4F0ZA

Crystal structure of calcineurin in complex with the calcineurin-inhibiting domain of the african swine fever virus protein a238l
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
total genus 118
structure length 357
sequence length 357
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4f0zA00
1XZWA 3ICFA 4ZVZA 5IOHA 4FCXA 4DSYA 1T70A 2CV9A 3EGHA 1QHWA 3QFNA 4ORBA 4OR9A 4LU9A 4I5LC 2JOGA 3QFOA 2Z06A 1OIDA 4G9JA 3RL4A 1NNWA 2IE4C 4KBPA 3H69A 2YVTA 1S95A 1AUIA 3C5WC 3DSDA 1II7A 3H60A 2WDEA 1S3MA 4ORCA 1S3NA 4Q7FA 4MOVA 2NXFA 3P71C 2BDXA 4H2FA 5GTUA 2HY1A 2DFJA 1V73A 2QJCA 2WDCA 4MP0A 2A22A 2Z72A 2NPPC 4H2BA 3AV0A 3PSNA 1U32A 4O5GA 2P6BA 4ZX2A 4V0XA 1HO5A 3FGAC 4IYPC 4MOYA 2BQ8X 3E7BA 4JA9A 1T71A 5HPEA 3RL5A 1UF3A 5INBA 3CK2A 3AUZA 5F3WA 1TCOA 2Q8UA 3E7AA 1XM7A 3H64A 3KBPA 4FBWA 4FBQA 2GJUA 2BCDA 2USHA 2HYPA 4TUGA 4FBKA 5J28A 2R17A 2NYLC 2QFRA 2Z1AA 3DW8C 5B8IA 4I5NC 4DHLA 3LL8A 1G5BA 3RL3A 3IVEA 4H2IA 3H68A 3EGGA 2XMOA 2WDFA 1SU1A 1KBPA 3K7VC 4TUIA 5EQVA 4LTYA 3H63A 3N5UA 1JK7A 4H1YP 1QFCA 3ZTVA 3C9FA 4UT3A 1IT6A 3HVQA 1S3LA 1Z2WA 4XPNA 1S8EA 1FJMA 1MF8A 4IL1A 1Z2XA 2AHDA 1OIEA 3IB8A 1M63A 1UTEA 1W24A 3H62B 4J6OA 5JJTA 4WWLA 5DNYA 3QFKA 4LACC 2IE3C 2O8AA 2O8GA 3K7WC 2HYOA 4JA7A 4O4KA 4H2GA 3IB7A 4NZVA 1HP1A 3JYFA 3T1IA 4UT2A 4O43A 3THNA 1WARA 3H61A 4M0VA 3QG5C 3ZU0A 4UT3B 4B2OA 4DT2A 4V0WA 2NYMC 2KKNA 1USHA 4YKEA 5C1VA 2IAEC 1S70A 3H67A 4O24A 4HD0A 5JPEA 2ZBMA 4KKZA 1HPUA 3QFMA 2QFPA 3DSCA 3GVEA 3TGHA 1OI8A 4H1SA 4F0ZA 1WAO1 2WDDA 3PSOA 4ORAA 4UWQA 3THOB 3H66A 5JPFA 4V0VA 3IVDA 3RQZA 3V4YA
chains in the Genus database with same CATH superfamily
1XZWA 3ICFA 4ZVZA 5IOHA 4FCXA 4DSYA 1T70A 2CV9A 3EGHA 1QHWA 3QFNA 4ORBA 4OR9A 4LU9A 4I5LC 2JOGA 3QFOA 2Z06A 1OIDA 4G9JA 3RL4A 1NNWA 2IE4C 4KBPA 3D03A 3H69A 2YVTA 1S95A 1AUIA 3C5WC 3DSDA 1II7A 2DXNA 3H60A 2WDEA 1S3MA 4ORCA 1S3NA 4Q7FA 4MOVA 2NXFA 3P71C 2BDXA 4H2FA 5GTUA 2HY1A 2DFJA 1V73A 2QJCA 2WDCA 4MP0A 2A22A 2Z72A 2NPPC 4H2BA 3AV0A 3PSNA 1U32A 2ZOAA 2P6BA 4O5GA 4ZX2A 4V0XA 1HO5A 3FGAC 4IYPC 4MOYA 2BQ8X 3E7BA 4JA9A 1T71A 5HPEA 3RL5A 1UF3A 5INBA 3CK2A 3AUZA 5F3WA 1TCOA 2Q8UA 2DXLA 1XM7A 3E7AA 3H64A 3KBPA 4FBWA 2GJUA 2BCDA 4FBQA 2USHA 2HYPA 4TUGA 4FBKA 5J28A 2R17A 2NYLC 2QFRA 2Z1AA 3DW8C 5B8IA 4I5NC 4DHLA 3LL8A 1G5BA 3RL3A 3IVEA 4H2IA 3H68A 3EGGA 2XMOA 2WDFA 1SU1A 1KBPA 3K7VC 4TUIA 5EQVA 4LTYA 3H63A 3N5UA 1JK7A 2ZO9B 4H1YP 1QFCA 3ZTVA 3C9FA 4UT3A 1IT6A 3HVQA 1S3LA 1Z2WA 4XPNA 1S8EA 2YEQA 1FJMA 1MF8A 4IL1A 1Z2XA 2AHDA 1OIEA 3IB8A 1M63A 1UTEA 1W24A 3H62B 4J6OA 5JJTA 4WWLA 5DNYA 3QFKA 4LACC 2IE3C 2O8AA 2O8GA 3E0JA 3K7WC 2HYOA 4JA7A 4O4KA 4H2GA 3IB7A 3V4YA 4NZVA 1HP1A 3JYFA 3T1IA 4UT2A 4O43A 3THNA 1WARA 3H61A 4M0VA 3QG5C 3ZU0A 4UT3B 4B2OA 4DT2A 4V0WA 2NYMC 2KKNA 1USHA 4YKEA 5C1VA 2IAEC 1S70A 3H67A 4O24A 4HD0A 5JPEA 2ZBMA 4KKZA 1HPUA 3QFMA 2QFPA 3DSCA 3GVEA 3TGHA 1OI8A 4H1SA 4F0ZA 1WAO1 2WDDA 3PSOA 4ORAA 4UWQA 3THOB 3H66A 5JPFA 4V0VA 3IVDA 3RQZA 3FLOA
chains in the Genus database with same CATH topology
1XZWA 3ICFA 4ZVZA 5IOHA 4FCXA 4DSYA 1T70A 2CV9A 3EGHA 1QHWA 3QFNA 4ORBA 4OR9A 4LU9A 4I5LC 2JOGA 3QFOA 2Z06A 1OIDA 4G9JA 3RL4A 1NNWA 2IE4C 4KBPA 3D03A 3H69A 2YVTA 1S95A 1AUIA 3C5WC 3DSDA 1II7A 2DXNA 3H60A 2WDEA 1S3MA 4ORCA 1S3NA 4Q7FA 4MOVA 2NXFA 3P71C 2BDXA 4H2FA 5GTUA 2HY1A 2DFJA 1V73A 2QJCA 2WDCA 4MP0A 2A22A 2Z72A 2NPPC 4H2BA 3AV0A 3PSNA 1U32A 2ZOAA 2P6BA 4O5GA 4ZX2A 4V0XA 1HO5A 3FGAC 4IYPC 4MOYA 2BQ8X 3E7BA 4JA9A 1T71A 5HPEA 3RL5A 1UF3A 5INBA 3CK2A 3AUZA 5F3WA 1TCOA 2Q8UA 2DXLA 1XM7A 3E7AA 3H64A 3KBPA 4FBWA 2GJUA 2BCDA 4FBQA 2USHA 2HYPA 4TUGA 4FBKA 5J28A 2R17A 2NYLC 2QFRA 2Z1AA 3DW8C 5B8IA 4I5NC 4DHLA 3LL8A 1G5BA 3RL3A 3IVEA 4H2IA 3H68A 3EGGA 2XMOA 2WDFA 1SU1A 1KBPA 3K7VC 4TUIA 5EQVA 4LTYA 3H63A 3N5UA 1JK7A 2ZO9B 4H1YP 1QFCA 3ZTVA 3C9FA 4UT3A 1IT6A 3HVQA 1S3LA 1Z2WA 4XPNA 1S8EA 2YEQA 1FJMA 1MF8A 4IL1A 1Z2XA 2AHDA 1OIEA 3IB8A 1M63A 1UTEA 1W24A 3H62B 4J6OA 5JJTA 4WWLA 5DNYA 3QFKA 4LACC 2IE3C 2O8AA 2O8GA 3E0JA 3K7WC 2HYOA 4JA7A 4O4KA 4H2GA 3IB7A 3V4YA 4NZVA 1HP1A 3JYFA 3T1IA 4UT2A 4O43A 3THNA 1WARA 3H61A 4M0VA 3QG5C 3ZU0A 4UT3B 4B2OA 4DT2A 4V0WA 2NYMC 2KKNA 1USHA 4YKEA 5C1VA 2IAEC 1S70A 3H67A 4O24A 4HD0A 5JPEA 2ZBMA 4KKZA 1HPUA 3QFMA 2QFPA 3DSCA 3GVEA 3TGHA 1OI8A 4H1SA 4F0ZA 1WAO1 2WDDA 3PSOA 4ORAA 4UWQA 3THOB 3H66A 5JPFA 4V0VA 3IVDA 3RQZA 3FLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZW A;  3ICF A;  4ZVZ A;  5IOH A;  4FCX A;  4DSY A;  1T70 A;  2CV9 A;  3EGH A;  1QHW A;  3QFN A;  4ORB A;  4OR9 A;  4LU9 A;  4I5L C;  2JOG A;  3QFO A;  2Z06 A;  1OID A;  4G9J A;  3RL4 A;  1NNW A;  2IE4 C;  4KBP A;  3H69 A;  2YVT A;  1S95 A;  1AUI A;  3C5W C;  3DSD A;  1II7 A;  3H60 A;  2WDE A;  1S3M A;  4ORC A;  1S3N A;  4Q7F A;  4MOV A;  2NXF A;  3P71 C;  2BDX A;  4H2F A;  5GTU A;  2HY1 A;  2DFJ A;  1V73 A;  2QJC A;  2WDC A;  4MP0 A;  2A22 A;  2Z72 A;  2NPP C;  4H2B A;  3AV0 A;  3PSN A;  1U32 A;  4O5G A;  2P6B A;  4ZX2 A;  4V0X A;  1HO5 A;  3FGA C;  4IYP C;  4MOY A;  2BQ8 X;  3E7B A;  4JA9 A;  1T71 A;  5HPE A;  3RL5 A;  1UF3 A;  5INB A;  3CK2 A;  3AUZ A;  5F3W A;  1TCO A;  2Q8U A;  3E7A A;  1XM7 A;  3H64 A;  3KBP A;  4FBW A;  4FBQ A;  2GJU A;  2BCD A;  2USH A;  2HYP A;  4TUG A;  4FBK A;  5J28 A;  2R17 A;  2NYL C;  2QFR A;  2Z1A A;  3DW8 C;  5B8I A;  4I5N C;  4DHL A;  3LL8 A;  1G5B A;  3RL3 A;  3IVE A;  4H2I A;  3H68 A;  3EGG A;  2XMO A;  2WDF A;  1SU1 A;  1KBP A;  3K7V C;  4TUI A;  5EQV A;  4LTY A;  3H63 A;  3N5U A;  1JK7 A;  4H1Y P;  1QFC A;  3ZTV A;  3C9F A;  4UT3 A;  1IT6 A;  3HVQ A;  1S3L A;  1Z2W A;  4XPN A;  1S8E A;  1FJM A;  1MF8 A;  4IL1 A;  1Z2X A;  2AHD A;  1OIE A;  3IB8 A;  1M63 A;  1UTE A;  1W24 A;  3H62 B;  4J6O A;  5JJT A;  4WWL A;  5DNY A;  3QFK A;  4LAC C;  2IE3 C;  2O8A A;  2O8G A;  3K7W C;  2HYO A;  4JA7 A;  4O4K A;  4H2G A;  3IB7 A;  4NZV A;  1HP1 A;  3JYF A;  3T1I A;  4UT2 A;  4O43 A;  3THN A;  1WAR A;  3H61 A;  4M0V A;  3QG5 C;  3ZU0 A;  4UT3 B;  4B2O A;  4DT2 A;  4V0W A;  2NYM C;  2KKN A;  1USH A;  4YKE A;  5C1V A;  2IAE C;  1S70 A;  3H67 A;  4O24 A;  4HD0 A;  5JPE A;  2ZBM A;  4KKZ A;  1HPU A;  3QFM A;  2QFP A;  3DSC A;  3GVE A;  3TGH A;  1OI8 A;  4H1S A;  4F0Z A;  1WAO 1;  2WDD A;  3PSO A;  4ORA A;  4UWQ A;  3THO B;  3H66 A;  5JPF A;  4V0V A;  3IVD A;  3RQZ A;  3V4Y A; 
#chains in the Genus database with same CATH topology
 1XZW A;  3ICF A;  4ZVZ A;  5IOH A;  4FCX A;  4DSY A;  1T70 A;  2CV9 A;  3EGH A;  1QHW A;  3QFN A;  4ORB A;  4OR9 A;  4LU9 A;  4I5L C;  2JOG A;  3QFO A;  2Z06 A;  1OID A;  4G9J A;  3RL4 A;  1NNW A;  2IE4 C;  4KBP A;  3D03 A;  3H69 A;  2YVT A;  1S95 A;  1AUI A;  3C5W C;  3DSD A;  1II7 A;  2DXN A;  3H60 A;  2WDE A;  1S3M A;  4ORC A;  1S3N A;  4Q7F A;  4MOV A;  2NXF A;  3P71 C;  2BDX A;  4H2F A;  5GTU A;  2HY1 A;  2DFJ A;  1V73 A;  2QJC A;  2WDC A;  4MP0 A;  2A22 A;  2Z72 A;  2NPP C;  4H2B A;  3AV0 A;  3PSN A;  1U32 A;  2ZOA A;  2P6B A;  4O5G A;  4ZX2 A;  4V0X A;  1HO5 A;  3FGA C;  4IYP C;  4MOY A;  2BQ8 X;  3E7B A;  4JA9 A;  1T71 A;  5HPE A;  3RL5 A;  1UF3 A;  5INB A;  3CK2 A;  3AUZ A;  5F3W A;  1TCO A;  2Q8U A;  2DXL A;  1XM7 A;  3E7A A;  3H64 A;  3KBP A;  4FBW A;  2GJU A;  2BCD A;  4FBQ A;  2USH A;  2HYP A;  4TUG A;  4FBK A;  5J28 A;  2R17 A;  2NYL C;  2QFR A;  2Z1A A;  3DW8 C;  5B8I A;  4I5N C;  4DHL A;  3LL8 A;  1G5B A;  3RL3 A;  3IVE A;  4H2I A;  3H68 A;  3EGG A;  2XMO A;  2WDF A;  1SU1 A;  1KBP A;  3K7V C;  4TUI A;  5EQV A;  4LTY A;  3H63 A;  3N5U A;  1JK7 A;  2ZO9 B;  4H1Y P;  1QFC A;  3ZTV A;  3C9F A;  4UT3 A;  1IT6 A;  3HVQ A;  1S3L A;  1Z2W A;  4XPN A;  1S8E A;  2YEQ A;  1FJM A;  1MF8 A;  4IL1 A;  1Z2X A;  2AHD A;  1OIE A;  3IB8 A;  1M63 A;  1UTE A;  1W24 A;  3H62 B;  4J6O A;  5JJT A;  4WWL A;  5DNY A;  3QFK A;  4LAC C;  2IE3 C;  2O8A A;  2O8G A;  3E0J A;  3K7W C;  2HYO A;  4JA7 A;  4O4K A;  4H2G A;  3IB7 A;  3V4Y A;  4NZV A;  1HP1 A;  3JYF A;  3T1I A;  4UT2 A;  4O43 A;  3THN A;  1WAR A;  3H61 A;  4M0V A;  3QG5 C;  3ZU0 A;  4UT3 B;  4B2O A;  4DT2 A;  4V0W A;  2NYM C;  2KKN A;  1USH A;  4YKE A;  5C1V A;  2IAE C;  1S70 A;  3H67 A;  4O24 A;  4HD0 A;  5JPE A;  2ZBM A;  4KKZ A;  1HPU A;  3QFM A;  2QFP A;  3DSC A;  3GVE A;  3TGH A;  1OI8 A;  4H1S A;  4F0Z A;  1WAO 1;  2WDD A;  3PSO A;  4ORA A;  4UWQ A;  3THO B;  3H66 A;  5JPF A;  4V0V A;  3IVD A;  3RQZ A;  3FLO A; 
#chains in the Genus database with same CATH homology
 1XZW A;  3ICF A;  4ZVZ A;  5IOH A;  4FCX A;  4DSY A;  1T70 A;  2CV9 A;  3EGH A;  1QHW A;  3QFN A;  4ORB A;  4OR9 A;  4LU9 A;  4I5L C;  2JOG A;  3QFO A;  2Z06 A;  1OID A;  4G9J A;  3RL4 A;  1NNW A;  2IE4 C;  4KBP A;  3D03 A;  3H69 A;  2YVT A;  1S95 A;  1AUI A;  3C5W C;  3DSD A;  1II7 A;  2DXN A;  3H60 A;  2WDE A;  1S3M A;  4ORC A;  1S3N A;  4Q7F A;  4MOV A;  2NXF A;  3P71 C;  2BDX A;  4H2F A;  5GTU A;  2HY1 A;  2DFJ A;  1V73 A;  2QJC A;  2WDC A;  4MP0 A;  2A22 A;  2Z72 A;  2NPP C;  4H2B A;  3AV0 A;  3PSN A;  1U32 A;  2ZOA A;  2P6B A;  4O5G A;  4ZX2 A;  4V0X A;  1HO5 A;  3FGA C;  4IYP C;  4MOY A;  2BQ8 X;  3E7B A;  4JA9 A;  1T71 A;  5HPE A;  3RL5 A;  1UF3 A;  5INB A;  3CK2 A;  3AUZ A;  5F3W A;  1TCO A;  2Q8U A;  2DXL A;  1XM7 A;  3E7A A;  3H64 A;  3KBP A;  4FBW A;  2GJU A;  2BCD A;  4FBQ A;  2USH A;  2HYP A;  4TUG A;  4FBK A;  5J28 A;  2R17 A;  2NYL C;  2QFR A;  2Z1A A;  3DW8 C;  5B8I A;  4I5N C;  4DHL A;  3LL8 A;  1G5B A;  3RL3 A;  3IVE A;  4H2I A;  3H68 A;  3EGG A;  2XMO A;  2WDF A;  1SU1 A;  1KBP A;  3K7V C;  4TUI A;  5EQV A;  4LTY A;  3H63 A;  3N5U A;  1JK7 A;  2ZO9 B;  4H1Y P;  1QFC A;  3ZTV A;  3C9F A;  4UT3 A;  1IT6 A;  3HVQ A;  1S3L A;  1Z2W A;  4XPN A;  1S8E A;  2YEQ A;  1FJM A;  1MF8 A;  4IL1 A;  1Z2X A;  2AHD A;  1OIE A;  3IB8 A;  1M63 A;  1UTE A;  1W24 A;  3H62 B;  4J6O A;  5JJT A;  4WWL A;  5DNY A;  3QFK A;  4LAC C;  2IE3 C;  2O8A A;  2O8G A;  3E0J A;  3K7W C;  2HYO A;  4JA7 A;  4O4K A;  4H2G A;  3IB7 A;  3V4Y A;  4NZV A;  1HP1 A;  3JYF A;  3T1I A;  4UT2 A;  4O43 A;  3THN A;  1WAR A;  3H61 A;  4M0V A;  3QG5 C;  3ZU0 A;  4UT3 B;  4B2O A;  4DT2 A;  4V0W A;  2NYM C;  2KKN A;  1USH A;  4YKE A;  5C1V A;  2IAE C;  1S70 A;  3H67 A;  4O24 A;  4HD0 A;  5JPE A;  2ZBM A;  4KKZ A;  1HPU A;  3QFM A;  2QFP A;  3DSC A;  3GVE A;  3TGH A;  1OI8 A;  4H1S A;  4F0Z A;  1WAO 1;  2WDD A;  3PSO A;  4ORA A;  4UWQ A;  3THO B;  3H66 A;  5JPF A;  4V0V A;  3IVD A;  3RQZ A;  3FLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...