5J28A

Ki67-pp1g (protein phosphatase 1, gamma isoform) holoenzyme complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ki-67 and RepoMan mitotic phosphatases assemble via an identical, yet novel mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
total genus 106
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5j28A00
1HO5A 4ORAA 4O43A 3AV0A 1II7A 1Z2XA 5DNYA 3QG5C 2NPPC 4IL1A 4Q7FA 4YKEA 3THNA 2NXFA 2IE3C 4O5GA 5JPFA 4H2BA 2HYPA 1QHWA 1G5BA 2KKNA 4DHLA 4MP0A 3TGHA 3C9FA 2BDXA 1OIDA 2Z06A 1T71A 4H2IA 3IVDA 3JYFA 4J6OA 4UT3B 3QFOA 3RL3A 1T70A 4ZVZA 1UTEA 4TUGA 2BCDA 1WAO1 4FBKA 1HPUA 4O4KA 3PSOA 1U32A 1OI8A 4WWLA 1JK7A 5F3WA 2GJUA 5IOHA 1MF8A 4KBPA 4DT2A 1IT6A 1HP1A 1AUIA 1S3LA 3THOB 2HYOA 2DFJA 2QFPA 3H63A 3QFNA 3IB7A 5GTUA 4UT3A 4MOVA 4V0XA 2WDFA 3DSCA 1XM7A 3E7AA 3RL4A 2Z1AA 4I5LC 4B2OA 2NYLC 3H67A 2P6BA 2XMOA 3ICFA 4DSYA 4V0VA 3H60A 1TCOA 3DSDA 3H62B 3QFMA 4H2GA 2IE4C 1W24A 4FCXA 3P71C 4FBQA 2QFRA 2QJCA 2HY1A 2ZBMA 1S95A 1V73A 3H68A 4LACC 3N5UA 3CK2A 2WDCA 3KBPA 3PSNA 2YVTA 4I5NC 1KBPA 5INBA 4MOYA 4ZX2A 1FJMA 2O8AA 5EQVA 1Z2WA 5HPEA 3LL8A 4LU9A 3FGAC 5JJTA 4ORBA 4XPNA 5B8IA 4KKZA 4LTYA 1USHA 1XZWA 1S3MA 4OR9A 1S8EA 3EGGA 2O8GA 4NZVA 1QFCA 3H61A 4HD0A 4M0VA 1NNWA 4H1YP 3QFKA 5J28A 3E7BA 4H1SA 1S70A 2USHA 2Q8UA 4H2FA 3AUZA 3RQZA 2NYMC 3H66A 3V4YA 4JA9A 4F0ZA 3H69A 3T1IA 5C1VA 2IAEC 1SU1A 3K7WC 3EGHA 1M63A 3H64A 4UWQA 3IB8A 2A22A 3IVEA 3RL5A 2Z72A 4FBWA 4IYPC 3ZU0A 2CV9A 2WDDA 4G9JA 3ZTVA 2AHDA 4UT2A 1WARA 3K7VC 4O24A 2R17A 1S3NA 5JPEA 3GVEA 2WDEA 3C5WC 4ORCA 4TUIA 1UF3A 3HVQA 3DW8C 2BQ8X 2JOGA 4V0WA 4JA7A 1OIEA
chains in the Genus database with same CATH superfamily
1HO5A 4ORAA 3D03A 4O43A 3AV0A 1II7A 1Z2XA 5DNYA 3QG5C 2NPPC 4IL1A 4Q7FA 4YKEA 3THNA 2NXFA 2DXLA 2IE3C 4O5GA 5JPFA 4H2BA 2HYPA 1QHWA 1G5BA 2KKNA 4DHLA 4MP0A 3TGHA 2ZO9B 3C9FA 2BDXA 1OIDA 2Z06A 1T71A 4H2IA 3IVDA 3JYFA 4J6OA 4UT3B 3QFOA 3RL3A 1T70A 4ZVZA 1UTEA 4TUGA 2BCDA 1WAO1 4FBKA 1HPUA 4O4KA 3PSOA 1U32A 1OI8A 4WWLA 1JK7A 5F3WA 2GJUA 5IOHA 1MF8A 4KBPA 4DT2A 1IT6A 1HP1A 1AUIA 1S3LA 3THOB 2HYOA 2DFJA 2QFPA 3H63A 3QFNA 3IB7A 5GTUA 4UT3A 3E0JA 4MOVA 4V0XA 2WDFA 3DSCA 1XM7A 3E7AA 3RL4A 2Z1AA 4I5LC 4B2OA 2NYLC 3H67A 2P6BA 2XMOA 3ICFA 4DSYA 4V0VA 3H60A 1TCOA 3DSDA 3H62B 3QFMA 4H2GA 2IE4C 1W24A 4FCXA 3P71C 4FBQA 3FLOA 2QFRA 2QJCA 2HY1A 2ZBMA 1S95A 1V73A 3H68A 2YEQA 4LACC 3N5UA 3CK2A 2WDCA 3KBPA 3PSNA 2YVTA 4I5NC 1KBPA 5INBA 4MOYA 4ZX2A 1FJMA 2O8AA 5EQVA 2ZOAA 1Z2WA 5HPEA 3LL8A 4LU9A 3FGAC 5JJTA 4ORBA 4XPNA 5B8IA 4KKZA 4LTYA 1USHA 1XZWA 1S3MA 4OR9A 1S8EA 3EGGA 2O8GA 4NZVA 1QFCA 3H61A 4HD0A 4M0VA 1NNWA 4H1YP 3QFKA 5J28A 3E7BA 4H1SA 1S70A 2USHA 2Q8UA 4H2FA 3AUZA 3RQZA 2NYMC 3H66A 3V4YA 4JA9A 4F0ZA 3H69A 3T1IA 5C1VA 2IAEC 1SU1A 3K7WC 3EGHA 1M63A 3H64A 4UWQA 3IB8A 2A22A 3IVEA 3RL5A 2Z72A 4FBWA 4IYPC 3ZU0A 2CV9A 2WDDA 4G9JA 3ZTVA 2AHDA 4UT2A 2DXNA 1WARA 3K7VC 4O24A 2R17A 1S3NA 5JPEA 3GVEA 2WDEA 3C5WC 4ORCA 4TUIA 1UF3A 3HVQA 3DW8C 2BQ8X 2JOGA 4V0WA 4JA7A 1OIEA
chains in the Genus database with same CATH topology
1HO5A 4ORAA 3D03A 4O43A 3AV0A 1II7A 1Z2XA 5DNYA 3QG5C 2NPPC 4IL1A 4Q7FA 4YKEA 3THNA 2NXFA 2DXLA 2IE3C 4O5GA 5JPFA 4H2BA 2HYPA 1QHWA 1G5BA 2KKNA 4DHLA 4MP0A 3TGHA 2ZO9B 3C9FA 2BDXA 1OIDA 2Z06A 1T71A 4H2IA 3IVDA 3JYFA 4J6OA 4UT3B 3QFOA 3RL3A 1T70A 4ZVZA 1UTEA 4TUGA 2BCDA 1WAO1 4FBKA 1HPUA 4O4KA 3PSOA 1U32A 1OI8A 4WWLA 1JK7A 5F3WA 2GJUA 5IOHA 1MF8A 4KBPA 4DT2A 1IT6A 1HP1A 1AUIA 1S3LA 3THOB 2HYOA 2DFJA 2QFPA 3H63A 3QFNA 3IB7A 5GTUA 4UT3A 3E0JA 4MOVA 4V0XA 2WDFA 3DSCA 1XM7A 3E7AA 3RL4A 2Z1AA 4I5LC 4B2OA 2NYLC 3H67A 2P6BA 2XMOA 3ICFA 4DSYA 4V0VA 3H60A 1TCOA 3DSDA 3H62B 3QFMA 4H2GA 2IE4C 1W24A 4FCXA 3P71C 4FBQA 3FLOA 2QFRA 2QJCA 2HY1A 2ZBMA 1S95A 1V73A 3H68A 2YEQA 4LACC 3N5UA 3CK2A 2WDCA 3KBPA 3PSNA 2YVTA 4I5NC 1KBPA 5INBA 4MOYA 4ZX2A 1FJMA 2O8AA 5EQVA 2ZOAA 1Z2WA 5HPEA 3LL8A 4LU9A 3FGAC 5JJTA 4ORBA 4XPNA 5B8IA 4KKZA 4LTYA 1USHA 1XZWA 1S3MA 4OR9A 1S8EA 3EGGA 2O8GA 4NZVA 1QFCA 3H61A 4HD0A 4M0VA 1NNWA 4H1YP 3QFKA 5J28A 3E7BA 4H1SA 1S70A 2USHA 2Q8UA 4H2FA 3AUZA 3RQZA 2NYMC 3H66A 3V4YA 4JA9A 4F0ZA 3H69A 3T1IA 5C1VA 2IAEC 1SU1A 3K7WC 3EGHA 1M63A 3H64A 4UWQA 3IB8A 2A22A 3IVEA 3RL5A 2Z72A 4FBWA 4IYPC 3ZU0A 2CV9A 2WDDA 4G9JA 3ZTVA 2AHDA 4UT2A 2DXNA 1WARA 3K7VC 4O24A 2R17A 1S3NA 5JPEA 3GVEA 2WDEA 3C5WC 4ORCA 4TUIA 1UF3A 3HVQA 3DW8C 2BQ8X 2JOGA 4V0WA 4JA7A 1OIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HO5 A;  4ORA A;  4O43 A;  3AV0 A;  1II7 A;  1Z2X A;  5DNY A;  3QG5 C;  2NPP C;  4IL1 A;  4Q7F A;  4YKE A;  3THN A;  2NXF A;  2IE3 C;  4O5G A;  5JPF A;  4H2B A;  2HYP A;  1QHW A;  1G5B A;  2KKN A;  4DHL A;  4MP0 A;  3TGH A;  3C9F A;  2BDX A;  1OID A;  2Z06 A;  1T71 A;  4H2I A;  3IVD A;  3JYF A;  4J6O A;  4UT3 B;  3QFO A;  3RL3 A;  1T70 A;  4ZVZ A;  1UTE A;  4TUG A;  2BCD A;  1WAO 1;  4FBK A;  1HPU A;  4O4K A;  3PSO A;  1U32 A;  1OI8 A;  4WWL A;  1JK7 A;  5F3W A;  2GJU A;  5IOH A;  1MF8 A;  4KBP A;  4DT2 A;  1IT6 A;  1HP1 A;  1AUI A;  1S3L A;  3THO B;  2HYO A;  2DFJ A;  2QFP A;  3H63 A;  3QFN A;  3IB7 A;  5GTU A;  4UT3 A;  4MOV A;  4V0X A;  2WDF A;  3DSC A;  1XM7 A;  3E7A A;  3RL4 A;  2Z1A A;  4I5L C;  4B2O A;  2NYL C;  3H67 A;  2P6B A;  2XMO A;  3ICF A;  4DSY A;  4V0V A;  3H60 A;  1TCO A;  3DSD A;  3H62 B;  3QFM A;  4H2G A;  2IE4 C;  1W24 A;  4FCX A;  3P71 C;  4FBQ A;  2QFR A;  2QJC A;  2HY1 A;  2ZBM A;  1S95 A;  1V73 A;  3H68 A;  4LAC C;  3N5U A;  3CK2 A;  2WDC A;  3KBP A;  3PSN A;  2YVT A;  4I5N C;  1KBP A;  5INB A;  4MOY A;  4ZX2 A;  1FJM A;  2O8A A;  5EQV A;  1Z2W A;  5HPE A;  3LL8 A;  4LU9 A;  3FGA C;  5JJT A;  4ORB A;  4XPN A;  5B8I A;  4KKZ A;  4LTY A;  1USH A;  1XZW A;  1S3M A;  4OR9 A;  1S8E A;  3EGG A;  2O8G A;  4NZV A;  1QFC A;  3H61 A;  4HD0 A;  4M0V A;  1NNW A;  4H1Y P;  3QFK A;  5J28 A;  3E7B A;  4H1S A;  1S70 A;  2USH A;  2Q8U A;  4H2F A;  3AUZ A;  3RQZ A;  2NYM C;  3H66 A;  3V4Y A;  4JA9 A;  4F0Z A;  3H69 A;  3T1I A;  5C1V A;  2IAE C;  1SU1 A;  3K7W C;  3EGH A;  1M63 A;  3H64 A;  4UWQ A;  3IB8 A;  2A22 A;  3IVE A;  3RL5 A;  2Z72 A;  4FBW A;  4IYP C;  3ZU0 A;  2CV9 A;  2WDD A;  4G9J A;  3ZTV A;  2AHD A;  4UT2 A;  1WAR A;  3K7V C;  4O24 A;  2R17 A;  1S3N A;  5JPE A;  3GVE A;  2WDE A;  3C5W C;  4ORC A;  4TUI A;  1UF3 A;  3HVQ A;  3DW8 C;  2BQ8 X;  2JOG A;  4V0W A;  4JA7 A;  1OIE A; 
#chains in the Genus database with same CATH topology
 1HO5 A;  4ORA A;  3D03 A;  4O43 A;  3AV0 A;  1II7 A;  1Z2X A;  5DNY A;  3QG5 C;  2NPP C;  4IL1 A;  4Q7F A;  4YKE A;  3THN A;  2NXF A;  2DXL A;  2IE3 C;  4O5G A;  5JPF A;  4H2B A;  2HYP A;  1QHW A;  1G5B A;  2KKN A;  4DHL A;  4MP0 A;  3TGH A;  2ZO9 B;  3C9F A;  2BDX A;  1OID A;  2Z06 A;  1T71 A;  4H2I A;  3IVD A;  3JYF A;  4J6O A;  4UT3 B;  3QFO A;  3RL3 A;  1T70 A;  4ZVZ A;  1UTE A;  4TUG A;  2BCD A;  1WAO 1;  4FBK A;  1HPU A;  4O4K A;  3PSO A;  1U32 A;  1OI8 A;  4WWL A;  1JK7 A;  5F3W A;  2GJU A;  5IOH A;  1MF8 A;  4KBP A;  4DT2 A;  1IT6 A;  1HP1 A;  1AUI A;  1S3L A;  3THO B;  2HYO A;  2DFJ A;  2QFP A;  3H63 A;  3QFN A;  3IB7 A;  5GTU A;  4UT3 A;  3E0J A;  4MOV A;  4V0X A;  2WDF A;  3DSC A;  1XM7 A;  3E7A A;  3RL4 A;  2Z1A A;  4I5L C;  4B2O A;  2NYL C;  3H67 A;  2P6B A;  2XMO A;  3ICF A;  4DSY A;  4V0V A;  3H60 A;  1TCO A;  3DSD A;  3H62 B;  3QFM A;  4H2G A;  2IE4 C;  1W24 A;  4FCX A;  3P71 C;  4FBQ A;  3FLO A;  2QFR A;  2QJC A;  2HY1 A;  2ZBM A;  1S95 A;  1V73 A;  3H68 A;  2YEQ A;  4LAC C;  3N5U A;  3CK2 A;  2WDC A;  3KBP A;  3PSN A;  2YVT A;  4I5N C;  1KBP A;  5INB A;  4MOY A;  4ZX2 A;  1FJM A;  2O8A A;  5EQV A;  2ZOA A;  1Z2W A;  5HPE A;  3LL8 A;  4LU9 A;  3FGA C;  5JJT A;  4ORB A;  4XPN A;  5B8I A;  4KKZ A;  4LTY A;  1USH A;  1XZW A;  1S3M A;  4OR9 A;  1S8E A;  3EGG A;  2O8G A;  4NZV A;  1QFC A;  3H61 A;  4HD0 A;  4M0V A;  1NNW A;  4H1Y P;  3QFK A;  5J28 A;  3E7B A;  4H1S A;  1S70 A;  2USH A;  2Q8U A;  4H2F A;  3AUZ A;  3RQZ A;  2NYM C;  3H66 A;  3V4Y A;  4JA9 A;  4F0Z A;  3H69 A;  3T1I A;  5C1V A;  2IAE C;  1SU1 A;  3K7W C;  3EGH A;  1M63 A;  3H64 A;  4UWQ A;  3IB8 A;  2A22 A;  3IVE A;  3RL5 A;  2Z72 A;  4FBW A;  4IYP C;  3ZU0 A;  2CV9 A;  2WDD A;  4G9J A;  3ZTV A;  2AHD A;  4UT2 A;  2DXN A;  1WAR A;  3K7V C;  4O24 A;  2R17 A;  1S3N A;  5JPE A;  3GVE A;  2WDE A;  3C5W C;  4ORC A;  4TUI A;  1UF3 A;  3HVQ A;  3DW8 C;  2BQ8 X;  2JOG A;  4V0W A;  4JA7 A;  1OIE A; 
#chains in the Genus database with same CATH homology
 1HO5 A;  4ORA A;  3D03 A;  4O43 A;  3AV0 A;  1II7 A;  1Z2X A;  5DNY A;  3QG5 C;  2NPP C;  4IL1 A;  4Q7F A;  4YKE A;  3THN A;  2NXF A;  2DXL A;  2IE3 C;  4O5G A;  5JPF A;  4H2B A;  2HYP A;  1QHW A;  1G5B A;  2KKN A;  4DHL A;  4MP0 A;  3TGH A;  2ZO9 B;  3C9F A;  2BDX A;  1OID A;  2Z06 A;  1T71 A;  4H2I A;  3IVD A;  3JYF A;  4J6O A;  4UT3 B;  3QFO A;  3RL3 A;  1T70 A;  4ZVZ A;  1UTE A;  4TUG A;  2BCD A;  1WAO 1;  4FBK A;  1HPU A;  4O4K A;  3PSO A;  1U32 A;  1OI8 A;  4WWL A;  1JK7 A;  5F3W A;  2GJU A;  5IOH A;  1MF8 A;  4KBP A;  4DT2 A;  1IT6 A;  1HP1 A;  1AUI A;  1S3L A;  3THO B;  2HYO A;  2DFJ A;  2QFP A;  3H63 A;  3QFN A;  3IB7 A;  5GTU A;  4UT3 A;  3E0J A;  4MOV A;  4V0X A;  2WDF A;  3DSC A;  1XM7 A;  3E7A A;  3RL4 A;  2Z1A A;  4I5L C;  4B2O A;  2NYL C;  3H67 A;  2P6B A;  2XMO A;  3ICF A;  4DSY A;  4V0V A;  3H60 A;  1TCO A;  3DSD A;  3H62 B;  3QFM A;  4H2G A;  2IE4 C;  1W24 A;  4FCX A;  3P71 C;  4FBQ A;  3FLO A;  2QFR A;  2QJC A;  2HY1 A;  2ZBM A;  1S95 A;  1V73 A;  3H68 A;  2YEQ A;  4LAC C;  3N5U A;  3CK2 A;  2WDC A;  3KBP A;  3PSN A;  2YVT A;  4I5N C;  1KBP A;  5INB A;  4MOY A;  4ZX2 A;  1FJM A;  2O8A A;  5EQV A;  2ZOA A;  1Z2W A;  5HPE A;  3LL8 A;  4LU9 A;  3FGA C;  5JJT A;  4ORB A;  4XPN A;  5B8I A;  4KKZ A;  4LTY A;  1USH A;  1XZW A;  1S3M A;  4OR9 A;  1S8E A;  3EGG A;  2O8G A;  4NZV A;  1QFC A;  3H61 A;  4HD0 A;  4M0V A;  1NNW A;  4H1Y P;  3QFK A;  5J28 A;  3E7B A;  4H1S A;  1S70 A;  2USH A;  2Q8U A;  4H2F A;  3AUZ A;  3RQZ A;  2NYM C;  3H66 A;  3V4Y A;  4JA9 A;  4F0Z A;  3H69 A;  3T1I A;  5C1V A;  2IAE C;  1SU1 A;  3K7W C;  3EGH A;  1M63 A;  3H64 A;  4UWQ A;  3IB8 A;  2A22 A;  3IVE A;  3RL5 A;  2Z72 A;  4FBW A;  4IYP C;  3ZU0 A;  2CV9 A;  2WDD A;  4G9J A;  3ZTV A;  2AHD A;  4UT2 A;  2DXN A;  1WAR A;  3K7V C;  4O24 A;  2R17 A;  1S3N A;  5JPE A;  3GVE A;  2WDE A;  3C5W C;  4ORC A;  4TUI A;  1UF3 A;  3HVQ A;  3DW8 C;  2BQ8 X;  2JOG A;  4V0W A;  4JA7 A;  1OIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...