2IAEC

Crystal structure of a protein phosphatase 2a (pp2a) holoenzyme.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
305
structure length
305
Chain Sequence
KVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVNRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Crystal structure of a protein phosphatase 2A heterotrimeric holoenzyme.
pubmed doi rcsb
source organism Mus musculus
total genus 87
structure length 305
sequence length 305
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2iaeC00
4ORCA 2NPPC 1HP1A 3H67A 3E7BA 2Z72A 4ZVZA 4O4KA 2IAEC 1Z2XA 3QFMA 4O43A 5JJTA 3TGHA 4FBWA 4JA9A 2USHA 3AUZA 2HY1A 4MOYA 1OIDA 4O24A 3K7VC 3EGGA 3RL5A 2AHDA 2NYLC 2HYOA 2WDFA 2Z1AA 4F0ZA 2Z06A 3KBPA 4O5GA 4V0WA 1HPUA 3DSCA 4UT3A 1MF8A 3PSOA 2KKNA 3HVQA 3QFKA 3IVDA 2O8AA 4OR9A 5J28A 2BDXA 4XPNA 3RQZA 2YVTA 2WDDA 1OIEA 4TUIA 1U32A 1S3NA 4WWLA 1S70A 4UWQA 1AUIA 4MP0A 1WAO1 2Q8UA 4B2OA 5HPEA 1TCOA 4FBQA 1SU1A 4H1YP 2A22A 4ZX2A 3IB7A 4LACC 2QJCA 4H2BA 1UF3A 4Q7FA 4UT3B 5GTUA 2NYMC 4JA7A 1W24A 3QFOA 4UT2A 4YKEA 2ZBMA 3THNA 1XM7A 3AV0A 1T70A 1HO5A 4DT2A 1NNWA 2XMOA 5JPFA 2DFJA 1S95A 2WDEA 4NZVA 2JOGA 3ZU0A 2QFRA 3DW8C 4HD0A 3RL4A 1JK7A 1FJMA 3C9FA 2P6BA 3CK2A 4V0VA 4J6OA 2GJUA 2O8GA 3C5WC 1QHWA 4H2FA 4H2IA 1S8EA 2WDCA 3EGHA 4TUGA 5IOHA 5B8IA 3H62B 2HYPA 3ICFA 1M63A 3N5UA 3H63A 3P71C 3RL3A 5C1VA 4DHLA 5INBA 4KKZA 5EQVA 3K7WC 3V4YA 3ZTVA 1S3MA 2IE3C 4IL1A 3T1IA 1QFCA 3IVEA 4V0XA 1IT6A 3H61A 3THOB 3DSDA 1XZWA 1G5BA 1Z2WA 3LL8A 3JYFA 4H2GA 4LTYA 4ORAA 3H60A 4FCXA 1S3LA 3H68A 4G9JA 3FGAC 3IB8A 4I5LC 2BQ8X 3E7AA 3PSNA 1OI8A 4FBKA 3H69A 5JPEA 2NXFA 3H64A 2BCDA 3QFNA 1WARA 4ORBA 1II7A 4LU9A 2CV9A 4I5NC 4M0VA 4KBPA 3H66A 4H1SA 4IYPC 4DSYA 3GVEA 1V73A 3QG5C 2R17A 1KBPA 1USHA 1UTEA 2QFPA 1T71A 2IE4C 4MOVA 5DNYA 5F3WA
chains in the Genus database with same CATH superfamily
4ORCA 2NPPC 1HP1A 3H67A 3E7BA 2Z72A 4ZVZA 4O4KA 2IAEC 1Z2XA 3QFMA 4O43A 5JJTA 3TGHA 4FBWA 4JA9A 2USHA 3AUZA 2HY1A 4MOYA 1OIDA 4O24A 3D03A 3K7VC 3EGGA 3RL5A 2AHDA 2NYLC 2HYOA 2ZOAA 2WDFA 2Z1AA 4F0ZA 2Z06A 2DXNA 3E0JA 3KBPA 4O5GA 4V0WA 1HPUA 3DSCA 4UT3A 1MF8A 3PSOA 2KKNA 3HVQA 3QFKA 2YEQA 2O8AA 3IVDA 4OR9A 2BDXA 5J28A 4XPNA 3RQZA 2YVTA 2WDDA 1OIEA 4TUIA 1U32A 1S3NA 4WWLA 1S70A 4UWQA 1AUIA 4MP0A 1WAO1 2Q8UA 4B2OA 5HPEA 1TCOA 4FBQA 1SU1A 4H1YP 2A22A 4ZX2A 3IB7A 4LACC 2QJCA 4H2BA 1UF3A 4Q7FA 4UT3B 5GTUA 2NYMC 4JA7A 1W24A 3QFOA 4UT2A 4YKEA 2ZBMA 3THNA 1XM7A 3AV0A 1T70A 1HO5A 4DT2A 1NNWA 2XMOA 5JPFA 2DFJA 1S95A 2WDEA 4NZVA 2JOGA 3ZU0A 2QFRA 3DW8C 3FLOA 4HD0A 1JK7A 1FJMA 3C9FA 2P6BA 3CK2A 4V0VA 4J6OA 3RL4A 2GJUA 2O8GA 3C5WC 1QHWA 4H2FA 4H2IA 1S8EA 2WDCA 3EGHA 4TUGA 5IOHA 2ZO9B 3H62B 5B8IA 2HYPA 3ICFA 1M63A 3N5UA 3H63A 3P71C 3RL3A 5C1VA 4DHLA 5INBA 4KKZA 5EQVA 3K7WC 3V4YA 3ZTVA 1S3MA 2IE3C 4IL1A 3T1IA 1QFCA 3IVEA 4V0XA 1IT6A 3H61A 3THOB 3DSDA 1XZWA 1G5BA 1Z2WA 3LL8A 3JYFA 4H2GA 4LTYA 4ORAA 3H60A 4FCXA 1S3LA 3H68A 4G9JA 3FGAC 3IB8A 4I5LC 2BQ8X 3E7AA 3PSNA 1OI8A 4FBKA 3H69A 5JPEA 2NXFA 3H64A 2BCDA 3QFNA 1WARA 4ORBA 1II7A 4LU9A 2CV9A 4I5NC 4M0VA 4KBPA 3H66A 4H1SA 4IYPC 4DSYA 3GVEA 1V73A 3QG5C 2R17A 2DXLA 1KBPA 1USHA 1UTEA 2QFPA 1T71A 2IE4C 4MOVA 5DNYA 5F3WA
chains in the Genus database with same CATH topology
4ORCA 2NPPC 1HP1A 3H67A 3E7BA 2Z72A 4ZVZA 4O4KA 2IAEC 1Z2XA 3QFMA 4O43A 5JJTA 3TGHA 4FBWA 4JA9A 2USHA 3AUZA 2HY1A 4MOYA 1OIDA 4O24A 3D03A 3K7VC 3EGGA 3RL5A 2AHDA 2NYLC 2HYOA 2ZOAA 2WDFA 2Z1AA 4F0ZA 2Z06A 2DXNA 3E0JA 3KBPA 4O5GA 4V0WA 1HPUA 3DSCA 4UT3A 1MF8A 3PSOA 2KKNA 3HVQA 3QFKA 2YEQA 2O8AA 3IVDA 4OR9A 2BDXA 5J28A 4XPNA 3RQZA 2YVTA 2WDDA 1OIEA 4TUIA 1U32A 1S3NA 4WWLA 1S70A 4UWQA 1AUIA 4MP0A 1WAO1 2Q8UA 4B2OA 5HPEA 1TCOA 4FBQA 1SU1A 4H1YP 2A22A 4ZX2A 3IB7A 4LACC 2QJCA 4H2BA 1UF3A 4Q7FA 4UT3B 5GTUA 2NYMC 4JA7A 1W24A 3QFOA 4UT2A 4YKEA 2ZBMA 3THNA 1XM7A 3AV0A 1T70A 1HO5A 4DT2A 1NNWA 2XMOA 5JPFA 2DFJA 1S95A 2WDEA 4NZVA 2JOGA 3ZU0A 2QFRA 3DW8C 3FLOA 4HD0A 1JK7A 1FJMA 3C9FA 2P6BA 3CK2A 4V0VA 4J6OA 3RL4A 2GJUA 2O8GA 3C5WC 1QHWA 4H2FA 4H2IA 1S8EA 2WDCA 3EGHA 4TUGA 5IOHA 2ZO9B 3H62B 5B8IA 2HYPA 3ICFA 1M63A 3N5UA 3H63A 3P71C 3RL3A 5C1VA 4DHLA 5INBA 4KKZA 5EQVA 3K7WC 3V4YA 3ZTVA 1S3MA 2IE3C 4IL1A 3T1IA 1QFCA 3IVEA 4V0XA 1IT6A 3H61A 3THOB 3DSDA 1XZWA 1G5BA 1Z2WA 3LL8A 3JYFA 4H2GA 4LTYA 4ORAA 3H60A 4FCXA 1S3LA 3H68A 4G9JA 3FGAC 3IB8A 4I5LC 2BQ8X 3E7AA 3PSNA 1OI8A 4FBKA 3H69A 5JPEA 2NXFA 3H64A 2BCDA 3QFNA 1WARA 4ORBA 1II7A 4LU9A 2CV9A 4I5NC 4M0VA 4KBPA 3H66A 4H1SA 4IYPC 4DSYA 3GVEA 1V73A 3QG5C 2R17A 2DXLA 1KBPA 1USHA 1UTEA 2QFPA 1T71A 2IE4C 4MOVA 5DNYA 5F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORC A;  2NPP C;  1HP1 A;  3H67 A;  3E7B A;  2Z72 A;  4ZVZ A;  4O4K A;  2IAE C;  1Z2X A;  3QFM A;  4O43 A;  5JJT A;  3TGH A;  4FBW A;  4JA9 A;  2USH A;  3AUZ A;  2HY1 A;  4MOY A;  1OID A;  4O24 A;  3K7V C;  3EGG A;  3RL5 A;  2AHD A;  2NYL C;  2HYO A;  2WDF A;  2Z1A A;  4F0Z A;  2Z06 A;  3KBP A;  4O5G A;  4V0W A;  1HPU A;  3DSC A;  4UT3 A;  1MF8 A;  3PSO A;  2KKN A;  3HVQ A;  3QFK A;  3IVD A;  2O8A A;  4OR9 A;  5J28 A;  2BDX A;  4XPN A;  3RQZ A;  2YVT A;  2WDD A;  1OIE A;  4TUI A;  1U32 A;  1S3N A;  4WWL A;  1S70 A;  4UWQ A;  1AUI A;  4MP0 A;  1WAO 1;  2Q8U A;  4B2O A;  5HPE A;  1TCO A;  4FBQ A;  1SU1 A;  4H1Y P;  2A22 A;  4ZX2 A;  3IB7 A;  4LAC C;  2QJC A;  4H2B A;  1UF3 A;  4Q7F A;  4UT3 B;  5GTU A;  2NYM C;  4JA7 A;  1W24 A;  3QFO A;  4UT2 A;  4YKE A;  2ZBM A;  3THN A;  1XM7 A;  3AV0 A;  1T70 A;  1HO5 A;  4DT2 A;  1NNW A;  2XMO A;  5JPF A;  2DFJ A;  1S95 A;  2WDE A;  4NZV A;  2JOG A;  3ZU0 A;  2QFR A;  3DW8 C;  4HD0 A;  3RL4 A;  1JK7 A;  1FJM A;  3C9F A;  2P6B A;  3CK2 A;  4V0V A;  4J6O A;  2GJU A;  2O8G A;  3C5W C;  1QHW A;  4H2F A;  4H2I A;  1S8E A;  2WDC A;  3EGH A;  4TUG A;  5IOH A;  5B8I A;  3H62 B;  2HYP A;  3ICF A;  1M63 A;  3N5U A;  3H63 A;  3P71 C;  3RL3 A;  5C1V A;  4DHL A;  5INB A;  4KKZ A;  5EQV A;  3K7W C;  3V4Y A;  3ZTV A;  1S3M A;  2IE3 C;  4IL1 A;  3T1I A;  1QFC A;  3IVE A;  4V0X A;  1IT6 A;  3H61 A;  3THO B;  3DSD A;  1XZW A;  1G5B A;  1Z2W A;  3LL8 A;  3JYF A;  4H2G A;  4LTY A;  4ORA A;  3H60 A;  4FCX A;  1S3L A;  3H68 A;  4G9J A;  3FGA C;  3IB8 A;  4I5L C;  2BQ8 X;  3E7A A;  3PSN A;  1OI8 A;  4FBK A;  3H69 A;  5JPE A;  2NXF A;  3H64 A;  2BCD A;  3QFN A;  1WAR A;  4ORB A;  1II7 A;  4LU9 A;  2CV9 A;  4I5N C;  4M0V A;  4KBP A;  3H66 A;  4H1S A;  4IYP C;  4DSY A;  3GVE A;  1V73 A;  3QG5 C;  2R17 A;  1KBP A;  1USH A;  1UTE A;  2QFP A;  1T71 A;  2IE4 C;  4MOV A;  5DNY A;  5F3W A; 
#chains in the Genus database with same CATH topology
 4ORC A;  2NPP C;  1HP1 A;  3H67 A;  3E7B A;  2Z72 A;  4ZVZ A;  4O4K A;  2IAE C;  1Z2X A;  3QFM A;  4O43 A;  5JJT A;  3TGH A;  4FBW A;  4JA9 A;  2USH A;  3AUZ A;  2HY1 A;  4MOY A;  1OID A;  4O24 A;  3D03 A;  3K7V C;  3EGG A;  3RL5 A;  2AHD A;  2NYL C;  2HYO A;  2ZOA A;  2WDF A;  2Z1A A;  4F0Z A;  2Z06 A;  2DXN A;  3E0J A;  3KBP A;  4O5G A;  4V0W A;  1HPU A;  3DSC A;  4UT3 A;  1MF8 A;  3PSO A;  2KKN A;  3HVQ A;  3QFK A;  2YEQ A;  2O8A A;  3IVD A;  4OR9 A;  2BDX A;  5J28 A;  4XPN A;  3RQZ A;  2YVT A;  2WDD A;  1OIE A;  4TUI A;  1U32 A;  1S3N A;  4WWL A;  1S70 A;  4UWQ A;  1AUI A;  4MP0 A;  1WAO 1;  2Q8U A;  4B2O A;  5HPE A;  1TCO A;  4FBQ A;  1SU1 A;  4H1Y P;  2A22 A;  4ZX2 A;  3IB7 A;  4LAC C;  2QJC A;  4H2B A;  1UF3 A;  4Q7F A;  4UT3 B;  5GTU A;  2NYM C;  4JA7 A;  1W24 A;  3QFO A;  4UT2 A;  4YKE A;  2ZBM A;  3THN A;  1XM7 A;  3AV0 A;  1T70 A;  1HO5 A;  4DT2 A;  1NNW A;  2XMO A;  5JPF A;  2DFJ A;  1S95 A;  2WDE A;  4NZV A;  2JOG A;  3ZU0 A;  2QFR A;  3DW8 C;  3FLO A;  4HD0 A;  1JK7 A;  1FJM A;  3C9F A;  2P6B A;  3CK2 A;  4V0V A;  4J6O A;  3RL4 A;  2GJU A;  2O8G A;  3C5W C;  1QHW A;  4H2F A;  4H2I A;  1S8E A;  2WDC A;  3EGH A;  4TUG A;  5IOH A;  2ZO9 B;  3H62 B;  5B8I A;  2HYP A;  3ICF A;  1M63 A;  3N5U A;  3H63 A;  3P71 C;  3RL3 A;  5C1V A;  4DHL A;  5INB A;  4KKZ A;  5EQV A;  3K7W C;  3V4Y A;  3ZTV A;  1S3M A;  2IE3 C;  4IL1 A;  3T1I A;  1QFC A;  3IVE A;  4V0X A;  1IT6 A;  3H61 A;  3THO B;  3DSD A;  1XZW A;  1G5B A;  1Z2W A;  3LL8 A;  3JYF A;  4H2G A;  4LTY A;  4ORA A;  3H60 A;  4FCX A;  1S3L A;  3H68 A;  4G9J A;  3FGA C;  3IB8 A;  4I5L C;  2BQ8 X;  3E7A A;  3PSN A;  1OI8 A;  4FBK A;  3H69 A;  5JPE A;  2NXF A;  3H64 A;  2BCD A;  3QFN A;  1WAR A;  4ORB A;  1II7 A;  4LU9 A;  2CV9 A;  4I5N C;  4M0V A;  4KBP A;  3H66 A;  4H1S A;  4IYP C;  4DSY A;  3GVE A;  1V73 A;  3QG5 C;  2R17 A;  2DXL A;  1KBP A;  1USH A;  1UTE A;  2QFP A;  1T71 A;  2IE4 C;  4MOV A;  5DNY A;  5F3W A; 
#chains in the Genus database with same CATH homology
 4ORC A;  2NPP C;  1HP1 A;  3H67 A;  3E7B A;  2Z72 A;  4ZVZ A;  4O4K A;  2IAE C;  1Z2X A;  3QFM A;  4O43 A;  5JJT A;  3TGH A;  4FBW A;  4JA9 A;  2USH A;  3AUZ A;  2HY1 A;  4MOY A;  1OID A;  4O24 A;  3D03 A;  3K7V C;  3EGG A;  3RL5 A;  2AHD A;  2NYL C;  2HYO A;  2ZOA A;  2WDF A;  2Z1A A;  4F0Z A;  2Z06 A;  2DXN A;  3E0J A;  3KBP A;  4O5G A;  4V0W A;  1HPU A;  3DSC A;  4UT3 A;  1MF8 A;  3PSO A;  2KKN A;  3HVQ A;  3QFK A;  2YEQ A;  2O8A A;  3IVD A;  4OR9 A;  2BDX A;  5J28 A;  4XPN A;  3RQZ A;  2YVT A;  2WDD A;  1OIE A;  4TUI A;  1U32 A;  1S3N A;  4WWL A;  1S70 A;  4UWQ A;  1AUI A;  4MP0 A;  1WAO 1;  2Q8U A;  4B2O A;  5HPE A;  1TCO A;  4FBQ A;  1SU1 A;  4H1Y P;  2A22 A;  4ZX2 A;  3IB7 A;  4LAC C;  2QJC A;  4H2B A;  1UF3 A;  4Q7F A;  4UT3 B;  5GTU A;  2NYM C;  4JA7 A;  1W24 A;  3QFO A;  4UT2 A;  4YKE A;  2ZBM A;  3THN A;  1XM7 A;  3AV0 A;  1T70 A;  1HO5 A;  4DT2 A;  1NNW A;  2XMO A;  5JPF A;  2DFJ A;  1S95 A;  2WDE A;  4NZV A;  2JOG A;  3ZU0 A;  2QFR A;  3DW8 C;  3FLO A;  4HD0 A;  1JK7 A;  1FJM A;  3C9F A;  2P6B A;  3CK2 A;  4V0V A;  4J6O A;  3RL4 A;  2GJU A;  2O8G A;  3C5W C;  1QHW A;  4H2F A;  4H2I A;  1S8E A;  2WDC A;  3EGH A;  4TUG A;  5IOH A;  2ZO9 B;  3H62 B;  5B8I A;  2HYP A;  3ICF A;  1M63 A;  3N5U A;  3H63 A;  3P71 C;  3RL3 A;  5C1V A;  4DHL A;  5INB A;  4KKZ A;  5EQV A;  3K7W C;  3V4Y A;  3ZTV A;  1S3M A;  2IE3 C;  4IL1 A;  3T1I A;  1QFC A;  3IVE A;  4V0X A;  1IT6 A;  3H61 A;  3THO B;  3DSD A;  1XZW A;  1G5B A;  1Z2W A;  3LL8 A;  3JYF A;  4H2G A;  4LTY A;  4ORA A;  3H60 A;  4FCX A;  1S3L A;  3H68 A;  4G9J A;  3FGA C;  3IB8 A;  4I5L C;  2BQ8 X;  3E7A A;  3PSN A;  1OI8 A;  4FBK A;  3H69 A;  5JPE A;  2NXF A;  3H64 A;  2BCD A;  3QFN A;  1WAR A;  4ORB A;  1II7 A;  4LU9 A;  2CV9 A;  4I5N C;  4M0V A;  4KBP A;  3H66 A;  4H1S A;  4IYP C;  4DSY A;  3GVE A;  1V73 A;  3QG5 C;  2R17 A;  2DXL A;  1KBP A;  1USH A;  1UTE A;  2QFP A;  1T71 A;  2IE4 C;  4MOV A;  5DNY A;  5F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...