2USHA

5'-nucleotidase from e. coli
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
524
structure length
506
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVSERVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 5'-NUCLEOTIDASE
publication title X-ray structure of the Escherichia coli periplasmic 5'-nucleotidase containing a dimetal catalytic site.
pubmed doi rcsb
source organism Escherichia coli
total genus 175
structure length 506
sequence length 524
chains with identical sequence B
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2ushA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 2ushA02
4B2OA 5JPFA 2JOGA 3DSCA 1S3NA 3QFKA 3H67A 1S95A 2NYLC 2O8GA 4FBKA 4YKEA 1M63A 2BQ8X 4KBPA 4H2GA 1HPUA 3H66A 2P6BA 1T70A 3IB7A 5IOHA 1AUIA 3ZU0A 2NPPC 2NXFA 2QFRA 1JK7A 2IE4C 5JPEA 3RL5A 4TUIA 1S3MA 2O8AA 3H61A 1S70A 4ORBA 4M0VA 1SU1A 5INBA 4FCXA 2WDDA 4ORCA 4H2BA 1OIEA 4WWLA 1IT6A 4O24A 3T1IA 4MP0A 1W24A 2AHDA 3K7WC 2NYMC 4H1YP 3QG5C 4DHLA 1WAO1 4HD0A 4UWQA 3IB8A 3EGGA 4H2IA 3K7VC 3THNA 5F3WA 1T71A 1OI8A 1U32A 2WDEA 3IVEA 2YVTA 2Z06A 2KKNA 4V0XA 3H68A 2USHA 1HP1A 3ICFA 1UTEA 2CV9A 1S8EA 4O43A 3LL8A 3H63A 4G9JA 2A22A 1QHWA 4FBQA 3THOB 3H69A 4FBWA 3CK2A 3N5UA 5C1VA 2QJCA 3PSNA 2HYPA 5GTUA 5HPEA 2Q8UA 4H2FA 3HVQA 3IVDA 3DW8C 5J28A 4O5GA 5JJTA 1V73A 1II7A 3QFNA 4F0ZA 2GJUA 2WDCA 4ORAA 1Z2XA 3AV0A 3QFMA 4O4KA 2IAEC 1USHA 4DSYA 4I5NC 3QFOA 2Z1AA 1MF8A 4IYPC 4MOVA 3E7AA 4JA9A 4JA7A 3DSDA 4V0VA 4IL1A 2DFJA 4NZVA 4UT3A 3RL3A 3H60A 1Z2WA 1WARA 4LTYA 3GVEA 1XM7A 1XZWA 3KBPA 2ZBMA 1S3LA 3PSOA 4XPNA 3H64A 4UT2A 5EQVA 4ZX2A 3C9FA 4LACC 4LU9A 3V4YA 2BCDA 4Q7FA 5DNYA 4UT3B 4TUGA 2QFPA 4DT2A 2HY1A 4KKZA 3RQZA 2WDFA 1OIDA 1FJMA 1KBPA 2Z72A 5B8IA 1HO5A 3E7BA 4MOYA 4H1SA 3RL4A 4ZVZA 2HYOA 3ZTVA 3JYFA 3FGAC 1NNWA 4OR9A 3C5WC 1UF3A 2IE3C 2BDXA 3EGHA 1TCOA 4J6OA 3TGHA 3H62B 3P71C 1G5BA 2XMOA 4I5LC 4V0WA 1QFCA 3AUZA 2R17A
chains in the Genus database with same CATH superfamily
4B2OA 5JPFA 2JOGA 2ZO9B 3DSCA 1S3NA 3QFKA 3H67A 1S95A 2NYLC 2O8GA 2YEQA 4FBKA 1M63A 2BQ8X 4KBPA 4YKEA 4H2GA 1HPUA 3H66A 2P6BA 1T70A 3IB7A 5IOHA 1AUIA 3ZU0A 2NPPC 2NXFA 2QFRA 1JK7A 2IE4C 5JPEA 3RL5A 4TUIA 1S3MA 2O8AA 3H61A 1S70A 4ORBA 4M0VA 1SU1A 5INBA 4FCXA 2WDDA 4ORCA 4H2BA 1OIEA 4WWLA 1IT6A 4O24A 3T1IA 4MP0A 1W24A 2AHDA 3K7WC 2NYMC 4H1YP 3QG5C 4DHLA 1WAO1 4HD0A 4UWQA 3IB8A 3EGGA 4H2IA 3K7VC 3THNA 5F3WA 1T71A 1OI8A 1U32A 2WDEA 3IVEA 2YVTA 2Z06A 2KKNA 4V0XA 3H68A 2USHA 1HP1A 3ICFA 1UTEA 2CV9A 1S8EA 3E0JA 3LL8A 4O43A 3H63A 3FLOA 4G9JA 2DXLA 2A22A 1QHWA 4FBQA 3THOB 3H69A 4FBWA 3CK2A 3N5UA 5C1VA 2QJCA 3PSNA 2HYPA 5GTUA 5HPEA 2Q8UA 4H2FA 3HVQA 3IVDA 3DW8C 5J28A 4O5GA 5JJTA 1V73A 1II7A 3QFNA 4F0ZA 2GJUA 2DXNA 2WDCA 4ORAA 1Z2XA 3AV0A 3QFMA 4O4KA 2IAEC 1USHA 4DSYA 4I5NC 3QFOA 2Z1AA 1MF8A 4IYPC 4MOVA 3E7AA 4JA9A 4JA7A 3DSDA 4V0VA 4IL1A 2DFJA 4NZVA 4UT3A 3RL3A 3H60A 1Z2WA 1WARA 4LTYA 3GVEA 1XM7A 1XZWA 3KBPA 2ZBMA 1S3LA 3PSOA 4XPNA 3H64A 2ZOAA 4UT2A 5EQVA 4ZX2A 3C9FA 4LACC 4LU9A 3V4YA 2BCDA 4Q7FA 5DNYA 4UT3B 4TUGA 2QFPA 4DT2A 2HY1A 4KKZA 3RQZA 2WDFA 1OIDA 1FJMA 1KBPA 3D03A 2Z72A 5B8IA 1HO5A 3E7BA 4MOYA 4H1SA 3RL4A 4ZVZA 2HYOA 3ZTVA 3JYFA 3FGAC 1NNWA 4OR9A 3C5WC 1UF3A 2IE3C 2BDXA 3EGHA 1TCOA 4J6OA 3TGHA 3H62B 3P71C 1G5BA 2XMOA 4I5LC 4V0WA 1QFCA 3AUZA 2R17A
chains in the Genus database with same CATH topology
4B2OA 5JPFA 2JOGA 2ZO9B 3DSCA 1S3NA 3QFKA 3H67A 1S95A 2NYLC 2O8GA 2YEQA 4FBKA 1M63A 2BQ8X 4KBPA 4YKEA 4H2GA 1HPUA 3H66A 2P6BA 1T70A 3IB7A 5IOHA 1AUIA 3ZU0A 2NPPC 2NXFA 2QFRA 1JK7A 2IE4C 5JPEA 3RL5A 4TUIA 1S3MA 2O8AA 3H61A 1S70A 4ORBA 4M0VA 1SU1A 5INBA 4FCXA 2WDDA 4ORCA 4H2BA 1OIEA 4WWLA 1IT6A 4O24A 3T1IA 4MP0A 1W24A 2AHDA 3K7WC 2NYMC 4H1YP 3QG5C 4DHLA 1WAO1 4HD0A 4UWQA 3IB8A 3EGGA 4H2IA 3K7VC 3THNA 5F3WA 1T71A 1OI8A 1U32A 2WDEA 3IVEA 2YVTA 2Z06A 2KKNA 4V0XA 3H68A 2USHA 1HP1A 3ICFA 1UTEA 2CV9A 1S8EA 3E0JA 3LL8A 4O43A 3H63A 3FLOA 4G9JA 2DXLA 2A22A 1QHWA 4FBQA 3THOB 3H69A 4FBWA 3CK2A 3N5UA 5C1VA 2QJCA 3PSNA 2HYPA 5GTUA 5HPEA 2Q8UA 4H2FA 3HVQA 3IVDA 3DW8C 5J28A 4O5GA 5JJTA 1V73A 1II7A 3QFNA 4F0ZA 2GJUA 2DXNA 2WDCA 4ORAA 1Z2XA 3AV0A 3QFMA 4O4KA 2IAEC 1USHA 4DSYA 4I5NC 3QFOA 2Z1AA 1MF8A 4IYPC 4MOVA 3E7AA 4JA9A 4JA7A 3DSDA 4V0VA 4IL1A 2DFJA 4NZVA 4UT3A 3RL3A 3H60A 1Z2WA 1WARA 4LTYA 3GVEA 1XM7A 1XZWA 3KBPA 2ZBMA 1S3LA 3PSOA 4XPNA 3H64A 2ZOAA 4UT2A 5EQVA 4ZX2A 3C9FA 4LACC 4LU9A 3V4YA 2BCDA 4Q7FA 5DNYA 4UT3B 4TUGA 2QFPA 4DT2A 2HY1A 4KKZA 3RQZA 2WDFA 1OIDA 1FJMA 1KBPA 3D03A 2Z72A 5B8IA 1HO5A 3E7BA 4MOYA 4H1SA 3RL4A 4ZVZA 2HYOA 3ZTVA 3JYFA 3FGAC 1NNWA 4OR9A 3C5WC 1UF3A 2IE3C 2BDXA 3EGHA 1TCOA 4J6OA 3TGHA 3H62B 3P71C 1G5BA 2XMOA 4I5LC 4V0WA 1QFCA 3AUZA 2R17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B2O A;  5JPF A;  2JOG A;  3DSC A;  1S3N A;  3QFK A;  3H67 A;  1S95 A;  2NYL C;  2O8G A;  4FBK A;  4YKE A;  1M63 A;  2BQ8 X;  4KBP A;  4H2G A;  1HPU A;  3H66 A;  2P6B A;  1T70 A;  3IB7 A;  5IOH A;  1AUI A;  3ZU0 A;  2NPP C;  2NXF A;  2QFR A;  1JK7 A;  2IE4 C;  5JPE A;  3RL5 A;  4TUI A;  1S3M A;  2O8A A;  3H61 A;  1S70 A;  4ORB A;  4M0V A;  1SU1 A;  5INB A;  4FCX A;  2WDD A;  4ORC A;  4H2B A;  1OIE A;  4WWL A;  1IT6 A;  4O24 A;  3T1I A;  4MP0 A;  1W24 A;  2AHD A;  3K7W C;  2NYM C;  4H1Y P;  3QG5 C;  4DHL A;  1WAO 1;  4HD0 A;  4UWQ A;  3IB8 A;  3EGG A;  4H2I A;  3K7V C;  3THN A;  5F3W A;  1T71 A;  1OI8 A;  1U32 A;  2WDE A;  3IVE A;  2YVT A;  2Z06 A;  2KKN A;  4V0X A;  3H68 A;  2USH A;  1HP1 A;  3ICF A;  1UTE A;  2CV9 A;  1S8E A;  4O43 A;  3LL8 A;  3H63 A;  4G9J A;  2A22 A;  1QHW A;  4FBQ A;  3THO B;  3H69 A;  4FBW A;  3CK2 A;  3N5U A;  5C1V A;  2QJC A;  3PSN A;  2HYP A;  5GTU A;  5HPE A;  2Q8U A;  4H2F A;  3HVQ A;  3IVD A;  3DW8 C;  5J28 A;  4O5G A;  5JJT A;  1V73 A;  1II7 A;  3QFN A;  4F0Z A;  2GJU A;  2WDC A;  4ORA A;  1Z2X A;  3AV0 A;  3QFM A;  4O4K A;  2IAE C;  1USH A;  4DSY A;  4I5N C;  3QFO A;  2Z1A A;  1MF8 A;  4IYP C;  4MOV A;  3E7A A;  4JA9 A;  4JA7 A;  3DSD A;  4V0V A;  4IL1 A;  2DFJ A;  4NZV A;  4UT3 A;  3RL3 A;  3H60 A;  1Z2W A;  1WAR A;  4LTY A;  3GVE A;  1XM7 A;  1XZW A;  3KBP A;  2ZBM A;  1S3L A;  3PSO A;  4XPN A;  3H64 A;  4UT2 A;  5EQV A;  4ZX2 A;  3C9F A;  4LAC C;  4LU9 A;  3V4Y A;  2BCD A;  4Q7F A;  5DNY A;  4UT3 B;  4TUG A;  2QFP A;  4DT2 A;  2HY1 A;  4KKZ A;  3RQZ A;  2WDF A;  1OID A;  1FJM A;  1KBP A;  2Z72 A;  5B8I A;  1HO5 A;  3E7B A;  4MOY A;  4H1S A;  3RL4 A;  4ZVZ A;  2HYO A;  3ZTV A;  3JYF A;  3FGA C;  1NNW A;  4OR9 A;  3C5W C;  1UF3 A;  2IE3 C;  2BDX A;  3EGH A;  1TCO A;  4J6O A;  3TGH A;  3H62 B;  3P71 C;  1G5B A;  2XMO A;  4I5L C;  4V0W A;  1QFC A;  3AUZ A;  2R17 A; 
#chains in the Genus database with same CATH topology
 4B2O A;  5JPF A;  2JOG A;  2ZO9 B;  3DSC A;  1S3N A;  3QFK A;  3H67 A;  1S95 A;  2NYL C;  2O8G A;  2YEQ A;  4FBK A;  1M63 A;  2BQ8 X;  4KBP A;  4YKE A;  4H2G A;  1HPU A;  3H66 A;  2P6B A;  1T70 A;  3IB7 A;  5IOH A;  1AUI A;  3ZU0 A;  2NPP C;  2NXF A;  2QFR A;  1JK7 A;  2IE4 C;  5JPE A;  3RL5 A;  4TUI A;  1S3M A;  2O8A A;  3H61 A;  1S70 A;  4ORB A;  4M0V A;  1SU1 A;  5INB A;  4FCX A;  2WDD A;  4ORC A;  4H2B A;  1OIE A;  4WWL A;  1IT6 A;  4O24 A;  3T1I A;  4MP0 A;  1W24 A;  2AHD A;  3K7W C;  2NYM C;  4H1Y P;  3QG5 C;  4DHL A;  1WAO 1;  4HD0 A;  4UWQ A;  3IB8 A;  3EGG A;  4H2I A;  3K7V C;  3THN A;  5F3W A;  1T71 A;  1OI8 A;  1U32 A;  2WDE A;  3IVE A;  2YVT A;  2Z06 A;  2KKN A;  4V0X A;  3H68 A;  2USH A;  1HP1 A;  3ICF A;  1UTE A;  2CV9 A;  1S8E A;  3E0J A;  3LL8 A;  4O43 A;  3H63 A;  3FLO A;  4G9J A;  2DXL A;  2A22 A;  1QHW A;  4FBQ A;  3THO B;  3H69 A;  4FBW A;  3CK2 A;  3N5U A;  5C1V A;  2QJC A;  3PSN A;  2HYP A;  5GTU A;  5HPE A;  2Q8U A;  4H2F A;  3HVQ A;  3IVD A;  3DW8 C;  5J28 A;  4O5G A;  5JJT A;  1V73 A;  1II7 A;  3QFN A;  4F0Z A;  2GJU A;  2DXN A;  2WDC A;  4ORA A;  1Z2X A;  3AV0 A;  3QFM A;  4O4K A;  2IAE C;  1USH A;  4DSY A;  4I5N C;  3QFO A;  2Z1A A;  1MF8 A;  4IYP C;  4MOV A;  3E7A A;  4JA9 A;  4JA7 A;  3DSD A;  4V0V A;  4IL1 A;  2DFJ A;  4NZV A;  4UT3 A;  3RL3 A;  3H60 A;  1Z2W A;  1WAR A;  4LTY A;  3GVE A;  1XM7 A;  1XZW A;  3KBP A;  2ZBM A;  1S3L A;  3PSO A;  4XPN A;  3H64 A;  2ZOA A;  4UT2 A;  5EQV A;  4ZX2 A;  3C9F A;  4LAC C;  4LU9 A;  3V4Y A;  2BCD A;  4Q7F A;  5DNY A;  4UT3 B;  4TUG A;  2QFP A;  4DT2 A;  2HY1 A;  4KKZ A;  3RQZ A;  2WDF A;  1OID A;  1FJM A;  1KBP A;  3D03 A;  2Z72 A;  5B8I A;  1HO5 A;  3E7B A;  4MOY A;  4H1S A;  3RL4 A;  4ZVZ A;  2HYO A;  3ZTV A;  3JYF A;  3FGA C;  1NNW A;  4OR9 A;  3C5W C;  1UF3 A;  2IE3 C;  2BDX A;  3EGH A;  1TCO A;  4J6O A;  3TGH A;  3H62 B;  3P71 C;  1G5B A;  2XMO A;  4I5L C;  4V0W A;  1QFC A;  3AUZ A;  2R17 A; 
#chains in the Genus database with same CATH homology
 4B2O A;  5JPF A;  2JOG A;  2ZO9 B;  3DSC A;  1S3N A;  3QFK A;  3H67 A;  1S95 A;  2NYL C;  2O8G A;  2YEQ A;  4FBK A;  1M63 A;  2BQ8 X;  4KBP A;  4YKE A;  4H2G A;  1HPU A;  3H66 A;  2P6B A;  1T70 A;  3IB7 A;  5IOH A;  1AUI A;  3ZU0 A;  2NPP C;  2NXF A;  2QFR A;  1JK7 A;  2IE4 C;  5JPE A;  3RL5 A;  4TUI A;  1S3M A;  2O8A A;  3H61 A;  1S70 A;  4ORB A;  4M0V A;  1SU1 A;  5INB A;  4FCX A;  2WDD A;  4ORC A;  4H2B A;  1OIE A;  4WWL A;  1IT6 A;  4O24 A;  3T1I A;  4MP0 A;  1W24 A;  2AHD A;  3K7W C;  2NYM C;  4H1Y P;  3QG5 C;  4DHL A;  1WAO 1;  4HD0 A;  4UWQ A;  3IB8 A;  3EGG A;  4H2I A;  3K7V C;  3THN A;  5F3W A;  1T71 A;  1OI8 A;  1U32 A;  2WDE A;  3IVE A;  2YVT A;  2Z06 A;  2KKN A;  4V0X A;  3H68 A;  2USH A;  1HP1 A;  3ICF A;  1UTE A;  2CV9 A;  1S8E A;  3E0J A;  3LL8 A;  4O43 A;  3H63 A;  3FLO A;  4G9J A;  2DXL A;  2A22 A;  1QHW A;  4FBQ A;  3THO B;  3H69 A;  4FBW A;  3CK2 A;  3N5U A;  5C1V A;  2QJC A;  3PSN A;  2HYP A;  5GTU A;  5HPE A;  2Q8U A;  4H2F A;  3HVQ A;  3IVD A;  3DW8 C;  5J28 A;  4O5G A;  5JJT A;  1V73 A;  1II7 A;  3QFN A;  4F0Z A;  2GJU A;  2DXN A;  2WDC A;  4ORA A;  1Z2X A;  3AV0 A;  3QFM A;  4O4K A;  2IAE C;  1USH A;  4DSY A;  4I5N C;  3QFO A;  2Z1A A;  1MF8 A;  4IYP C;  4MOV A;  3E7A A;  4JA9 A;  4JA7 A;  3DSD A;  4V0V A;  4IL1 A;  2DFJ A;  4NZV A;  4UT3 A;  3RL3 A;  3H60 A;  1Z2W A;  1WAR A;  4LTY A;  3GVE A;  1XM7 A;  1XZW A;  3KBP A;  2ZBM A;  1S3L A;  3PSO A;  4XPN A;  3H64 A;  2ZOA A;  4UT2 A;  5EQV A;  4ZX2 A;  3C9F A;  4LAC C;  4LU9 A;  3V4Y A;  2BCD A;  4Q7F A;  5DNY A;  4UT3 B;  4TUG A;  2QFP A;  4DT2 A;  2HY1 A;  4KKZ A;  3RQZ A;  2WDF A;  1OID A;  1FJM A;  1KBP A;  3D03 A;  2Z72 A;  5B8I A;  1HO5 A;  3E7B A;  4MOY A;  4H1S A;  3RL4 A;  4ZVZ A;  2HYO A;  3ZTV A;  3JYF A;  3FGA C;  1NNW A;  4OR9 A;  3C5W C;  1UF3 A;  2IE3 C;  2BDX A;  3EGH A;  1TCO A;  4J6O A;  3TGH A;  3H62 B;  3P71 C;  1G5B A;  2XMO A;  4I5L C;  4V0W A;  1QFC A;  3AUZ A;  2R17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...