2IAEC

Crystal structure of a protein phosphatase 2a (pp2a) holoenzyme.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
305
structure length
305
Chain Sequence
KVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVNRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein phosphatase 2A heterotrimeric holoenzyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 87
structure length 305
sequence length 305
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2iaeC00
4B2OA 3THOB 4FBQA 4HD0A 3PSOA 3AV0A 2Q8UA 1UF3A 2QJCA 3AUZA 4MP0A 4UT2A 5EQVA 5C1VA 4DSYA 1KBPA 2NXFA 4UT3B 3PSNA 1QHWA 2A22A 4J6OA 5F3WA 4Q7FA 3TGHA 2ZBMA 4KBPA 2GJUA 4TUIA 1OIDA 4FBKA 4OR9A 3KBPA 4H1SA 4IL1A 3QFNA 3H64A 4V0WA 5JPFA 2IE3C 3C9FA 5JPEA 2IE4C 2KKNA 3H60A 3LL8A 4O43A 2NYLC 4KKZA 3H68A 4O24A 5INBA 2Z1AA 5JJTA 5DNYA 2AHDA 1MF8A 1S3NA 2R17A 4JA7A 2XMOA 3RQZA 3T1IA 4FBWA 2BQ8X 2JOGA 3V4YA 2CV9A 3H63A 4H2GA 1OIEA 1OI8A 1U32A 2HYOA 1HO5A 3DW8C 3IB7A 2BCDA 2NYMC 1TCOA 4I5NC 5IOHA 3EGHA 1SU1A 2Z72A 3FGAC 3ZU0A 2WDFA 2WDCA 1WARA 2P6BA 3HVQA 4V0XA 4DT2A 1T70A 4UT3A 2O8GA 3H69A 2NPPC 4ORCA 2HY1A 2WDEA 4FCXA 4ORAA 2QFRA 3C5WC 3JYFA 4DHLA 4WWLA 3IB8A 4G9JA 4LACC 5J28A 1AUIA 3N5UA 2USHA 1S95A 4O5GA 3RL4A 3IVEA 4V0VA 4H2IA 2YVTA 5HPEA 4I5LC 3K7WC 4JA9A 1XM7A 3QFOA 4H2FA 1S3LA 3H61A 1HPUA 3QFMA 5GTUA 1S70A 1HP1A 1QFCA 2DFJA 2O8AA 4LTYA 4F0ZA 1FJMA 1USHA 5B8IA 4MOYA 3IVDA 3ZTVA 1NNWA 1W24A 3CK2A 3QG5C 2IAEC 3H67A 2BDXA 2Z06A 3H66A 1JK7A 1V73A 2HYPA 1Z2WA 1S3MA 4MOVA 1Z2XA 2WDDA 3K7VC 4H1YP 3P71C 1T71A 4ZVZA 3ICFA 1II7A 4NZVA 3QFKA 4YKEA 4UWQA 3RL5A 4TUGA 1UTEA 4ZX2A 4ORBA 3EGGA 3DSCA 4IYPC 1WAO1 3E7AA 3GVEA 2QFPA 4LU9A 3THNA 3DSDA 1M63A 1IT6A 3H62B 4M0VA 1XZWA 1S8EA 3E7BA 4O4KA 3RL3A 4H2BA 4XPNA 1G5BA
chains in the Genus database with same CATH superfamily
4B2OA 3THOB 4FBQA 4HD0A 3PSOA 3AV0A 2Q8UA 1UF3A 2QJCA 3AUZA 4MP0A 4UT2A 5EQVA 5C1VA 4DSYA 1KBPA 2NXFA 4UT3B 3PSNA 1QHWA 2A22A 4J6OA 5F3WA 4Q7FA 3TGHA 2ZBMA 4KBPA 2GJUA 4TUIA 1OIDA 4FBKA 4OR9A 3KBPA 4H1SA 4IL1A 3QFNA 3H64A 4V0WA 5JPFA 2IE3C 3C9FA 5JPEA 2IE4C 2KKNA 3H60A 3LL8A 4O43A 2NYLC 4KKZA 3H68A 4O24A 5INBA 2Z1AA 5JJTA 5DNYA 2AHDA 1MF8A 2DXNA 1S3NA 2R17A 4JA7A 2XMOA 3RQZA 3T1IA 3D03A 2BQ8X 2JOGA 2ZOAA 2CV9A 4FBWA 3V4YA 2DXLA 3H63A 4H2GA 1OIEA 1OI8A 1U32A 2HYOA 1HO5A 3DW8C 3IB7A 2BCDA 2NYMC 1TCOA 4I5NC 5IOHA 3EGHA 1SU1A 2Z72A 3FGAC 3ZU0A 2WDFA 2WDCA 1WARA 2P6BA 3HVQA 4V0XA 4DT2A 1T70A 4UT3A 2O8GA 3H69A 2NPPC 4ORCA 2HY1A 2WDEA 4FCXA 4ORAA 2QFRA 3C5WC 3JYFA 4DHLA 4WWLA 3IB8A 4G9JA 4LACC 5J28A 1AUIA 3N5UA 2USHA 1S95A 4O5GA 3RL4A 3IVEA 4V0VA 4H2IA 2YVTA 5HPEA 4I5LC 3FLOA 3K7WC 2ZO9B 4JA9A 1XM7A 3QFOA 4H2FA 1S3LA 3H61A 1HPUA 3QFMA 5GTUA 1S70A 1HP1A 1QFCA 2DFJA 2O8AA 4LTYA 4F0ZA 1FJMA 1USHA 5B8IA 4MOYA 3IVDA 3ZTVA 1NNWA 1W24A 3CK2A 3QG5C 2IAEC 3H67A 2BDXA 2Z06A 3H66A 1JK7A 1V73A 2HYPA 1Z2WA 1S3MA 4MOVA 1Z2XA 2WDDA 3K7VC 4H1YP 3P71C 1T71A 4ZVZA 3ICFA 1II7A 2YEQA 4NZVA 3QFKA 4YKEA 4UWQA 3RL5A 4TUGA 1UTEA 4ZX2A 4ORBA 3EGGA 3E0JA 3DSCA 4IYPC 1WAO1 3E7AA 3GVEA 2QFPA 4LU9A 3THNA 3DSDA 1M63A 1IT6A 3H62B 4M0VA 1XZWA 1S8EA 3E7BA 4O4KA 3RL3A 4H2BA 4XPNA 1G5BA
chains in the Genus database with same CATH topology
4B2OA 3THOB 4FBQA 4HD0A 3PSOA 3AV0A 2Q8UA 1UF3A 2QJCA 3AUZA 4MP0A 4UT2A 5EQVA 5C1VA 4DSYA 1KBPA 2NXFA 4UT3B 3PSNA 1QHWA 2A22A 4J6OA 5F3WA 4Q7FA 3TGHA 2ZBMA 4KBPA 2GJUA 4TUIA 1OIDA 4FBKA 4OR9A 3KBPA 4H1SA 4IL1A 3QFNA 3H64A 4V0WA 5JPFA 2IE3C 3C9FA 5JPEA 2IE4C 2KKNA 3H60A 3LL8A 4O43A 2NYLC 4KKZA 3H68A 4O24A 5INBA 2Z1AA 5JJTA 5DNYA 2AHDA 1MF8A 2DXNA 1S3NA 2R17A 4JA7A 2XMOA 3RQZA 3T1IA 3D03A 2BQ8X 2JOGA 2ZOAA 2CV9A 4FBWA 3V4YA 2DXLA 3H63A 4H2GA 1OIEA 1OI8A 1U32A 2HYOA 1HO5A 3DW8C 3IB7A 2BCDA 2NYMC 1TCOA 4I5NC 5IOHA 3EGHA 1SU1A 2Z72A 3FGAC 3ZU0A 2WDFA 2WDCA 1WARA 2P6BA 3HVQA 4V0XA 4DT2A 1T70A 4UT3A 2O8GA 3H69A 2NPPC 4ORCA 2HY1A 2WDEA 4FCXA 4ORAA 2QFRA 3C5WC 3JYFA 4DHLA 4WWLA 3IB8A 4G9JA 4LACC 5J28A 1AUIA 3N5UA 2USHA 1S95A 4O5GA 3RL4A 3IVEA 4V0VA 4H2IA 2YVTA 5HPEA 4I5LC 3FLOA 3K7WC 2ZO9B 4JA9A 1XM7A 3QFOA 4H2FA 1S3LA 3H61A 1HPUA 3QFMA 5GTUA 1S70A 1HP1A 1QFCA 2DFJA 2O8AA 4LTYA 4F0ZA 1FJMA 1USHA 5B8IA 4MOYA 3IVDA 3ZTVA 1NNWA 1W24A 3CK2A 3QG5C 2IAEC 3H67A 2BDXA 2Z06A 3H66A 1JK7A 1V73A 2HYPA 1Z2WA 1S3MA 4MOVA 1Z2XA 2WDDA 3K7VC 4H1YP 3P71C 1T71A 4ZVZA 3ICFA 1II7A 2YEQA 4NZVA 3QFKA 4YKEA 4UWQA 3RL5A 4TUGA 1UTEA 4ZX2A 4ORBA 3EGGA 3E0JA 3DSCA 4IYPC 1WAO1 3E7AA 3GVEA 2QFPA 4LU9A 3THNA 3DSDA 1M63A 1IT6A 3H62B 4M0VA 1XZWA 1S8EA 3E7BA 4O4KA 3RL3A 4H2BA 4XPNA 1G5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B2O A;  3THO B;  4FBQ A;  4HD0 A;  3PSO A;  3AV0 A;  2Q8U A;  1UF3 A;  2QJC A;  3AUZ A;  4MP0 A;  4UT2 A;  5EQV A;  5C1V A;  4DSY A;  1KBP A;  2NXF A;  4UT3 B;  3PSN A;  1QHW A;  2A22 A;  4J6O A;  5F3W A;  4Q7F A;  3TGH A;  2ZBM A;  4KBP A;  2GJU A;  4TUI A;  1OID A;  4FBK A;  4OR9 A;  3KBP A;  4H1S A;  4IL1 A;  3QFN A;  3H64 A;  4V0W A;  5JPF A;  2IE3 C;  3C9F A;  5JPE A;  2IE4 C;  2KKN A;  3H60 A;  3LL8 A;  4O43 A;  2NYL C;  4KKZ A;  3H68 A;  4O24 A;  5INB A;  2Z1A A;  5JJT A;  5DNY A;  2AHD A;  1MF8 A;  1S3N A;  2R17 A;  4JA7 A;  2XMO A;  3RQZ A;  3T1I A;  4FBW A;  2BQ8 X;  2JOG A;  3V4Y A;  2CV9 A;  3H63 A;  4H2G A;  1OIE A;  1OI8 A;  1U32 A;  2HYO A;  1HO5 A;  3DW8 C;  3IB7 A;  2BCD A;  2NYM C;  1TCO A;  4I5N C;  5IOH A;  3EGH A;  1SU1 A;  2Z72 A;  3FGA C;  3ZU0 A;  2WDF A;  2WDC A;  1WAR A;  2P6B A;  3HVQ A;  4V0X A;  4DT2 A;  1T70 A;  4UT3 A;  2O8G A;  3H69 A;  2NPP C;  4ORC A;  2HY1 A;  2WDE A;  4FCX A;  4ORA A;  2QFR A;  3C5W C;  3JYF A;  4DHL A;  4WWL A;  3IB8 A;  4G9J A;  4LAC C;  5J28 A;  1AUI A;  3N5U A;  2USH A;  1S95 A;  4O5G A;  3RL4 A;  3IVE A;  4V0V A;  4H2I A;  2YVT A;  5HPE A;  4I5L C;  3K7W C;  4JA9 A;  1XM7 A;  3QFO A;  4H2F A;  1S3L A;  3H61 A;  1HPU A;  3QFM A;  5GTU A;  1S70 A;  1HP1 A;  1QFC A;  2DFJ A;  2O8A A;  4LTY A;  4F0Z A;  1FJM A;  1USH A;  5B8I A;  4MOY A;  3IVD A;  3ZTV A;  1NNW A;  1W24 A;  3CK2 A;  3QG5 C;  2IAE C;  3H67 A;  2BDX A;  2Z06 A;  3H66 A;  1JK7 A;  1V73 A;  2HYP A;  1Z2W A;  1S3M A;  4MOV A;  1Z2X A;  2WDD A;  3K7V C;  4H1Y P;  3P71 C;  1T71 A;  4ZVZ A;  3ICF A;  1II7 A;  4NZV A;  3QFK A;  4YKE A;  4UWQ A;  3RL5 A;  4TUG A;  1UTE A;  4ZX2 A;  4ORB A;  3EGG A;  3DSC A;  4IYP C;  1WAO 1;  3E7A A;  3GVE A;  2QFP A;  4LU9 A;  3THN A;  3DSD A;  1M63 A;  1IT6 A;  3H62 B;  4M0V A;  1XZW A;  1S8E A;  3E7B A;  4O4K A;  3RL3 A;  4H2B A;  4XPN A;  1G5B A; 
#chains in the Genus database with same CATH topology
 4B2O A;  3THO B;  4FBQ A;  4HD0 A;  3PSO A;  3AV0 A;  2Q8U A;  1UF3 A;  2QJC A;  3AUZ A;  4MP0 A;  4UT2 A;  5EQV A;  5C1V A;  4DSY A;  1KBP A;  2NXF A;  4UT3 B;  3PSN A;  1QHW A;  2A22 A;  4J6O A;  5F3W A;  4Q7F A;  3TGH A;  2ZBM A;  4KBP A;  2GJU A;  4TUI A;  1OID A;  4FBK A;  4OR9 A;  3KBP A;  4H1S A;  4IL1 A;  3QFN A;  3H64 A;  4V0W A;  5JPF A;  2IE3 C;  3C9F A;  5JPE A;  2IE4 C;  2KKN A;  3H60 A;  3LL8 A;  4O43 A;  2NYL C;  4KKZ A;  3H68 A;  4O24 A;  5INB A;  2Z1A A;  5JJT A;  5DNY A;  2AHD A;  1MF8 A;  2DXN A;  1S3N A;  2R17 A;  4JA7 A;  2XMO A;  3RQZ A;  3T1I A;  3D03 A;  2BQ8 X;  2JOG A;  2ZOA A;  2CV9 A;  4FBW A;  3V4Y A;  2DXL A;  3H63 A;  4H2G A;  1OIE A;  1OI8 A;  1U32 A;  2HYO A;  1HO5 A;  3DW8 C;  3IB7 A;  2BCD A;  2NYM C;  1TCO A;  4I5N C;  5IOH A;  3EGH A;  1SU1 A;  2Z72 A;  3FGA C;  3ZU0 A;  2WDF A;  2WDC A;  1WAR A;  2P6B A;  3HVQ A;  4V0X A;  4DT2 A;  1T70 A;  4UT3 A;  2O8G A;  3H69 A;  2NPP C;  4ORC A;  2HY1 A;  2WDE A;  4FCX A;  4ORA A;  2QFR A;  3C5W C;  3JYF A;  4DHL A;  4WWL A;  3IB8 A;  4G9J A;  4LAC C;  5J28 A;  1AUI A;  3N5U A;  2USH A;  1S95 A;  4O5G A;  3RL4 A;  3IVE A;  4V0V A;  4H2I A;  2YVT A;  5HPE A;  4I5L C;  3FLO A;  3K7W C;  2ZO9 B;  4JA9 A;  1XM7 A;  3QFO A;  4H2F A;  1S3L A;  3H61 A;  1HPU A;  3QFM A;  5GTU A;  1S70 A;  1HP1 A;  1QFC A;  2DFJ A;  2O8A A;  4LTY A;  4F0Z A;  1FJM A;  1USH A;  5B8I A;  4MOY A;  3IVD A;  3ZTV A;  1NNW A;  1W24 A;  3CK2 A;  3QG5 C;  2IAE C;  3H67 A;  2BDX A;  2Z06 A;  3H66 A;  1JK7 A;  1V73 A;  2HYP A;  1Z2W A;  1S3M A;  4MOV A;  1Z2X A;  2WDD A;  3K7V C;  4H1Y P;  3P71 C;  1T71 A;  4ZVZ A;  3ICF A;  1II7 A;  2YEQ A;  4NZV A;  3QFK A;  4YKE A;  4UWQ A;  3RL5 A;  4TUG A;  1UTE A;  4ZX2 A;  4ORB A;  3EGG A;  3E0J A;  3DSC A;  4IYP C;  1WAO 1;  3E7A A;  3GVE A;  2QFP A;  4LU9 A;  3THN A;  3DSD A;  1M63 A;  1IT6 A;  3H62 B;  4M0V A;  1XZW A;  1S8E A;  3E7B A;  4O4K A;  3RL3 A;  4H2B A;  4XPN A;  1G5B A; 
#chains in the Genus database with same CATH homology
 4B2O A;  3THO B;  4FBQ A;  4HD0 A;  3PSO A;  3AV0 A;  2Q8U A;  1UF3 A;  2QJC A;  3AUZ A;  4MP0 A;  4UT2 A;  5EQV A;  5C1V A;  4DSY A;  1KBP A;  2NXF A;  4UT3 B;  3PSN A;  1QHW A;  2A22 A;  4J6O A;  5F3W A;  4Q7F A;  3TGH A;  2ZBM A;  4KBP A;  2GJU A;  4TUI A;  1OID A;  4FBK A;  4OR9 A;  3KBP A;  4H1S A;  4IL1 A;  3QFN A;  3H64 A;  4V0W A;  5JPF A;  2IE3 C;  3C9F A;  5JPE A;  2IE4 C;  2KKN A;  3H60 A;  3LL8 A;  4O43 A;  2NYL C;  4KKZ A;  3H68 A;  4O24 A;  5INB A;  2Z1A A;  5JJT A;  5DNY A;  2AHD A;  1MF8 A;  2DXN A;  1S3N A;  2R17 A;  4JA7 A;  2XMO A;  3RQZ A;  3T1I A;  3D03 A;  2BQ8 X;  2JOG A;  2ZOA A;  2CV9 A;  4FBW A;  3V4Y A;  2DXL A;  3H63 A;  4H2G A;  1OIE A;  1OI8 A;  1U32 A;  2HYO A;  1HO5 A;  3DW8 C;  3IB7 A;  2BCD A;  2NYM C;  1TCO A;  4I5N C;  5IOH A;  3EGH A;  1SU1 A;  2Z72 A;  3FGA C;  3ZU0 A;  2WDF A;  2WDC A;  1WAR A;  2P6B A;  3HVQ A;  4V0X A;  4DT2 A;  1T70 A;  4UT3 A;  2O8G A;  3H69 A;  2NPP C;  4ORC A;  2HY1 A;  2WDE A;  4FCX A;  4ORA A;  2QFR A;  3C5W C;  3JYF A;  4DHL A;  4WWL A;  3IB8 A;  4G9J A;  4LAC C;  5J28 A;  1AUI A;  3N5U A;  2USH A;  1S95 A;  4O5G A;  3RL4 A;  3IVE A;  4V0V A;  4H2I A;  2YVT A;  5HPE A;  4I5L C;  3FLO A;  3K7W C;  2ZO9 B;  4JA9 A;  1XM7 A;  3QFO A;  4H2F A;  1S3L A;  3H61 A;  1HPU A;  3QFM A;  5GTU A;  1S70 A;  1HP1 A;  1QFC A;  2DFJ A;  2O8A A;  4LTY A;  4F0Z A;  1FJM A;  1USH A;  5B8I A;  4MOY A;  3IVD A;  3ZTV A;  1NNW A;  1W24 A;  3CK2 A;  3QG5 C;  2IAE C;  3H67 A;  2BDX A;  2Z06 A;  3H66 A;  1JK7 A;  1V73 A;  2HYP A;  1Z2W A;  1S3M A;  4MOV A;  1Z2X A;  2WDD A;  3K7V C;  4H1Y P;  3P71 C;  1T71 A;  4ZVZ A;  3ICF A;  1II7 A;  2YEQ A;  4NZV A;  3QFK A;  4YKE A;  4UWQ A;  3RL5 A;  4TUG A;  1UTE A;  4ZX2 A;  4ORB A;  3EGG A;  3E0J A;  3DSC A;  4IYP C;  1WAO 1;  3E7A A;  3GVE A;  2QFP A;  4LU9 A;  3THN A;  3DSD A;  1M63 A;  1IT6 A;  3H62 B;  4M0V A;  1XZW A;  1S8E A;  3E7B A;  4O4K A;  3RL3 A;  4H2B A;  4XPN A;  1G5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...