2IE4C

Structure of the protein phosphatase 2a core enzyme bound to okadaic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,hydrolase
molecule keywords Protein Phosphatase 2, regulatory subunit A (PR 65), alpha i
publication title Structure of Protein Phosphatase 2A Core Enzyme Bound to Tumor-Inducing Toxins
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2ie4C00
1Z2XA 3HVQA 2IE3C 3H61A 2HYPA 3DSCA 1UF3A 3RL5A 1Z2WA 4M0VA 3H60A 4LACC 2KKNA 1U32A 3H64A 3THNA 4IYPC 1OIEA 4YKEA 2BQ8X 3E7BA 2BCDA 3GVEA 3N5UA 4Q7FA 5B8IA 5JJTA 2IAEC 3C5WC 1WARA 5C1VA 3RL4A 4H1YP 4ORBA 3RL3A 3DSDA 4UT3A 1XM7A 4O43A 1OIDA 4JA9A 4ZVZA 2R17A 4ZX2A 4FBKA 4FBQA 4O4KA 2NYMC 3ZTVA 3JYFA 2WDCA 1V73A 4KKZA 4MP0A 5J28A 1S3MA 5F3WA 4MOYA 3K7VC 3DW8C 5GTUA 1S3NA 4KBPA 3T1IA 3CK2A 2DFJA 4V0VA 2ZBMA 4LTYA 3V4YA 1QFCA 3PSNA 1T70A 4FBWA 2O8AA 1II7A 2HYOA 3IB7A 3RQZA 1WAO1 2Q8UA 4ORAA 2BDXA 3K7WC 1S95A 3AV0A 4V0WA 4F0ZA 4UT3B 5HPEA 1HPUA 3H68A 1QHWA 4WWLA 1XZWA 3EGGA 5EQVA 1AUIA 4V0XA 3LL8A 3IB8A 2NYLC 3QFOA 4B2OA 2IE4C 2USHA 2HY1A 3KBPA 3THOB 2YVTA 4DSYA 3IVEA 4MOVA 4G9JA 2AHDA 1OI8A 4JA7A 2QJCA 3P71C 2O8GA 4H2GA 4ORCA 4TUIA 4DHLA 2WDDA 3H63A 4IL1A 2Z1AA 1G5BA 1HP1A 1USHA 2XMOA 4NZVA 4HD0A 4FCXA 5JPFA 1KBPA 2P6BA 1S70A 3PSOA 4H2IA 1SU1A 1HO5A 3ICFA 1M63A 1FJMA 2A22A 3QFKA 1JK7A 3H69A 2QFRA 5IOHA 3C9FA 4H2BA 4J6OA 3AUZA 4O5GA 3E7AA 1S8EA 4I5LC 2QFPA 4TUGA 1NNWA 3H66A 2CV9A 4OR9A 4H2FA 3IVDA 3EGHA 4I5NC 2Z72A 3ZU0A 1T71A 4LU9A 2WDFA 2GJUA 3QFNA 1W24A 3TGHA 1IT6A 1UTEA 4DT2A 3QFMA 4O24A 4XPNA 5DNYA 2JOGA 3H67A 3QG5C 3H62B 4UT2A 5INBA 4H1SA 1MF8A 5JPEA 2NPPC 2NXFA 2WDEA 1S3LA 2Z06A 3FGAC 4UWQA 1TCOA
chains in the Genus database with same CATH superfamily
1Z2XA 2DXLA 2YEQA 2IE3C 3H61A 3HVQA 2HYPA 3DSCA 1UF3A 3RL5A 1Z2WA 4M0VA 3H60A 3D03A 4LACC 2KKNA 1U32A 3H64A 3THNA 4IYPC 1OIEA 4YKEA 2BQ8X 3E7BA 2BCDA 3GVEA 3N5UA 4Q7FA 5B8IA 5JJTA 2IAEC 3C5WC 1WARA 5C1VA 3RL4A 4H1YP 4ORBA 3RL3A 3DSDA 4UT3A 1XM7A 4O43A 1OIDA 4JA9A 4ZVZA 2R17A 4ZX2A 2DXNA 4FBKA 4FBQA 4O4KA 2NYMC 3ZTVA 3JYFA 2WDCA 1V73A 4KKZA 4MP0A 5J28A 1S3MA 5F3WA 4MOYA 3K7VC 3DW8C 5GTUA 1S3NA 4KBPA 3T1IA 3CK2A 2DFJA 4V0VA 2ZBMA 4LTYA 3V4YA 1QFCA 3PSNA 1T70A 4FBWA 2O8AA 1II7A 2HYOA 3IB7A 3RQZA 1WAO1 2Q8UA 4ORAA 2BDXA 3K7WC 1S95A 3AV0A 4V0WA 4F0ZA 4UT3B 5HPEA 1HPUA 3H68A 1QHWA 4WWLA 1XZWA 3EGGA 5EQVA 1AUIA 4V0XA 3LL8A 3IB8A 2NYLC 3QFOA 4B2OA 2IE4C 2USHA 2HY1A 3KBPA 3THOB 2YVTA 4DSYA 3IVEA 4MOVA 4G9JA 2AHDA 1OI8A 4JA7A 2QJCA 3P71C 2O8GA 4H2GA 4ORCA 4TUIA 4DHLA 2WDDA 3H63A 4IL1A 2Z1AA 1G5BA 1HP1A 1USHA 2XMOA 4NZVA 4HD0A 4FCXA 5JPFA 1KBPA 2P6BA 1S70A 3PSOA 4H2IA 1SU1A 1HO5A 3ICFA 1M63A 1FJMA 2A22A 3QFKA 1JK7A 3H69A 2QFRA 5IOHA 3C9FA 2ZOAA 3E0JA 4H2BA 4J6OA 3AUZA 4O5GA 3E7AA 1S8EA 3FLOA 2QFPA 4I5LC 4TUGA 1NNWA 3H66A 2CV9A 4OR9A 4H2FA 3IVDA 3EGHA 4I5NC 2Z72A 3ZU0A 1T71A 4LU9A 2WDFA 2GJUA 3QFNA 1W24A 3TGHA 1IT6A 1UTEA 4DT2A 3QFMA 4O24A 4XPNA 5DNYA 2JOGA 3H67A 2ZO9B 3H62B 3QG5C 4UT2A 5INBA 4H1SA 1MF8A 5JPEA 2NPPC 2NXFA 2WDEA 1S3LA 2Z06A 3FGAC 4UWQA 1TCOA
chains in the Genus database with same CATH topology
1Z2XA 2DXLA 2YEQA 2IE3C 3H61A 3HVQA 2HYPA 3DSCA 1UF3A 3RL5A 1Z2WA 4M0VA 3H60A 3D03A 4LACC 2KKNA 1U32A 3H64A 3THNA 4IYPC 1OIEA 4YKEA 2BQ8X 3E7BA 2BCDA 3GVEA 3N5UA 4Q7FA 5B8IA 5JJTA 2IAEC 3C5WC 1WARA 5C1VA 3RL4A 4H1YP 4ORBA 3RL3A 3DSDA 4UT3A 1XM7A 4O43A 1OIDA 4JA9A 4ZVZA 2R17A 4ZX2A 2DXNA 4FBKA 4FBQA 4O4KA 2NYMC 3ZTVA 3JYFA 2WDCA 1V73A 4KKZA 4MP0A 5J28A 1S3MA 5F3WA 4MOYA 3K7VC 3DW8C 5GTUA 1S3NA 4KBPA 3T1IA 3CK2A 2DFJA 4V0VA 2ZBMA 4LTYA 3V4YA 1QFCA 3PSNA 1T70A 4FBWA 2O8AA 1II7A 2HYOA 3IB7A 3RQZA 1WAO1 2Q8UA 4ORAA 2BDXA 3K7WC 1S95A 3AV0A 4V0WA 4F0ZA 4UT3B 5HPEA 1HPUA 3H68A 1QHWA 4WWLA 1XZWA 3EGGA 5EQVA 1AUIA 4V0XA 3LL8A 3IB8A 2NYLC 3QFOA 4B2OA 2IE4C 2USHA 2HY1A 3KBPA 3THOB 2YVTA 4DSYA 3IVEA 4MOVA 4G9JA 2AHDA 1OI8A 4JA7A 2QJCA 3P71C 2O8GA 4H2GA 4ORCA 4TUIA 4DHLA 2WDDA 3H63A 4IL1A 2Z1AA 1G5BA 1HP1A 1USHA 2XMOA 4NZVA 4HD0A 4FCXA 5JPFA 1KBPA 2P6BA 1S70A 3PSOA 4H2IA 1SU1A 1HO5A 3ICFA 1M63A 1FJMA 2A22A 3QFKA 1JK7A 3H69A 2QFRA 5IOHA 3C9FA 2ZOAA 3E0JA 4H2BA 4J6OA 3AUZA 4O5GA 3E7AA 1S8EA 3FLOA 2QFPA 4I5LC 4TUGA 1NNWA 3H66A 2CV9A 4OR9A 4H2FA 3IVDA 3EGHA 4I5NC 2Z72A 3ZU0A 1T71A 4LU9A 2WDFA 2GJUA 3QFNA 1W24A 3TGHA 1IT6A 1UTEA 4DT2A 3QFMA 4O24A 4XPNA 5DNYA 2JOGA 3H67A 2ZO9B 3H62B 3QG5C 4UT2A 5INBA 4H1SA 1MF8A 5JPEA 2NPPC 2NXFA 2WDEA 1S3LA 2Z06A 3FGAC 4UWQA 1TCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2X A;  3HVQ A;  2IE3 C;  3H61 A;  2HYP A;  3DSC A;  1UF3 A;  3RL5 A;  1Z2W A;  4M0V A;  3H60 A;  4LAC C;  2KKN A;  1U32 A;  3H64 A;  3THN A;  4IYP C;  1OIE A;  4YKE A;  2BQ8 X;  3E7B A;  2BCD A;  3GVE A;  3N5U A;  4Q7F A;  5B8I A;  5JJT A;  2IAE C;  3C5W C;  1WAR A;  5C1V A;  3RL4 A;  4H1Y P;  4ORB A;  3RL3 A;  3DSD A;  4UT3 A;  1XM7 A;  4O43 A;  1OID A;  4JA9 A;  4ZVZ A;  2R17 A;  4ZX2 A;  4FBK A;  4FBQ A;  4O4K A;  2NYM C;  3ZTV A;  3JYF A;  2WDC A;  1V73 A;  4KKZ A;  4MP0 A;  5J28 A;  1S3M A;  5F3W A;  4MOY A;  3K7V C;  3DW8 C;  5GTU A;  1S3N A;  4KBP A;  3T1I A;  3CK2 A;  2DFJ A;  4V0V A;  2ZBM A;  4LTY A;  3V4Y A;  1QFC A;  3PSN A;  1T70 A;  4FBW A;  2O8A A;  1II7 A;  2HYO A;  3IB7 A;  3RQZ A;  1WAO 1;  2Q8U A;  4ORA A;  2BDX A;  3K7W C;  1S95 A;  3AV0 A;  4V0W A;  4F0Z A;  4UT3 B;  5HPE A;  1HPU A;  3H68 A;  1QHW A;  4WWL A;  1XZW A;  3EGG A;  5EQV A;  1AUI A;  4V0X A;  3LL8 A;  3IB8 A;  2NYL C;  3QFO A;  4B2O A;  2IE4 C;  2USH A;  2HY1 A;  3KBP A;  3THO B;  2YVT A;  4DSY A;  3IVE A;  4MOV A;  4G9J A;  2AHD A;  1OI8 A;  4JA7 A;  2QJC A;  3P71 C;  2O8G A;  4H2G A;  4ORC A;  4TUI A;  4DHL A;  2WDD A;  3H63 A;  4IL1 A;  2Z1A A;  1G5B A;  1HP1 A;  1USH A;  2XMO A;  4NZV A;  4HD0 A;  4FCX A;  5JPF A;  1KBP A;  2P6B A;  1S70 A;  3PSO A;  4H2I A;  1SU1 A;  1HO5 A;  3ICF A;  1M63 A;  1FJM A;  2A22 A;  3QFK A;  1JK7 A;  3H69 A;  2QFR A;  5IOH A;  3C9F A;  4H2B A;  4J6O A;  3AUZ A;  4O5G A;  3E7A A;  1S8E A;  4I5L C;  2QFP A;  4TUG A;  1NNW A;  3H66 A;  2CV9 A;  4OR9 A;  4H2F A;  3IVD A;  3EGH A;  4I5N C;  2Z72 A;  3ZU0 A;  1T71 A;  4LU9 A;  2WDF A;  2GJU A;  3QFN A;  1W24 A;  3TGH A;  1IT6 A;  1UTE A;  4DT2 A;  3QFM A;  4O24 A;  4XPN A;  5DNY A;  2JOG A;  3H67 A;  3QG5 C;  3H62 B;  4UT2 A;  5INB A;  4H1S A;  1MF8 A;  5JPE A;  2NPP C;  2NXF A;  2WDE A;  1S3L A;  2Z06 A;  3FGA C;  4UWQ A;  1TCO A; 
#chains in the Genus database with same CATH topology
 1Z2X A;  2DXL A;  2YEQ A;  2IE3 C;  3H61 A;  3HVQ A;  2HYP A;  3DSC A;  1UF3 A;  3RL5 A;  1Z2W A;  4M0V A;  3H60 A;  3D03 A;  4LAC C;  2KKN A;  1U32 A;  3H64 A;  3THN A;  4IYP C;  1OIE A;  4YKE A;  2BQ8 X;  3E7B A;  2BCD A;  3GVE A;  3N5U A;  4Q7F A;  5B8I A;  5JJT A;  2IAE C;  3C5W C;  1WAR A;  5C1V A;  3RL4 A;  4H1Y P;  4ORB A;  3RL3 A;  3DSD A;  4UT3 A;  1XM7 A;  4O43 A;  1OID A;  4JA9 A;  4ZVZ A;  2R17 A;  4ZX2 A;  2DXN A;  4FBK A;  4FBQ A;  4O4K A;  2NYM C;  3ZTV A;  3JYF A;  2WDC A;  1V73 A;  4KKZ A;  4MP0 A;  5J28 A;  1S3M A;  5F3W A;  4MOY A;  3K7V C;  3DW8 C;  5GTU A;  1S3N A;  4KBP A;  3T1I A;  3CK2 A;  2DFJ A;  4V0V A;  2ZBM A;  4LTY A;  3V4Y A;  1QFC A;  3PSN A;  1T70 A;  4FBW A;  2O8A A;  1II7 A;  2HYO A;  3IB7 A;  3RQZ A;  1WAO 1;  2Q8U A;  4ORA A;  2BDX A;  3K7W C;  1S95 A;  3AV0 A;  4V0W A;  4F0Z A;  4UT3 B;  5HPE A;  1HPU A;  3H68 A;  1QHW A;  4WWL A;  1XZW A;  3EGG A;  5EQV A;  1AUI A;  4V0X A;  3LL8 A;  3IB8 A;  2NYL C;  3QFO A;  4B2O A;  2IE4 C;  2USH A;  2HY1 A;  3KBP A;  3THO B;  2YVT A;  4DSY A;  3IVE A;  4MOV A;  4G9J A;  2AHD A;  1OI8 A;  4JA7 A;  2QJC A;  3P71 C;  2O8G A;  4H2G A;  4ORC A;  4TUI A;  4DHL A;  2WDD A;  3H63 A;  4IL1 A;  2Z1A A;  1G5B A;  1HP1 A;  1USH A;  2XMO A;  4NZV A;  4HD0 A;  4FCX A;  5JPF A;  1KBP A;  2P6B A;  1S70 A;  3PSO A;  4H2I A;  1SU1 A;  1HO5 A;  3ICF A;  1M63 A;  1FJM A;  2A22 A;  3QFK A;  1JK7 A;  3H69 A;  2QFR A;  5IOH A;  3C9F A;  2ZOA A;  3E0J A;  4H2B A;  4J6O A;  3AUZ A;  4O5G A;  3E7A A;  1S8E A;  3FLO A;  2QFP A;  4I5L C;  4TUG A;  1NNW A;  3H66 A;  2CV9 A;  4OR9 A;  4H2F A;  3IVD A;  3EGH A;  4I5N C;  2Z72 A;  3ZU0 A;  1T71 A;  4LU9 A;  2WDF A;  2GJU A;  3QFN A;  1W24 A;  3TGH A;  1IT6 A;  1UTE A;  4DT2 A;  3QFM A;  4O24 A;  4XPN A;  5DNY A;  2JOG A;  3H67 A;  2ZO9 B;  3H62 B;  3QG5 C;  4UT2 A;  5INB A;  4H1S A;  1MF8 A;  5JPE A;  2NPP C;  2NXF A;  2WDE A;  1S3L A;  2Z06 A;  3FGA C;  4UWQ A;  1TCO A; 
#chains in the Genus database with same CATH homology
 1Z2X A;  2DXL A;  2YEQ A;  2IE3 C;  3H61 A;  3HVQ A;  2HYP A;  3DSC A;  1UF3 A;  3RL5 A;  1Z2W A;  4M0V A;  3H60 A;  3D03 A;  4LAC C;  2KKN A;  1U32 A;  3H64 A;  3THN A;  4IYP C;  1OIE A;  4YKE A;  2BQ8 X;  3E7B A;  2BCD A;  3GVE A;  3N5U A;  4Q7F A;  5B8I A;  5JJT A;  2IAE C;  3C5W C;  1WAR A;  5C1V A;  3RL4 A;  4H1Y P;  4ORB A;  3RL3 A;  3DSD A;  4UT3 A;  1XM7 A;  4O43 A;  1OID A;  4JA9 A;  4ZVZ A;  2R17 A;  4ZX2 A;  2DXN A;  4FBK A;  4FBQ A;  4O4K A;  2NYM C;  3ZTV A;  3JYF A;  2WDC A;  1V73 A;  4KKZ A;  4MP0 A;  5J28 A;  1S3M A;  5F3W A;  4MOY A;  3K7V C;  3DW8 C;  5GTU A;  1S3N A;  4KBP A;  3T1I A;  3CK2 A;  2DFJ A;  4V0V A;  2ZBM A;  4LTY A;  3V4Y A;  1QFC A;  3PSN A;  1T70 A;  4FBW A;  2O8A A;  1II7 A;  2HYO A;  3IB7 A;  3RQZ A;  1WAO 1;  2Q8U A;  4ORA A;  2BDX A;  3K7W C;  1S95 A;  3AV0 A;  4V0W A;  4F0Z A;  4UT3 B;  5HPE A;  1HPU A;  3H68 A;  1QHW A;  4WWL A;  1XZW A;  3EGG A;  5EQV A;  1AUI A;  4V0X A;  3LL8 A;  3IB8 A;  2NYL C;  3QFO A;  4B2O A;  2IE4 C;  2USH A;  2HY1 A;  3KBP A;  3THO B;  2YVT A;  4DSY A;  3IVE A;  4MOV A;  4G9J A;  2AHD A;  1OI8 A;  4JA7 A;  2QJC A;  3P71 C;  2O8G A;  4H2G A;  4ORC A;  4TUI A;  4DHL A;  2WDD A;  3H63 A;  4IL1 A;  2Z1A A;  1G5B A;  1HP1 A;  1USH A;  2XMO A;  4NZV A;  4HD0 A;  4FCX A;  5JPF A;  1KBP A;  2P6B A;  1S70 A;  3PSO A;  4H2I A;  1SU1 A;  1HO5 A;  3ICF A;  1M63 A;  1FJM A;  2A22 A;  3QFK A;  1JK7 A;  3H69 A;  2QFR A;  5IOH A;  3C9F A;  2ZOA A;  3E0J A;  4H2B A;  4J6O A;  3AUZ A;  4O5G A;  3E7A A;  1S8E A;  3FLO A;  2QFP A;  4I5L C;  4TUG A;  1NNW A;  3H66 A;  2CV9 A;  4OR9 A;  4H2F A;  3IVD A;  3EGH A;  4I5N C;  2Z72 A;  3ZU0 A;  1T71 A;  4LU9 A;  2WDF A;  2GJU A;  3QFN A;  1W24 A;  3TGH A;  1IT6 A;  1UTE A;  4DT2 A;  3QFM A;  4O24 A;  4XPN A;  5DNY A;  2JOG A;  3H67 A;  2ZO9 B;  3H62 B;  3QG5 C;  4UT2 A;  5INB A;  4H1S A;  1MF8 A;  5JPE A;  2NPP C;  2NXF A;  2WDE A;  1S3L A;  2Z06 A;  3FGA C;  4UWQ A;  1TCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...