2IE4C

Structure of the protein phosphatase 2a core enzyme bound to okadaic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Phosphatase 2, regulatory subunit A (PR 65), alpha i
publication title Structure of Protein Phosphatase 2A Core Enzyme Bound to Tumor-Inducing Toxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,hydrolase
total genus 101
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2ie4C00
4O24A 3GVEA 2R17A 4MOYA 1Z2XA 2Z06A 4LACC 2WDCA 4NZVA 2QJCA 3PSNA 1S8EA 1OI8A 5IOHA 1T71A 3PSOA 4UT3B 3H60A 4JA7A 3H61A 4ORBA 3QG5C 4V0WA 3TGHA 4G9JA 3ZU0A 1KBPA 2O8AA 3IVDA 2BCDA 3QFNA 3RL5A 4B2OA 3QFKA 2BQ8X 3DW8C 1XZWA 2Z1AA 2DFJA 4O5GA 2WDEA 1Z2WA 4F0ZA 1QHWA 4H2BA 3THOB 4V0VA 2WDDA 2IAEC 2YVTA 1II7A 4IYPC 4J6OA 2NPPC 5EQVA 4UT3A 4M0VA 5HPEA 2QFPA 3H63A 1UF3A 3RQZA 4FBWA 3RL4A 3JYFA 5C1VA 3QFOA 5GTUA 3V4YA 3K7VC 3H62B 1T70A 2BDXA 3ICFA 4DHLA 2CV9A 1IT6A 2GJUA 4I5NC 3LL8A 5B8IA 1MF8A 3H67A 1V73A 4IL1A 4OR9A 4FBQA 4ZVZA 1HP1A 1S70A 4MP0A 3EGGA 4TUIA 4LTYA 3H66A 3C9FA 1G5BA 4H2GA 3P71C 2NYMC 3RL3A 2Q8UA 3HVQA 4MOVA 2ZBMA 4ORCA 1JK7A 3H69A 3IB8A 4O43A 3ZTVA 4YKEA 3IB7A 5INBA 5J28A 1S3MA 5JPFA 2P6BA 5F3WA 1OIDA 2NXFA 2A22A 4I5LC 4DSYA 4ORAA 1M63A 4LU9A 4UWQA 1SU1A 3H68A 3IVEA 4WWLA 2JOGA 1XM7A 1W24A 4XPNA 5JPEA 2HY1A 1U32A 3T1IA 1WARA 4H2FA 2USHA 3E7BA 4ZX2A 4H1YP 4FBKA 3EGHA 4TUGA 1S95A 4UT2A 1WAO1 4DT2A 1HPUA 1QFCA 2QFRA 3C5WC 5JJTA 2O8GA 1S3LA 3E7AA 2WDFA 1FJMA 3CK2A 4FCXA 3K7WC 4Q7FA 1TCOA 4H1SA 2HYPA 2AHDA 1OIEA 2HYOA 3H64A 4HD0A 5DNYA 3DSDA 3FGAC 3N5UA 2Z72A 4V0XA 3THNA 2IE3C 3KBPA 2XMOA 3QFMA 1AUIA 1HO5A 1UTEA 3AV0A 4KBPA 4O4KA 4KKZA 4H2IA 3DSCA 2IE4C 4JA9A 2NYLC 1NNWA 1USHA 2KKNA 1S3NA 3AUZA
chains in the Genus database with same CATH superfamily
4O24A 3GVEA 2R17A 4MOYA 1Z2XA 2Z06A 4LACC 2WDCA 4NZVA 2QJCA 3PSNA 1S8EA 1OI8A 5IOHA 1T71A 3PSOA 3FLOA 4UT3B 3H60A 4JA7A 3H61A 4ORBA 3QG5C 4V0WA 3TGHA 4G9JA 3ZU0A 1KBPA 2O8AA 3IVDA 2BCDA 2DXNA 3QFNA 3RL5A 4B2OA 3QFKA 2BQ8X 3DW8C 1XZWA 2DFJA 2Z1AA 4O5GA 2WDEA 1Z2WA 4F0ZA 1QHWA 4H2BA 1NNWA 3THOB 4V0VA 2WDDA 2IAEC 2YVTA 1II7A 4IYPC 4J6OA 2NPPC 5EQVA 4UT3A 4M0VA 5HPEA 2QFPA 3H63A 1UF3A 3RQZA 4FBWA 3RL4A 3JYFA 5C1VA 3QFOA 5GTUA 3V4YA 3K7VC 3H62B 1T70A 2BDXA 3ICFA 2YEQA 4DHLA 2CV9A 1IT6A 2GJUA 4I5NC 3LL8A 5B8IA 1MF8A 3H67A 1V73A 4IL1A 4OR9A 4FBQA 4ZVZA 1HP1A 1S70A 4MP0A 3EGGA 4TUIA 4LTYA 3H66A 3C9FA 1G5BA 4H2GA 3P71C 2NYMC 3RL3A 2Q8UA 3HVQA 4MOVA 2ZBMA 4ORCA 1JK7A 3H69A 3IB8A 4O43A 3ZTVA 4YKEA 3IB7A 5INBA 5J28A 1S3MA 5JPFA 2P6BA 3D03A 5F3WA 1OIDA 2NXFA 2A22A 4I5LC 4DSYA 4ORAA 1M63A 4LU9A 4UWQA 1SU1A 3H68A 3IVEA 4WWLA 2JOGA 1XM7A 1W24A 4XPNA 5JPEA 2HY1A 1U32A 3T1IA 1WARA 4H2FA 2USHA 3E7BA 4ZX2A 4H1YP 4FBKA 3EGHA 4TUGA 1S95A 4UT2A 1WAO1 4DT2A 1HPUA 1QFCA 2QFRA 3C5WC 5JJTA 2O8GA 1S3LA 3E7AA 2WDFA 1FJMA 3CK2A 2ZOAA 4FCXA 3K7WC 4Q7FA 1TCOA 4H1SA 2ZO9B 2HYPA 2AHDA 1OIEA 2HYOA 3H64A 4HD0A 5DNYA 3DSDA 3FGAC 3N5UA 2Z72A 4V0XA 3THNA 2IE3C 3KBPA 2XMOA 3QFMA 1AUIA 1HO5A 1UTEA 3AV0A 4KBPA 4O4KA 3E0JA 4KKZA 4H2IA 3DSCA 2IE4C 4JA9A 2NYLC 2DXLA 1USHA 2KKNA 1S3NA 3AUZA
chains in the Genus database with same CATH topology
4O24A 3GVEA 2R17A 4MOYA 1Z2XA 2Z06A 4LACC 2WDCA 4NZVA 2QJCA 3PSNA 1S8EA 1OI8A 5IOHA 1T71A 3PSOA 3FLOA 4UT3B 3H60A 4JA7A 3H61A 4ORBA 3QG5C 4V0WA 3TGHA 4G9JA 3ZU0A 1KBPA 2O8AA 3IVDA 2BCDA 2DXNA 3QFNA 3RL5A 4B2OA 3QFKA 2BQ8X 3DW8C 1XZWA 2DFJA 2Z1AA 4O5GA 2WDEA 1Z2WA 4F0ZA 1QHWA 4H2BA 1NNWA 3THOB 4V0VA 2WDDA 2IAEC 2YVTA 1II7A 4IYPC 4J6OA 2NPPC 5EQVA 4UT3A 4M0VA 5HPEA 2QFPA 3H63A 1UF3A 3RQZA 4FBWA 3RL4A 3JYFA 5C1VA 3QFOA 5GTUA 3V4YA 3K7VC 3H62B 1T70A 2BDXA 3ICFA 2YEQA 4DHLA 2CV9A 1IT6A 2GJUA 4I5NC 3LL8A 5B8IA 1MF8A 3H67A 1V73A 4IL1A 4OR9A 4FBQA 4ZVZA 1HP1A 1S70A 4MP0A 3EGGA 4TUIA 4LTYA 3H66A 3C9FA 1G5BA 4H2GA 3P71C 2NYMC 3RL3A 2Q8UA 3HVQA 4MOVA 2ZBMA 4ORCA 1JK7A 3H69A 3IB8A 4O43A 3ZTVA 4YKEA 3IB7A 5INBA 5J28A 1S3MA 5JPFA 2P6BA 3D03A 5F3WA 1OIDA 2NXFA 2A22A 4I5LC 4DSYA 4ORAA 1M63A 4LU9A 4UWQA 1SU1A 3H68A 3IVEA 4WWLA 2JOGA 1XM7A 1W24A 4XPNA 5JPEA 2HY1A 1U32A 3T1IA 1WARA 4H2FA 2USHA 3E7BA 4ZX2A 4H1YP 4FBKA 3EGHA 4TUGA 1S95A 4UT2A 1WAO1 4DT2A 1HPUA 1QFCA 2QFRA 3C5WC 5JJTA 2O8GA 1S3LA 3E7AA 2WDFA 1FJMA 3CK2A 2ZOAA 4FCXA 3K7WC 4Q7FA 1TCOA 4H1SA 2ZO9B 2HYPA 2AHDA 1OIEA 2HYOA 3H64A 4HD0A 5DNYA 3DSDA 3FGAC 3N5UA 2Z72A 4V0XA 3THNA 2IE3C 3KBPA 2XMOA 3QFMA 1AUIA 1HO5A 1UTEA 3AV0A 4KBPA 4O4KA 3E0JA 4KKZA 4H2IA 3DSCA 2IE4C 4JA9A 2NYLC 2DXLA 1USHA 2KKNA 1S3NA 3AUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O24 A;  3GVE A;  2R17 A;  4MOY A;  1Z2X A;  2Z06 A;  4LAC C;  2WDC A;  4NZV A;  2QJC A;  3PSN A;  1S8E A;  1OI8 A;  5IOH A;  1T71 A;  3PSO A;  4UT3 B;  3H60 A;  4JA7 A;  3H61 A;  4ORB A;  3QG5 C;  4V0W A;  3TGH A;  4G9J A;  3ZU0 A;  1KBP A;  2O8A A;  3IVD A;  2BCD A;  3QFN A;  3RL5 A;  4B2O A;  3QFK A;  2BQ8 X;  3DW8 C;  1XZW A;  2Z1A A;  2DFJ A;  4O5G A;  2WDE A;  1Z2W A;  4F0Z A;  1QHW A;  4H2B A;  3THO B;  4V0V A;  2WDD A;  2IAE C;  2YVT A;  1II7 A;  4IYP C;  4J6O A;  2NPP C;  5EQV A;  4UT3 A;  4M0V A;  5HPE A;  2QFP A;  3H63 A;  1UF3 A;  3RQZ A;  4FBW A;  3RL4 A;  3JYF A;  5C1V A;  3QFO A;  5GTU A;  3V4Y A;  3K7V C;  3H62 B;  1T70 A;  2BDX A;  3ICF A;  4DHL A;  2CV9 A;  1IT6 A;  2GJU A;  4I5N C;  3LL8 A;  5B8I A;  1MF8 A;  3H67 A;  1V73 A;  4IL1 A;  4OR9 A;  4FBQ A;  4ZVZ A;  1HP1 A;  1S70 A;  4MP0 A;  3EGG A;  4TUI A;  4LTY A;  3H66 A;  3C9F A;  1G5B A;  4H2G A;  3P71 C;  2NYM C;  3RL3 A;  2Q8U A;  3HVQ A;  4MOV A;  2ZBM A;  4ORC A;  1JK7 A;  3H69 A;  3IB8 A;  4O43 A;  3ZTV A;  4YKE A;  3IB7 A;  5INB A;  5J28 A;  1S3M A;  5JPF A;  2P6B A;  5F3W A;  1OID A;  2NXF A;  2A22 A;  4I5L C;  4DSY A;  4ORA A;  1M63 A;  4LU9 A;  4UWQ A;  1SU1 A;  3H68 A;  3IVE A;  4WWL A;  2JOG A;  1XM7 A;  1W24 A;  4XPN A;  5JPE A;  2HY1 A;  1U32 A;  3T1I A;  1WAR A;  4H2F A;  2USH A;  3E7B A;  4ZX2 A;  4H1Y P;  4FBK A;  3EGH A;  4TUG A;  1S95 A;  4UT2 A;  1WAO 1;  4DT2 A;  1HPU A;  1QFC A;  2QFR A;  3C5W C;  5JJT A;  2O8G A;  1S3L A;  3E7A A;  2WDF A;  1FJM A;  3CK2 A;  4FCX A;  3K7W C;  4Q7F A;  1TCO A;  4H1S A;  2HYP A;  2AHD A;  1OIE A;  2HYO A;  3H64 A;  4HD0 A;  5DNY A;  3DSD A;  3FGA C;  3N5U A;  2Z72 A;  4V0X A;  3THN A;  2IE3 C;  3KBP A;  2XMO A;  3QFM A;  1AUI A;  1HO5 A;  1UTE A;  3AV0 A;  4KBP A;  4O4K A;  4KKZ A;  4H2I A;  3DSC A;  2IE4 C;  4JA9 A;  2NYL C;  1NNW A;  1USH A;  2KKN A;  1S3N A;  3AUZ A; 
#chains in the Genus database with same CATH topology
 4O24 A;  3GVE A;  2R17 A;  4MOY A;  1Z2X A;  2Z06 A;  4LAC C;  2WDC A;  4NZV A;  2QJC A;  3PSN A;  1S8E A;  1OI8 A;  5IOH A;  1T71 A;  3PSO A;  3FLO A;  4UT3 B;  3H60 A;  4JA7 A;  3H61 A;  4ORB A;  3QG5 C;  4V0W A;  3TGH A;  4G9J A;  3ZU0 A;  1KBP A;  2O8A A;  3IVD A;  2BCD A;  2DXN A;  3QFN A;  3RL5 A;  4B2O A;  3QFK A;  2BQ8 X;  3DW8 C;  1XZW A;  2DFJ A;  2Z1A A;  4O5G A;  2WDE A;  1Z2W A;  4F0Z A;  1QHW A;  4H2B A;  1NNW A;  3THO B;  4V0V A;  2WDD A;  2IAE C;  2YVT A;  1II7 A;  4IYP C;  4J6O A;  2NPP C;  5EQV A;  4UT3 A;  4M0V A;  5HPE A;  2QFP A;  3H63 A;  1UF3 A;  3RQZ A;  4FBW A;  3RL4 A;  3JYF A;  5C1V A;  3QFO A;  5GTU A;  3V4Y A;  3K7V C;  3H62 B;  1T70 A;  2BDX A;  3ICF A;  2YEQ A;  4DHL A;  2CV9 A;  1IT6 A;  2GJU A;  4I5N C;  3LL8 A;  5B8I A;  1MF8 A;  3H67 A;  1V73 A;  4IL1 A;  4OR9 A;  4FBQ A;  4ZVZ A;  1HP1 A;  1S70 A;  4MP0 A;  3EGG A;  4TUI A;  4LTY A;  3H66 A;  3C9F A;  1G5B A;  4H2G A;  3P71 C;  2NYM C;  3RL3 A;  2Q8U A;  3HVQ A;  4MOV A;  2ZBM A;  4ORC A;  1JK7 A;  3H69 A;  3IB8 A;  4O43 A;  3ZTV A;  4YKE A;  3IB7 A;  5INB A;  5J28 A;  1S3M A;  5JPF A;  2P6B A;  3D03 A;  5F3W A;  1OID A;  2NXF A;  2A22 A;  4I5L C;  4DSY A;  4ORA A;  1M63 A;  4LU9 A;  4UWQ A;  1SU1 A;  3H68 A;  3IVE A;  4WWL A;  2JOG A;  1XM7 A;  1W24 A;  4XPN A;  5JPE A;  2HY1 A;  1U32 A;  3T1I A;  1WAR A;  4H2F A;  2USH A;  3E7B A;  4ZX2 A;  4H1Y P;  4FBK A;  3EGH A;  4TUG A;  1S95 A;  4UT2 A;  1WAO 1;  4DT2 A;  1HPU A;  1QFC A;  2QFR A;  3C5W C;  5JJT A;  2O8G A;  1S3L A;  3E7A A;  2WDF A;  1FJM A;  3CK2 A;  2ZOA A;  4FCX A;  3K7W C;  4Q7F A;  1TCO A;  4H1S A;  2ZO9 B;  2HYP A;  2AHD A;  1OIE A;  2HYO A;  3H64 A;  4HD0 A;  5DNY A;  3DSD A;  3FGA C;  3N5U A;  2Z72 A;  4V0X A;  3THN A;  2IE3 C;  3KBP A;  2XMO A;  3QFM A;  1AUI A;  1HO5 A;  1UTE A;  3AV0 A;  4KBP A;  4O4K A;  3E0J A;  4KKZ A;  4H2I A;  3DSC A;  2IE4 C;  4JA9 A;  2NYL C;  2DXL A;  1USH A;  2KKN A;  1S3N A;  3AUZ A; 
#chains in the Genus database with same CATH homology
 4O24 A;  3GVE A;  2R17 A;  4MOY A;  1Z2X A;  2Z06 A;  4LAC C;  2WDC A;  4NZV A;  2QJC A;  3PSN A;  1S8E A;  1OI8 A;  5IOH A;  1T71 A;  3PSO A;  3FLO A;  4UT3 B;  3H60 A;  4JA7 A;  3H61 A;  4ORB A;  3QG5 C;  4V0W A;  3TGH A;  4G9J A;  3ZU0 A;  1KBP A;  2O8A A;  3IVD A;  2BCD A;  2DXN A;  3QFN A;  3RL5 A;  4B2O A;  3QFK A;  2BQ8 X;  3DW8 C;  1XZW A;  2DFJ A;  2Z1A A;  4O5G A;  2WDE A;  1Z2W A;  4F0Z A;  1QHW A;  4H2B A;  1NNW A;  3THO B;  4V0V A;  2WDD A;  2IAE C;  2YVT A;  1II7 A;  4IYP C;  4J6O A;  2NPP C;  5EQV A;  4UT3 A;  4M0V A;  5HPE A;  2QFP A;  3H63 A;  1UF3 A;  3RQZ A;  4FBW A;  3RL4 A;  3JYF A;  5C1V A;  3QFO A;  5GTU A;  3V4Y A;  3K7V C;  3H62 B;  1T70 A;  2BDX A;  3ICF A;  2YEQ A;  4DHL A;  2CV9 A;  1IT6 A;  2GJU A;  4I5N C;  3LL8 A;  5B8I A;  1MF8 A;  3H67 A;  1V73 A;  4IL1 A;  4OR9 A;  4FBQ A;  4ZVZ A;  1HP1 A;  1S70 A;  4MP0 A;  3EGG A;  4TUI A;  4LTY A;  3H66 A;  3C9F A;  1G5B A;  4H2G A;  3P71 C;  2NYM C;  3RL3 A;  2Q8U A;  3HVQ A;  4MOV A;  2ZBM A;  4ORC A;  1JK7 A;  3H69 A;  3IB8 A;  4O43 A;  3ZTV A;  4YKE A;  3IB7 A;  5INB A;  5J28 A;  1S3M A;  5JPF A;  2P6B A;  3D03 A;  5F3W A;  1OID A;  2NXF A;  2A22 A;  4I5L C;  4DSY A;  4ORA A;  1M63 A;  4LU9 A;  4UWQ A;  1SU1 A;  3H68 A;  3IVE A;  4WWL A;  2JOG A;  1XM7 A;  1W24 A;  4XPN A;  5JPE A;  2HY1 A;  1U32 A;  3T1I A;  1WAR A;  4H2F A;  2USH A;  3E7B A;  4ZX2 A;  4H1Y P;  4FBK A;  3EGH A;  4TUG A;  1S95 A;  4UT2 A;  1WAO 1;  4DT2 A;  1HPU A;  1QFC A;  2QFR A;  3C5W C;  5JJT A;  2O8G A;  1S3L A;  3E7A A;  2WDF A;  1FJM A;  3CK2 A;  2ZOA A;  4FCX A;  3K7W C;  4Q7F A;  1TCO A;  4H1S A;  2ZO9 B;  2HYP A;  2AHD A;  1OIE A;  2HYO A;  3H64 A;  4HD0 A;  5DNY A;  3DSD A;  3FGA C;  3N5U A;  2Z72 A;  4V0X A;  3THN A;  2IE3 C;  3KBP A;  2XMO A;  3QFM A;  1AUI A;  1HO5 A;  1UTE A;  3AV0 A;  4KBP A;  4O4K A;  3E0J A;  4KKZ A;  4H2I A;  3DSC A;  2IE4 C;  4JA9 A;  2NYL C;  2DXL A;  1USH A;  2KKN A;  1S3N A;  3AUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...