2IE3C

Structure of the protein phosphatase 2a core enzyme bound to tumor-inducing toxins
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Protein Phosphatase 2A Core Enzyme Bound to Tumor-Inducing Toxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/toxin
molecule keywords Protein Phosphatase 2, regulatory subunit A (PR 65), alpha i
total genus 104
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2ie3C00
3H66A 1JK7A 3AV0A 4MOYA 2QJCA 2WDEA 4UT3B 3H61A 3H63A 4ZVZA 3QFMA 3FGAC 4H1SA 4G9JA 1USHA 4DSYA 5JPEA 3PSOA 1UF3A 3THNA 3ZTVA 4FBQA 4LTYA 5EQVA 3KBPA 1G5BA 1S95A 1FJMA 3K7WC 1XZWA 1II7A 1IT6A 3H69A 3ICFA 4TUGA 1S3NA 3C9FA 4JA7A 2IE3C 4O4KA 2WDDA 2IE4C 3RL5A 3H68A 1S70A 4MOVA 3PSNA 2USHA 3EGGA 1NNWA 4FCXA 4F0ZA 3RL3A 3IVDA 3H62B 2KKNA 5JPFA 3JYFA 5IOHA 2WDCA 4ORCA 2NYLC 3TGHA 1XM7A 2Q8UA 4O5GA 3QFOA 4IYPC 4DHLA 1SU1A 2QFRA 3RQZA 2NXFA 4M0VA 4FBWA 4NZVA 3V4YA 3AUZA 1HPUA 4ZX2A 4Q7FA 2A22A 2Z06A 4LU9A 2R17A 3H64A 4V0VA 5GTUA 2AHDA 5J28A 1S3LA 2WDFA 2Z72A 2HYPA 3DW8C 4H2FA 1TCOA 2HYOA 3GVEA 5C1VA 4DT2A 4OR9A 1KBPA 1OI8A 4J6OA 3QG5C 4TUIA 3CK2A 5B8IA 2DFJA 1WARA 3EGHA 4FBKA 1V73A 4I5NC 4ORBA 2IAEC 2P6BA 5INBA 2BCDA 4ORAA 3DSCA 1U32A 5DNYA 2BDXA 3T1IA 1OIDA 4UT3A 1WAO1 3N5UA 1S3MA 3THOB 1HP1A 4UT2A 4B2OA 2QFPA 5HPEA 2YVTA 2NYMC 4KBPA 1M63A 2O8GA 3LL8A 1W24A 2XMOA 4H1YP 1MF8A 4V0WA 3IB7A 4MP0A 3ZU0A 4H2BA 2HY1A 1QHWA 4LACC 3H60A 2JOGA 4H2IA 3IVEA 3QFNA 4O24A 2BQ8X 3QFKA 1Z2WA 4JA9A 2GJUA 3H67A 3RL4A 1HO5A 1S8EA 1OIEA 4I5LC 4WWLA 4HD0A 1AUIA 4H2GA 3DSDA 1QFCA 5JJTA 2CV9A 3IB8A 3E7AA 1T70A 3E7BA 3K7VC 2Z1AA 4UWQA 4KKZA 4IL1A 3C5WC 1T71A 4XPNA 2NPPC 3HVQA 4YKEA 3P71C 1Z2XA 4V0XA 4O43A 1UTEA 5F3WA 2O8AA 2ZBMA
chains in the Genus database with same CATH superfamily
3H66A 1JK7A 3AV0A 4MOYA 2QJCA 2WDEA 4UT3B 3H61A 3H63A 4ZVZA 3QFMA 3FGAC 4H1SA 4G9JA 1USHA 4DSYA 5JPEA 3PSOA 1UF3A 3THNA 3ZTVA 4FBQA 4LTYA 3D03A 5EQVA 3KBPA 1G5BA 1S95A 1FJMA 3K7WC 1XZWA 1II7A 1IT6A 3H69A 3ICFA 4TUGA 1S3NA 3C9FA 4JA7A 2IE3C 4O4KA 2WDDA 2IE4C 3RL5A 3H68A 1S70A 4MOVA 3PSNA 2USHA 3EGGA 1NNWA 4FCXA 4F0ZA 3RL3A 3IVDA 3H62B 2KKNA 5JPFA 3JYFA 5IOHA 2WDCA 4ORCA 2NYLC 3TGHA 2DXNA 1XM7A 2Q8UA 4O5GA 3QFOA 4IYPC 4DHLA 1SU1A 2QFRA 3RQZA 2NXFA 4M0VA 4FBWA 4NZVA 3V4YA 3AUZA 1HPUA 4ZX2A 4Q7FA 2A22A 3FLOA 2Z06A 4LU9A 2R17A 3H64A 4V0VA 5GTUA 2ZO9B 2AHDA 5J28A 1S3LA 2WDFA 2Z72A 2HYPA 3DW8C 4H2FA 1TCOA 2HYOA 3GVEA 5C1VA 4DT2A 4OR9A 1KBPA 1OI8A 4J6OA 3QG5C 4TUIA 3CK2A 5B8IA 2DFJA 1WARA 3EGHA 4FBKA 1V73A 4I5NC 4ORBA 2IAEC 2P6BA 5INBA 2BCDA 4ORAA 3DSCA 1U32A 5DNYA 2BDXA 3T1IA 1OIDA 2YEQA 4UT3A 1WAO1 3N5UA 1S3MA 3THOB 1HP1A 4UT2A 4B2OA 2QFPA 5HPEA 2YVTA 2NYMC 4KBPA 1M63A 2O8GA 3LL8A 1W24A 2XMOA 4H1YP 1MF8A 4V0WA 3IB7A 4MP0A 3ZU0A 4H2BA 2DXLA 2HY1A 1QHWA 4LACC 3H60A 2JOGA 4H2IA 3IVEA 3QFNA 4O24A 2BQ8X 3QFKA 2ZOAA 1Z2WA 4JA9A 2GJUA 3H67A 3RL4A 1HO5A 1S8EA 1OIEA 4I5LC 4WWLA 4HD0A 1AUIA 4H2GA 3DSDA 1QFCA 5JJTA 2CV9A 3IB8A 3E7AA 1T70A 3E0JA 3E7BA 2Z1AA 3K7VC 4UWQA 4KKZA 4IL1A 3C5WC 1T71A 4XPNA 2NPPC 3HVQA 4YKEA 3P71C 1Z2XA 4V0XA 4O43A 1UTEA 5F3WA 2O8AA 2ZBMA
chains in the Genus database with same CATH topology
3H66A 1JK7A 3AV0A 4MOYA 2QJCA 2WDEA 4UT3B 3H61A 3H63A 4ZVZA 3QFMA 3FGAC 4H1SA 4G9JA 1USHA 4DSYA 5JPEA 3PSOA 1UF3A 3THNA 3ZTVA 4FBQA 4LTYA 3D03A 5EQVA 3KBPA 1G5BA 1S95A 1FJMA 3K7WC 1XZWA 1II7A 1IT6A 3H69A 3ICFA 4TUGA 1S3NA 3C9FA 4JA7A 2IE3C 4O4KA 2WDDA 2IE4C 3RL5A 3H68A 1S70A 4MOVA 3PSNA 2USHA 3EGGA 1NNWA 4FCXA 4F0ZA 3RL3A 3IVDA 3H62B 2KKNA 5JPFA 3JYFA 5IOHA 2WDCA 4ORCA 2NYLC 3TGHA 2DXNA 1XM7A 2Q8UA 4O5GA 3QFOA 4IYPC 4DHLA 1SU1A 2QFRA 3RQZA 2NXFA 4M0VA 4FBWA 4NZVA 3V4YA 3AUZA 1HPUA 4ZX2A 4Q7FA 2A22A 3FLOA 2Z06A 4LU9A 2R17A 3H64A 4V0VA 5GTUA 2ZO9B 2AHDA 5J28A 1S3LA 2WDFA 2Z72A 2HYPA 3DW8C 4H2FA 1TCOA 2HYOA 3GVEA 5C1VA 4DT2A 4OR9A 1KBPA 1OI8A 4J6OA 3QG5C 4TUIA 3CK2A 5B8IA 2DFJA 1WARA 3EGHA 4FBKA 1V73A 4I5NC 4ORBA 2IAEC 2P6BA 5INBA 2BCDA 4ORAA 3DSCA 1U32A 5DNYA 2BDXA 3T1IA 1OIDA 2YEQA 4UT3A 1WAO1 3N5UA 1S3MA 3THOB 1HP1A 4UT2A 4B2OA 2QFPA 5HPEA 2YVTA 2NYMC 4KBPA 1M63A 2O8GA 3LL8A 1W24A 2XMOA 4H1YP 1MF8A 4V0WA 3IB7A 4MP0A 3ZU0A 4H2BA 2DXLA 2HY1A 1QHWA 4LACC 3H60A 2JOGA 4H2IA 3IVEA 3QFNA 4O24A 2BQ8X 3QFKA 2ZOAA 1Z2WA 4JA9A 2GJUA 3H67A 3RL4A 1HO5A 1S8EA 1OIEA 4I5LC 4WWLA 4HD0A 1AUIA 4H2GA 3DSDA 1QFCA 5JJTA 2CV9A 3IB8A 3E7AA 1T70A 3E0JA 3E7BA 2Z1AA 3K7VC 4UWQA 4KKZA 4IL1A 3C5WC 1T71A 4XPNA 2NPPC 3HVQA 4YKEA 3P71C 1Z2XA 4V0XA 4O43A 1UTEA 5F3WA 2O8AA 2ZBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H66 A;  1JK7 A;  3AV0 A;  4MOY A;  2QJC A;  2WDE A;  4UT3 B;  3H61 A;  3H63 A;  4ZVZ A;  3QFM A;  3FGA C;  4H1S A;  4G9J A;  1USH A;  4DSY A;  5JPE A;  3PSO A;  1UF3 A;  3THN A;  3ZTV A;  4FBQ A;  4LTY A;  5EQV A;  3KBP A;  1G5B A;  1S95 A;  1FJM A;  3K7W C;  1XZW A;  1II7 A;  1IT6 A;  3H69 A;  3ICF A;  4TUG A;  1S3N A;  3C9F A;  4JA7 A;  2IE3 C;  4O4K A;  2WDD A;  2IE4 C;  3RL5 A;  3H68 A;  1S70 A;  4MOV A;  3PSN A;  2USH A;  3EGG A;  1NNW A;  4FCX A;  4F0Z A;  3RL3 A;  3IVD A;  3H62 B;  2KKN A;  5JPF A;  3JYF A;  5IOH A;  2WDC A;  4ORC A;  2NYL C;  3TGH A;  1XM7 A;  2Q8U A;  4O5G A;  3QFO A;  4IYP C;  4DHL A;  1SU1 A;  2QFR A;  3RQZ A;  2NXF A;  4M0V A;  4FBW A;  4NZV A;  3V4Y A;  3AUZ A;  1HPU A;  4ZX2 A;  4Q7F A;  2A22 A;  2Z06 A;  4LU9 A;  2R17 A;  3H64 A;  4V0V A;  5GTU A;  2AHD A;  5J28 A;  1S3L A;  2WDF A;  2Z72 A;  2HYP A;  3DW8 C;  4H2F A;  1TCO A;  2HYO A;  3GVE A;  5C1V A;  4DT2 A;  4OR9 A;  1KBP A;  1OI8 A;  4J6O A;  3QG5 C;  4TUI A;  3CK2 A;  5B8I A;  2DFJ A;  1WAR A;  3EGH A;  4FBK A;  1V73 A;  4I5N C;  4ORB A;  2IAE C;  2P6B A;  5INB A;  2BCD A;  4ORA A;  3DSC A;  1U32 A;  5DNY A;  2BDX A;  3T1I A;  1OID A;  4UT3 A;  1WAO 1;  3N5U A;  1S3M A;  3THO B;  1HP1 A;  4UT2 A;  4B2O A;  2QFP A;  5HPE A;  2YVT A;  2NYM C;  4KBP A;  1M63 A;  2O8G A;  3LL8 A;  1W24 A;  2XMO A;  4H1Y P;  1MF8 A;  4V0W A;  3IB7 A;  4MP0 A;  3ZU0 A;  4H2B A;  2HY1 A;  1QHW A;  4LAC C;  3H60 A;  2JOG A;  4H2I A;  3IVE A;  3QFN A;  4O24 A;  2BQ8 X;  3QFK A;  1Z2W A;  4JA9 A;  2GJU A;  3H67 A;  3RL4 A;  1HO5 A;  1S8E A;  1OIE A;  4I5L C;  4WWL A;  4HD0 A;  1AUI A;  4H2G A;  3DSD A;  1QFC A;  5JJT A;  2CV9 A;  3IB8 A;  3E7A A;  1T70 A;  3E7B A;  3K7V C;  2Z1A A;  4UWQ A;  4KKZ A;  4IL1 A;  3C5W C;  1T71 A;  4XPN A;  2NPP C;  3HVQ A;  4YKE A;  3P71 C;  1Z2X A;  4V0X A;  4O43 A;  1UTE A;  5F3W A;  2O8A A;  2ZBM A; 
#chains in the Genus database with same CATH topology
 3H66 A;  1JK7 A;  3AV0 A;  4MOY A;  2QJC A;  2WDE A;  4UT3 B;  3H61 A;  3H63 A;  4ZVZ A;  3QFM A;  3FGA C;  4H1S A;  4G9J A;  1USH A;  4DSY A;  5JPE A;  3PSO A;  1UF3 A;  3THN A;  3ZTV A;  4FBQ A;  4LTY A;  3D03 A;  5EQV A;  3KBP A;  1G5B A;  1S95 A;  1FJM A;  3K7W C;  1XZW A;  1II7 A;  1IT6 A;  3H69 A;  3ICF A;  4TUG A;  1S3N A;  3C9F A;  4JA7 A;  2IE3 C;  4O4K A;  2WDD A;  2IE4 C;  3RL5 A;  3H68 A;  1S70 A;  4MOV A;  3PSN A;  2USH A;  3EGG A;  1NNW A;  4FCX A;  4F0Z A;  3RL3 A;  3IVD A;  3H62 B;  2KKN A;  5JPF A;  3JYF A;  5IOH A;  2WDC A;  4ORC A;  2NYL C;  3TGH A;  2DXN A;  1XM7 A;  2Q8U A;  4O5G A;  3QFO A;  4IYP C;  4DHL A;  1SU1 A;  2QFR A;  3RQZ A;  2NXF A;  4M0V A;  4FBW A;  4NZV A;  3V4Y A;  3AUZ A;  1HPU A;  4ZX2 A;  4Q7F A;  2A22 A;  3FLO A;  2Z06 A;  4LU9 A;  2R17 A;  3H64 A;  4V0V A;  5GTU A;  2ZO9 B;  2AHD A;  5J28 A;  1S3L A;  2WDF A;  2Z72 A;  2HYP A;  3DW8 C;  4H2F A;  1TCO A;  2HYO A;  3GVE A;  5C1V A;  4DT2 A;  4OR9 A;  1KBP A;  1OI8 A;  4J6O A;  3QG5 C;  4TUI A;  3CK2 A;  5B8I A;  2DFJ A;  1WAR A;  3EGH A;  4FBK A;  1V73 A;  4I5N C;  4ORB A;  2IAE C;  2P6B A;  5INB A;  2BCD A;  4ORA A;  3DSC A;  1U32 A;  5DNY A;  2BDX A;  3T1I A;  1OID A;  2YEQ A;  4UT3 A;  1WAO 1;  3N5U A;  1S3M A;  3THO B;  1HP1 A;  4UT2 A;  4B2O A;  2QFP A;  5HPE A;  2YVT A;  2NYM C;  4KBP A;  1M63 A;  2O8G A;  3LL8 A;  1W24 A;  2XMO A;  4H1Y P;  1MF8 A;  4V0W A;  3IB7 A;  4MP0 A;  3ZU0 A;  4H2B A;  2DXL A;  2HY1 A;  1QHW A;  4LAC C;  3H60 A;  2JOG A;  4H2I A;  3IVE A;  3QFN A;  4O24 A;  2BQ8 X;  3QFK A;  2ZOA A;  1Z2W A;  4JA9 A;  2GJU A;  3H67 A;  3RL4 A;  1HO5 A;  1S8E A;  1OIE A;  4I5L C;  4WWL A;  4HD0 A;  1AUI A;  4H2G A;  3DSD A;  1QFC A;  5JJT A;  2CV9 A;  3IB8 A;  3E7A A;  1T70 A;  3E0J A;  3E7B A;  2Z1A A;  3K7V C;  4UWQ A;  4KKZ A;  4IL1 A;  3C5W C;  1T71 A;  4XPN A;  2NPP C;  3HVQ A;  4YKE A;  3P71 C;  1Z2X A;  4V0X A;  4O43 A;  1UTE A;  5F3W A;  2O8A A;  2ZBM A; 
#chains in the Genus database with same CATH homology
 3H66 A;  1JK7 A;  3AV0 A;  4MOY A;  2QJC A;  2WDE A;  4UT3 B;  3H61 A;  3H63 A;  4ZVZ A;  3QFM A;  3FGA C;  4H1S A;  4G9J A;  1USH A;  4DSY A;  5JPE A;  3PSO A;  1UF3 A;  3THN A;  3ZTV A;  4FBQ A;  4LTY A;  3D03 A;  5EQV A;  3KBP A;  1G5B A;  1S95 A;  1FJM A;  3K7W C;  1XZW A;  1II7 A;  1IT6 A;  3H69 A;  3ICF A;  4TUG A;  1S3N A;  3C9F A;  4JA7 A;  2IE3 C;  4O4K A;  2WDD A;  2IE4 C;  3RL5 A;  3H68 A;  1S70 A;  4MOV A;  3PSN A;  2USH A;  3EGG A;  1NNW A;  4FCX A;  4F0Z A;  3RL3 A;  3IVD A;  3H62 B;  2KKN A;  5JPF A;  3JYF A;  5IOH A;  2WDC A;  4ORC A;  2NYL C;  3TGH A;  2DXN A;  1XM7 A;  2Q8U A;  4O5G A;  3QFO A;  4IYP C;  4DHL A;  1SU1 A;  2QFR A;  3RQZ A;  2NXF A;  4M0V A;  4FBW A;  4NZV A;  3V4Y A;  3AUZ A;  1HPU A;  4ZX2 A;  4Q7F A;  2A22 A;  3FLO A;  2Z06 A;  4LU9 A;  2R17 A;  3H64 A;  4V0V A;  5GTU A;  2ZO9 B;  2AHD A;  5J28 A;  1S3L A;  2WDF A;  2Z72 A;  2HYP A;  3DW8 C;  4H2F A;  1TCO A;  2HYO A;  3GVE A;  5C1V A;  4DT2 A;  4OR9 A;  1KBP A;  1OI8 A;  4J6O A;  3QG5 C;  4TUI A;  3CK2 A;  5B8I A;  2DFJ A;  1WAR A;  3EGH A;  4FBK A;  1V73 A;  4I5N C;  4ORB A;  2IAE C;  2P6B A;  5INB A;  2BCD A;  4ORA A;  3DSC A;  1U32 A;  5DNY A;  2BDX A;  3T1I A;  1OID A;  2YEQ A;  4UT3 A;  1WAO 1;  3N5U A;  1S3M A;  3THO B;  1HP1 A;  4UT2 A;  4B2O A;  2QFP A;  5HPE A;  2YVT A;  2NYM C;  4KBP A;  1M63 A;  2O8G A;  3LL8 A;  1W24 A;  2XMO A;  4H1Y P;  1MF8 A;  4V0W A;  3IB7 A;  4MP0 A;  3ZU0 A;  4H2B A;  2DXL A;  2HY1 A;  1QHW A;  4LAC C;  3H60 A;  2JOG A;  4H2I A;  3IVE A;  3QFN A;  4O24 A;  2BQ8 X;  3QFK A;  2ZOA A;  1Z2W A;  4JA9 A;  2GJU A;  3H67 A;  3RL4 A;  1HO5 A;  1S8E A;  1OIE A;  4I5L C;  4WWL A;  4HD0 A;  1AUI A;  4H2G A;  3DSD A;  1QFC A;  5JJT A;  2CV9 A;  3IB8 A;  3E7A A;  1T70 A;  3E0J A;  3E7B A;  2Z1A A;  3K7V C;  4UWQ A;  4KKZ A;  4IL1 A;  3C5W C;  1T71 A;  4XPN A;  2NPP C;  3HVQ A;  4YKE A;  3P71 C;  1Z2X A;  4V0X A;  4O43 A;  1UTE A;  5F3W A;  2O8A A;  2ZBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...