5J28A

Ki67-pp1g (protein phosphatase 1, gamma isoform) holoenzyme complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ki-67 and RepoMan mitotic phosphatases assemble via an identical, yet novel mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
total genus 106
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5j28A00
4XPNA 4O24A 2USHA 3K7VC 4B2OA 1MF8A 1UTEA 1XM7A 2WDDA 4DT2A 2WDEA 2NYLC 2AHDA 3QG5C 1OIDA 1U32A 3DW8C 2WDCA 2HYPA 4DSYA 3H69A 5JPEA 1USHA 4F0ZA 3ZU0A 4UT2A 4ORCA 3RL4A 5HPEA 1S3NA 4LACC 4I5NC 3N5UA 4M0VA 1S95A 4ORAA 4UWQA 3QFNA 3RL3A 3EGHA 5J28A 4IL1A 2IAEC 2O8AA 2NPPC 1WAO1 5INBA 1QHWA 4ORBA 3K7WC 1IT6A 3H62B 1OI8A 3IVDA 4MOYA 1Z2WA 4OR9A 4JA9A 4J6OA 2ZBMA 4LTYA 1NNWA 4ZVZA 1HPUA 1QFCA 3AUZA 5IOHA 2A22A 4V0VA 1S8EA 2JOGA 1W24A 4LU9A 3GVEA 4ZX2A 3HVQA 3PSOA 1SU1A 1M63A 3IVEA 3DSDA 5C1VA 2P6BA 1XZWA 3FGAC 4MP0A 4KKZA 4DHLA 2HYOA 3DSCA 4MOVA 3E7BA 1HP1A 3QFKA 3RQZA 1KBPA 3H66A 1S3MA 1UF3A 3LL8A 2BQ8X 2Q8UA 3H68A 2KKNA 1G5BA 4TUIA 2XMOA 1FJMA 3C5WC 3ICFA 1II7A 4H1YP 2QFPA 2IE4C 2QJCA 3RL5A 3V4YA 3KBPA 4FBKA 4V0WA 1V73A 1S3LA 1Z2XA 4O4KA 3ZTVA 2Z1AA 3H61A 2NXFA 3H63A 4YKEA 1T70A 2R17A 2Z06A 4UT3A 2GJUA 2HY1A 5DNYA 1T71A 5GTUA 3T1IA 2IE3C 3IB7A 4H2BA 1JK7A 5EQVA 5F3WA 1AUIA 4O5GA 4TUGA 3CK2A 3H64A 4H1SA 4NZVA 4G9JA 2BCDA 2Z72A 3EGGA 4FBWA 2CV9A 4WWLA 2DFJA 3THNA 4IYPC 5B8IA 4FCXA 4UT3B 1S70A 3H60A 2WDFA 4HD0A 1TCOA 1OIEA 4H2FA 3H67A 1HO5A 4V0XA 3TGHA 5JJTA 3JYFA 3THOB 3QFMA 4FBQA 3C9FA 3PSNA 3AV0A 2YVTA 3P71C 2NYMC 3QFOA 4I5LC 2QFRA 4O43A 4KBPA 4H2IA 2O8GA 1WARA 2BDXA 3IB8A 5JPFA 3E7AA 4JA7A 4Q7FA 4H2GA
chains in the Genus database with same CATH superfamily
4XPNA 4O24A 2USHA 3K7VC 4B2OA 1MF8A 1UTEA 1XM7A 2WDDA 4DT2A 2WDEA 2NYLC 2AHDA 3QG5C 1OIDA 1U32A 3DW8C 2WDCA 2HYPA 4DSYA 3H69A 5JPEA 1USHA 4F0ZA 3ZU0A 4UT2A 4ORCA 3RL4A 5HPEA 1S3NA 4LACC 4I5NC 3N5UA 4M0VA 1S95A 4ORAA 4UWQA 3QFNA 3RL3A 3EGHA 5J28A 4IL1A 2IAEC 2O8AA 2ZOAA 2NPPC 1WAO1 2YEQA 5INBA 1QHWA 4ORBA 3K7WC 1IT6A 3H62B 1OI8A 3IVDA 4MOYA 1Z2WA 4OR9A 4JA9A 4J6OA 2ZBMA 4LTYA 1NNWA 4ZVZA 1HPUA 1QFCA 3AUZA 5IOHA 2A22A 4V0VA 1S8EA 2JOGA 1W24A 4LU9A 3GVEA 2ZO9B 4ZX2A 3HVQA 3PSOA 1SU1A 1M63A 2DXNA 3IVEA 3DSDA 5C1VA 2P6BA 1XZWA 3FGAC 4MP0A 4KKZA 4DHLA 2HYOA 3DSCA 4MOVA 3E7BA 1HP1A 3QFKA 3RQZA 1KBPA 3H66A 1S3MA 1UF3A 3LL8A 2BQ8X 2Q8UA 3FLOA 3H68A 2KKNA 1G5BA 4TUIA 2XMOA 3E0JA 1FJMA 3C5WC 3ICFA 1II7A 4H1YP 2QFPA 2IE4C 2QJCA 3RL5A 3V4YA 3KBPA 4FBKA 4V0WA 1V73A 1S3LA 1Z2XA 4O4KA 3ZTVA 2Z1AA 3H61A 2NXFA 3H63A 4YKEA 1T70A 2R17A 2Z06A 4UT3A 2GJUA 2HY1A 5DNYA 1T71A 5GTUA 3T1IA 2IE3C 3IB7A 4H2BA 1JK7A 5EQVA 5F3WA 1AUIA 4O5GA 4TUGA 3CK2A 3H64A 4H1SA 4NZVA 4G9JA 2BCDA 2Z72A 3EGGA 4FBWA 2CV9A 4WWLA 2DFJA 3THNA 4IYPC 5B8IA 4FCXA 4UT3B 1S70A 3H60A 2WDFA 4HD0A 1TCOA 1OIEA 4H2FA 3H67A 1HO5A 4V0XA 3TGHA 2DXLA 5JJTA 3JYFA 3THOB 3QFMA 4FBQA 3C9FA 3PSNA 3AV0A 2YVTA 3P71C 2NYMC 3QFOA 4I5LC 2QFRA 4O43A 3D03A 4KBPA 4H2IA 2O8GA 1WARA 2BDXA 3IB8A 5JPFA 3E7AA 4JA7A 4Q7FA 4H2GA
chains in the Genus database with same CATH topology
4XPNA 4O24A 2USHA 3K7VC 4B2OA 1MF8A 1UTEA 1XM7A 2WDDA 4DT2A 2WDEA 2NYLC 2AHDA 3QG5C 1OIDA 1U32A 3DW8C 2WDCA 2HYPA 4DSYA 3H69A 5JPEA 1USHA 4F0ZA 3ZU0A 4UT2A 4ORCA 3RL4A 5HPEA 1S3NA 4LACC 4I5NC 3N5UA 4M0VA 1S95A 4ORAA 4UWQA 3QFNA 3RL3A 3EGHA 5J28A 4IL1A 2IAEC 2O8AA 2ZOAA 2NPPC 1WAO1 2YEQA 5INBA 1QHWA 4ORBA 3K7WC 1IT6A 3H62B 1OI8A 3IVDA 4MOYA 1Z2WA 4OR9A 4JA9A 4J6OA 2ZBMA 4LTYA 1NNWA 4ZVZA 1HPUA 1QFCA 3AUZA 5IOHA 2A22A 4V0VA 1S8EA 2JOGA 1W24A 4LU9A 3GVEA 2ZO9B 4ZX2A 3HVQA 3PSOA 1SU1A 1M63A 2DXNA 3IVEA 3DSDA 5C1VA 2P6BA 1XZWA 3FGAC 4MP0A 4KKZA 4DHLA 2HYOA 3DSCA 4MOVA 3E7BA 1HP1A 3QFKA 3RQZA 1KBPA 3H66A 1S3MA 1UF3A 3LL8A 2BQ8X 2Q8UA 3FLOA 3H68A 2KKNA 1G5BA 4TUIA 2XMOA 3E0JA 1FJMA 3C5WC 3ICFA 1II7A 4H1YP 2QFPA 2IE4C 2QJCA 3RL5A 3V4YA 3KBPA 4FBKA 4V0WA 1V73A 1S3LA 1Z2XA 4O4KA 3ZTVA 2Z1AA 3H61A 2NXFA 3H63A 4YKEA 1T70A 2R17A 2Z06A 4UT3A 2GJUA 2HY1A 5DNYA 1T71A 5GTUA 3T1IA 2IE3C 3IB7A 4H2BA 1JK7A 5EQVA 5F3WA 1AUIA 4O5GA 4TUGA 3CK2A 3H64A 4H1SA 4NZVA 4G9JA 2BCDA 2Z72A 3EGGA 4FBWA 2CV9A 4WWLA 2DFJA 3THNA 4IYPC 5B8IA 4FCXA 4UT3B 1S70A 3H60A 2WDFA 4HD0A 1TCOA 1OIEA 4H2FA 3H67A 1HO5A 4V0XA 3TGHA 2DXLA 5JJTA 3JYFA 3THOB 3QFMA 4FBQA 3C9FA 3PSNA 3AV0A 2YVTA 3P71C 2NYMC 3QFOA 4I5LC 2QFRA 4O43A 3D03A 4KBPA 4H2IA 2O8GA 1WARA 2BDXA 3IB8A 5JPFA 3E7AA 4JA7A 4Q7FA 4H2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPN A;  4O24 A;  2USH A;  3K7V C;  4B2O A;  1MF8 A;  1UTE A;  1XM7 A;  2WDD A;  4DT2 A;  2WDE A;  2NYL C;  2AHD A;  3QG5 C;  1OID A;  1U32 A;  3DW8 C;  2WDC A;  2HYP A;  4DSY A;  3H69 A;  5JPE A;  1USH A;  4F0Z A;  3ZU0 A;  4UT2 A;  4ORC A;  3RL4 A;  5HPE A;  1S3N A;  4LAC C;  4I5N C;  3N5U A;  4M0V A;  1S95 A;  4ORA A;  4UWQ A;  3QFN A;  3RL3 A;  3EGH A;  5J28 A;  4IL1 A;  2IAE C;  2O8A A;  2NPP C;  1WAO 1;  5INB A;  1QHW A;  4ORB A;  3K7W C;  1IT6 A;  3H62 B;  1OI8 A;  3IVD A;  4MOY A;  1Z2W A;  4OR9 A;  4JA9 A;  4J6O A;  2ZBM A;  4LTY A;  1NNW A;  4ZVZ A;  1HPU A;  1QFC A;  3AUZ A;  5IOH A;  2A22 A;  4V0V A;  1S8E A;  2JOG A;  1W24 A;  4LU9 A;  3GVE A;  4ZX2 A;  3HVQ A;  3PSO A;  1SU1 A;  1M63 A;  3IVE A;  3DSD A;  5C1V A;  2P6B A;  1XZW A;  3FGA C;  4MP0 A;  4KKZ A;  4DHL A;  2HYO A;  3DSC A;  4MOV A;  3E7B A;  1HP1 A;  3QFK A;  3RQZ A;  1KBP A;  3H66 A;  1S3M A;  1UF3 A;  3LL8 A;  2BQ8 X;  2Q8U A;  3H68 A;  2KKN A;  1G5B A;  4TUI A;  2XMO A;  1FJM A;  3C5W C;  3ICF A;  1II7 A;  4H1Y P;  2QFP A;  2IE4 C;  2QJC A;  3RL5 A;  3V4Y A;  3KBP A;  4FBK A;  4V0W A;  1V73 A;  1S3L A;  1Z2X A;  4O4K A;  3ZTV A;  2Z1A A;  3H61 A;  2NXF A;  3H63 A;  4YKE A;  1T70 A;  2R17 A;  2Z06 A;  4UT3 A;  2GJU A;  2HY1 A;  5DNY A;  1T71 A;  5GTU A;  3T1I A;  2IE3 C;  3IB7 A;  4H2B A;  1JK7 A;  5EQV A;  5F3W A;  1AUI A;  4O5G A;  4TUG A;  3CK2 A;  3H64 A;  4H1S A;  4NZV A;  4G9J A;  2BCD A;  2Z72 A;  3EGG A;  4FBW A;  2CV9 A;  4WWL A;  2DFJ A;  3THN A;  4IYP C;  5B8I A;  4FCX A;  4UT3 B;  1S70 A;  3H60 A;  2WDF A;  4HD0 A;  1TCO A;  1OIE A;  4H2F A;  3H67 A;  1HO5 A;  4V0X A;  3TGH A;  5JJT A;  3JYF A;  3THO B;  3QFM A;  4FBQ A;  3C9F A;  3PSN A;  3AV0 A;  2YVT A;  3P71 C;  2NYM C;  3QFO A;  4I5L C;  2QFR A;  4O43 A;  4KBP A;  4H2I A;  2O8G A;  1WAR A;  2BDX A;  3IB8 A;  5JPF A;  3E7A A;  4JA7 A;  4Q7F A;  4H2G A; 
#chains in the Genus database with same CATH topology
 4XPN A;  4O24 A;  2USH A;  3K7V C;  4B2O A;  1MF8 A;  1UTE A;  1XM7 A;  2WDD A;  4DT2 A;  2WDE A;  2NYL C;  2AHD A;  3QG5 C;  1OID A;  1U32 A;  3DW8 C;  2WDC A;  2HYP A;  4DSY A;  3H69 A;  5JPE A;  1USH A;  4F0Z A;  3ZU0 A;  4UT2 A;  4ORC A;  3RL4 A;  5HPE A;  1S3N A;  4LAC C;  4I5N C;  3N5U A;  4M0V A;  1S95 A;  4ORA A;  4UWQ A;  3QFN A;  3RL3 A;  3EGH A;  5J28 A;  4IL1 A;  2IAE C;  2O8A A;  2ZOA A;  2NPP C;  1WAO 1;  2YEQ A;  5INB A;  1QHW A;  4ORB A;  3K7W C;  1IT6 A;  3H62 B;  1OI8 A;  3IVD A;  4MOY A;  1Z2W A;  4OR9 A;  4JA9 A;  4J6O A;  2ZBM A;  4LTY A;  1NNW A;  4ZVZ A;  1HPU A;  1QFC A;  3AUZ A;  5IOH A;  2A22 A;  4V0V A;  1S8E A;  2JOG A;  1W24 A;  4LU9 A;  3GVE A;  2ZO9 B;  4ZX2 A;  3HVQ A;  3PSO A;  1SU1 A;  1M63 A;  2DXN A;  3IVE A;  3DSD A;  5C1V A;  2P6B A;  1XZW A;  3FGA C;  4MP0 A;  4KKZ A;  4DHL A;  2HYO A;  3DSC A;  4MOV A;  3E7B A;  1HP1 A;  3QFK A;  3RQZ A;  1KBP A;  3H66 A;  1S3M A;  1UF3 A;  3LL8 A;  2BQ8 X;  2Q8U A;  3FLO A;  3H68 A;  2KKN A;  1G5B A;  4TUI A;  2XMO A;  3E0J A;  1FJM A;  3C5W C;  3ICF A;  1II7 A;  4H1Y P;  2QFP A;  2IE4 C;  2QJC A;  3RL5 A;  3V4Y A;  3KBP A;  4FBK A;  4V0W A;  1V73 A;  1S3L A;  1Z2X A;  4O4K A;  3ZTV A;  2Z1A A;  3H61 A;  2NXF A;  3H63 A;  4YKE A;  1T70 A;  2R17 A;  2Z06 A;  4UT3 A;  2GJU A;  2HY1 A;  5DNY A;  1T71 A;  5GTU A;  3T1I A;  2IE3 C;  3IB7 A;  4H2B A;  1JK7 A;  5EQV A;  5F3W A;  1AUI A;  4O5G A;  4TUG A;  3CK2 A;  3H64 A;  4H1S A;  4NZV A;  4G9J A;  2BCD A;  2Z72 A;  3EGG A;  4FBW A;  2CV9 A;  4WWL A;  2DFJ A;  3THN A;  4IYP C;  5B8I A;  4FCX A;  4UT3 B;  1S70 A;  3H60 A;  2WDF A;  4HD0 A;  1TCO A;  1OIE A;  4H2F A;  3H67 A;  1HO5 A;  4V0X A;  3TGH A;  2DXL A;  5JJT A;  3JYF A;  3THO B;  3QFM A;  4FBQ A;  3C9F A;  3PSN A;  3AV0 A;  2YVT A;  3P71 C;  2NYM C;  3QFO A;  4I5L C;  2QFR A;  4O43 A;  3D03 A;  4KBP A;  4H2I A;  2O8G A;  1WAR A;  2BDX A;  3IB8 A;  5JPF A;  3E7A A;  4JA7 A;  4Q7F A;  4H2G A; 
#chains in the Genus database with same CATH homology
 4XPN A;  4O24 A;  2USH A;  3K7V C;  4B2O A;  1MF8 A;  1UTE A;  1XM7 A;  2WDD A;  4DT2 A;  2WDE A;  2NYL C;  2AHD A;  3QG5 C;  1OID A;  1U32 A;  3DW8 C;  2WDC A;  2HYP A;  4DSY A;  3H69 A;  5JPE A;  1USH A;  4F0Z A;  3ZU0 A;  4UT2 A;  4ORC A;  3RL4 A;  5HPE A;  1S3N A;  4LAC C;  4I5N C;  3N5U A;  4M0V A;  1S95 A;  4ORA A;  4UWQ A;  3QFN A;  3RL3 A;  3EGH A;  5J28 A;  4IL1 A;  2IAE C;  2O8A A;  2ZOA A;  2NPP C;  1WAO 1;  2YEQ A;  5INB A;  1QHW A;  4ORB A;  3K7W C;  1IT6 A;  3H62 B;  1OI8 A;  3IVD A;  4MOY A;  1Z2W A;  4OR9 A;  4JA9 A;  4J6O A;  2ZBM A;  4LTY A;  1NNW A;  4ZVZ A;  1HPU A;  1QFC A;  3AUZ A;  5IOH A;  2A22 A;  4V0V A;  1S8E A;  2JOG A;  1W24 A;  4LU9 A;  3GVE A;  2ZO9 B;  4ZX2 A;  3HVQ A;  3PSO A;  1SU1 A;  1M63 A;  2DXN A;  3IVE A;  3DSD A;  5C1V A;  2P6B A;  1XZW A;  3FGA C;  4MP0 A;  4KKZ A;  4DHL A;  2HYO A;  3DSC A;  4MOV A;  3E7B A;  1HP1 A;  3QFK A;  3RQZ A;  1KBP A;  3H66 A;  1S3M A;  1UF3 A;  3LL8 A;  2BQ8 X;  2Q8U A;  3FLO A;  3H68 A;  2KKN A;  1G5B A;  4TUI A;  2XMO A;  3E0J A;  1FJM A;  3C5W C;  3ICF A;  1II7 A;  4H1Y P;  2QFP A;  2IE4 C;  2QJC A;  3RL5 A;  3V4Y A;  3KBP A;  4FBK A;  4V0W A;  1V73 A;  1S3L A;  1Z2X A;  4O4K A;  3ZTV A;  2Z1A A;  3H61 A;  2NXF A;  3H63 A;  4YKE A;  1T70 A;  2R17 A;  2Z06 A;  4UT3 A;  2GJU A;  2HY1 A;  5DNY A;  1T71 A;  5GTU A;  3T1I A;  2IE3 C;  3IB7 A;  4H2B A;  1JK7 A;  5EQV A;  5F3W A;  1AUI A;  4O5G A;  4TUG A;  3CK2 A;  3H64 A;  4H1S A;  4NZV A;  4G9J A;  2BCD A;  2Z72 A;  3EGG A;  4FBW A;  2CV9 A;  4WWL A;  2DFJ A;  3THN A;  4IYP C;  5B8I A;  4FCX A;  4UT3 B;  1S70 A;  3H60 A;  2WDF A;  4HD0 A;  1TCO A;  1OIE A;  4H2F A;  3H67 A;  1HO5 A;  4V0X A;  3TGH A;  2DXL A;  5JJT A;  3JYF A;  3THO B;  3QFM A;  4FBQ A;  3C9F A;  3PSN A;  3AV0 A;  2YVT A;  3P71 C;  2NYM C;  3QFO A;  4I5L C;  2QFR A;  4O43 A;  3D03 A;  4KBP A;  4H2I A;  2O8G A;  1WAR A;  2BDX A;  3IB8 A;  5JPF A;  3E7A A;  4JA7 A;  4Q7F A;  4H2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...