5IOHA

Repoman-pp1a (protein phosphatase 1, alpha isoform) holoenzyme complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
293
structure length
293
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Ki-67 and RepoMan mitotic phosphatases assemble via an identical, yet novel mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 104
structure length 293
sequence length 293
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5iohA00
2WDEA 3V4YA 3JYFA 3ICFA 1NNWA 2NYLC 3EGHA 4UT2A 2HYOA 3C5WC 1WAO1 4WWLA 2WDDA 4O5GA 1QFCA 2O8GA 3H66A 3AUZA 1T71A 3AV0A 4LU9A 3IVDA 4H1YP 4DHLA 3TGHA 4FCXA 2YVTA 4NZVA 3QFNA 3THOB 4O24A 2ZBMA 2XMOA 4O43A 1USHA 2HY1A 4UWQA 4MP0A 1UTEA 3IVEA 1S70A 3DSDA 1OI8A 1XZWA 3H69A 3RL5A 1S3MA 5F3WA 2BCDA 1HPUA 4LTYA 4M0VA 3PSNA 4H2BA 4IL1A 2IAEC 1M63A 1Z2WA 1HP1A 2Q8UA 1KBPA 3T1IA 1TCOA 5DNYA 3C9FA 1G5BA 1II7A 3HVQA 2WDFA 4G9JA 1Z2XA 2IE3C 3KBPA 4FBKA 5EQVA 1SU1A 4ORBA 2USHA 1JK7A 4IYPC 4J6OA 5INBA 3E7AA 1OIDA 4FBWA 4F0ZA 4KKZA 1QHWA 4ZX2A 4XPNA 2R17A 1UF3A 3K7VC 4V0VA 4H2GA 2QFPA 3ZU0A 4DSYA 2CV9A 4ORAA 1S3LA 1HO5A 2JOGA 2NXFA 4UT3A 3H67A 1AUIA 3QG5C 4H2FA 4V0WA 1S95A 2Z1AA 3EGGA 3H60A 1T70A 3QFKA 3H64A 3E7BA 1FJMA 3THNA 1S8EA 2BQ8X 4JA7A 3ZTVA 4UT3B 3LL8A 5J28A 3DSCA 1W24A 4H2IA 4YKEA 3RQZA 1XM7A 2NYMC 4V0XA 3PSOA 1S3NA 3N5UA 3P71C 2IE4C 4MOVA 4Q7FA 4OR9A 1WARA 3K7WC 4I5NC 4O4KA 4H1SA 4ORCA 2AHDA 3RL4A 4TUIA 3QFMA 4TUGA 3H61A 2A22A 2WDCA 3H63A 3QFOA 2QJCA 4KBPA 5IOHA 4B2OA 4JA9A 1V73A 4FBQA 3IB8A 1IT6A 3GVEA 3H62B 4MOYA 5JPEA 3H68A 4LACC 2QFRA 2NPPC 2P6BA 3IB7A 2DFJA 2Z06A 3DW8C 4I5LC 5GTUA 5HPEA 1U32A 2Z72A 4HD0A 2KKNA 2O8AA 1OIEA 2BDXA 3FGAC 2GJUA 5C1VA 3RL3A 5JJTA 5JPFA 4DT2A 1MF8A 4ZVZA 3CK2A 5B8IA 2HYPA
chains in the Genus database with same CATH superfamily
2WDEA 3V4YA 3JYFA 2ZOAA 3ICFA 1NNWA 2NYLC 3D03A 3EGHA 4UT2A 2HYOA 3C5WC 1WAO1 4WWLA 2WDDA 4O5GA 1QFCA 2O8GA 3H66A 2DXNA 3AUZA 1T71A 3AV0A 4LU9A 3IVDA 4H1YP 4DHLA 3TGHA 4FCXA 2YVTA 4NZVA 3QFNA 3THOB 4O24A 2ZBMA 2XMOA 4O43A 1USHA 2HY1A 4UWQA 4MP0A 1UTEA 3IVEA 1S70A 3DSDA 1OI8A 1XZWA 3H69A 3RL5A 1S3MA 5F3WA 2BCDA 1HPUA 4LTYA 4M0VA 3PSNA 4H2BA 4IL1A 2IAEC 1M63A 1Z2WA 1HP1A 2Q8UA 1KBPA 3T1IA 1TCOA 5DNYA 3C9FA 1G5BA 1II7A 2ZO9B 3HVQA 2WDFA 4G9JA 1Z2XA 2IE3C 3KBPA 4FBKA 5EQVA 1SU1A 4ORBA 2USHA 1JK7A 4IYPC 4J6OA 5INBA 3E7AA 1OIDA 4FBWA 4F0ZA 4KKZA 1QHWA 4ZX2A 4XPNA 2R17A 1UF3A 3K7VC 4V0VA 4H2GA 2QFPA 3ZU0A 4DSYA 2CV9A 4ORAA 1S3LA 1HO5A 2JOGA 2NXFA 3E0JA 4UT3A 3H67A 1AUIA 3QG5C 4H2FA 4V0WA 1S95A 2YEQA 2Z1AA 3EGGA 3H60A 1T70A 3QFKA 3H64A 3E7BA 1FJMA 3THNA 1S8EA 2BQ8X 4JA7A 3ZTVA 4UT3B 3LL8A 5J28A 3DSCA 1W24A 4H2IA 4YKEA 3RQZA 1XM7A 2NYMC 4V0XA 3PSOA 1S3NA 3N5UA 3P71C 2IE4C 4MOVA 4Q7FA 4OR9A 1WARA 3K7WC 4I5NC 4O4KA 4H1SA 4ORCA 2AHDA 3RL4A 4TUIA 3QFMA 4TUGA 3H61A 2A22A 2WDCA 3H63A 3QFOA 2QJCA 4KBPA 5IOHA 4B2OA 4JA9A 1V73A 4FBQA 3IB8A 1IT6A 3GVEA 3H62B 4MOYA 2DXLA 5JPEA 3FLOA 3H68A 4LACC 2QFRA 2NPPC 2P6BA 3IB7A 2DFJA 2Z06A 3DW8C 4I5LC 5GTUA 5HPEA 1U32A 2Z72A 4HD0A 2KKNA 2O8AA 1OIEA 2BDXA 3FGAC 2GJUA 5C1VA 3RL3A 5JJTA 5JPFA 4DT2A 1MF8A 4ZVZA 3CK2A 5B8IA 2HYPA
chains in the Genus database with same CATH topology
2WDEA 3V4YA 3JYFA 2ZOAA 3ICFA 1NNWA 2NYLC 3D03A 3EGHA 4UT2A 2HYOA 3C5WC 1WAO1 4WWLA 2WDDA 4O5GA 1QFCA 2O8GA 3H66A 2DXNA 3AUZA 1T71A 3AV0A 4LU9A 3IVDA 4H1YP 4DHLA 3TGHA 4FCXA 2YVTA 4NZVA 3QFNA 3THOB 4O24A 2ZBMA 2XMOA 4O43A 1USHA 2HY1A 4UWQA 4MP0A 1UTEA 3IVEA 1S70A 3DSDA 1OI8A 1XZWA 3H69A 3RL5A 1S3MA 5F3WA 2BCDA 1HPUA 4LTYA 4M0VA 3PSNA 4H2BA 4IL1A 2IAEC 1M63A 1Z2WA 1HP1A 2Q8UA 1KBPA 3T1IA 1TCOA 5DNYA 3C9FA 1G5BA 1II7A 2ZO9B 3HVQA 2WDFA 4G9JA 1Z2XA 2IE3C 3KBPA 4FBKA 5EQVA 1SU1A 4ORBA 2USHA 1JK7A 4IYPC 4J6OA 5INBA 3E7AA 1OIDA 4FBWA 4F0ZA 4KKZA 1QHWA 4ZX2A 4XPNA 2R17A 1UF3A 3K7VC 4V0VA 4H2GA 2QFPA 3ZU0A 4DSYA 2CV9A 4ORAA 1S3LA 1HO5A 2JOGA 2NXFA 3E0JA 4UT3A 3H67A 1AUIA 3QG5C 4H2FA 4V0WA 1S95A 2YEQA 2Z1AA 3EGGA 3H60A 1T70A 3QFKA 3H64A 3E7BA 1FJMA 3THNA 1S8EA 2BQ8X 4JA7A 3ZTVA 4UT3B 3LL8A 5J28A 3DSCA 1W24A 4H2IA 4YKEA 3RQZA 1XM7A 2NYMC 4V0XA 3PSOA 1S3NA 3N5UA 3P71C 2IE4C 4MOVA 4Q7FA 4OR9A 1WARA 3K7WC 4I5NC 4O4KA 4H1SA 4ORCA 2AHDA 3RL4A 4TUIA 3QFMA 4TUGA 3H61A 2A22A 2WDCA 3H63A 3QFOA 2QJCA 4KBPA 5IOHA 4B2OA 4JA9A 1V73A 4FBQA 3IB8A 1IT6A 3GVEA 3H62B 4MOYA 2DXLA 5JPEA 3FLOA 3H68A 4LACC 2QFRA 2NPPC 2P6BA 3IB7A 2DFJA 2Z06A 3DW8C 4I5LC 5GTUA 5HPEA 1U32A 2Z72A 4HD0A 2KKNA 2O8AA 1OIEA 2BDXA 3FGAC 2GJUA 5C1VA 3RL3A 5JJTA 5JPFA 4DT2A 1MF8A 4ZVZA 3CK2A 5B8IA 2HYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDE A;  3V4Y A;  3JYF A;  3ICF A;  1NNW A;  2NYL C;  3EGH A;  4UT2 A;  2HYO A;  3C5W C;  1WAO 1;  4WWL A;  2WDD A;  4O5G A;  1QFC A;  2O8G A;  3H66 A;  3AUZ A;  1T71 A;  3AV0 A;  4LU9 A;  3IVD A;  4H1Y P;  4DHL A;  3TGH A;  4FCX A;  2YVT A;  4NZV A;  3QFN A;  3THO B;  4O24 A;  2ZBM A;  2XMO A;  4O43 A;  1USH A;  2HY1 A;  4UWQ A;  4MP0 A;  1UTE A;  3IVE A;  1S70 A;  3DSD A;  1OI8 A;  1XZW A;  3H69 A;  3RL5 A;  1S3M A;  5F3W A;  2BCD A;  1HPU A;  4LTY A;  4M0V A;  3PSN A;  4H2B A;  4IL1 A;  2IAE C;  1M63 A;  1Z2W A;  1HP1 A;  2Q8U A;  1KBP A;  3T1I A;  1TCO A;  5DNY A;  3C9F A;  1G5B A;  1II7 A;  3HVQ A;  2WDF A;  4G9J A;  1Z2X A;  2IE3 C;  3KBP A;  4FBK A;  5EQV A;  1SU1 A;  4ORB A;  2USH A;  1JK7 A;  4IYP C;  4J6O A;  5INB A;  3E7A A;  1OID A;  4FBW A;  4F0Z A;  4KKZ A;  1QHW A;  4ZX2 A;  4XPN A;  2R17 A;  1UF3 A;  3K7V C;  4V0V A;  4H2G A;  2QFP A;  3ZU0 A;  4DSY A;  2CV9 A;  4ORA A;  1S3L A;  1HO5 A;  2JOG A;  2NXF A;  4UT3 A;  3H67 A;  1AUI A;  3QG5 C;  4H2F A;  4V0W A;  1S95 A;  2Z1A A;  3EGG A;  3H60 A;  1T70 A;  3QFK A;  3H64 A;  3E7B A;  1FJM A;  3THN A;  1S8E A;  2BQ8 X;  4JA7 A;  3ZTV A;  4UT3 B;  3LL8 A;  5J28 A;  3DSC A;  1W24 A;  4H2I A;  4YKE A;  3RQZ A;  1XM7 A;  2NYM C;  4V0X A;  3PSO A;  1S3N A;  3N5U A;  3P71 C;  2IE4 C;  4MOV A;  4Q7F A;  4OR9 A;  1WAR A;  3K7W C;  4I5N C;  4O4K A;  4H1S A;  4ORC A;  2AHD A;  3RL4 A;  4TUI A;  3QFM A;  4TUG A;  3H61 A;  2A22 A;  2WDC A;  3H63 A;  3QFO A;  2QJC A;  4KBP A;  5IOH A;  4B2O A;  4JA9 A;  1V73 A;  4FBQ A;  3IB8 A;  1IT6 A;  3GVE A;  3H62 B;  4MOY A;  5JPE A;  3H68 A;  4LAC C;  2QFR A;  2NPP C;  2P6B A;  3IB7 A;  2DFJ A;  2Z06 A;  3DW8 C;  4I5L C;  5GTU A;  5HPE A;  1U32 A;  2Z72 A;  4HD0 A;  2KKN A;  2O8A A;  1OIE A;  2BDX A;  3FGA C;  2GJU A;  5C1V A;  3RL3 A;  5JJT A;  5JPF A;  4DT2 A;  1MF8 A;  4ZVZ A;  3CK2 A;  5B8I A;  2HYP A; 
#chains in the Genus database with same CATH topology
 2WDE A;  3V4Y A;  3JYF A;  2ZOA A;  3ICF A;  1NNW A;  2NYL C;  3D03 A;  3EGH A;  4UT2 A;  2HYO A;  3C5W C;  1WAO 1;  4WWL A;  2WDD A;  4O5G A;  1QFC A;  2O8G A;  3H66 A;  2DXN A;  3AUZ A;  1T71 A;  3AV0 A;  4LU9 A;  3IVD A;  4H1Y P;  4DHL A;  3TGH A;  4FCX A;  2YVT A;  4NZV A;  3QFN A;  3THO B;  4O24 A;  2ZBM A;  2XMO A;  4O43 A;  1USH A;  2HY1 A;  4UWQ A;  4MP0 A;  1UTE A;  3IVE A;  1S70 A;  3DSD A;  1OI8 A;  1XZW A;  3H69 A;  3RL5 A;  1S3M A;  5F3W A;  2BCD A;  1HPU A;  4LTY A;  4M0V A;  3PSN A;  4H2B A;  4IL1 A;  2IAE C;  1M63 A;  1Z2W A;  1HP1 A;  2Q8U A;  1KBP A;  3T1I A;  1TCO A;  5DNY A;  3C9F A;  1G5B A;  1II7 A;  2ZO9 B;  3HVQ A;  2WDF A;  4G9J A;  1Z2X A;  2IE3 C;  3KBP A;  4FBK A;  5EQV A;  1SU1 A;  4ORB A;  2USH A;  1JK7 A;  4IYP C;  4J6O A;  5INB A;  3E7A A;  1OID A;  4FBW A;  4F0Z A;  4KKZ A;  1QHW A;  4ZX2 A;  4XPN A;  2R17 A;  1UF3 A;  3K7V C;  4V0V A;  4H2G A;  2QFP A;  3ZU0 A;  4DSY A;  2CV9 A;  4ORA A;  1S3L A;  1HO5 A;  2JOG A;  2NXF A;  3E0J A;  4UT3 A;  3H67 A;  1AUI A;  3QG5 C;  4H2F A;  4V0W A;  1S95 A;  2YEQ A;  2Z1A A;  3EGG A;  3H60 A;  1T70 A;  3QFK A;  3H64 A;  3E7B A;  1FJM A;  3THN A;  1S8E A;  2BQ8 X;  4JA7 A;  3ZTV A;  4UT3 B;  3LL8 A;  5J28 A;  3DSC A;  1W24 A;  4H2I A;  4YKE A;  3RQZ A;  1XM7 A;  2NYM C;  4V0X A;  3PSO A;  1S3N A;  3N5U A;  3P71 C;  2IE4 C;  4MOV A;  4Q7F A;  4OR9 A;  1WAR A;  3K7W C;  4I5N C;  4O4K A;  4H1S A;  4ORC A;  2AHD A;  3RL4 A;  4TUI A;  3QFM A;  4TUG A;  3H61 A;  2A22 A;  2WDC A;  3H63 A;  3QFO A;  2QJC A;  4KBP A;  5IOH A;  4B2O A;  4JA9 A;  1V73 A;  4FBQ A;  3IB8 A;  1IT6 A;  3GVE A;  3H62 B;  4MOY A;  2DXL A;  5JPE A;  3FLO A;  3H68 A;  4LAC C;  2QFR A;  2NPP C;  2P6B A;  3IB7 A;  2DFJ A;  2Z06 A;  3DW8 C;  4I5L C;  5GTU A;  5HPE A;  1U32 A;  2Z72 A;  4HD0 A;  2KKN A;  2O8A A;  1OIE A;  2BDX A;  3FGA C;  2GJU A;  5C1V A;  3RL3 A;  5JJT A;  5JPF A;  4DT2 A;  1MF8 A;  4ZVZ A;  3CK2 A;  5B8I A;  2HYP A; 
#chains in the Genus database with same CATH homology
 2WDE A;  3V4Y A;  3JYF A;  2ZOA A;  3ICF A;  1NNW A;  2NYL C;  3D03 A;  3EGH A;  4UT2 A;  2HYO A;  3C5W C;  1WAO 1;  4WWL A;  2WDD A;  4O5G A;  1QFC A;  2O8G A;  3H66 A;  2DXN A;  3AUZ A;  1T71 A;  3AV0 A;  4LU9 A;  3IVD A;  4H1Y P;  4DHL A;  3TGH A;  4FCX A;  2YVT A;  4NZV A;  3QFN A;  3THO B;  4O24 A;  2ZBM A;  2XMO A;  4O43 A;  1USH A;  2HY1 A;  4UWQ A;  4MP0 A;  1UTE A;  3IVE A;  1S70 A;  3DSD A;  1OI8 A;  1XZW A;  3H69 A;  3RL5 A;  1S3M A;  5F3W A;  2BCD A;  1HPU A;  4LTY A;  4M0V A;  3PSN A;  4H2B A;  4IL1 A;  2IAE C;  1M63 A;  1Z2W A;  1HP1 A;  2Q8U A;  1KBP A;  3T1I A;  1TCO A;  5DNY A;  3C9F A;  1G5B A;  1II7 A;  2ZO9 B;  3HVQ A;  2WDF A;  4G9J A;  1Z2X A;  2IE3 C;  3KBP A;  4FBK A;  5EQV A;  1SU1 A;  4ORB A;  2USH A;  1JK7 A;  4IYP C;  4J6O A;  5INB A;  3E7A A;  1OID A;  4FBW A;  4F0Z A;  4KKZ A;  1QHW A;  4ZX2 A;  4XPN A;  2R17 A;  1UF3 A;  3K7V C;  4V0V A;  4H2G A;  2QFP A;  3ZU0 A;  4DSY A;  2CV9 A;  4ORA A;  1S3L A;  1HO5 A;  2JOG A;  2NXF A;  3E0J A;  4UT3 A;  3H67 A;  1AUI A;  3QG5 C;  4H2F A;  4V0W A;  1S95 A;  2YEQ A;  2Z1A A;  3EGG A;  3H60 A;  1T70 A;  3QFK A;  3H64 A;  3E7B A;  1FJM A;  3THN A;  1S8E A;  2BQ8 X;  4JA7 A;  3ZTV A;  4UT3 B;  3LL8 A;  5J28 A;  3DSC A;  1W24 A;  4H2I A;  4YKE A;  3RQZ A;  1XM7 A;  2NYM C;  4V0X A;  3PSO A;  1S3N A;  3N5U A;  3P71 C;  2IE4 C;  4MOV A;  4Q7F A;  4OR9 A;  1WAR A;  3K7W C;  4I5N C;  4O4K A;  4H1S A;  4ORC A;  2AHD A;  3RL4 A;  4TUI A;  3QFM A;  4TUG A;  3H61 A;  2A22 A;  2WDC A;  3H63 A;  3QFO A;  2QJC A;  4KBP A;  5IOH A;  4B2O A;  4JA9 A;  1V73 A;  4FBQ A;  3IB8 A;  1IT6 A;  3GVE A;  3H62 B;  4MOY A;  2DXL A;  5JPE A;  3FLO A;  3H68 A;  4LAC C;  2QFR A;  2NPP C;  2P6B A;  3IB7 A;  2DFJ A;  2Z06 A;  3DW8 C;  4I5L C;  5GTU A;  5HPE A;  1U32 A;  2Z72 A;  4HD0 A;  2KKN A;  2O8A A;  1OIE A;  2BDX A;  3FGA C;  2GJU A;  5C1V A;  3RL3 A;  5JJT A;  5JPF A;  4DT2 A;  1MF8 A;  4ZVZ A;  3CK2 A;  5B8I A;  2HYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...