5J28A

Ki67-pp1g (protein phosphatase 1, gamma isoform) holoenzyme complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
publication title The Ki-67 and RepoMan mitotic phosphatases assemble via an identical, yet novel mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 106
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5j28A00
2Z06A 1U32A 5C1VA 4OR9A 2XMOA 5INBA 4FBWA 3ZU0A 3IB7A 4O43A 3QFNA 2USHA 1QFCA 4FBKA 2O8GA 4JA9A 3H67A 3FGAC 2A22A 2Z72A 5JPFA 3H69A 1M63A 4KBPA 4H2FA 4UWQA 2WDEA 3RL5A 2HYPA 4Q7FA 4H2GA 3EGHA 3C5WC 4ORAA 5JPEA 4FCXA 4DHLA 1NNWA 3RL3A 1IT6A 3QFKA 3THNA 5JJTA 4G9JA 4DT2A 1OIEA 4ORCA 3AUZA 3ICFA 4TUGA 3K7VC 1S3LA 1JK7A 4F0ZA 4MOVA 2NXFA 1QHWA 2Z1AA 2JOGA 5GTUA 2WDDA 4MP0A 3DSDA 1W24A 4ORBA 2ZBMA 4H1SA 3QG5C 2IAEC 3DSCA 1S3NA 4H1YP 2DFJA 4LTYA 4IYPC 4LU9A 3PSNA 3AV0A 3H64A 3QFOA 4H2BA 4DSYA 1WARA 1HPUA 1Z2WA 3PSOA 4LACC 1KBPA 4XPNA 3N5UA 3RQZA 1S70A 3T1IA 2BCDA 4NZVA 4I5NC 2IE3C 3H68A 4UT2A 3K7WC 3H66A 1Z2XA 3JYFA 2CV9A 1T70A 3H61A 2QFRA 1AUIA 3QFMA 4FBQA 4YKEA 5B8IA 3H62B 2HY1A 4KKZA 1HP1A 2NYMC 2WDFA 1S95A 3KBPA 4H2IA 3TGHA 3H63A 3LL8A 4UT3A 3P71C 3IB8A 1WAO1 1OI8A 2HYOA 2NPPC 3GVEA 4V0WA 5IOHA 1XZWA 1SU1A 1UF3A 1V73A 1UTEA 3HVQA 4O5GA 1OIDA 3IVEA 4I5LC 4O4KA 4J6OA 1FJMA 1T71A 3ZTVA 4HD0A 4ZVZA 2WDCA 1S8EA 2QFPA 2BQ8X 3C9FA 3EGGA 4B2OA 2R17A 1MF8A 3RL4A 3IVDA 4MOYA 3THOB 2AHDA 2BDXA 4WWLA 4ZX2A 1TCOA 1G5BA 5J28A 4V0VA 1HO5A 4O24A 2P6BA 3CK2A 1S3MA 1USHA 1XM7A 5HPEA 2KKNA 5F3WA 4V0XA 2NYLC 2O8AA 2Q8UA 3E7AA 3V4YA 4UT3B 2YVTA 2QJCA 3H60A 4IL1A 1II7A 4TUIA 2IE4C 2GJUA 3E7BA 5EQVA 4M0VA 4JA7A 3DW8C 5DNYA
chains in the Genus database with same CATH superfamily
2Z06A 1U32A 5C1VA 4OR9A 3FLOA 2XMOA 5INBA 4FBWA 3ZU0A 3IB7A 4O43A 3QFNA 2USHA 1QFCA 4FBKA 2O8GA 4JA9A 3D03A 3H67A 3FGAC 2A22A 2Z72A 5JPFA 3H69A 1M63A 4KBPA 4H2FA 4UWQA 2WDEA 3RL5A 2HYPA 4Q7FA 4H2GA 3EGHA 3C5WC 4ORAA 5JPEA 4FCXA 4DHLA 1NNWA 3RL3A 2YEQA 1IT6A 3QFKA 2ZO9B 3THNA 5JJTA 4G9JA 4DT2A 1OIEA 4ORCA 3AUZA 3ICFA 4TUGA 3K7VC 1S3LA 1JK7A 4F0ZA 4MOVA 2NXFA 1QHWA 2Z1AA 2JOGA 5GTUA 2WDDA 4MP0A 3DSDA 1W24A 4ORBA 2ZBMA 4H1SA 3QG5C 2IAEC 3DSCA 1S3NA 4H1YP 2DFJA 4LTYA 4IYPC 4LU9A 3PSNA 3AV0A 3H64A 3QFOA 4H2BA 4DSYA 1WARA 1HPUA 1Z2WA 3PSOA 4LACC 1KBPA 4XPNA 3N5UA 3RQZA 1S70A 3T1IA 2BCDA 4NZVA 4I5NC 2IE3C 3H68A 4UT2A 3K7WC 3H66A 1Z2XA 3JYFA 2CV9A 1T70A 3H61A 2QFRA 1AUIA 3QFMA 4FBQA 2DXLA 4YKEA 5B8IA 3H62B 2HY1A 4KKZA 1HP1A 2NYMC 2WDFA 1S95A 3KBPA 4H2IA 3TGHA 2ZOAA 3H63A 3LL8A 4UT3A 3P71C 3IB8A 1WAO1 1OI8A 2HYOA 2NPPC 3E0JA 3GVEA 4V0WA 5IOHA 1XZWA 1SU1A 1UF3A 1V73A 1UTEA 3HVQA 4O5GA 1OIDA 3IVEA 4I5LC 4O4KA 4J6OA 1FJMA 1T71A 3ZTVA 4HD0A 4ZVZA 2WDCA 1S8EA 2QFPA 2BQ8X 3C9FA 3EGGA 4B2OA 2R17A 1MF8A 3RL4A 3IVDA 4MOYA 3THOB 2AHDA 2BDXA 4WWLA 4ZX2A 1TCOA 1G5BA 5J28A 4V0VA 1HO5A 4O24A 2P6BA 3CK2A 1S3MA 1USHA 1XM7A 5HPEA 2KKNA 5F3WA 4V0XA 2NYLC 2O8AA 2Q8UA 3E7AA 3V4YA 4UT3B 2QJCA 2YVTA 3H60A 4IL1A 1II7A 4TUIA 2IE4C 2GJUA 3E7BA 5EQVA 4M0VA 2DXNA 4JA7A 3DW8C 5DNYA
chains in the Genus database with same CATH topology
2Z06A 1U32A 5C1VA 4OR9A 3FLOA 2XMOA 5INBA 4FBWA 3ZU0A 3IB7A 4O43A 3QFNA 2USHA 1QFCA 4FBKA 2O8GA 4JA9A 3D03A 3H67A 3FGAC 2A22A 2Z72A 5JPFA 3H69A 1M63A 4KBPA 4H2FA 4UWQA 2WDEA 3RL5A 2HYPA 4Q7FA 4H2GA 3EGHA 3C5WC 4ORAA 5JPEA 4FCXA 4DHLA 1NNWA 3RL3A 2YEQA 1IT6A 3QFKA 2ZO9B 3THNA 5JJTA 4G9JA 4DT2A 1OIEA 4ORCA 3AUZA 3ICFA 4TUGA 3K7VC 1S3LA 1JK7A 4F0ZA 4MOVA 2NXFA 1QHWA 2Z1AA 2JOGA 5GTUA 2WDDA 4MP0A 3DSDA 1W24A 4ORBA 2ZBMA 4H1SA 3QG5C 2IAEC 3DSCA 1S3NA 4H1YP 2DFJA 4LTYA 4IYPC 4LU9A 3PSNA 3AV0A 3H64A 3QFOA 4H2BA 4DSYA 1WARA 1HPUA 1Z2WA 3PSOA 4LACC 1KBPA 4XPNA 3N5UA 3RQZA 1S70A 3T1IA 2BCDA 4NZVA 4I5NC 2IE3C 3H68A 4UT2A 3K7WC 3H66A 1Z2XA 3JYFA 2CV9A 1T70A 3H61A 2QFRA 1AUIA 3QFMA 4FBQA 2DXLA 4YKEA 5B8IA 3H62B 2HY1A 4KKZA 1HP1A 2NYMC 2WDFA 1S95A 3KBPA 4H2IA 3TGHA 2ZOAA 3H63A 3LL8A 4UT3A 3P71C 3IB8A 1WAO1 1OI8A 2HYOA 2NPPC 3E0JA 3GVEA 4V0WA 5IOHA 1XZWA 1SU1A 1UF3A 1V73A 1UTEA 3HVQA 4O5GA 1OIDA 3IVEA 4I5LC 4O4KA 4J6OA 1FJMA 1T71A 3ZTVA 4HD0A 4ZVZA 2WDCA 1S8EA 2QFPA 2BQ8X 3C9FA 3EGGA 4B2OA 2R17A 1MF8A 3RL4A 3IVDA 4MOYA 3THOB 2AHDA 2BDXA 4WWLA 4ZX2A 1TCOA 1G5BA 5J28A 4V0VA 1HO5A 4O24A 2P6BA 3CK2A 1S3MA 1USHA 1XM7A 5HPEA 2KKNA 5F3WA 4V0XA 2NYLC 2O8AA 2Q8UA 3E7AA 3V4YA 4UT3B 2QJCA 2YVTA 3H60A 4IL1A 1II7A 4TUIA 2IE4C 2GJUA 3E7BA 5EQVA 4M0VA 2DXNA 4JA7A 3DW8C 5DNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z06 A;  1U32 A;  5C1V A;  4OR9 A;  2XMO A;  5INB A;  4FBW A;  3ZU0 A;  3IB7 A;  4O43 A;  3QFN A;  2USH A;  1QFC A;  4FBK A;  2O8G A;  4JA9 A;  3H67 A;  3FGA C;  2A22 A;  2Z72 A;  5JPF A;  3H69 A;  1M63 A;  4KBP A;  4H2F A;  4UWQ A;  2WDE A;  3RL5 A;  2HYP A;  4Q7F A;  4H2G A;  3EGH A;  3C5W C;  4ORA A;  5JPE A;  4FCX A;  4DHL A;  1NNW A;  3RL3 A;  1IT6 A;  3QFK A;  3THN A;  5JJT A;  4G9J A;  4DT2 A;  1OIE A;  4ORC A;  3AUZ A;  3ICF A;  4TUG A;  3K7V C;  1S3L A;  1JK7 A;  4F0Z A;  4MOV A;  2NXF A;  1QHW A;  2Z1A A;  2JOG A;  5GTU A;  2WDD A;  4MP0 A;  3DSD A;  1W24 A;  4ORB A;  2ZBM A;  4H1S A;  3QG5 C;  2IAE C;  3DSC A;  1S3N A;  4H1Y P;  2DFJ A;  4LTY A;  4IYP C;  4LU9 A;  3PSN A;  3AV0 A;  3H64 A;  3QFO A;  4H2B A;  4DSY A;  1WAR A;  1HPU A;  1Z2W A;  3PSO A;  4LAC C;  1KBP A;  4XPN A;  3N5U A;  3RQZ A;  1S70 A;  3T1I A;  2BCD A;  4NZV A;  4I5N C;  2IE3 C;  3H68 A;  4UT2 A;  3K7W C;  3H66 A;  1Z2X A;  3JYF A;  2CV9 A;  1T70 A;  3H61 A;  2QFR A;  1AUI A;  3QFM A;  4FBQ A;  4YKE A;  5B8I A;  3H62 B;  2HY1 A;  4KKZ A;  1HP1 A;  2NYM C;  2WDF A;  1S95 A;  3KBP A;  4H2I A;  3TGH A;  3H63 A;  3LL8 A;  4UT3 A;  3P71 C;  3IB8 A;  1WAO 1;  1OI8 A;  2HYO A;  2NPP C;  3GVE A;  4V0W A;  5IOH A;  1XZW A;  1SU1 A;  1UF3 A;  1V73 A;  1UTE A;  3HVQ A;  4O5G A;  1OID A;  3IVE A;  4I5L C;  4O4K A;  4J6O A;  1FJM A;  1T71 A;  3ZTV A;  4HD0 A;  4ZVZ A;  2WDC A;  1S8E A;  2QFP A;  2BQ8 X;  3C9F A;  3EGG A;  4B2O A;  2R17 A;  1MF8 A;  3RL4 A;  3IVD A;  4MOY A;  3THO B;  2AHD A;  2BDX A;  4WWL A;  4ZX2 A;  1TCO A;  1G5B A;  5J28 A;  4V0V A;  1HO5 A;  4O24 A;  2P6B A;  3CK2 A;  1S3M A;  1USH A;  1XM7 A;  5HPE A;  2KKN A;  5F3W A;  4V0X A;  2NYL C;  2O8A A;  2Q8U A;  3E7A A;  3V4Y A;  4UT3 B;  2YVT A;  2QJC A;  3H60 A;  4IL1 A;  1II7 A;  4TUI A;  2IE4 C;  2GJU A;  3E7B A;  5EQV A;  4M0V A;  4JA7 A;  3DW8 C;  5DNY A; 
#chains in the Genus database with same CATH topology
 2Z06 A;  1U32 A;  5C1V A;  4OR9 A;  3FLO A;  2XMO A;  5INB A;  4FBW A;  3ZU0 A;  3IB7 A;  4O43 A;  3QFN A;  2USH A;  1QFC A;  4FBK A;  2O8G A;  4JA9 A;  3D03 A;  3H67 A;  3FGA C;  2A22 A;  2Z72 A;  5JPF A;  3H69 A;  1M63 A;  4KBP A;  4H2F A;  4UWQ A;  2WDE A;  3RL5 A;  2HYP A;  4Q7F A;  4H2G A;  3EGH A;  3C5W C;  4ORA A;  5JPE A;  4FCX A;  4DHL A;  1NNW A;  3RL3 A;  2YEQ A;  1IT6 A;  3QFK A;  2ZO9 B;  3THN A;  5JJT A;  4G9J A;  4DT2 A;  1OIE A;  4ORC A;  3AUZ A;  3ICF A;  4TUG A;  3K7V C;  1S3L A;  1JK7 A;  4F0Z A;  4MOV A;  2NXF A;  1QHW A;  2Z1A A;  2JOG A;  5GTU A;  2WDD A;  4MP0 A;  3DSD A;  1W24 A;  4ORB A;  2ZBM A;  4H1S A;  3QG5 C;  2IAE C;  3DSC A;  1S3N A;  4H1Y P;  2DFJ A;  4LTY A;  4IYP C;  4LU9 A;  3PSN A;  3AV0 A;  3H64 A;  3QFO A;  4H2B A;  4DSY A;  1WAR A;  1HPU A;  1Z2W A;  3PSO A;  4LAC C;  1KBP A;  4XPN A;  3N5U A;  3RQZ A;  1S70 A;  3T1I A;  2BCD A;  4NZV A;  4I5N C;  2IE3 C;  3H68 A;  4UT2 A;  3K7W C;  3H66 A;  1Z2X A;  3JYF A;  2CV9 A;  1T70 A;  3H61 A;  2QFR A;  1AUI A;  3QFM A;  4FBQ A;  2DXL A;  4YKE A;  5B8I A;  3H62 B;  2HY1 A;  4KKZ A;  1HP1 A;  2NYM C;  2WDF A;  1S95 A;  3KBP A;  4H2I A;  3TGH A;  2ZOA A;  3H63 A;  3LL8 A;  4UT3 A;  3P71 C;  3IB8 A;  1WAO 1;  1OI8 A;  2HYO A;  2NPP C;  3E0J A;  3GVE A;  4V0W A;  5IOH A;  1XZW A;  1SU1 A;  1UF3 A;  1V73 A;  1UTE A;  3HVQ A;  4O5G A;  1OID A;  3IVE A;  4I5L C;  4O4K A;  4J6O A;  1FJM A;  1T71 A;  3ZTV A;  4HD0 A;  4ZVZ A;  2WDC A;  1S8E A;  2QFP A;  2BQ8 X;  3C9F A;  3EGG A;  4B2O A;  2R17 A;  1MF8 A;  3RL4 A;  3IVD A;  4MOY A;  3THO B;  2AHD A;  2BDX A;  4WWL A;  4ZX2 A;  1TCO A;  1G5B A;  5J28 A;  4V0V A;  1HO5 A;  4O24 A;  2P6B A;  3CK2 A;  1S3M A;  1USH A;  1XM7 A;  5HPE A;  2KKN A;  5F3W A;  4V0X A;  2NYL C;  2O8A A;  2Q8U A;  3E7A A;  3V4Y A;  4UT3 B;  2QJC A;  2YVT A;  3H60 A;  4IL1 A;  1II7 A;  4TUI A;  2IE4 C;  2GJU A;  3E7B A;  5EQV A;  4M0V A;  2DXN A;  4JA7 A;  3DW8 C;  5DNY A; 
#chains in the Genus database with same CATH homology
 2Z06 A;  1U32 A;  5C1V A;  4OR9 A;  3FLO A;  2XMO A;  5INB A;  4FBW A;  3ZU0 A;  3IB7 A;  4O43 A;  3QFN A;  2USH A;  1QFC A;  4FBK A;  2O8G A;  4JA9 A;  3D03 A;  3H67 A;  3FGA C;  2A22 A;  2Z72 A;  5JPF A;  3H69 A;  1M63 A;  4KBP A;  4H2F A;  4UWQ A;  2WDE A;  3RL5 A;  2HYP A;  4Q7F A;  4H2G A;  3EGH A;  3C5W C;  4ORA A;  5JPE A;  4FCX A;  4DHL A;  1NNW A;  3RL3 A;  2YEQ A;  1IT6 A;  3QFK A;  2ZO9 B;  3THN A;  5JJT A;  4G9J A;  4DT2 A;  1OIE A;  4ORC A;  3AUZ A;  3ICF A;  4TUG A;  3K7V C;  1S3L A;  1JK7 A;  4F0Z A;  4MOV A;  2NXF A;  1QHW A;  2Z1A A;  2JOG A;  5GTU A;  2WDD A;  4MP0 A;  3DSD A;  1W24 A;  4ORB A;  2ZBM A;  4H1S A;  3QG5 C;  2IAE C;  3DSC A;  1S3N A;  4H1Y P;  2DFJ A;  4LTY A;  4IYP C;  4LU9 A;  3PSN A;  3AV0 A;  3H64 A;  3QFO A;  4H2B A;  4DSY A;  1WAR A;  1HPU A;  1Z2W A;  3PSO A;  4LAC C;  1KBP A;  4XPN A;  3N5U A;  3RQZ A;  1S70 A;  3T1I A;  2BCD A;  4NZV A;  4I5N C;  2IE3 C;  3H68 A;  4UT2 A;  3K7W C;  3H66 A;  1Z2X A;  3JYF A;  2CV9 A;  1T70 A;  3H61 A;  2QFR A;  1AUI A;  3QFM A;  4FBQ A;  2DXL A;  4YKE A;  5B8I A;  3H62 B;  2HY1 A;  4KKZ A;  1HP1 A;  2NYM C;  2WDF A;  1S95 A;  3KBP A;  4H2I A;  3TGH A;  2ZOA A;  3H63 A;  3LL8 A;  4UT3 A;  3P71 C;  3IB8 A;  1WAO 1;  1OI8 A;  2HYO A;  2NPP C;  3E0J A;  3GVE A;  4V0W A;  5IOH A;  1XZW A;  1SU1 A;  1UF3 A;  1V73 A;  1UTE A;  3HVQ A;  4O5G A;  1OID A;  3IVE A;  4I5L C;  4O4K A;  4J6O A;  1FJM A;  1T71 A;  3ZTV A;  4HD0 A;  4ZVZ A;  2WDC A;  1S8E A;  2QFP A;  2BQ8 X;  3C9F A;  3EGG A;  4B2O A;  2R17 A;  1MF8 A;  3RL4 A;  3IVD A;  4MOY A;  3THO B;  2AHD A;  2BDX A;  4WWL A;  4ZX2 A;  1TCO A;  1G5B A;  5J28 A;  4V0V A;  1HO5 A;  4O24 A;  2P6B A;  3CK2 A;  1S3M A;  1USH A;  1XM7 A;  5HPE A;  2KKN A;  5F3W A;  4V0X A;  2NYL C;  2O8A A;  2Q8U A;  3E7A A;  3V4Y A;  4UT3 B;  2QJC A;  2YVT A;  3H60 A;  4IL1 A;  1II7 A;  4TUI A;  2IE4 C;  2GJU A;  3E7B A;  5EQV A;  4M0V A;  2DXN A;  4JA7 A;  3DW8 C;  5DNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...