH homology
 4I5N C;  3H69 A;  3PSO A;  3TGH A;  2Z06 A;  3QFM A;  1S95 A;  4H2I A;  3T1I A;  3DSC A;  3H64 A;  1FJM A;  2NYM C;  2NYL C;  1G5B A;  4FBK A;  4ZX2 A;  1V73 A;  2Z72 A;  3K7W C;  1XM7 A;  2WDC A;  3C9F A;  2ZO9 B;  5J28 A;  3IVE A;  4H2F A;  4UT3 A;  2IE3 C;  3H63 A;  3H68 A;  4OR9 A;  4M0V A;  4WWL A;  3P71 C;  4IYP C;  2HY1 A;  2Z1A A;  3KBP A;  3RQZ A;  4UT2 A;  2CV9 A;  2Q8U A;  2WDD A;  3IB7 A;  5JJT A;  1UTE A;  2BDX A;  5F3W A;  3H62 B;  2ZBM A;  1W24 A;  2YVT A;  3PSN A;  1II7 A;  1Z2W A;  4JA9 A;  4FBQ A;  5GTU A;  3JYF A;  3FLO A;  4TUI A;  5INB A;  1OI8 A;  3GVE A;  5HPE A;  4H1Y P;  3H61 A;  2IE4 C;  4ZVZ A;  1AUI A;  3H67 A;  3K7V C;  4YKE A;  2DFJ A;  5B8I A;  4MOY A;  3THN A;  2QFR A;  3DW8 C;  1USH A;  1QFC A;  5DNY A;  2BQ8 X;  4I5L C;  4LTY A;  4O4K A;  3LL8 A;  4H2B A;  2DXN A;  1T70 A;  4H2G A;  3QFO A;  3QFK A;  4O43 A;  3IB8 A;  3QFN A;  3EGH A;  4FCX A;  3RL4 A;  3V4Y A;  2IAE C;  4DHL A;  3E7B A;  3D03 A;  3EGG A;  4MOV A;  2NXF A;  1HO5 A;  4V0X A;  4H1S A;  4G9J A;  1M63 A;  3QG5 C;  3CK2 A;  3ZTV A;  2WDF A;  4JA7 A;  1XZW A;  1U32 A;  1S3L A;  2P6B A;  2XMO A;  1NNW A;  2GJU A;  5JPF A;  3H66 A;  1HP1 A;  2AHD A;  2O8A A;  2YEQ A;  4ORA A;  2R17 A;  4F0Z A;  3N5U A;  3THO B;  4FBW A;  1S8E A;  2A22 A;  1OID A;  1Z2X A;  3AUZ A;  3IVD A;  4O5G A;  4ORB A;  1SU1 A;  4UWQ A;  3DSD A;  2BCD A;  4NZV A;  1S3N A;  2ZOA A;  2JOG A;  1T71 A;  4Q7F A;  1WAR A;  4HD0 A;  4MP0 A;  5JPE A;  4LAC C;  3H60 A;  3E7A A;  1S3M A;  2QJC A;  2KKN A;  2WDE A;  4O24 A;  1JK7 A;  5C1V A;  4J6O A;  2QFP A;  4TUG A;  3HVQ A;  4B2O A;  2DXL A;  2HYP A;  5IOH A;  4V0W A;  3ICF A;  1HPU A;  2O8G A;  1S70 A;  1UF3 A;  4IL1 A;  1QHW A;  1TCO A;  4ORC A;  3RL3 A;  2USH A;  3RL5 A;  1WAO 1;  2HYO A;  3C5W C;  4KBP A;  3ZU0 A;  3FGA C;  3AV0 A;  4V0V A;  1OIE A;  4UT3 B;  1IT6 A;  4LU9 A;  4KKZ A;  1KBP A;  5EQV A;  4XPN A;  1MF8 A;  4DT2 A;  4DSY A;  2NPP C;  3E0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...