2USHA

5'-nucleotidase from e. coli
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
524
structure length
506
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of the Escherichia coli periplasmic 5'-nucleotidase containing a dimetal catalytic site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords 5'-NUCLEOTIDASE
total genus 175
structure length 506
sequence length 524
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2ushA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 2ushA02
1S70A 4IL1A 1XM7A 1KBPA 3H60A 4I5NC 3V4YA 1FJMA 1T70A 3ZTVA 4F0ZA 1XZWA 3E7AA 5DNYA 5HPEA 3H61A 2QFPA 4H2BA 1QFCA 4WWLA 1II7A 4UT2A 5IOHA 2YVTA 4UWQA 3H69A 1U32A 2WDEA 4LU9A 1HO5A 2DFJA 3THNA 3QFOA 2HY1A 5JPFA 4J6OA 3RL4A 4LTYA 4ZX2A 4JA9A 3DSDA 3CK2A 1S95A 3GVEA 3PSOA 4TUGA 2QFRA 4G9JA 2HYOA 4Q7FA 4H1YP 4ORBA 4DHLA 3DW8C 4FBWA 4JA7A 5B8IA 4IYPC 1NNWA 5JJTA 4HD0A 2XMOA 1S3NA 3QFMA 1S3LA 2AHDA 4FCXA 4V0XA 5INBA 2O8AA 4ORAA 1JK7A 1QHWA 4H1SA 2BCDA 1HPUA 2NYMC 2Z06A 1IT6A 3KBPA 4KBPA 4O4KA 4UT3A 3H67A 3AUZA 4I5LC 5C1VA 4B2OA 5F3WA 2IAEC 3H66A 3QFNA 4H2GA 4OR9A 3RL3A 2KKNA 2Z72A 2P6BA 4YKEA 4FBQA 3RL5A 1S3MA 3EGHA 4DT2A 2Q8UA 1OI8A 2HYPA 2JOGA 3T1IA 2NPPC 2NXFA 2IE4C 4V0VA 1V73A 2A22A 3JYFA 4XPNA 3E7BA 3IVEA 4O5GA 5GTUA 2R17A 1MF8A 2IE3C 1G5BA 3QFKA 4O43A 2ZBMA 5EQVA 4H2IA 1WAO1 1WARA 3P71C 3IB8A 5JPEA 4NZVA 2GJUA 3RQZA 3ICFA 4O24A 3IVDA 2O8GA 4ZVZA 4V0WA 4UT3B 3HVQA 2NYLC 2BDXA 4KKZA 2USHA 1AUIA 2BQ8X 1W24A 3LL8A 3QG5C 1OIEA 4LACC 3K7WC 1M63A 3DSCA 2QJCA 1UTEA 4H2FA 4MP0A 1Z2WA 3H62B 3N5UA 2WDCA 3H63A 3PSNA 4MOVA 3ZU0A 4ORCA 3K7VC 1USHA 1Z2XA 3C5WC 1OIDA 2Z1AA 3H68A 4MOYA 3IB7A 4FBKA 3THOB 3EGGA 1SU1A 4TUIA 5J28A 1HP1A 2WDDA 1UF3A 3C9FA 4M0VA 4DSYA 2CV9A 3FGAC 1T71A 2WDFA 3TGHA 1S8EA 1TCOA 3AV0A 3H64A
chains in the Genus database with same CATH superfamily
1S70A 4IL1A 1XM7A 1KBPA 3H60A 4I5NC 3V4YA 1FJMA 1T70A 3ZTVA 4F0ZA 1XZWA 3E7AA 5DNYA 5HPEA 3H61A 2QFPA 4H2BA 1QFCA 4WWLA 1II7A 4UT2A 5IOHA 2YVTA 4UWQA 3H69A 1U32A 4LU9A 1HO5A 2DFJA 3THNA 3QFOA 2HY1A 5JPFA 4J6OA 3RL4A 4LTYA 4ZX2A 4JA9A 3DSDA 3CK2A 3E0JA 1S95A 3FLOA 3GVEA 2YEQA 3PSOA 4TUGA 2QFRA 4G9JA 2HYOA 4Q7FA 4H1YP 4ORBA 4DHLA 3DW8C 4FBWA 4JA7A 5B8IA 4IYPC 1NNWA 5JJTA 4HD0A 2XMOA 1S3NA 3QFMA 1S3LA 2AHDA 4FCXA 4V0XA 5INBA 2O8AA 4ORAA 1JK7A 1QHWA 4H1SA 2BCDA 1HPUA 2NYMC 2Z06A 1IT6A 3KBPA 4KBPA 4O4KA 4UT3A 3H67A 3AUZA 4I5LC 5C1VA 4B2OA 5F3WA 2IAEC 3H66A 3QFNA 4H2GA 4OR9A 3RL3A 2KKNA 2Z72A 2P6BA 4YKEA 4FBQA 3RL5A 1S3MA 3EGHA 4DT2A 2Q8UA 1OI8A 2HYPA 3AV0A 2JOGA 3T1IA 2NPPC 2NXFA 2IE4C 4V0VA 1V73A 2A22A 3JYFA 4XPNA 3E7BA 3IVEA 4O5GA 5GTUA 2R17A 1MF8A 2IE3C 1G5BA 3QFKA 4O43A 2ZBMA 5EQVA 4H2IA 1WAO1 1WARA 3P71C 3IB8A 5JPEA 4NZVA 2ZOAA 2GJUA 3RQZA 3ICFA 4O24A 3IVDA 3D03A 2O8GA 4ZVZA 4V0WA 4UT3B 3HVQA 2NYLC 2BDXA 4KKZA 2USHA 1AUIA 2BQ8X 1W24A 3LL8A 3QG5C 1OIEA 4LACC 3K7WC 1M63A 3DSCA 2QJCA 1UTEA 4H2FA 4MP0A 1Z2WA 3H62B 3N5UA 2WDCA 3H63A 3PSNA 4MOVA 3ZU0A 4ORCA 3K7VC 1USHA 1Z2XA 3C5WC 1OIDA 2Z1AA 3H68A 4MOYA 3IB7A 4FBKA 2DXLA 3THOB 3EGGA 1SU1A 4TUIA 5J28A 1HP1A 2WDDA 1UF3A 2DXNA 3C9FA 4M0VA 4DSYA 2CV9A 3FGAC 1T71A 2WDFA 2ZO9B 3TGHA 1S8EA 1TCOA 2WDEA 3H64A
chains in the Genus database with same CATH topology
1S70A 4IL1A 1XM7A 1KBPA 3H60A 4I5NC 3V4YA 1FJMA 1T70A 3ZTVA 4F0ZA 1XZWA 3E7AA 5DNYA 5HPEA 3H61A 2QFPA 4H2BA 1QFCA 4WWLA 1II7A 4UT2A 5IOHA 2YVTA 4UWQA 3H69A 1U32A 4LU9A 1HO5A 2DFJA 3THNA 3QFOA 2HY1A 5JPFA 4J6OA 3RL4A 4LTYA 4ZX2A 4JA9A 3DSDA 3CK2A 3E0JA 1S95A 3FLOA 3GVEA 2YEQA 3PSOA 4TUGA 2QFRA 4G9JA 2HYOA 4Q7FA 4H1YP 4ORBA 4DHLA 3DW8C 4FBWA 4JA7A 5B8IA 4IYPC 1NNWA 5JJTA 4HD0A 2XMOA 1S3NA 3QFMA 1S3LA 2AHDA 4FCXA 4V0XA 5INBA 2O8AA 4ORAA 1JK7A 1QHWA 4H1SA 2BCDA 1HPUA 2NYMC 2Z06A 1IT6A 3KBPA 4KBPA 4O4KA 4UT3A 3H67A 3AUZA 4I5LC 5C1VA 4B2OA 5F3WA 2IAEC 3H66A 3QFNA 4H2GA 4OR9A 3RL3A 2KKNA 2Z72A 2P6BA 4YKEA 4FBQA 3RL5A 1S3MA 3EGHA 4DT2A 2Q8UA 1OI8A 2HYPA 3AV0A 2JOGA 3T1IA 2NPPC 2NXFA 2IE4C 4V0VA 1V73A 2A22A 3JYFA 4XPNA 3E7BA 3IVEA 4O5GA 5GTUA 2R17A 1MF8A 2IE3C 1G5BA 3QFKA 4O43A 2ZBMA 5EQVA 4H2IA 1WAO1 1WARA 3P71C 3IB8A 5JPEA 4NZVA 2ZOAA 2GJUA 3RQZA 3ICFA 4O24A 3IVDA 3D03A 2O8GA 4ZVZA 4V0WA 4UT3B 3HVQA 2NYLC 2BDXA 4KKZA 2USHA 1AUIA 2BQ8X 1W24A 3LL8A 3QG5C 1OIEA 4LACC 3K7WC 1M63A 3DSCA 2QJCA 1UTEA 4H2FA 4MP0A 1Z2WA 3H62B 3N5UA 2WDCA 3H63A 3PSNA 4MOVA 3ZU0A 4ORCA 3K7VC 1USHA 1Z2XA 3C5WC 1OIDA 2Z1AA 3H68A 4MOYA 3IB7A 4FBKA 2DXLA 3THOB 3EGGA 1SU1A 4TUIA 5J28A 1HP1A 2WDDA 1UF3A 2DXNA 3C9FA 4M0VA 4DSYA 2CV9A 3FGAC 1T71A 2WDFA 2ZO9B 3TGHA 1S8EA 1TCOA 2WDEA 3H64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S70 A;  4IL1 A;  1XM7 A;  1KBP A;  3H60 A;  4I5N C;  3V4Y A;  1FJM A;  1T70 A;  3ZTV A;  4F0Z A;  1XZW A;  3E7A A;  5DNY A;  5HPE A;  3H61 A;  2QFP A;  4H2B A;  1QFC A;  4WWL A;  1II7 A;  4UT2 A;  5IOH A;  2YVT A;  4UWQ A;  3H69 A;  1U32 A;  2WDE A;  4LU9 A;  1HO5 A;  2DFJ A;  3THN A;  3QFO A;  2HY1 A;  5JPF A;  4J6O A;  3RL4 A;  4LTY A;  4ZX2 A;  4JA9 A;  3DSD A;  3CK2 A;  1S95 A;  3GVE A;  3PSO A;  4TUG A;  2QFR A;  4G9J A;  2HYO A;  4Q7F A;  4H1Y P;  4ORB A;  4DHL A;  3DW8 C;  4FBW A;  4JA7 A;  5B8I A;  4IYP C;  1NNW A;  5JJT A;  4HD0 A;  2XMO A;  1S3N A;  3QFM A;  1S3L A;  2AHD A;  4FCX A;  4V0X A;  5INB A;  2O8A A;  4ORA A;  1JK7 A;  1QHW A;  4H1S A;  2BCD A;  1HPU A;  2NYM C;  2Z06 A;  1IT6 A;  3KBP A;  4KBP A;  4O4K A;  4UT3 A;  3H67 A;  3AUZ A;  4I5L C;  5C1V A;  4B2O A;  5F3W A;  2IAE C;  3H66 A;  3QFN A;  4H2G A;  4OR9 A;  3RL3 A;  2KKN A;  2Z72 A;  2P6B A;  4YKE A;  4FBQ A;  3RL5 A;  1S3M A;  3EGH A;  4DT2 A;  2Q8U A;  1OI8 A;  2HYP A;  2JOG A;  3T1I A;  2NPP C;  2NXF A;  2IE4 C;  4V0V A;  1V73 A;  2A22 A;  3JYF A;  4XPN A;  3E7B A;  3IVE A;  4O5G A;  5GTU A;  2R17 A;  1MF8 A;  2IE3 C;  1G5B A;  3QFK A;  4O43 A;  2ZBM A;  5EQV A;  4H2I A;  1WAO 1;  1WAR A;  3P71 C;  3IB8 A;  5JPE A;  4NZV A;  2GJU A;  3RQZ A;  3ICF A;  4O24 A;  3IVD A;  2O8G A;  4ZVZ A;  4V0W A;  4UT3 B;  3HVQ A;  2NYL C;  2BDX A;  4KKZ A;  2USH A;  1AUI A;  2BQ8 X;  1W24 A;  3LL8 A;  3QG5 C;  1OIE A;  4LAC C;  3K7W C;  1M63 A;  3DSC A;  2QJC A;  1UTE A;  4H2F A;  4MP0 A;  1Z2W A;  3H62 B;  3N5U A;  2WDC A;  3H63 A;  3PSN A;  4MOV A;  3ZU0 A;  4ORC A;  3K7V C;  1USH A;  1Z2X A;  3C5W C;  1OID A;  2Z1A A;  3H68 A;  4MOY A;  3IB7 A;  4FBK A;  3THO B;  3EGG A;  1SU1 A;  4TUI A;  5J28 A;  1HP1 A;  2WDD A;  1UF3 A;  3C9F A;  4M0V A;  4DSY A;  2CV9 A;  3FGA C;  1T71 A;  2WDF A;  3TGH A;  1S8E A;  1TCO A;  3AV0 A;  3H64 A; 
#chains in the Genus database with same CATH topology
 1S70 A;  4IL1 A;  1XM7 A;  1KBP A;  3H60 A;  4I5N C;  3V4Y A;  1FJM A;  1T70 A;  3ZTV A;  4F0Z A;  1XZW A;  3E7A A;  5DNY A;  5HPE A;  3H61 A;  2QFP A;  4H2B A;  1QFC A;  4WWL A;  1II7 A;  4UT2 A;  5IOH A;  2YVT A;  4UWQ A;  3H69 A;  1U32 A;  4LU9 A;  1HO5 A;  2DFJ A;  3THN A;  3QFO A;  2HY1 A;  5JPF A;  4J6O A;  3RL4 A;  4LTY A;  4ZX2 A;  4JA9 A;  3DSD A;  3CK2 A;  3E0J A;  1S95 A;  3FLO A;  3GVE A;  2YEQ A;  3PSO A;  4TUG A;  2QFR A;  4G9J A;  2HYO A;  4Q7F A;  4H1Y P;  4ORB A;  4DHL A;  3DW8 C;  4FBW A;  4JA7 A;  5B8I A;  4IYP C;  1NNW A;  5JJT A;  4HD0 A;  2XMO A;  1S3N A;  3QFM A;  1S3L A;  2AHD A;  4FCX A;  4V0X A;  5INB A;  2O8A A;  4ORA A;  1JK7 A;  1QHW A;  4H1S A;  2BCD A;  1HPU A;  2NYM C;  2Z06 A;  1IT6 A;  3KBP A;  4KBP A;  4O4K A;  4UT3 A;  3H67 A;  3AUZ A;  4I5L C;  5C1V A;  4B2O A;  5F3W A;  2IAE C;  3H66 A;  3QFN A;  4H2G A;  4OR9 A;  3RL3 A;  2KKN A;  2Z72 A;  2P6B A;  4YKE A;  4FBQ A;  3RL5 A;  1S3M A;  3EGH A;  4DT2 A;  2Q8U A;  1OI8 A;  2HYP A;  3AV0 A;  2JOG A;  3T1I A;  2NPP C;  2NXF A;  2IE4 C;  4V0V A;  1V73 A;  2A22 A;  3JYF A;  4XPN A;  3E7B A;  3IVE A;  4O5G A;  5GTU A;  2R17 A;  1MF8 A;  2IE3 C;  1G5B A;  3QFK A;  4O43 A;  2ZBM A;  5EQV A;  4H2I A;  1WAO 1;  1WAR A;  3P71 C;  3IB8 A;  5JPE A;  4NZV A;  2ZOA A;  2GJU A;  3RQZ A;  3ICF A;  4O24 A;  3IVD A;  3D03 A;  2O8G A;  4ZVZ A;  4V0W A;  4UT3 B;  3HVQ A;  2NYL C;  2BDX A;  4KKZ A;  2USH A;  1AUI A;  2BQ8 X;  1W24 A;  3LL8 A;  3QG5 C;  1OIE A;  4LAC C;  3K7W C;  1M63 A;  3DSC A;  2QJC A;  1UTE A;  4H2F A;  4MP0 A;  1Z2W A;  3H62 B;  3N5U A;  2WDC A;  3H63 A;  3PSN A;  4MOV A;  3ZU0 A;  4ORC A;  3K7V C;  1USH A;  1Z2X A;  3C5W C;  1OID A;  2Z1A A;  3H68 A;  4MOY A;  3IB7 A;  4FBK A;  2DXL A;  3THO B;  3EGG A;  1SU1 A;  4TUI A;  5J28 A;  1HP1 A;  2WDD A;  1UF3 A;  2DXN A;  3C9F A;  4M0V A;  4DSY A;  2CV9 A;  3FGA C;  1T71 A;  2WDF A;  2ZO9 B;  3TGH A;  1S8E A;  1TCO A;  2WDE A;  3H64 A; 
#chains in the Genus database with same CATH homology
 1S70 A;  4IL1 A;  1XM7 A;  1KBP A;  3H60 A;  4I5N C;  3V4Y A;  1FJM A;  1T70 A;  3ZTV A;  4F0Z A;  1XZW A;  3E7A A;  5DNY A;  5HPE A;  3H61 A;  2QFP A;  4H2B A;  1QFC A;  4WWL A;  1II7 A;  4UT2 A;  5IOH A;  2YVT A;  4UWQ A;  3H69 A;  1U32 A;  4LU9 A;  1HO5 A;  2DFJ A;  3THN A;  3QFO A;  2HY1 A;  5JPF A;  4J6O A;  3RL4 A;  4LTY A;  4ZX2 A;  4JA9 A;  3DSD A;  3CK2 A;  3E0J A;  1S95 A;  3FLO A;  3GVE A;  2YEQ A;  3PSO A;  4TUG A;  2QFR A;  4G9J A;  2HYO A;  4Q7F A;  4H1Y P;  4ORB A;  4DHL A;  3DW8 C;  4FBW A;  4JA7 A;  5B8I A;  4IYP C;  1NNW A;  5JJT A;  4HD0 A;  2XMO A;  1S3N A;  3QFM A;  1S3L A;  2AHD A;  4FCX A;  4V0X A;  5INB A;  2O8A A;  4ORA A;  1JK7 A;  1QHW A;  4H1S A;  2BCD A;  1HPU A;  2NYM C;  2Z06 A;  1IT6 A;  3KBP A;  4KBP A;  4O4K A;  4UT3 A;  3H67 A;  3AUZ A;  4I5L C;  5C1V A;  4B2O A;  5F3W A;  2IAE C;  3H66 A;  3QFN A;  4H2G A;  4OR9 A;  3RL3 A;  2KKN A;  2Z72 A;  2P6B A;  4YKE A;  4FBQ A;  3RL5 A;  1S3M A;  3EGH A;  4DT2 A;  2Q8U A;  1OI8 A;  2HYP A;  3AV0 A;  2JOG A;  3T1I A;  2NPP C;  2NXF A;  2IE4 C;  4V0V A;  1V73 A;  2A22 A;  3JYF A;  4XPN A;  3E7B A;  3IVE A;  4O5G A;  5GTU A;  2R17 A;  1MF8 A;  2IE3 C;  1G5B A;  3QFK A;  4O43 A;  2ZBM A;  5EQV A;  4H2I A;  1WAO 1;  1WAR A;  3P71 C;  3IB8 A;  5JPE A;  4NZV A;  2ZOA A;  2GJU A;  3RQZ A;  3ICF A;  4O24 A;  3IVD A;  3D03 A;  2O8G A;  4ZVZ A;  4V0W A;  4UT3 B;  3HVQ A;  2NYL C;  2BDX A;  4KKZ A;  2USH A;  1AUI A;  2BQ8 X;  1W24 A;  3LL8 A;  3QG5 C;  1OIE A;  4LAC C;  3K7W C;  1M63 A;  3DSC A;  2QJC A;  1UTE A;  4H2F A;  4MP0 A;  1Z2W A;  3H62 B;  3N5U A;  2WDC A;  3H63 A;  3PSN A;  4MOV A;  3ZU0 A;  4ORC A;  3K7V C;  1USH A;  1Z2X A;  3C5W C;  1OID A;  2Z1A A;  3H68 A;  4MOY A;  3IB7 A;  4FBK A;  2DXL A;  3THO B;  3EGG A;  1SU1 A;  4TUI A;  5J28 A;  1HP1 A;  2WDD A;  1UF3 A;  2DXN A;  3C9F A;  4M0V A;  4DSY A;  2CV9 A;  3FGA C;  1T71 A;  2WDF A;  2ZO9 B;  3TGH A;  1S8E A;  1TCO A;  2WDE A;  3H64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...