2HY1A

Crystal structure of rv0805
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
256
structure length
227
Chain Sequence
PRPDYVLLHISDTHLIDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCGCNLVHVYPDTVVHSVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Rv0805
publication title Structural and Biochemical Analysis of the Rv0805 Cyclic Nucleotide Phosphodiesterase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 66
structure length 227
sequence length 256
ec nomenclature ec 3.1.4.53: 3',5'-cyclic-AMP phosphodiesterase.
pdb deposition date 2006-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 2hy1A00
2IE4C 1SU1A 2P6BA 2A22A 4V0WA 4DT2A 5JJTA 3V4YA 3H66A 3RQZA 3QFKA 3EGHA 3IB7A 4MOYA 2JOGA 3C9FA 4H2GA 4Q7FA 3H67A 2QFPA 1USHA 2O8GA 2USHA 3PSOA 4TUIA 2QFRA 4DSYA 3AUZA 4UT2A 5JPEA 3T1IA 4MP0A 2NPPC 4LU9A 1QFCA 4MOVA 4XPNA 3FGAC 4JA7A 3DSDA 4LTYA 1UF3A 4H1YP 3ZU0A 1M63A 3QFMA 4FBWA 2IAEC 3LL8A 4UWQA 3RL4A 3E7BA 3H61A 3JYFA 2NXFA 1QHWA 3IB8A 4V0XA 4FCXA 1HO5A 1OIDA 1G5BA 4LACC 3THOB 3PSNA 3H69A 1NNWA 5F3WA 2WDEA 2XMOA 4IYPC 1S3NA 3H64A 4FBQA 1XZWA 4ORBA 1S95A 2BCDA 4FBKA 5EQVA 2GJUA 4WWLA 1MF8A 5JPFA 3KBPA 2HYOA 2WDCA 1UTEA 1S70A 3QFOA 2BDXA 1Z2XA 1TCOA 3DW8C 4HD0A 3E7AA 4NZVA 2BQ8X 1W24A 4G9JA 4H2FA 4UT3A 3C5WC 2NYLC 4ZVZA 3CK2A 5GTUA 3TGHA 2WDFA 3GVEA 1WARA 4O5GA 1HPUA 4ORCA 3RL3A 1Z2WA 5INBA 1FJMA 1II7A 2IE3C 2NYMC 3IVEA 4JA9A 4B2OA 4H1SA 3ZTVA 3K7WC 2Z06A 1S3MA 1S8EA 1OI8A 5J28A 4OR9A 1IT6A 4I5LC 1HP1A 1KBPA 4ORAA 1V73A 4UT3B 2HYPA 3QFNA 1WAO1 2YVTA 1JK7A 2WDDA 3H68A 1S3LA 4H2IA 4ZX2A 5IOHA 2O8AA 4O43A 1U32A 3HVQA 3K7VC 4I5NC 3RL5A 5C1VA 3THNA 2CV9A 2R17A 2Z1AA 1AUIA 2AHDA 1T71A 3N5UA 4H2BA 3EGGA 2Q8UA 4F0ZA 2QJCA 3IVDA 4YKEA 3H63A 5HPEA 2HY1A 4IL1A 5DNYA 2KKNA 3ICFA 4M0VA 4V0VA 4DHLA 1OIEA 3QG5C 4TUGA 1T70A 4KKZA 1XM7A 3AV0A 3P71C 3H62B 2Z72A 4O4KA 4O24A 2DFJA 4J6OA 3DSCA 4KBPA 5B8IA 2ZBMA 3H60A
chains in the Genus database with same CATH superfamily
2IE4C 1SU1A 2P6BA 2A22A 4V0WA 4DT2A 5JJTA 3V4YA 3H66A 3RQZA 3QFKA 3EGHA 3IB7A 4MOYA 2JOGA 3C9FA 4H2GA 4Q7FA 3H67A 2QFPA 1USHA 2O8GA 2USHA 3PSOA 4TUIA 2QFRA 4DSYA 3AUZA 4UT2A 5JPEA 3T1IA 4MP0A 2NPPC 4LU9A 1QFCA 4MOVA 4XPNA 3FGAC 4JA7A 3DSDA 4LTYA 1UF3A 4H1YP 3ZU0A 1M63A 3QFMA 4FBWA 2IAEC 3LL8A 4UWQA 3RL4A 3E7BA 3H61A 3JYFA 2NXFA 1QHWA 3IB8A 4V0XA 4FCXA 1HO5A 1OIDA 1G5BA 4LACC 3THOB 3PSNA 3H69A 1NNWA 2ZOAA 5F3WA 2WDEA 2XMOA 4IYPC 1S3NA 3H64A 4FBQA 1XZWA 4ORBA 1S95A 2BCDA 4FBKA 5EQVA 2GJUA 4WWLA 1MF8A 5JPFA 2YEQA 3KBPA 2HYOA 2WDCA 1UTEA 1S70A 3QFOA 2BDXA 1Z2XA 1TCOA 3DW8C 4HD0A 3E7AA 4NZVA 2BQ8X 1W24A 4G9JA 4H2FA 4UT3A 3C5WC 2NYLC 4ZVZA 3CK2A 5GTUA 3TGHA 2WDFA 3GVEA 1WARA 4O5GA 1HPUA 4ORCA 3RL3A 1Z2WA 5INBA 1FJMA 1II7A 2IE3C 2NYMC 3IVEA 4JA9A 4B2OA 4H1SA 3ZTVA 3K7WC 2Z06A 1S3MA 1S8EA 1OI8A 5J28A 4OR9A 1IT6A 4I5LC 1HP1A 1KBPA 4ORAA 1V73A 4UT3B 2HYPA 3QFNA 1WAO1 2YVTA 1JK7A 2WDDA 3H68A 1S3LA 3E0JA 4H2IA 3FLOA 4ZX2A 5IOHA 2O8AA 4O43A 1U32A 3HVQA 3K7VC 4I5NC 3RL5A 5C1VA 3THNA 3D03A 2CV9A 2R17A 2Z1AA 1AUIA 2AHDA 1T71A 3N5UA 4H2BA 3EGGA 2Q8UA 4F0ZA 2QJCA 3IVDA 4YKEA 3H63A 5HPEA 2HY1A 4IL1A 5DNYA 2KKNA 3ICFA 4M0VA 4V0VA 4DHLA 1OIEA 3QG5C 4TUGA 1T70A 4KKZA 1XM7A 2DXNA 3AV0A 3P71C 3H62B 2Z72A 4O4KA 2DXLA 4O24A 2ZO9B 2DFJA 4J6OA 3DSCA 4KBPA 5B8IA 2ZBMA 3H60A
chains in the Genus database with same CATH topology
2IE4C 1SU1A 2P6BA 2A22A 4V0WA 4DT2A 5JJTA 3V4YA 3H66A 3RQZA 3QFKA 3EGHA 3IB7A 4MOYA 2JOGA 3C9FA 4H2GA 4Q7FA 3H67A 2QFPA 1USHA 2O8GA 2USHA 3PSOA 4TUIA 2QFRA 4DSYA 3AUZA 4UT2A 5JPEA 3T1IA 4MP0A 2NPPC 4LU9A 1QFCA 4MOVA 4XPNA 3FGAC 4JA7A 3DSDA 4LTYA 1UF3A 4H1YP 3ZU0A 1M63A 3QFMA 4FBWA 2IAEC 3LL8A 4UWQA 3RL4A 3E7BA 3H61A 3JYFA 2NXFA 1QHWA 3IB8A 4V0XA 4FCXA 1HO5A 1OIDA 1G5BA 4LACC 3THOB 3PSNA 3H69A 1NNWA 2ZOAA 5F3WA 2WDEA 2XMOA 4IYPC 1S3NA 3H64A 4FBQA 1XZWA 4ORBA 1S95A 2BCDA 4FBKA 5EQVA 2GJUA 4WWLA 1MF8A 5JPFA 2YEQA 3KBPA 2HYOA 2WDCA 1UTEA 1S70A 3QFOA 2BDXA 1Z2XA 1TCOA 3DW8C 4HD0A 3E7AA 4NZVA 2BQ8X 1W24A 4G9JA 4H2FA 4UT3A 3C5WC 2NYLC 4ZVZA 3CK2A 5GTUA 3TGHA 2WDFA 3GVEA 1WARA 4O5GA 1HPUA 4ORCA 3RL3A 1Z2WA 5INBA 1FJMA 1II7A 2IE3C 2NYMC 3IVEA 4JA9A 4B2OA 4H1SA 3ZTVA 3K7WC 2Z06A 1S3MA 1S8EA 1OI8A 5J28A 4OR9A 1IT6A 4I5LC 1HP1A 1KBPA 4ORAA 1V73A 4UT3B 2HYPA 3QFNA 1WAO1 2YVTA 1JK7A 2WDDA 3H68A 1S3LA 3E0JA 4H2IA 3FLOA 4ZX2A 5IOHA 2O8AA 4O43A 1U32A 3HVQA 3K7VC 4I5NC 3RL5A 5C1VA 3THNA 3D03A 2CV9A 2R17A 2Z1AA 1AUIA 2AHDA 1T71A 3N5UA 4H2BA 3EGGA 2Q8UA 4F0ZA 2QJCA 3IVDA 4YKEA 3H63A 5HPEA 2HY1A 4IL1A 5DNYA 2KKNA 3ICFA 4M0VA 4V0VA 4DHLA 1OIEA 3QG5C 4TUGA 1T70A 4KKZA 1XM7A 2DXNA 3AV0A 3P71C 3H62B 2Z72A 4O4KA 2DXLA 4O24A 2ZO9B 2DFJA 4J6OA 3DSCA 4KBPA 5B8IA 2ZBMA 3H60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IE4 C;  1SU1 A;  2P6B A;  2A22 A;  4V0W A;  4DT2 A;  5JJT A;  3V4Y A;  3H66 A;  3RQZ A;  3QFK A;  3EGH A;  3IB7 A;  4MOY A;  2JOG A;  3C9F A;  4H2G A;  4Q7F A;  3H67 A;  2QFP A;  1USH A;  2O8G A;  2USH A;  3PSO A;  4TUI A;  2QFR A;  4DSY A;  3AUZ A;  4UT2 A;  5JPE A;  3T1I A;  4MP0 A;  2NPP C;  4LU9 A;  1QFC A;  4MOV A;  4XPN A;  3FGA C;  4JA7 A;  3DSD A;  4LTY A;  1UF3 A;  4H1Y P;  3ZU0 A;  1M63 A;  3QFM A;  4FBW A;  2IAE C;  3LL8 A;  4UWQ A;  3RL4 A;  3E7B A;  3H61 A;  3JYF A;  2NXF A;  1QHW A;  3IB8 A;  4V0X A;  4FCX A;  1HO5 A;  1OID A;  1G5B A;  4LAC C;  3THO B;  3PSN A;  3H69 A;  1NNW A;  5F3W A;  2WDE A;  2XMO A;  4IYP C;  1S3N A;  3H64 A;  4FBQ A;  1XZW A;  4ORB A;  1S95 A;  2BCD A;  4FBK A;  5EQV A;  2GJU A;  4WWL A;  1MF8 A;  5JPF A;  3KBP A;  2HYO A;  2WDC A;  1UTE A;  1S70 A;  3QFO A;  2BDX A;  1Z2X A;  1TCO A;  3DW8 C;  4HD0 A;  3E7A A;  4NZV A;  2BQ8 X;  1W24 A;  4G9J A;  4H2F A;  4UT3 A;  3C5W C;  2NYL C;  4ZVZ A;  3CK2 A;  5GTU A;  3TGH A;  2WDF A;  3GVE A;  1WAR A;  4O5G A;  1HPU A;  4ORC A;  3RL3 A;  1Z2W A;  5INB A;  1FJM A;  1II7 A;  2IE3 C;  2NYM C;  3IVE A;  4JA9 A;  4B2O A;  4H1S A;  3ZTV A;  3K7W C;  2Z06 A;  1S3M A;  1S8E A;  1OI8 A;  5J28 A;  4OR9 A;  1IT6 A;  4I5L C;  1HP1 A;  1KBP A;  4ORA A;  1V73 A;  4UT3 B;  2HYP A;  3QFN A;  1WAO 1;  2YVT A;  1JK7 A;  2WDD A;  3H68 A;  1S3L A;  4H2I A;  4ZX2 A;  5IOH A;  2O8A A;  4O43 A;  1U32 A;  3HVQ A;  3K7V C;  4I5N C;  3RL5 A;  5C1V A;  3THN A;  2CV9 A;  2R17 A;  2Z1A A;  1AUI A;  2AHD A;  1T71 A;  3N5U A;  4H2B A;  3EGG A;  2Q8U A;  4F0Z A;  2QJC A;  3IVD A;  4YKE A;  3H63 A;  5HPE A;  2HY1 A;  4IL1 A;  5DNY A;  2KKN A;  3ICF A;  4M0V A;  4V0V A;  4DHL A;  1OIE A;  3QG5 C;  4TUG A;  1T70 A;  4KKZ A;  1XM7 A;  3AV0 A;  3P71 C;  3H62 B;  2Z72 A;  4O4K A;  4O24 A;  2DFJ A;  4J6O A;  3DSC A;  4KBP A;  5B8I A;  2ZBM A;  3H60 A; 
#chains in the Genus database with same CATH topology
 2IE4 C;  1SU1 A;  2P6B A;  2A22 A;  4V0W A;  4DT2 A;  5JJT A;  3V4Y A;  3H66 A;  3RQZ A;  3QFK A;  3EGH A;  3IB7 A;  4MOY A;  2JOG A;  3C9F A;  4H2G A;  4Q7F A;  3H67 A;  2QFP A;  1USH A;  2O8G A;  2USH A;  3PSO A;  4TUI A;  2QFR A;  4DSY A;  3AUZ A;  4UT2 A;  5JPE A;  3T1I A;  4MP0 A;  2NPP C;  4LU9 A;  1QFC A;  4MOV A;  4XPN A;  3FGA C;  4JA7 A;  3DSD A;  4LTY A;  1UF3 A;  4H1Y P;  3ZU0 A;  1M63 A;  3QFM A;  4FBW A;  2IAE C;  3LL8 A;  4UWQ A;  3RL4 A;  3E7B A;  3H61 A;  3JYF A;  2NXF A;  1QHW A;  3IB8 A;  4V0X A;  4FCX A;  1HO5 A;  1OID A;  1G5B A;  4LAC C;  3THO B;  3PSN A;  3H69 A;  1NNW A;  2ZOA A;  5F3W A;  2WDE A;  2XMO A;  4IYP C;  1S3N A;  3H64 A;  4FBQ A;  1XZW A;  4ORB A;  1S95 A;  2BCD A;  4FBK A;  5EQV A;  2GJU A;  4WWL A;  1MF8 A;  5JPF A;  2YEQ A;  3KBP A;  2HYO A;  2WDC A;  1UTE A;  1S70 A;  3QFO A;  2BDX A;  1Z2X A;  1TCO A;  3DW8 C;  4HD0 A;  3E7A A;  4NZV A;  2BQ8 X;  1W24 A;  4G9J A;  4H2F A;  4UT3 A;  3C5W C;  2NYL C;  4ZVZ A;  3CK2 A;  5GTU A;  3TGH A;  2WDF A;  3GVE A;  1WAR A;  4O5G A;  1HPU A;  4ORC A;  3RL3 A;  1Z2W A;  5INB A;  1FJM A;  1II7 A;  2IE3 C;  2NYM C;  3IVE A;  4JA9 A;  4B2O A;  4H1S A;  3ZTV A;  3K7W C;  2Z06 A;  1S3M A;  1S8E A;  1OI8 A;  5J28 A;  4OR9 A;  1IT6 A;  4I5L C;  1HP1 A;  1KBP A;  4ORA A;  1V73 A;  4UT3 B;  2HYP A;  3QFN A;  1WAO 1;  2YVT A;  1JK7 A;  2WDD A;  3H68 A;  1S3L A;  3E0J A;  4H2I A;  3FLO A;  4ZX2 A;  5IOH A;  2O8A A;  4O43 A;  1U32 A;  3HVQ A;  3K7V C;  4I5N C;  3RL5 A;  5C1V A;  3THN A;  3D03 A;  2CV9 A;  2R17 A;  2Z1A A;  1AUI A;  2AHD A;  1T71 A;  3N5U A;  4H2B A;  3EGG A;  2Q8U A;  4F0Z A;  2QJC A;  3IVD A;  4YKE A;  3H63 A;  5HPE A;  2HY1 A;  4IL1 A;  5DNY A;  2KKN A;  3ICF A;  4M0V A;  4V0V A;  4DHL A;  1OIE A;  3QG5 C;  4TUG A;  1T70 A;  4KKZ A;  1XM7 A;  2DXN A;  3AV0 A;  3P71 C;  3H62 B;  2Z72 A;  4O4K A;  2DXL A;  4O24 A;  2ZO9 B;  2DFJ A;  4J6O A;  3DSC A;  4KBP A;  5B8I A;  2ZBM A;  3H60 A; 
#chains in the Genus database with same CATH homology
 2IE4 C;  1SU1 A;  2P6B A;  2A22 A;  4V0W A;  4DT2 A;  5JJT A;  3V4Y A;  3H66 A;  3RQZ A;  3QFK A;  3EGH A;  3IB7 A;  4MOY A;  2JOG A;  3C9F A;  4H2G A;  4Q7F A;  3H67 A;  2QFP A;  1USH A;  2O8G A;  2USH A;  3PSO A;  4TUI A;  2QFR A;  4DSY A;  3AUZ A;  4UT2 A;  5JPE A;  3T1I A;  4MP0 A;  2NPP C;  4LU9 A;  1QFC A;  4MOV A;  4XPN A;  3FGA C;  4JA7 A;  3DSD A;  4LTY A;  1UF3 A;  4H1Y P;  3ZU0 A;  1M63 A;  3QFM A;  4FBW A;  2IAE C;  3LL8 A;  4UWQ A;  3RL4 A;  3E7B A;  3H61 A;  3JYF A;  2NXF A;  1QHW A;  3IB8 A;  4V0X A;  4FCX A;  1HO5 A;  1OID A;  1G5B A;  4LAC C;  3THO B;  3PSN A;  3H69 A;  1NNW A;  2ZOA A;  5F3W A;  2WDE A;  2XMO A;  4IYP C;  1S3N A;  3H64 A;  4FBQ A;  1XZW A;  4ORB A;  1S95 A;  2BCD A;  4FBK A;  5EQV A;  2GJU A;  4WWL A;  1MF8 A;  5JPF A;  2YEQ A;  3KBP A;  2HYO A;  2WDC A;  1UTE A;  1S70 A;  3QFO A;  2BDX A;  1Z2X A;  1TCO A;  3DW8 C;  4HD0 A;  3E7A A;  4NZV A;  2BQ8 X;  1W24 A;  4G9J A;  4H2F A;  4UT3 A;  3C5W C;  2NYL C;  4ZVZ A;  3CK2 A;  5GTU A;  3TGH A;  2WDF A;  3GVE A;  1WAR A;  4O5G A;  1HPU A;  4ORC A;  3RL3 A;  1Z2W A;  5INB A;  1FJM A;  1II7 A;  2IE3 C;  2NYM C;  3IVE A;  4JA9 A;  4B2O A;  4H1S A;  3ZTV A;  3K7W C;  2Z06 A;  1S3M A;  1S8E A;  1OI8 A;  5J28 A;  4OR9 A;  1IT6 A;  4I5L C;  1HP1 A;  1KBP A;  4ORA A;  1V73 A;  4UT3 B;  2HYP A;  3QFN A;  1WAO 1;  2YVT A;  1JK7 A;  2WDD A;  3H68 A;  1S3L A;  3E0J A;  4H2I A;  3FLO A;  4ZX2 A;  5IOH A;  2O8A A;  4O43 A;  1U32 A;  3HVQ A;  3K7V C;  4I5N C;  3RL5 A;  5C1V A;  3THN A;  3D03 A;  2CV9 A;  2R17 A;  2Z1A A;  1AUI A;  2AHD A;  1T71 A;  3N5U A;  4H2B A;  3EGG A;  2Q8U A;  4F0Z A;  2QJC A;  3IVD A;  4YKE A;  3H63 A;  5HPE A;  2HY1 A;  4IL1 A;  5DNY A;  2KKN A;  3ICF A;  4M0V A;  4V0V A;  4DHL A;  1OIE A;  3QG5 C;  4TUG A;  1T70 A;  4KKZ A;  1XM7 A;  2DXN A;  3AV0 A;  3P71 C;  3H62 B;  2Z72 A;  4O4K A;  2DXL A;  4O24 A;  2ZO9 B;  2DFJ A;  4J6O A;  3DSC A;  4KBP A;  5B8I A;  2ZBM A;  3H60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...