5J28A

Ki67-pp1g (protein phosphatase 1, gamma isoform) holoenzyme complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
293
structure length
293
Chain Sequence
LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Serine/threonine-protein phosphatase PP1-gamma catalytic sub
publication title The Ki-67 and RepoMan mitotic phosphatases assemble via an identical, yet novel mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5j28A00
5C1VA 4FBQA 1Z2WA 2O8AA 4O5GA 4NZVA 4O4KA 5J28A 4G9JA 2GJUA 4LU9A 4MOVA 1XM7A 1WAO1 2ZBMA 3FGAC 4FBKA 4KKZA 3QFMA 2O8GA 2DFJA 4H1YP 3DW8C 3RL3A 5HPEA 3THOB 4FBWA 4MOYA 3RL4A 5JPFA 2IE4C 2IAEC 1QFCA 5JJTA 5DNYA 2BDXA 5JPEA 1S70A 4MP0A 1U32A 4ORBA 3K7WC 3AUZA 2QFPA 2Q8UA 3IB7A 4WWLA 1II7A 1MF8A 3KBPA 4TUIA 1OIEA 1AUIA 1M63A 1Z2XA 2HYPA 2NPPC 3EGGA 3PSNA 3T1IA 3ZU0A 3LL8A 2CV9A 3H67A 3H68A 1WARA 1W24A 4I5LC 4V0XA 2HYOA 3QFOA 4H2BA 5F3WA 3TGHA 2BQ8X 3H69A 4DHLA 1KBPA 1S95A 3HVQA 5B8IA 2A22A 2YVTA 4OR9A 3JYFA 3IVDA 3QFKA 3H61A 3EGHA 2HY1A 3C9FA 1T71A 4H2IA 4O43A 5IOHA 4YKEA 3DSDA 3V4YA 3QFNA 1V73A 3E7BA 1JK7A 3THNA 4UT3A 3H63A 1S3LA 3DSCA 3H62B 3IVEA 3IB8A 4JA9A 2Z06A 4JA7A 4M0VA 4DSYA 5INBA 4Q7FA 4J6OA 1XZWA 2R17A 1IT6A 4I5NC 2WDDA 4ORCA 2NYMC 1S3MA 4UWQA 3N5UA 3H60A 4ORAA 3C5WC 2QJCA 3P71C 3ICFA 4V0VA 2P6BA 3AV0A 4IL1A 4ZVZA 4UT2A 1T70A 3K7VC 2XMOA 5EQVA 4KBPA 4ZX2A 1QHWA 3ZTVA 1HO5A 3QG5C 2USHA 1TCOA 1OIDA 3H66A 1HPUA 1S3NA 3GVEA 5GTUA 2NXFA 4HD0A 1HP1A 4XPNA 4UT3B 2WDCA 3RL5A 1OI8A 4B2OA 4H2GA 1NNWA 1USHA 4TUGA 1G5BA 2Z72A 4H1SA 2JOGA 2BCDA 3E7AA 1FJMA 3CK2A 2WDEA 2IE3C 1S8EA 4IYPC 1UTEA 2Z1AA 2NYLC 4FCXA 4O24A 2QFRA 4F0ZA 3PSOA 4H2FA 2WDFA 2KKNA 1SU1A 2AHDA 4LACC 3H64A 3RQZA 4DT2A 4LTYA 1UF3A 4V0WA
chains in the Genus database with same CATH superfamily
5C1VA 4FBQA 1Z2WA 2O8AA 4O5GA 4NZVA 4O4KA 3FLOA 5J28A 4G9JA 2GJUA 4LU9A 4MOVA 1XM7A 1WAO1 2ZBMA 3FGAC 4FBKA 4KKZA 3QFMA 2O8GA 2DFJA 4H1YP 3DW8C 3RL3A 5HPEA 3THOB 4FBWA 4MOYA 3RL4A 5JPFA 2DXLA 2IE4C 2IAEC 1QFCA 5JJTA 5DNYA 2BDXA 5JPEA 1S70A 4MP0A 1U32A 4ORBA 3K7WC 3AUZA 2QFPA 2Q8UA 3IB7A 4WWLA 1II7A 1MF8A 3KBPA 4TUIA 1OIEA 1AUIA 1M63A 1Z2XA 2HYPA 2NPPC 3EGGA 3PSNA 3T1IA 3ZU0A 3LL8A 2CV9A 3H67A 2DXNA 3H68A 1WARA 1W24A 4I5LC 4V0XA 2HYOA 3QFOA 4H2BA 5F3WA 3TGHA 2BQ8X 3H69A 4DHLA 1KBPA 1S95A 3HVQA 5B8IA 2A22A 2YVTA 4OR9A 3JYFA 3IVDA 3QFKA 3H61A 3EGHA 2HY1A 3C9FA 1T71A 4H2IA 4O43A 5IOHA 4YKEA 3DSDA 3V4YA 3QFNA 1V73A 3E7BA 1JK7A 3THNA 4UT3A 3H63A 1S3LA 2ZO9B 3DSCA 3H62B 3IVEA 3IB8A 4JA9A 2Z06A 4JA7A 4M0VA 4DSYA 5INBA 4Q7FA 3D03A 4J6OA 1XZWA 2R17A 1IT6A 4I5NC 2WDDA 3E0JA 2NYMC 4ORCA 1S3MA 4UWQA 3N5UA 3H60A 4ORAA 3C5WC 2QJCA 3P71C 3ICFA 4V0VA 2P6BA 3AV0A 4IL1A 4ZVZA 4UT2A 1T70A 3K7VC 2XMOA 5EQVA 4KBPA 4ZX2A 1QHWA 3ZTVA 1HO5A 3QG5C 2USHA 1TCOA 1OIDA 3H66A 1HPUA 1S3NA 3GVEA 5GTUA 2NXFA 4HD0A 1HP1A 4XPNA 4UT3B 2WDCA 3RL5A 1OI8A 4B2OA 4H2GA 1NNWA 1USHA 4TUGA 1G5BA 2Z72A 4H1SA 2JOGA 2BCDA 3E7AA 1FJMA 2ZOAA 3CK2A 2WDEA 2IE3C 1S8EA 4IYPC 1UTEA 2Z1AA 2NYLC 4FCXA 4O24A 2QFRA 4F0ZA 3PSOA 4H2FA 2WDFA 2KKNA 1SU1A 2AHDA 2YEQA 4LACC 3H64A 3RQZA 4DT2A 4LTYA 1UF3A 4V0WA
chains in the Genus database with same CATH topology
5C1VA 4FBQA 1Z2WA 2O8AA 4O5GA 4NZVA 4O4KA 3FLOA 5J28A 4G9JA 2GJUA 4LU9A 4MOVA 1XM7A 1WAO1 2ZBMA 3FGAC 4FBKA 4KKZA 3QFMA 2O8GA 2DFJA 4H1YP 3DW8C 3RL3A 5HPEA 3THOB 4FBWA 4MOYA 3RL4A 5JPFA 2DXLA 2IE4C 2IAEC 1QFCA 5JJTA 5DNYA 2BDXA 5JPEA 1S70A 4MP0A 1U32A 4ORBA 3K7WC 3AUZA 2QFPA 2Q8UA 3IB7A 4WWLA 1II7A 1MF8A 3KBPA 4TUIA 1OIEA 1AUIA 1M63A 1Z2XA 2HYPA 2NPPC 3EGGA 3PSNA 3T1IA 3ZU0A 3LL8A 2CV9A 3H67A 2DXNA 3H68A 1WARA 1W24A 4I5LC 4V0XA 2HYOA 3QFOA 4H2BA 5F3WA 3TGHA 2BQ8X 3H69A 4DHLA 1KBPA 1S95A 3HVQA 5B8IA 2A22A 2YVTA 4OR9A 3JYFA 3IVDA 3QFKA 3H61A 3EGHA 2HY1A 3C9FA 1T71A 4H2IA 4O43A 5IOHA 4YKEA 3DSDA 3V4YA 3QFNA 1V73A 3E7BA 1JK7A 3THNA 4UT3A 3H63A 1S3LA 2ZO9B 3DSCA 3H62B 3IVEA 3IB8A 4JA9A 2Z06A 4JA7A 4M0VA 4DSYA 5INBA 4Q7FA 3D03A 4J6OA 1XZWA 2R17A 1IT6A 4I5NC 2WDDA 3E0JA 2NYMC 4ORCA 1S3MA 4UWQA 3N5UA 3H60A 4ORAA 3C5WC 2QJCA 3P71C 3ICFA 4V0VA 2P6BA 3AV0A 4IL1A 4ZVZA 4UT2A 1T70A 3K7VC 2XMOA 5EQVA 4KBPA 4ZX2A 1QHWA 3ZTVA 1HO5A 3QG5C 2USHA 1TCOA 1OIDA 3H66A 1HPUA 1S3NA 3GVEA 5GTUA 2NXFA 4HD0A 1HP1A 4XPNA 4UT3B 2WDCA 3RL5A 1OI8A 4B2OA 4H2GA 1NNWA 1USHA 4TUGA 1G5BA 2Z72A 4H1SA 2JOGA 2BCDA 3E7AA 1FJMA 2ZOAA 3CK2A 2WDEA 2IE3C 1S8EA 4IYPC 1UTEA 2Z1AA 2NYLC 4FCXA 4O24A 2QFRA 4F0ZA 3PSOA 4H2FA 2WDFA 2KKNA 1SU1A 2AHDA 2YEQA 4LACC 3H64A 3RQZA 4DT2A 4LTYA 1UF3A 4V0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1V A;  4FBQ A;  1Z2W A;  2O8A A;  4O5G A;  4NZV A;  4O4K A;  5J28 A;  4G9J A;  2GJU A;  4LU9 A;  4MOV A;  1XM7 A;  1WAO 1;  2ZBM A;  3FGA C;  4FBK A;  4KKZ A;  3QFM A;  2O8G A;  2DFJ A;  4H1Y P;  3DW8 C;  3RL3 A;  5HPE A;  3THO B;  4FBW A;  4MOY A;  3RL4 A;  5JPF A;  2IE4 C;  2IAE C;  1QFC A;  5JJT A;  5DNY A;  2BDX A;  5JPE A;  1S70 A;  4MP0 A;  1U32 A;  4ORB A;  3K7W C;  3AUZ A;  2QFP A;  2Q8U A;  3IB7 A;  4WWL A;  1II7 A;  1MF8 A;  3KBP A;  4TUI A;  1OIE A;  1AUI A;  1M63 A;  1Z2X A;  2HYP A;  2NPP C;  3EGG A;  3PSN A;  3T1I A;  3ZU0 A;  3LL8 A;  2CV9 A;  3H67 A;  3H68 A;  1WAR A;  1W24 A;  4I5L C;  4V0X A;  2HYO A;  3QFO A;  4H2B A;  5F3W A;  3TGH A;  2BQ8 X;  3H69 A;  4DHL A;  1KBP A;  1S95 A;  3HVQ A;  5B8I A;  2A22 A;  2YVT A;  4OR9 A;  3JYF A;  3IVD A;  3QFK A;  3H61 A;  3EGH A;  2HY1 A;  3C9F A;  1T71 A;  4H2I A;  4O43 A;  5IOH A;  4YKE A;  3DSD A;  3V4Y A;  3QFN A;  1V73 A;  3E7B A;  1JK7 A;  3THN A;  4UT3 A;  3H63 A;  1S3L A;  3DSC A;  3H62 B;  3IVE A;  3IB8 A;  4JA9 A;  2Z06 A;  4JA7 A;  4M0V A;  4DSY A;  5INB A;  4Q7F A;  4J6O A;  1XZW A;  2R17 A;  1IT6 A;  4I5N C;  2WDD A;  4ORC A;  2NYM C;  1S3M A;  4UWQ A;  3N5U A;  3H60 A;  4ORA A;  3C5W C;  2QJC A;  3P71 C;  3ICF A;  4V0V A;  2P6B A;  3AV0 A;  4IL1 A;  4ZVZ A;  4UT2 A;  1T70 A;  3K7V C;  2XMO A;  5EQV A;  4KBP A;  4ZX2 A;  1QHW A;  3ZTV A;  1HO5 A;  3QG5 C;  2USH A;  1TCO A;  1OID A;  3H66 A;  1HPU A;  1S3N A;  3GVE A;  5GTU A;  2NXF A;  4HD0 A;  1HP1 A;  4XPN A;  4UT3 B;  2WDC A;  3RL5 A;  1OI8 A;  4B2O A;  4H2G A;  1NNW A;  1USH A;  4TUG A;  1G5B A;  2Z72 A;  4H1S A;  2JOG A;  2BCD A;  3E7A A;  1FJM A;  3CK2 A;  2WDE A;  2IE3 C;  1S8E A;  4IYP C;  1UTE A;  2Z1A A;  2NYL C;  4FCX A;  4O24 A;  2QFR A;  4F0Z A;  3PSO A;  4H2F A;  2WDF A;  2KKN A;  1SU1 A;  2AHD A;  4LAC C;  3H64 A;  3RQZ A;  4DT2 A;  4LTY A;  1UF3 A;  4V0W A; 
#chains in the Genus database with same CATH topology
 5C1V A;  4FBQ A;  1Z2W A;  2O8A A;  4O5G A;  4NZV A;  4O4K A;  3FLO A;  5J28 A;  4G9J A;  2GJU A;  4LU9 A;  4MOV A;  1XM7 A;  1WAO 1;  2ZBM A;  3FGA C;  4FBK A;  4KKZ A;  3QFM A;  2O8G A;  2DFJ A;  4H1Y P;  3DW8 C;  3RL3 A;  5HPE A;  3THO B;  4FBW A;  4MOY A;  3RL4 A;  5JPF A;  2DXL A;  2IE4 C;  2IAE C;  1QFC A;  5JJT A;  5DNY A;  2BDX A;  5JPE A;  1S70 A;  4MP0 A;  1U32 A;  4ORB A;  3K7W C;  3AUZ A;  2QFP A;  2Q8U A;  3IB7 A;  4WWL A;  1II7 A;  1MF8 A;  3KBP A;  4TUI A;  1OIE A;  1AUI A;  1M63 A;  1Z2X A;  2HYP A;  2NPP C;  3EGG A;  3PSN A;  3T1I A;  3ZU0 A;  3LL8 A;  2CV9 A;  3H67 A;  2DXN A;  3H68 A;  1WAR A;  1W24 A;  4I5L C;  4V0X A;  2HYO A;  3QFO A;  4H2B A;  5F3W A;  3TGH A;  2BQ8 X;  3H69 A;  4DHL A;  1KBP A;  1S95 A;  3HVQ A;  5B8I A;  2A22 A;  2YVT A;  4OR9 A;  3JYF A;  3IVD A;  3QFK A;  3H61 A;  3EGH A;  2HY1 A;  3C9F A;  1T71 A;  4H2I A;  4O43 A;  5IOH A;  4YKE A;  3DSD A;  3V4Y A;  3QFN A;  1V73 A;  3E7B A;  1JK7 A;  3THN A;  4UT3 A;  3H63 A;  1S3L A;  2ZO9 B;  3DSC A;  3H62 B;  3IVE A;  3IB8 A;  4JA9 A;  2Z06 A;  4JA7 A;  4M0V A;  4DSY A;  5INB A;  4Q7F A;  3D03 A;  4J6O A;  1XZW A;  2R17 A;  1IT6 A;  4I5N C;  2WDD A;  3E0J A;  2NYM C;  4ORC A;  1S3M A;  4UWQ A;  3N5U A;  3H60 A;  4ORA A;  3C5W C;  2QJC A;  3P71 C;  3ICF A;  4V0V A;  2P6B A;  3AV0 A;  4IL1 A;  4ZVZ A;  4UT2 A;  1T70 A;  3K7V C;  2XMO A;  5EQV A;  4KBP A;  4ZX2 A;  1QHW A;  3ZTV A;  1HO5 A;  3QG5 C;  2USH A;  1TCO A;  1OID A;  3H66 A;  1HPU A;  1S3N A;  3GVE A;  5GTU A;  2NXF A;  4HD0 A;  1HP1 A;  4XPN A;  4UT3 B;  2WDC A;  3RL5 A;  1OI8 A;  4B2O A;  4H2G A;  1NNW A;  1USH A;  4TUG A;  1G5B A;  2Z72 A;  4H1S A;  2JOG A;  2BCD A;  3E7A A;  1FJM A;  2ZOA A;  3CK2 A;  2WDE A;  2IE3 C;  1S8E A;  4IYP C;  1UTE A;  2Z1A A;  2NYL C;  4FCX A;  4O24 A;  2QFR A;  4F0Z A;  3PSO A;  4H2F A;  2WDF A;  2KKN A;  1SU1 A;  2AHD A;  2YEQ A;  4LAC C;  3H64 A;  3RQZ A;  4DT2 A;  4LTY A;  1UF3 A;  4V0W A; 
#chains in the Genus database with same CATH homology
 5C1V A;  4FBQ A;  1Z2W A;  2O8A A;  4O5G A;  4NZV A;  4O4K A;  3FLO A;  5J28 A;  4G9J A;  2GJU A;  4LU9 A;  4MOV A;  1XM7 A;  1WAO 1;  2ZBM A;  3FGA C;  4FBK A;  4KKZ A;  3QFM A;  2O8G A;  2DFJ A;  4H1Y P;  3DW8 C;  3RL3 A;  5HPE A;  3THO B;  4FBW A;  4MOY A;  3RL4 A;  5JPF A;  2DXL A;  2IE4 C;  2IAE C;  1QFC A;  5JJT A;  5DNY A;  2BDX A;  5JPE A;  1S70 A;  4MP0 A;  1U32 A;  4ORB A;  3K7W C;  3AUZ A;  2QFP A;  2Q8U A;  3IB7 A;  4WWL A;  1II7 A;  1MF8 A;  3KBP A;  4TUI A;  1OIE A;  1AUI A;  1M63 A;  1Z2X A;  2HYP A;  2NPP C;  3EGG A;  3PSN A;  3T1I A;  3ZU0 A;  3LL8 A;  2CV9 A;  3H67 A;  2DXN A;  3H68 A;  1WAR A;  1W24 A;  4I5L C;  4V0X A;  2HYO A;  3QFO A;  4H2B A;  5F3W A;  3TGH A;  2BQ8 X;  3H69 A;  4DHL A;  1KBP A;  1S95 A;  3HVQ A;  5B8I A;  2A22 A;  2YVT A;  4OR9 A;  3JYF A;  3IVD A;  3QFK A;  3H61 A;  3EGH A;  2HY1 A;  3C9F A;  1T71 A;  4H2I A;  4O43 A;  5IOH A;  4YKE A;  3DSD A;  3V4Y A;  3QFN A;  1V73 A;  3E7B A;  1JK7 A;  3THN A;  4UT3 A;  3H63 A;  1S3L A;  2ZO9 B;  3DSC A;  3H62 B;  3IVE A;  3IB8 A;  4JA9 A;  2Z06 A;  4JA7 A;  4M0V A;  4DSY A;  5INB A;  4Q7F A;  3D03 A;  4J6O A;  1XZW A;  2R17 A;  1IT6 A;  4I5N C;  2WDD A;  3E0J A;  2NYM C;  4ORC A;  1S3M A;  4UWQ A;  3N5U A;  3H60 A;  4ORA A;  3C5W C;  2QJC A;  3P71 C;  3ICF A;  4V0V A;  2P6B A;  3AV0 A;  4IL1 A;  4ZVZ A;  4UT2 A;  1T70 A;  3K7V C;  2XMO A;  5EQV A;  4KBP A;  4ZX2 A;  1QHW A;  3ZTV A;  1HO5 A;  3QG5 C;  2USH A;  1TCO A;  1OID A;  3H66 A;  1HPU A;  1S3N A;  3GVE A;  5GTU A;  2NXF A;  4HD0 A;  1HP1 A;  4XPN A;  4UT3 B;  2WDC A;  3RL5 A;  1OI8 A;  4B2O A;  4H2G A;  1NNW A;  1USH A;  4TUG A;  1G5B A;  2Z72 A;  4H1S A;  2JOG A;  2BCD A;  3E7A A;  1FJM A;  2ZOA A;  3CK2 A;  2WDE A;  2IE3 C;  1S8E A;  4IYP C;  1UTE A;  2Z1A A;  2NYL C;  4FCX A;  4O24 A;  2QFR A;  4F0Z A;  3PSO A;  4H2F A;  2WDF A;  2KKN A;  1SU1 A;  2AHD A;  2YEQ A;  4LAC C;  3H64 A;  3RQZ A;  4DT2 A;  4LTY A;  1UF3 A;  4V0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...