1HP1A

5'-nucleotidase (open form) complex with atp
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
516
structure length
516
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKRVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 5'-NUCLEOTIDASE
publication title Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
pubmed doi rcsb
source organism Escherichia coli
total genus 180
structure length 516
sequence length 516
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1hp1A01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1hp1A02
3C9FA 4FBWA 1USHA 4ORCA 1S3NA 4B2OA 4LTYA 4DT2A 3H63A 3IVEA 2ZBMA 2QJCA 4H1YP 5INBA 1XM7A 1T70A 2NYLC 4TUIA 1MF8A 2O8AA 3RQZA 3H61A 3PSNA 1UF3A 4Q7FA 2IE4C 3IB7A 5EQVA 1XZWA 2WDFA 2IE3C 2O8GA 3E7AA 3T1IA 4LU9A 4MOVA 3AUZA 3RL3A 1OI8A 1Z2XA 4V0VA 2USHA 1V73A 3JYFA 3H68A 3K7WC 5JJTA 1S3MA 4O43A 4ORAA 4V0XA 2NXFA 3EGGA 4DHLA 3DSCA 3QFMA 4DSYA 2KKNA 1JK7A 2CV9A 3EGHA 3KBPA 1U32A 4V0WA 2WDEA 1KBPA 4H1SA 1NNWA 4YKEA 2WDCA 4IL1A 4G9JA 4JA7A 2BDXA 3FGAC 4KBPA 4O5GA 3H62B 4O24A 2QFRA 1SU1A 1UTEA 1Z2WA 4FBQA 2BCDA 2Q8UA 3P71C 3K7VC 4F0ZA 3QG5C 3PSOA 5C1VA 4MP0A 3DSDA 1HPUA 3HVQA 4HD0A 5GTUA 5DNYA 1OIEA 4OR9A 4ORBA 3QFOA 5B8IA 1S70A 2JOGA 1OIDA 2Z72A 4ZX2A 1WAO1 1TCOA 3QFNA 2DFJA 4FBKA 4H2BA 3N5UA 2P6BA 1S8EA 4M0VA 3TGHA 2GJUA 3H60A 4XPNA 1AUIA 1G5BA 5JPFA 1S95A 1T71A 2QFPA 2NPPC 3H64A 1WARA 3C5WC 3RL4A 1FJMA 2YVTA 1QHWA 1S3LA 3H66A 4I5NC 2XMOA 3RL5A 4ZVZA 3THOB 3E7BA 4WWLA 4UT3A 3DW8C 3LL8A 2NYMC 5HPEA 1QFCA 3AV0A 2Z06A 3ZU0A 5J28A 2HYOA 1IT6A 3H69A 4FCXA 2BQ8X 3V4YA 5F3WA 4NZVA 1II7A 4JA9A 4LACC 4TUGA 2HY1A 1W24A 1HO5A 2WDDA 2IAEC 3QFKA 3GVEA 2A22A 3IB8A 4H2FA 1HP1A 2HYPA 4H2IA 3H67A 4UWQA 4I5LC 4H2GA 4KKZA 3THNA 4UT2A 1M63A 5JPEA 2AHDA 4IYPC 5IOHA 3ICFA 4MOYA 4UT3B 4J6OA 2Z1AA 3ZTVA 3IVDA 2R17A 3CK2A 4O4KA
chains in the Genus database with same CATH superfamily
3C9FA 4FBWA 1USHA 4ORCA 1S3NA 4B2OA 4LTYA 4DT2A 3H63A 3IVEA 2ZBMA 2QJCA 4H1YP 5INBA 1XM7A 1T70A 2NYLC 4TUIA 1MF8A 2O8AA 3RQZA 3E0JA 3H61A 3PSNA 1UF3A 4Q7FA 2IE4C 3IB7A 5EQVA 1XZWA 2WDFA 2IE3C 2O8GA 3E7AA 3T1IA 4LU9A 4MOVA 3AUZA 3RL3A 1OI8A 1Z2XA 4V0VA 2USHA 1V73A 3JYFA 3H68A 3K7WC 5JJTA 1S3MA 4O43A 4ORAA 4V0XA 2NXFA 3EGGA 4DHLA 3DSCA 3QFMA 2DXNA 4DSYA 2KKNA 1JK7A 2CV9A 3EGHA 3KBPA 1U32A 4V0WA 2WDEA 1KBPA 4H1SA 1NNWA 4YKEA 2WDCA 4IL1A 4G9JA 3FLOA 2BDXA 3FGAC 4JA7A 4KBPA 4O5GA 3H62B 4O24A 2QFRA 1SU1A 1UTEA 1Z2WA 4FBQA 2BCDA 2Q8UA 3P71C 3K7VC 4F0ZA 3QG5C 3PSOA 5C1VA 4MP0A 3DSDA 1HPUA 3HVQA 4HD0A 5GTUA 5DNYA 1OIEA 4OR9A 4ORBA 3QFOA 5B8IA 1S70A 2JOGA 2YEQA 1OIDA 2Z72A 4ZX2A 1WAO1 1TCOA 3QFNA 2DFJA 4FBKA 4H2BA 3N5UA 2P6BA 1S8EA 4M0VA 3TGHA 2GJUA 3H60A 4XPNA 1AUIA 1G5BA 5JPFA 1S95A 1T71A 2QFPA 2NPPC 3H64A 2ZO9B 1WARA 2ZOAA 3C5WC 3RL4A 1FJMA 2YVTA 1QHWA 1S3LA 3H66A 4I5NC 2XMOA 3RL5A 4ZVZA 3THOB 3E7BA 4WWLA 4UT3A 3DW8C 3LL8A 2NYMC 5HPEA 1QFCA 3AV0A 2Z06A 3ZU0A 5J28A 2HYOA 1IT6A 3H69A 4FCXA 2BQ8X 3V4YA 5F3WA 4NZVA 1II7A 4JA9A 4LACC 4TUGA 2HY1A 3D03A 1W24A 2DXLA 1HO5A 2WDDA 2IAEC 3QFKA 3GVEA 2A22A 3IB8A 4H2FA 1HP1A 2HYPA 4H2IA 3H67A 4UWQA 4I5LC 4H2GA 4KKZA 3THNA 4UT2A 1M63A 5JPEA 2AHDA 4IYPC 5IOHA 3ICFA 4MOYA 4UT3B 4J6OA 2Z1AA 3ZTVA 3IVDA 2R17A 3CK2A 4O4KA
chains in the Genus database with same CATH topology
3C9FA 4FBWA 1USHA 4ORCA 1S3NA 4B2OA 4LTYA 4DT2A 3H63A 3IVEA 2ZBMA 2QJCA 4H1YP 5INBA 1XM7A 1T70A 2NYLC 4TUIA 1MF8A 2O8AA 3RQZA 3E0JA 3H61A 3PSNA 1UF3A 4Q7FA 2IE4C 3IB7A 5EQVA 1XZWA 2WDFA 2IE3C 2O8GA 3E7AA 3T1IA 4LU9A 4MOVA 3AUZA 3RL3A 1OI8A 1Z2XA 4V0VA 2USHA 1V73A 3JYFA 3H68A 3K7WC 5JJTA 1S3MA 4O43A 4ORAA 4V0XA 2NXFA 3EGGA 4DHLA 3DSCA 3QFMA 2DXNA 4DSYA 2KKNA 1JK7A 2CV9A 3EGHA 3KBPA 1U32A 4V0WA 2WDEA 1KBPA 4H1SA 1NNWA 4YKEA 2WDCA 4IL1A 4G9JA 3FLOA 2BDXA 3FGAC 4JA7A 4KBPA 4O5GA 3H62B 4O24A 2QFRA 1SU1A 1UTEA 1Z2WA 4FBQA 2BCDA 2Q8UA 3P71C 3K7VC 4F0ZA 3QG5C 3PSOA 5C1VA 4MP0A 3DSDA 1HPUA 3HVQA 4HD0A 5GTUA 5DNYA 1OIEA 4OR9A 4ORBA 3QFOA 5B8IA 1S70A 2JOGA 2YEQA 1OIDA 2Z72A 4ZX2A 1WAO1 1TCOA 3QFNA 2DFJA 4FBKA 4H2BA 3N5UA 2P6BA 1S8EA 4M0VA 3TGHA 2GJUA 3H60A 4XPNA 1AUIA 1G5BA 5JPFA 1S95A 1T71A 2QFPA 2NPPC 3H64A 2ZO9B 1WARA 2ZOAA 3C5WC 3RL4A 1FJMA 2YVTA 1QHWA 1S3LA 3H66A 4I5NC 2XMOA 3RL5A 4ZVZA 3THOB 3E7BA 4WWLA 4UT3A 3DW8C 3LL8A 2NYMC 5HPEA 1QFCA 3AV0A 2Z06A 3ZU0A 5J28A 2HYOA 1IT6A 3H69A 4FCXA 2BQ8X 3V4YA 5F3WA 4NZVA 1II7A 4JA9A 4LACC 4TUGA 2HY1A 3D03A 1W24A 2DXLA 1HO5A 2WDDA 2IAEC 3QFKA 3GVEA 2A22A 3IB8A 4H2FA 1HP1A 2HYPA 4H2IA 3H67A 4UWQA 4I5LC 4H2GA 4KKZA 3THNA 4UT2A 1M63A 5JPEA 2AHDA 4IYPC 5IOHA 3ICFA 4MOYA 4UT3B 4J6OA 2Z1AA 3ZTVA 3IVDA 2R17A 3CK2A 4O4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9F A;  4FBW A;  1USH A;  4ORC A;  1S3N A;  4B2O A;  4LTY A;  4DT2 A;  3H63 A;  3IVE A;  2ZBM A;  2QJC A;  4H1Y P;  5INB A;  1XM7 A;  1T70 A;  2NYL C;  4TUI A;  1MF8 A;  2O8A A;  3RQZ A;  3H61 A;  3PSN A;  1UF3 A;  4Q7F A;  2IE4 C;  3IB7 A;  5EQV A;  1XZW A;  2WDF A;  2IE3 C;  2O8G A;  3E7A A;  3T1I A;  4LU9 A;  4MOV A;  3AUZ A;  3RL3 A;  1OI8 A;  1Z2X A;  4V0V A;  2USH A;  1V73 A;  3JYF A;  3H68 A;  3K7W C;  5JJT A;  1S3M A;  4O43 A;  4ORA A;  4V0X A;  2NXF A;  3EGG A;  4DHL A;  3DSC A;  3QFM A;  4DSY A;  2KKN A;  1JK7 A;  2CV9 A;  3EGH A;  3KBP A;  1U32 A;  4V0W A;  2WDE A;  1KBP A;  4H1S A;  1NNW A;  4YKE A;  2WDC A;  4IL1 A;  4G9J A;  4JA7 A;  2BDX A;  3FGA C;  4KBP A;  4O5G A;  3H62 B;  4O24 A;  2QFR A;  1SU1 A;  1UTE A;  1Z2W A;  4FBQ A;  2BCD A;  2Q8U A;  3P71 C;  3K7V C;  4F0Z A;  3QG5 C;  3PSO A;  5C1V A;  4MP0 A;  3DSD A;  1HPU A;  3HVQ A;  4HD0 A;  5GTU A;  5DNY A;  1OIE A;  4OR9 A;  4ORB A;  3QFO A;  5B8I A;  1S70 A;  2JOG A;  1OID A;  2Z72 A;  4ZX2 A;  1WAO 1;  1TCO A;  3QFN A;  2DFJ A;  4FBK A;  4H2B A;  3N5U A;  2P6B A;  1S8E A;  4M0V A;  3TGH A;  2GJU A;  3H60 A;  4XPN A;  1AUI A;  1G5B A;  5JPF A;  1S95 A;  1T71 A;  2QFP A;  2NPP C;  3H64 A;  1WAR A;  3C5W C;  3RL4 A;  1FJM A;  2YVT A;  1QHW A;  1S3L A;  3H66 A;  4I5N C;  2XMO A;  3RL5 A;  4ZVZ A;  3THO B;  3E7B A;  4WWL A;  4UT3 A;  3DW8 C;  3LL8 A;  2NYM C;  5HPE A;  1QFC A;  3AV0 A;  2Z06 A;  3ZU0 A;  5J28 A;  2HYO A;  1IT6 A;  3H69 A;  4FCX A;  2BQ8 X;  3V4Y A;  5F3W A;  4NZV A;  1II7 A;  4JA9 A;  4LAC C;  4TUG A;  2HY1 A;  1W24 A;  1HO5 A;  2WDD A;  2IAE C;  3QFK A;  3GVE A;  2A22 A;  3IB8 A;  4H2F A;  1HP1 A;  2HYP A;  4H2I A;  3H67 A;  4UWQ A;  4I5L C;  4H2G A;  4KKZ A;  3THN A;  4UT2 A;  1M63 A;  5JPE A;  2AHD A;  4IYP C;  5IOH A;  3ICF A;  4MOY A;  4UT3 B;  4J6O A;  2Z1A A;  3ZTV A;  3IVD A;  2R17 A;  3CK2 A;  4O4K A; 
#chains in the Genus database with same CATH topology
 3C9F A;  4FBW A;  1USH A;  4ORC A;  1S3N A;  4B2O A;  4LTY A;  4DT2 A;  3H63 A;  3IVE A;  2ZBM A;  2QJC A;  4H1Y P;  5INB A;  1XM7 A;  1T70 A;  2NYL C;  4TUI A;  1MF8 A;  2O8A A;  3RQZ A;  3E0J A;  3H61 A;  3PSN A;  1UF3 A;  4Q7F A;  2IE4 C;  3IB7 A;  5EQV A;  1XZW A;  2WDF A;  2IE3 C;  2O8G A;  3E7A A;  3T1I A;  4LU9 A;  4MOV A;  3AUZ A;  3RL3 A;  1OI8 A;  1Z2X A;  4V0V A;  2USH A;  1V73 A;  3JYF A;  3H68 A;  3K7W C;  5JJT A;  1S3M A;  4O43 A;  4ORA A;  4V0X A;  2NXF A;  3EGG A;  4DHL A;  3DSC A;  3QFM A;  2DXN A;  4DSY A;  2KKN A;  1JK7 A;  2CV9 A;  3EGH A;  3KBP A;  1U32 A;  4V0W A;  2WDE A;  1KBP A;  4H1S A;  1NNW A;  4YKE A;  2WDC A;  4IL1 A;  4G9J A;  3FLO A;  2BDX A;  3FGA C;  4JA7 A;  4KBP A;  4O5G A;  3H62 B;  4O24 A;  2QFR A;  1SU1 A;  1UTE A;  1Z2W A;  4FBQ A;  2BCD A;  2Q8U A;  3P71 C;  3K7V C;  4F0Z A;  3QG5 C;  3PSO A;  5C1V A;  4MP0 A;  3DSD A;  1HPU A;  3HVQ A;  4HD0 A;  5GTU A;  5DNY A;  1OIE A;  4OR9 A;  4ORB A;  3QFO A;  5B8I A;  1S70 A;  2JOG A;  2YEQ A;  1OID A;  2Z72 A;  4ZX2 A;  1WAO 1;  1TCO A;  3QFN A;  2DFJ A;  4FBK A;  4H2B A;  3N5U A;  2P6B A;  1S8E A;  4M0V A;  3TGH A;  2GJU A;  3H60 A;  4XPN A;  1AUI A;  1G5B A;  5JPF A;  1S95 A;  1T71 A;  2QFP A;  2NPP C;  3H64 A;  2ZO9 B;  1WAR A;  2ZOA A;  3C5W C;  3RL4 A;  1FJM A;  2YVT A;  1QHW A;  1S3L A;  3H66 A;  4I5N C;  2XMO A;  3RL5 A;  4ZVZ A;  3THO B;  3E7B A;  4WWL A;  4UT3 A;  3DW8 C;  3LL8 A;  2NYM C;  5HPE A;  1QFC A;  3AV0 A;  2Z06 A;  3ZU0 A;  5J28 A;  2HYO A;  1IT6 A;  3H69 A;  4FCX A;  2BQ8 X;  3V4Y A;  5F3W A;  4NZV A;  1II7 A;  4JA9 A;  4LAC C;  4TUG A;  2HY1 A;  3D03 A;  1W24 A;  2DXL A;  1HO5 A;  2WDD A;  2IAE C;  3QFK A;  3GVE A;  2A22 A;  3IB8 A;  4H2F A;  1HP1 A;  2HYP A;  4H2I A;  3H67 A;  4UWQ A;  4I5L C;  4H2G A;  4KKZ A;  3THN A;  4UT2 A;  1M63 A;  5JPE A;  2AHD A;  4IYP C;  5IOH A;  3ICF A;  4MOY A;  4UT3 B;  4J6O A;  2Z1A A;  3ZTV A;  3IVD A;  2R17 A;  3CK2 A;  4O4K A; 
#chains in the Genus database with same CATH homology
 3C9F A;  4FBW A;  1USH A;  4ORC A;  1S3N A;  4B2O A;  4LTY A;  4DT2 A;  3H63 A;  3IVE A;  2ZBM A;  2QJC A;  4H1Y P;  5INB A;  1XM7 A;  1T70 A;  2NYL C;  4TUI A;  1MF8 A;  2O8A A;  3RQZ A;  3E0J A;  3H61 A;  3PSN A;  1UF3 A;  4Q7F A;  2IE4 C;  3IB7 A;  5EQV A;  1XZW A;  2WDF A;  2IE3 C;  2O8G A;  3E7A A;  3T1I A;  4LU9 A;  4MOV A;  3AUZ A;  3RL3 A;  1OI8 A;  1Z2X A;  4V0V A;  2USH A;  1V73 A;  3JYF A;  3H68 A;  3K7W C;  5JJT A;  1S3M A;  4O43 A;  4ORA A;  4V0X A;  2NXF A;  3EGG A;  4DHL A;  3DSC A;  3QFM A;  2DXN A;  4DSY A;  2KKN A;  1JK7 A;  2CV9 A;  3EGH A;  3KBP A;  1U32 A;  4V0W A;  2WDE A;  1KBP A;  4H1S A;  1NNW A;  4YKE A;  2WDC A;  4IL1 A;  4G9J A;  3FLO A;  2BDX A;  3FGA C;  4JA7 A;  4KBP A;  4O5G A;  3H62 B;  4O24 A;  2QFR A;  1SU1 A;  1UTE A;  1Z2W A;  4FBQ A;  2BCD A;  2Q8U A;  3P71 C;  3K7V C;  4F0Z A;  3QG5 C;  3PSO A;  5C1V A;  4MP0 A;  3DSD A;  1HPU A;  3HVQ A;  4HD0 A;  5GTU A;  5DNY A;  1OIE A;  4OR9 A;  4ORB A;  3QFO A;  5B8I A;  1S70 A;  2JOG A;  2YEQ A;  1OID A;  2Z72 A;  4ZX2 A;  1WAO 1;  1TCO A;  3QFN A;  2DFJ A;  4FBK A;  4H2B A;  3N5U A;  2P6B A;  1S8E A;  4M0V A;  3TGH A;  2GJU A;  3H60 A;  4XPN A;  1AUI A;  1G5B A;  5JPF A;  1S95 A;  1T71 A;  2QFP A;  2NPP C;  3H64 A;  2ZO9 B;  1WAR A;  2ZOA A;  3C5W C;  3RL4 A;  1FJM A;  2YVT A;  1QHW A;  1S3L A;  3H66 A;  4I5N C;  2XMO A;  3RL5 A;  4ZVZ A;  3THO B;  3E7B A;  4WWL A;  4UT3 A;  3DW8 C;  3LL8 A;  2NYM C;  5HPE A;  1QFC A;  3AV0 A;  2Z06 A;  3ZU0 A;  5J28 A;  2HYO A;  1IT6 A;  3H69 A;  4FCX A;  2BQ8 X;  3V4Y A;  5F3W A;  4NZV A;  1II7 A;  4JA9 A;  4LAC C;  4TUG A;  2HY1 A;  3D03 A;  1W24 A;  2DXL A;  1HO5 A;  2WDD A;  2IAE C;  3QFK A;  3GVE A;  2A22 A;  3IB8 A;  4H2F A;  1HP1 A;  2HYP A;  4H2I A;  3H67 A;  4UWQ A;  4I5L C;  4H2G A;  4KKZ A;  3THN A;  4UT2 A;  1M63 A;  5JPE A;  2AHD A;  4IYP C;  5IOH A;  3ICF A;  4MOY A;  4UT3 B;  4J6O A;  2Z1A A;  3ZTV A;  3IVD A;  2R17 A;  3CK2 A;  4O4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...