4F0ZA

Crystal structure of calcineurin in complex with the calcineurin-inhibiting domain of the african swine fever virus protein a238l
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
publication title The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 357
sequence length 357
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4f0zA00
1U32A 4UT3A 3ZTVA 1T70A 3AUZA 2IAEC 3H61A 5B8IA 4H2FA 1UTEA 3IB8A 4DT2A 4KKZA 2QFPA 3THNA 1QFCA 1S3LA 4O43A 4DHLA 2QJCA 2WDEA 1MF8A 3T1IA 5EQVA 2IE4C 3E7BA 4B2OA 4MOVA 4ORBA 5IOHA 1XM7A 2WDCA 4LACC 1T71A 2ZBMA 3KBPA 2BDXA 5HPEA 5INBA 4TUIA 4H1SA 5C1VA 4ZX2A 5GTUA 3JYFA 4ORCA 2WDFA 4O4KA 3FGAC 2DFJA 3PSNA 3H64A 4WWLA 3V4YA 4IL1A 3DW8C 1II7A 2NXFA 1OI8A 3ZU0A 3THOB 3EGGA 4O5GA 1SU1A 2Q8UA 3H69A 2AHDA 2HY1A 2HYOA 3N5UA 3QFOA 2QFRA 3P71C 3QFNA 5JPFA 4FCXA 3IVDA 2O8GA 4F0ZA 2O8AA 3H62B 4G9JA 3IB7A 4V0VA 3ICFA 2WDDA 4V0XA 3H60A 4KBPA 2USHA 2Z06A 4JA7A 1AUIA 3TGHA 1Z2XA 3GVEA 2R17A 4M0VA 5DNYA 2Z1AA 2XMOA 4I5LC 4HD0A 4ORAA 2NYLC 3QG5C 3PSOA 4H1YP 1M63A 4UT2A 1NNWA 3RL5A 1Z2WA 1S8EA 4LU9A 2GJUA 3C9FA 3CK2A 4H2IA 4NZVA 4ZVZA 5JPEA 3DSDA 1HP1A 2BCDA 3H66A 3RL4A 2CV9A 3RQZA 2YVTA 1OIEA 4FBQA 1WARA 4H2GA 1TCOA 4H2BA 1WAO1 1XZWA 3IVEA 4MP0A 1G5BA 1V73A 3HVQA 1JK7A 4JA9A 4V0WA 3K7VC 5F3WA 1HO5A 1W24A 2JOGA 3QFKA 4IYPC 4LTYA 4O24A 1HPUA 1S95A 3C5WC 1OIDA 2A22A 3E7AA 4I5NC 4UWQA 3RL3A 1FJMA 3LL8A 4XPNA 4MOYA 3H68A 1S3MA 4Q7FA 2KKNA 5J28A 1KBPA 3H67A 4FBWA 3H63A 4J6OA 2NYMC 3DSCA 4FBKA 3K7WC 2Z72A 5JJTA 1IT6A 4TUGA 1UF3A 4YKEA 3AV0A 2BQ8X 1S3NA 1QHWA 3EGHA 4UT3B 2NPPC 1USHA 4DSYA 3QFMA 2P6BA 1S70A 4OR9A 2IE3C 2HYPA
chains in the Genus database with same CATH superfamily
1U32A 4UT3A 3ZTVA 1T70A 3AUZA 2IAEC 3H61A 5B8IA 4H2FA 1UTEA 3IB8A 4DT2A 4KKZA 2QFPA 3THNA 1QFCA 1S3LA 4O43A 4DHLA 2QJCA 2WDEA 1MF8A 3T1IA 5EQVA 2IE4C 3E7BA 4B2OA 4MOVA 4ORBA 5IOHA 1XM7A 2WDCA 4LACC 2YEQA 1T71A 2ZBMA 3KBPA 2BDXA 5HPEA 5INBA 4TUIA 4H1SA 5C1VA 4ZX2A 5GTUA 3JYFA 4ORCA 2WDFA 4O4KA 3FGAC 2DFJA 3PSNA 3H64A 4WWLA 3V4YA 4IL1A 3DW8C 1II7A 2NXFA 1OI8A 3ZU0A 3THOB 3EGGA 4O5GA 1SU1A 2Q8UA 3H69A 2AHDA 2HY1A 2HYOA 3N5UA 3QFOA 2QFRA 3P71C 3QFNA 5JPFA 4FCXA 3IVDA 2O8GA 4F0ZA 2O8AA 2DXNA 3H62B 4G9JA 3IB7A 4V0VA 3ICFA 2WDDA 4V0XA 3H60A 4KBPA 2USHA 2Z06A 4JA7A 1AUIA 3TGHA 1Z2XA 3GVEA 3FLOA 2R17A 4M0VA 5DNYA 2Z1AA 2XMOA 4I5LC 4HD0A 4ORAA 2NYLC 3QG5C 3PSOA 4H1YP 1M63A 4UT2A 1NNWA 3RL5A 1Z2WA 3D03A 1S8EA 4LU9A 2GJUA 3C9FA 3CK2A 4H2IA 4NZVA 4ZVZA 5JPEA 3DSDA 1HP1A 2DXLA 2BCDA 3H66A 3RL4A 2CV9A 3RQZA 2YVTA 1OIEA 2ZO9B 4FBQA 1WARA 4H2GA 1TCOA 4H2BA 1WAO1 1XZWA 3IVEA 4MP0A 1G5BA 1V73A 3HVQA 1JK7A 2ZOAA 4JA9A 4V0WA 3K7VC 5F3WA 1HO5A 1W24A 2JOGA 3E0JA 3QFKA 4IYPC 4LTYA 4O24A 1HPUA 1S95A 3C5WC 1OIDA 2A22A 3E7AA 4I5NC 4UWQA 3RL3A 1FJMA 3LL8A 4XPNA 4MOYA 3H68A 1S3MA 4Q7FA 2KKNA 5J28A 1KBPA 3H67A 4FBWA 3H63A 4J6OA 2NYMC 3DSCA 4FBKA 3K7WC 2Z72A 5JJTA 1IT6A 4TUGA 1UF3A 4YKEA 3AV0A 2BQ8X 1S3NA 1QHWA 3EGHA 4UT3B 2NPPC 1USHA 4DSYA 3QFMA 2P6BA 1S70A 4OR9A 2IE3C 2HYPA
chains in the Genus database with same CATH topology
1U32A 4UT3A 3ZTVA 1T70A 3AUZA 2IAEC 3H61A 5B8IA 4H2FA 1UTEA 3IB8A 4DT2A 4KKZA 2QFPA 3THNA 1QFCA 1S3LA 4O43A 4DHLA 2QJCA 2WDEA 1MF8A 3T1IA 5EQVA 2IE4C 3E7BA 4B2OA 4MOVA 4ORBA 5IOHA 1XM7A 2WDCA 4LACC 2YEQA 1T71A 2ZBMA 3KBPA 2BDXA 5HPEA 5INBA 4TUIA 4H1SA 5C1VA 4ZX2A 5GTUA 3JYFA 4ORCA 2WDFA 4O4KA 3FGAC 2DFJA 3PSNA 3H64A 4WWLA 3V4YA 4IL1A 3DW8C 1II7A 2NXFA 1OI8A 3ZU0A 3THOB 3EGGA 4O5GA 1SU1A 2Q8UA 3H69A 2AHDA 2HY1A 2HYOA 3N5UA 3QFOA 2QFRA 3P71C 3QFNA 5JPFA 4FCXA 3IVDA 2O8GA 4F0ZA 2O8AA 2DXNA 3H62B 4G9JA 3IB7A 4V0VA 3ICFA 2WDDA 4V0XA 3H60A 4KBPA 2USHA 2Z06A 4JA7A 1AUIA 3TGHA 1Z2XA 3GVEA 3FLOA 2R17A 4M0VA 5DNYA 2Z1AA 2XMOA 4I5LC 4HD0A 4ORAA 2NYLC 3QG5C 3PSOA 4H1YP 1M63A 4UT2A 1NNWA 3RL5A 1Z2WA 3D03A 1S8EA 4LU9A 2GJUA 3C9FA 3CK2A 4H2IA 4NZVA 4ZVZA 5JPEA 3DSDA 1HP1A 2DXLA 2BCDA 3H66A 3RL4A 2CV9A 3RQZA 2YVTA 1OIEA 2ZO9B 4FBQA 1WARA 4H2GA 1TCOA 4H2BA 1WAO1 1XZWA 3IVEA 4MP0A 1G5BA 1V73A 3HVQA 1JK7A 2ZOAA 4JA9A 4V0WA 3K7VC 5F3WA 1HO5A 1W24A 2JOGA 3E0JA 3QFKA 4IYPC 4LTYA 4O24A 1HPUA 1S95A 3C5WC 1OIDA 2A22A 3E7AA 4I5NC 4UWQA 3RL3A 1FJMA 3LL8A 4XPNA 4MOYA 3H68A 1S3MA 4Q7FA 2KKNA 5J28A 1KBPA 3H67A 4FBWA 3H63A 4J6OA 2NYMC 3DSCA 4FBKA 3K7WC 2Z72A 5JJTA 1IT6A 4TUGA 1UF3A 4YKEA 3AV0A 2BQ8X 1S3NA 1QHWA 3EGHA 4UT3B 2NPPC 1USHA 4DSYA 3QFMA 2P6BA 1S70A 4OR9A 2IE3C 2HYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U32 A;  4UT3 A;  3ZTV A;  1T70 A;  3AUZ A;  2IAE C;  3H61 A;  5B8I A;  4H2F A;  1UTE A;  3IB8 A;  4DT2 A;  4KKZ A;  2QFP A;  3THN A;  1QFC A;  1S3L A;  4O43 A;  4DHL A;  2QJC A;  2WDE A;  1MF8 A;  3T1I A;  5EQV A;  2IE4 C;  3E7B A;  4B2O A;  4MOV A;  4ORB A;  5IOH A;  1XM7 A;  2WDC A;  4LAC C;  1T71 A;  2ZBM A;  3KBP A;  2BDX A;  5HPE A;  5INB A;  4TUI A;  4H1S A;  5C1V A;  4ZX2 A;  5GTU A;  3JYF A;  4ORC A;  2WDF A;  4O4K A;  3FGA C;  2DFJ A;  3PSN A;  3H64 A;  4WWL A;  3V4Y A;  4IL1 A;  3DW8 C;  1II7 A;  2NXF A;  1OI8 A;  3ZU0 A;  3THO B;  3EGG A;  4O5G A;  1SU1 A;  2Q8U A;  3H69 A;  2AHD A;  2HY1 A;  2HYO A;  3N5U A;  3QFO A;  2QFR A;  3P71 C;  3QFN A;  5JPF A;  4FCX A;  3IVD A;  2O8G A;  4F0Z A;  2O8A A;  3H62 B;  4G9J A;  3IB7 A;  4V0V A;  3ICF A;  2WDD A;  4V0X A;  3H60 A;  4KBP A;  2USH A;  2Z06 A;  4JA7 A;  1AUI A;  3TGH A;  1Z2X A;  3GVE A;  2R17 A;  4M0V A;  5DNY A;  2Z1A A;  2XMO A;  4I5L C;  4HD0 A;  4ORA A;  2NYL C;  3QG5 C;  3PSO A;  4H1Y P;  1M63 A;  4UT2 A;  1NNW A;  3RL5 A;  1Z2W A;  1S8E A;  4LU9 A;  2GJU A;  3C9F A;  3CK2 A;  4H2I A;  4NZV A;  4ZVZ A;  5JPE A;  3DSD A;  1HP1 A;  2BCD A;  3H66 A;  3RL4 A;  2CV9 A;  3RQZ A;  2YVT A;  1OIE A;  4FBQ A;  1WAR A;  4H2G A;  1TCO A;  4H2B A;  1WAO 1;  1XZW A;  3IVE A;  4MP0 A;  1G5B A;  1V73 A;  3HVQ A;  1JK7 A;  4JA9 A;  4V0W A;  3K7V C;  5F3W A;  1HO5 A;  1W24 A;  2JOG A;  3QFK A;  4IYP C;  4LTY A;  4O24 A;  1HPU A;  1S95 A;  3C5W C;  1OID A;  2A22 A;  3E7A A;  4I5N C;  4UWQ A;  3RL3 A;  1FJM A;  3LL8 A;  4XPN A;  4MOY A;  3H68 A;  1S3M A;  4Q7F A;  2KKN A;  5J28 A;  1KBP A;  3H67 A;  4FBW A;  3H63 A;  4J6O A;  2NYM C;  3DSC A;  4FBK A;  3K7W C;  2Z72 A;  5JJT A;  1IT6 A;  4TUG A;  1UF3 A;  4YKE A;  3AV0 A;  2BQ8 X;  1S3N A;  1QHW A;  3EGH A;  4UT3 B;  2NPP C;  1USH A;  4DSY A;  3QFM A;  2P6B A;  1S70 A;  4OR9 A;  2IE3 C;  2HYP A; 
#chains in the Genus database with same CATH topology
 1U32 A;  4UT3 A;  3ZTV A;  1T70 A;  3AUZ A;  2IAE C;  3H61 A;  5B8I A;  4H2F A;  1UTE A;  3IB8 A;  4DT2 A;  4KKZ A;  2QFP A;  3THN A;  1QFC A;  1S3L A;  4O43 A;  4DHL A;  2QJC A;  2WDE A;  1MF8 A;  3T1I A;  5EQV A;  2IE4 C;  3E7B A;  4B2O A;  4MOV A;  4ORB A;  5IOH A;  1XM7 A;  2WDC A;  4LAC C;  2YEQ A;  1T71 A;  2ZBM A;  3KBP A;  2BDX A;  5HPE A;  5INB A;  4TUI A;  4H1S A;  5C1V A;  4ZX2 A;  5GTU A;  3JYF A;  4ORC A;  2WDF A;  4O4K A;  3FGA C;  2DFJ A;  3PSN A;  3H64 A;  4WWL A;  3V4Y A;  4IL1 A;  3DW8 C;  1II7 A;  2NXF A;  1OI8 A;  3ZU0 A;  3THO B;  3EGG A;  4O5G A;  1SU1 A;  2Q8U A;  3H69 A;  2AHD A;  2HY1 A;  2HYO A;  3N5U A;  3QFO A;  2QFR A;  3P71 C;  3QFN A;  5JPF A;  4FCX A;  3IVD A;  2O8G A;  4F0Z A;  2O8A A;  2DXN A;  3H62 B;  4G9J A;  3IB7 A;  4V0V A;  3ICF A;  2WDD A;  4V0X A;  3H60 A;  4KBP A;  2USH A;  2Z06 A;  4JA7 A;  1AUI A;  3TGH A;  1Z2X A;  3GVE A;  3FLO A;  2R17 A;  4M0V A;  5DNY A;  2Z1A A;  2XMO A;  4I5L C;  4HD0 A;  4ORA A;  2NYL C;  3QG5 C;  3PSO A;  4H1Y P;  1M63 A;  4UT2 A;  1NNW A;  3RL5 A;  1Z2W A;  3D03 A;  1S8E A;  4LU9 A;  2GJU A;  3C9F A;  3CK2 A;  4H2I A;  4NZV A;  4ZVZ A;  5JPE A;  3DSD A;  1HP1 A;  2DXL A;  2BCD A;  3H66 A;  3RL4 A;  2CV9 A;  3RQZ A;  2YVT A;  1OIE A;  2ZO9 B;  4FBQ A;  1WAR A;  4H2G A;  1TCO A;  4H2B A;  1WAO 1;  1XZW A;  3IVE A;  4MP0 A;  1G5B A;  1V73 A;  3HVQ A;  1JK7 A;  2ZOA A;  4JA9 A;  4V0W A;  3K7V C;  5F3W A;  1HO5 A;  1W24 A;  2JOG A;  3E0J A;  3QFK A;  4IYP C;  4LTY A;  4O24 A;  1HPU A;  1S95 A;  3C5W C;  1OID A;  2A22 A;  3E7A A;  4I5N C;  4UWQ A;  3RL3 A;  1FJM A;  3LL8 A;  4XPN A;  4MOY A;  3H68 A;  1S3M A;  4Q7F A;  2KKN A;  5J28 A;  1KBP A;  3H67 A;  4FBW A;  3H63 A;  4J6O A;  2NYM C;  3DSC A;  4FBK A;  3K7W C;  2Z72 A;  5JJT A;  1IT6 A;  4TUG A;  1UF3 A;  4YKE A;  3AV0 A;  2BQ8 X;  1S3N A;  1QHW A;  3EGH A;  4UT3 B;  2NPP C;  1USH A;  4DSY A;  3QFM A;  2P6B A;  1S70 A;  4OR9 A;  2IE3 C;  2HYP A; 
#chains in the Genus database with same CATH homology
 1U32 A;  4UT3 A;  3ZTV A;  1T70 A;  3AUZ A;  2IAE C;  3H61 A;  5B8I A;  4H2F A;  1UTE A;  3IB8 A;  4DT2 A;  4KKZ A;  2QFP A;  3THN A;  1QFC A;  1S3L A;  4O43 A;  4DHL A;  2QJC A;  2WDE A;  1MF8 A;  3T1I A;  5EQV A;  2IE4 C;  3E7B A;  4B2O A;  4MOV A;  4ORB A;  5IOH A;  1XM7 A;  2WDC A;  4LAC C;  2YEQ A;  1T71 A;  2ZBM A;  3KBP A;  2BDX A;  5HPE A;  5INB A;  4TUI A;  4H1S A;  5C1V A;  4ZX2 A;  5GTU A;  3JYF A;  4ORC A;  2WDF A;  4O4K A;  3FGA C;  2DFJ A;  3PSN A;  3H64 A;  4WWL A;  3V4Y A;  4IL1 A;  3DW8 C;  1II7 A;  2NXF A;  1OI8 A;  3ZU0 A;  3THO B;  3EGG A;  4O5G A;  1SU1 A;  2Q8U A;  3H69 A;  2AHD A;  2HY1 A;  2HYO A;  3N5U A;  3QFO A;  2QFR A;  3P71 C;  3QFN A;  5JPF A;  4FCX A;  3IVD A;  2O8G A;  4F0Z A;  2O8A A;  2DXN A;  3H62 B;  4G9J A;  3IB7 A;  4V0V A;  3ICF A;  2WDD A;  4V0X A;  3H60 A;  4KBP A;  2USH A;  2Z06 A;  4JA7 A;  1AUI A;  3TGH A;  1Z2X A;  3GVE A;  3FLO A;  2R17 A;  4M0V A;  5DNY A;  2Z1A A;  2XMO A;  4I5L C;  4HD0 A;  4ORA A;  2NYL C;  3QG5 C;  3PSO A;  4H1Y P;  1M63 A;  4UT2 A;  1NNW A;  3RL5 A;  1Z2W A;  3D03 A;  1S8E A;  4LU9 A;  2GJU A;  3C9F A;  3CK2 A;  4H2I A;  4NZV A;  4ZVZ A;  5JPE A;  3DSD A;  1HP1 A;  2DXL A;  2BCD A;  3H66 A;  3RL4 A;  2CV9 A;  3RQZ A;  2YVT A;  1OIE A;  2ZO9 B;  4FBQ A;  1WAR A;  4H2G A;  1TCO A;  4H2B A;  1WAO 1;  1XZW A;  3IVE A;  4MP0 A;  1G5B A;  1V73 A;  3HVQ A;  1JK7 A;  2ZOA A;  4JA9 A;  4V0W A;  3K7V C;  5F3W A;  1HO5 A;  1W24 A;  2JOG A;  3E0J A;  3QFK A;  4IYP C;  4LTY A;  4O24 A;  1HPU A;  1S95 A;  3C5W C;  1OID A;  2A22 A;  3E7A A;  4I5N C;  4UWQ A;  3RL3 A;  1FJM A;  3LL8 A;  4XPN A;  4MOY A;  3H68 A;  1S3M A;  4Q7F A;  2KKN A;  5J28 A;  1KBP A;  3H67 A;  4FBW A;  3H63 A;  4J6O A;  2NYM C;  3DSC A;  4FBK A;  3K7W C;  2Z72 A;  5JJT A;  1IT6 A;  4TUG A;  1UF3 A;  4YKE A;  3AV0 A;  2BQ8 X;  1S3N A;  1QHW A;  3EGH A;  4UT3 B;  2NPP C;  1USH A;  4DSY A;  3QFM A;  2P6B A;  1S70 A;  4OR9 A;  2IE3 C;  2HYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...