2IE4C

Structure of the protein phosphatase 2a core enzyme bound to okadaic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Protein Phosphatase 2A Core Enzyme Bound to Tumor-Inducing Toxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,hydrolase
molecule keywords Protein Phosphatase 2, regulatory subunit A (PR 65), alpha i
total genus 101
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2ie4C00
1V73A 3QFMA 1QHWA 2IAEC 1NNWA 2USHA 4UT3B 3RL4A 5HPEA 5INBA 4LACC 4G9JA 3RL3A 3CK2A 5JJTA 5JPEA 3H62B 2AHDA 3AV0A 1XM7A 4MP0A 1S70A 4H1SA 4O24A 3RQZA 4UT3A 2QFPA 3FGAC 1JK7A 2O8AA 1FJMA 3PSNA 5GTUA 3E7BA 5F3WA 4KKZA 1G5BA 2WDFA 1S95A 4OR9A 1S3MA 5B8IA 3H66A 2HYOA 3K7WC 4F0ZA 3LL8A 2Z1AA 4O43A 3DSCA 2HYPA 3EGGA 4O5GA 4ORAA 1S8EA 3DSDA 4FBKA 3IVEA 2BCDA 4XPNA 2GJUA 3PSOA 1OI8A 2CV9A 2HY1A 3ZU0A 3QFKA 1OIDA 2IE4C 1QFCA 2IE3C 2BDXA 4I5LC 4JA9A 2JOGA 4HD0A 3IVDA 1XZWA 4H2IA 4MOVA 4UWQA 4O4KA 3THNA 2BQ8X 5C1VA 3QFNA 4FBWA 4B2OA 1U32A 3H60A 2Z06A 4ORBA 1TCOA 2YVTA 1WARA 3TGHA 5J28A 1IT6A 3HVQA 4FCXA 4DT2A 4JA7A 5EQVA 2NYMC 2XMOA 4UT2A 1KBPA 2KKNA 1AUIA 3DW8C 3P71C 1T71A 4H1YP 4LU9A 5DNYA 3ICFA 3RL5A 4H2GA 1HO5A 1OIEA 4ZX2A 1T70A 4J6OA 4Q7FA 2QJCA 1UTEA 2P6BA 2A22A 4FBQA 4ORCA 4LTYA 2R17A 3H64A 1M63A 3H63A 4V0XA 3THOB 3H68A 4ZVZA 3T1IA 4DHLA 1SU1A 2WDEA 4V0WA 1HP1A 4NZVA 4TUIA 4KBPA 2WDDA 2WDCA 3V4YA 3ZTVA 3QFOA 4IYPC 1S3LA 4H2BA 2NPPC 3AUZA 1S3NA 3H67A 1USHA 1Z2WA 3H69A 5JPFA 4TUGA 1W24A 2NYLC 3KBPA 1UF3A 4V0VA 2NXFA 2ZBMA 2O8GA 5IOHA 3IB7A 3QG5C 3C5WC 1WAO1 4MOYA 3E7AA 1II7A 4IL1A 3JYFA 3C9FA 4H2FA 4M0VA 3H61A 4YKEA 3IB8A 1MF8A 3EGHA 1Z2XA 4I5NC 2QFRA 2Z72A 3GVEA 3N5UA 3K7VC 2DFJA 2Q8UA 4WWLA 1HPUA 4DSYA
chains in the Genus database with same CATH superfamily
1V73A 3QFMA 1QHWA 2IAEC 1NNWA 2USHA 4UT3B 3RL4A 2DXNA 3E0JA 5HPEA 5INBA 4LACC 4G9JA 3RL3A 3CK2A 2ZO9B 5JJTA 5JPEA 3H62B 2AHDA 3AV0A 1XM7A 4MP0A 1S70A 4H1SA 4O24A 3RQZA 4UT3A 2QFPA 3FGAC 2ZOAA 1JK7A 2O8AA 1FJMA 3PSNA 5GTUA 3E7BA 5F3WA 4KKZA 1G5BA 2WDFA 1S95A 4OR9A 1S3MA 5B8IA 3H66A 2HYOA 3K7WC 4F0ZA 3LL8A 2Z1AA 4O43A 3DSCA 2HYPA 3EGGA 4O5GA 4ORAA 1S8EA 3DSDA 4FBKA 3IVEA 2BCDA 4XPNA 2GJUA 3PSOA 1OI8A 2CV9A 2HY1A 3ZU0A 3QFKA 1OIDA 2IE4C 1QFCA 2IE3C 2BDXA 4I5LC 4JA9A 2JOGA 3D03A 4HD0A 3IVDA 1XZWA 4H2IA 4MOVA 4UWQA 4O4KA 3THNA 2BQ8X 5C1VA 3QFNA 4FBWA 4B2OA 1U32A 3H60A 2Z06A 2DXLA 4ORBA 1TCOA 2YVTA 1WARA 3TGHA 5J28A 1IT6A 3HVQA 4FCXA 4DT2A 4JA7A 2YEQA 2NYMC 2XMOA 4UT2A 5EQVA 1KBPA 2KKNA 1AUIA 3DW8C 3P71C 1T71A 4H1YP 4LU9A 5DNYA 3ICFA 3RL5A 4H2GA 1HO5A 1OIEA 4ZX2A 1T70A 4J6OA 4Q7FA 2QJCA 1UTEA 2P6BA 2A22A 4FBQA 4ORCA 4LTYA 2R17A 3H64A 1M63A 3H63A 4V0XA 3THOB 3H68A 4ZVZA 3T1IA 4DHLA 1SU1A 2WDEA 4V0WA 1HP1A 4NZVA 4TUIA 4KBPA 2WDDA 2WDCA 3V4YA 3ZTVA 3QFOA 4IYPC 1S3LA 4H2BA 2NPPC 3AUZA 1S3NA 3H67A 1USHA 1Z2WA 3H69A 5JPFA 4TUGA 1W24A 2NYLC 3KBPA 1UF3A 4V0VA 2NXFA 2ZBMA 2O8GA 5IOHA 3IB7A 3QG5C 3C5WC 1WAO1 4MOYA 3E7AA 1II7A 4IL1A 3JYFA 3C9FA 4H2FA 4M0VA 3H61A 4YKEA 3IB8A 1MF8A 3EGHA 1Z2XA 4I5NC 2QFRA 2Z72A 3GVEA 3FLOA 3N5UA 3K7VC 2DFJA 2Q8UA 4WWLA 1HPUA 4DSYA
chains in the Genus database with same CATH topology
1V73A 3QFMA 1QHWA 2IAEC 1NNWA 2USHA 4UT3B 3RL4A 2DXNA 3E0JA 5HPEA 5INBA 4LACC 4G9JA 3RL3A 3CK2A 2ZO9B 5JJTA 5JPEA 3H62B 2AHDA 3AV0A 1XM7A 4MP0A 1S70A 4H1SA 4O24A 3RQZA 4UT3A 2QFPA 3FGAC 2ZOAA 1JK7A 2O8AA 1FJMA 3PSNA 5GTUA 3E7BA 5F3WA 4KKZA 1G5BA 2WDFA 1S95A 4OR9A 1S3MA 5B8IA 3H66A 2HYOA 3K7WC 4F0ZA 3LL8A 2Z1AA 4O43A 3DSCA 2HYPA 3EGGA 4O5GA 4ORAA 1S8EA 3DSDA 4FBKA 3IVEA 2BCDA 4XPNA 2GJUA 3PSOA 1OI8A 2CV9A 2HY1A 3ZU0A 3QFKA 1OIDA 2IE4C 1QFCA 2IE3C 2BDXA 4I5LC 4JA9A 2JOGA 3D03A 4HD0A 3IVDA 1XZWA 4H2IA 4MOVA 4UWQA 4O4KA 3THNA 2BQ8X 5C1VA 3QFNA 4FBWA 4B2OA 1U32A 3H60A 2Z06A 2DXLA 4ORBA 1TCOA 2YVTA 1WARA 3TGHA 5J28A 1IT6A 3HVQA 4FCXA 4DT2A 4JA7A 2YEQA 2NYMC 2XMOA 4UT2A 5EQVA 1KBPA 2KKNA 1AUIA 3DW8C 3P71C 1T71A 4H1YP 4LU9A 5DNYA 3ICFA 3RL5A 4H2GA 1HO5A 1OIEA 4ZX2A 1T70A 4J6OA 4Q7FA 2QJCA 1UTEA 2P6BA 2A22A 4FBQA 4ORCA 4LTYA 2R17A 3H64A 1M63A 3H63A 4V0XA 3THOB 3H68A 4ZVZA 3T1IA 4DHLA 1SU1A 2WDEA 4V0WA 1HP1A 4NZVA 4TUIA 4KBPA 2WDDA 2WDCA 3V4YA 3ZTVA 3QFOA 4IYPC 1S3LA 4H2BA 2NPPC 3AUZA 1S3NA 3H67A 1USHA 1Z2WA 3H69A 5JPFA 4TUGA 1W24A 2NYLC 3KBPA 1UF3A 4V0VA 2NXFA 2ZBMA 2O8GA 5IOHA 3IB7A 3QG5C 3C5WC 1WAO1 4MOYA 3E7AA 1II7A 4IL1A 3JYFA 3C9FA 4H2FA 4M0VA 3H61A 4YKEA 3IB8A 1MF8A 3EGHA 1Z2XA 4I5NC 2QFRA 2Z72A 3GVEA 3FLOA 3N5UA 3K7VC 2DFJA 2Q8UA 4WWLA 1HPUA 4DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V73 A;  3QFM A;  1QHW A;  2IAE C;  1NNW A;  2USH A;  4UT3 B;  3RL4 A;  5HPE A;  5INB A;  4LAC C;  4G9J A;  3RL3 A;  3CK2 A;  5JJT A;  5JPE A;  3H62 B;  2AHD A;  3AV0 A;  1XM7 A;  4MP0 A;  1S70 A;  4H1S A;  4O24 A;  3RQZ A;  4UT3 A;  2QFP A;  3FGA C;  1JK7 A;  2O8A A;  1FJM A;  3PSN A;  5GTU A;  3E7B A;  5F3W A;  4KKZ A;  1G5B A;  2WDF A;  1S95 A;  4OR9 A;  1S3M A;  5B8I A;  3H66 A;  2HYO A;  3K7W C;  4F0Z A;  3LL8 A;  2Z1A A;  4O43 A;  3DSC A;  2HYP A;  3EGG A;  4O5G A;  4ORA A;  1S8E A;  3DSD A;  4FBK A;  3IVE A;  2BCD A;  4XPN A;  2GJU A;  3PSO A;  1OI8 A;  2CV9 A;  2HY1 A;  3ZU0 A;  3QFK A;  1OID A;  2IE4 C;  1QFC A;  2IE3 C;  2BDX A;  4I5L C;  4JA9 A;  2JOG A;  4HD0 A;  3IVD A;  1XZW A;  4H2I A;  4MOV A;  4UWQ A;  4O4K A;  3THN A;  2BQ8 X;  5C1V A;  3QFN A;  4FBW A;  4B2O A;  1U32 A;  3H60 A;  2Z06 A;  4ORB A;  1TCO A;  2YVT A;  1WAR A;  3TGH A;  5J28 A;  1IT6 A;  3HVQ A;  4FCX A;  4DT2 A;  4JA7 A;  5EQV A;  2NYM C;  2XMO A;  4UT2 A;  1KBP A;  2KKN A;  1AUI A;  3DW8 C;  3P71 C;  1T71 A;  4H1Y P;  4LU9 A;  5DNY A;  3ICF A;  3RL5 A;  4H2G A;  1HO5 A;  1OIE A;  4ZX2 A;  1T70 A;  4J6O A;  4Q7F A;  2QJC A;  1UTE A;  2P6B A;  2A22 A;  4FBQ A;  4ORC A;  4LTY A;  2R17 A;  3H64 A;  1M63 A;  3H63 A;  4V0X A;  3THO B;  3H68 A;  4ZVZ A;  3T1I A;  4DHL A;  1SU1 A;  2WDE A;  4V0W A;  1HP1 A;  4NZV A;  4TUI A;  4KBP A;  2WDD A;  2WDC A;  3V4Y A;  3ZTV A;  3QFO A;  4IYP C;  1S3L A;  4H2B A;  2NPP C;  3AUZ A;  1S3N A;  3H67 A;  1USH A;  1Z2W A;  3H69 A;  5JPF A;  4TUG A;  1W24 A;  2NYL C;  3KBP A;  1UF3 A;  4V0V A;  2NXF A;  2ZBM A;  2O8G A;  5IOH A;  3IB7 A;  3QG5 C;  3C5W C;  1WAO 1;  4MOY A;  3E7A A;  1II7 A;  4IL1 A;  3JYF A;  3C9F A;  4H2F A;  4M0V A;  3H61 A;  4YKE A;  3IB8 A;  1MF8 A;  3EGH A;  1Z2X A;  4I5N C;  2QFR A;  2Z72 A;  3GVE A;  3N5U A;  3K7V C;  2DFJ A;  2Q8U A;  4WWL A;  1HPU A;  4DSY A; 
#chains in the Genus database with same CATH topology
 1V73 A;  3QFM A;  1QHW A;  2IAE C;  1NNW A;  2USH A;  4UT3 B;  3RL4 A;  2DXN A;  3E0J A;  5HPE A;  5INB A;  4LAC C;  4G9J A;  3RL3 A;  3CK2 A;  2ZO9 B;  5JJT A;  5JPE A;  3H62 B;  2AHD A;  3AV0 A;  1XM7 A;  4MP0 A;  1S70 A;  4H1S A;  4O24 A;  3RQZ A;  4UT3 A;  2QFP A;  3FGA C;  2ZOA A;  1JK7 A;  2O8A A;  1FJM A;  3PSN A;  5GTU A;  3E7B A;  5F3W A;  4KKZ A;  1G5B A;  2WDF A;  1S95 A;  4OR9 A;  1S3M A;  5B8I A;  3H66 A;  2HYO A;  3K7W C;  4F0Z A;  3LL8 A;  2Z1A A;  4O43 A;  3DSC A;  2HYP A;  3EGG A;  4O5G A;  4ORA A;  1S8E A;  3DSD A;  4FBK A;  3IVE A;  2BCD A;  4XPN A;  2GJU A;  3PSO A;  1OI8 A;  2CV9 A;  2HY1 A;  3ZU0 A;  3QFK A;  1OID A;  2IE4 C;  1QFC A;  2IE3 C;  2BDX A;  4I5L C;  4JA9 A;  2JOG A;  3D03 A;  4HD0 A;  3IVD A;  1XZW A;  4H2I A;  4MOV A;  4UWQ A;  4O4K A;  3THN A;  2BQ8 X;  5C1V A;  3QFN A;  4FBW A;  4B2O A;  1U32 A;  3H60 A;  2Z06 A;  2DXL A;  4ORB A;  1TCO A;  2YVT A;  1WAR A;  3TGH A;  5J28 A;  1IT6 A;  3HVQ A;  4FCX A;  4DT2 A;  4JA7 A;  2YEQ A;  2NYM C;  2XMO A;  4UT2 A;  5EQV A;  1KBP A;  2KKN A;  1AUI A;  3DW8 C;  3P71 C;  1T71 A;  4H1Y P;  4LU9 A;  5DNY A;  3ICF A;  3RL5 A;  4H2G A;  1HO5 A;  1OIE A;  4ZX2 A;  1T70 A;  4J6O A;  4Q7F A;  2QJC A;  1UTE A;  2P6B A;  2A22 A;  4FBQ A;  4ORC A;  4LTY A;  2R17 A;  3H64 A;  1M63 A;  3H63 A;  4V0X A;  3THO B;  3H68 A;  4ZVZ A;  3T1I A;  4DHL A;  1SU1 A;  2WDE A;  4V0W A;  1HP1 A;  4NZV A;  4TUI A;  4KBP A;  2WDD A;  2WDC A;  3V4Y A;  3ZTV A;  3QFO A;  4IYP C;  1S3L A;  4H2B A;  2NPP C;  3AUZ A;  1S3N A;  3H67 A;  1USH A;  1Z2W A;  3H69 A;  5JPF A;  4TUG A;  1W24 A;  2NYL C;  3KBP A;  1UF3 A;  4V0V A;  2NXF A;  2ZBM A;  2O8G A;  5IOH A;  3IB7 A;  3QG5 C;  3C5W C;  1WAO 1;  4MOY A;  3E7A A;  1II7 A;  4IL1 A;  3JYF A;  3C9F A;  4H2F A;  4M0V A;  3H61 A;  4YKE A;  3IB8 A;  1MF8 A;  3EGH A;  1Z2X A;  4I5N C;  2QFR A;  2Z72 A;  3GVE A;  3FLO A;  3N5U A;  3K7V C;  2DFJ A;  2Q8U A;  4WWL A;  1HPU A;  4DSY A; 
#chains in the Genus database with same CATH homology
 1V73 A;  3QFM A;  1QHW A;  2IAE C;  1NNW A;  2USH A;  4UT3 B;  3RL4 A;  2DXN A;  3E0J A;  5HPE A;  5INB A;  4LAC C;  4G9J A;  3RL3 A;  3CK2 A;  2ZO9 B;  5JJT A;  5JPE A;  3H62 B;  2AHD A;  3AV0 A;  1XM7 A;  4MP0 A;  1S70 A;  4H1S A;  4O24 A;  3RQZ A;  4UT3 A;  2QFP A;  3FGA C;  2ZOA A;  1JK7 A;  2O8A A;  1FJM A;  3PSN A;  5GTU A;  3E7B A;  5F3W A;  4KKZ A;  1G5B A;  2WDF A;  1S95 A;  4OR9 A;  1S3M A;  5B8I A;  3H66 A;  2HYO A;  3K7W C;  4F0Z A;  3LL8 A;  2Z1A A;  4O43 A;  3DSC A;  2HYP A;  3EGG A;  4O5G A;  4ORA A;  1S8E A;  3DSD A;  4FBK A;  3IVE A;  2BCD A;  4XPN A;  2GJU A;  3PSO A;  1OI8 A;  2CV9 A;  2HY1 A;  3ZU0 A;  3QFK A;  1OID A;  2IE4 C;  1QFC A;  2IE3 C;  2BDX A;  4I5L C;  4JA9 A;  2JOG A;  3D03 A;  4HD0 A;  3IVD A;  1XZW A;  4H2I A;  4MOV A;  4UWQ A;  4O4K A;  3THN A;  2BQ8 X;  5C1V A;  3QFN A;  4FBW A;  4B2O A;  1U32 A;  3H60 A;  2Z06 A;  2DXL A;  4ORB A;  1TCO A;  2YVT A;  1WAR A;  3TGH A;  5J28 A;  1IT6 A;  3HVQ A;  4FCX A;  4DT2 A;  4JA7 A;  2YEQ A;  2NYM C;  2XMO A;  4UT2 A;  5EQV A;  1KBP A;  2KKN A;  1AUI A;  3DW8 C;  3P71 C;  1T71 A;  4H1Y P;  4LU9 A;  5DNY A;  3ICF A;  3RL5 A;  4H2G A;  1HO5 A;  1OIE A;  4ZX2 A;  1T70 A;  4J6O A;  4Q7F A;  2QJC A;  1UTE A;  2P6B A;  2A22 A;  4FBQ A;  4ORC A;  4LTY A;  2R17 A;  3H64 A;  1M63 A;  3H63 A;  4V0X A;  3THO B;  3H68 A;  4ZVZ A;  3T1I A;  4DHL A;  1SU1 A;  2WDE A;  4V0W A;  1HP1 A;  4NZV A;  4TUI A;  4KBP A;  2WDD A;  2WDC A;  3V4Y A;  3ZTV A;  3QFO A;  4IYP C;  1S3L A;  4H2B A;  2NPP C;  3AUZ A;  1S3N A;  3H67 A;  1USH A;  1Z2W A;  3H69 A;  5JPF A;  4TUG A;  1W24 A;  2NYL C;  3KBP A;  1UF3 A;  4V0V A;  2NXF A;  2ZBM A;  2O8G A;  5IOH A;  3IB7 A;  3QG5 C;  3C5W C;  1WAO 1;  4MOY A;  3E7A A;  1II7 A;  4IL1 A;  3JYF A;  3C9F A;  4H2F A;  4M0V A;  3H61 A;  4YKE A;  3IB8 A;  1MF8 A;  3EGH A;  1Z2X A;  4I5N C;  2QFR A;  2Z72 A;  3GVE A;  3FLO A;  3N5U A;  3K7V C;  2DFJ A;  2Q8U A;  4WWL A;  1HPU A;  4DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...