1UF3A

Crystal structure of tt1561 of thermus thermophilus hb8
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
228
structure length
228
Chain Sequence
MRRTVRYILATSNPMGDLEALEKFVKLAPDTGADAIALIGNLMPKAAKSRDYAAFFRILSEAHLPTAYVPGPQDAPIWEYLREAANVELVHPEMRNVHETFTFWRGPYLVAGVGGEIADEGEPEEHEALRYPAWVAEYRLKALWELKDYPKIFLFHTMPYHKGLNEQGSHEVAHLIKTHNPLLVLVAGKGQKHEMLGASWVVVPGDLSEGEYSLLDLRARKLETGNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TT1561 of thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TT1561
total genus 72
structure length 228
sequence length 228
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14582 Metallophos_3 Metallophosphoesterase, calcineurin superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1uf3A00
1OIDA 1G5BA 4ZX2A 1IT6A 3GVEA 1TCOA 3AV0A 1USHA 4KKZA 4LTYA 1XM7A 3CK2A 2QFRA 3N5UA 1U32A 2NPPC 1UF3A 4WWLA 5IOHA 5GTUA 3FGAC 2GJUA 3JYFA 3V4YA 4DT2A 2NYLC 1OIEA 4ZVZA 4Q7FA 3AUZA 5DNYA 2JOGA 3QG5C 2CV9A 2NYMC 3QFMA 1HO5A 3E7BA 3H67A 2WDCA 4ORCA 1S3LA 2XMOA 3PSNA 1S3NA 2O8AA 4UT2A 1S95A 1MF8A 2O8GA 4TUGA 4V0WA 3H61A 4JA7A 5B8IA 4FBWA 3QFNA 3EGGA 3H60A 1NNWA 5F3WA 2QFPA 4UT3A 3DSCA 3T1IA 4ORBA 1S8EA 4F0ZA 5JPEA 1XZWA 1QHWA 4OR9A 4DHLA 5C1VA 1AUIA 5JPFA 3LL8A 3IB8A 4M0VA 3P71C 4FBKA 4MOYA 4O43A 4V0XA 2Z72A 3H68A 3H63A 2KKNA 1WAO1 4J6OA 3RL3A 2BQ8X 2Z1AA 3H62B 1M63A 4FCXA 1HP1A 1Z2WA 3ICFA 3QFKA 4JA9A 3QFOA 2Q8UA 3EGHA 4MOVA 4YKEA 3RL4A 2IE3C 1HPUA 3K7VC 1KBPA 2WDDA 3RQZA 4I5NC 2WDFA 4IL1A 1WARA 1JK7A 4O4KA 3TGHA 3DW8C 4H1SA 5HPEA 1UTEA 5J28A 1QFCA 4XPNA 1II7A 3IVEA 4HD0A 1S70A 1FJMA 4G9JA 2P6BA 3THOB 4I5LC 4V0VA 1W24A 2ZBMA 2YVTA 3ZTVA 4DSYA 2A22A 2USHA 4B2OA 2HYOA 4LU9A 3PSOA 3E7AA 2NXFA 3C9FA 2HYPA 3HVQA 4H2GA 4LACC 4TUIA 4NZVA 1S3MA 4UWQA 1SU1A 2IAEC 2QJCA 3H66A 3IVDA 3K7WC 3IB7A 4UT3B 5EQVA 3DSDA 4ORAA 4H2IA 2WDEA 4KBPA 4O5GA 4O24A 4H2FA 1OI8A 4H1YP 5INBA 3RL5A 3C5WC 1V73A 3H64A 4H2BA 3THNA 4IYPC 2IE4C 5JJTA 1T71A 2AHDA 4MP0A 3ZU0A 2HY1A 1T70A 2R17A 2Z06A 1Z2XA 4FBQA 3KBPA 2DFJA 2BDXA 3H69A 2BCDA
chains in the Genus database with same CATH superfamily
1OIDA 1G5BA 4ZX2A 1IT6A 3GVEA 1TCOA 2ZOAA 3AV0A 1USHA 4KKZA 4LTYA 1XM7A 3CK2A 2QFRA 3N5UA 3FLOA 1U32A 2NPPC 1UF3A 4WWLA 5IOHA 5GTUA 3FGAC 2GJUA 3JYFA 3V4YA 4DT2A 2NYLC 1OIEA 4ZVZA 4Q7FA 3AUZA 5DNYA 2JOGA 3QG5C 2CV9A 2NYMC 3QFMA 1HO5A 3E7BA 3H67A 2WDCA 4ORCA 1S3LA 2XMOA 3PSNA 1S3NA 2O8AA 4UT2A 2DXLA 1S95A 1MF8A 2O8GA 4TUGA 4V0WA 3H61A 4JA7A 5B8IA 4FBWA 3QFNA 3EGGA 3H60A 1NNWA 5F3WA 2QFPA 2DXNA 4UT3A 3DSCA 3T1IA 4ORBA 1S8EA 4F0ZA 5JPEA 1XZWA 1QHWA 4OR9A 4DHLA 5C1VA 1AUIA 5JPFA 3LL8A 3IB8A 4M0VA 3P71C 4FBKA 4MOYA 4O43A 4V0XA 2Z72A 3H68A 3H63A 2KKNA 1WAO1 4J6OA 3RL3A 2BQ8X 2Z1AA 3H62B 1M63A 4FCXA 1HP1A 1Z2WA 3ICFA 3QFKA 4JA9A 3QFOA 2Q8UA 3EGHA 2YEQA 4MOVA 4YKEA 3RL4A 2IE3C 1HPUA 3K7VC 1KBPA 2WDDA 3RQZA 4I5NC 2WDFA 4IL1A 1WARA 1JK7A 4O4KA 3TGHA 3DW8C 4H1SA 5HPEA 1UTEA 5J28A 1QFCA 4XPNA 1II7A 3IVEA 4HD0A 1S70A 1FJMA 2ZO9B 4G9JA 2P6BA 3THOB 4I5LC 4V0VA 1W24A 2ZBMA 2YVTA 3ZTVA 4DSYA 2A22A 2USHA 4B2OA 2HYOA 4LU9A 3PSOA 3E7AA 2NXFA 3C9FA 2HYPA 3HVQA 4H2GA 4LACC 4TUIA 3E0JA 4NZVA 1S3MA 4UWQA 1SU1A 2IAEC 2QJCA 3H66A 3IVDA 3K7WC 3IB7A 4UT3B 5EQVA 3D03A 3DSDA 4ORAA 4H2IA 2WDEA 4KBPA 4O5GA 4O24A 4H2FA 1OI8A 4H1YP 5INBA 3RL5A 3C5WC 1V73A 3H64A 4H2BA 3THNA 4IYPC 2IE4C 5JJTA 1T71A 2AHDA 4MP0A 3ZU0A 2HY1A 1T70A 2R17A 2Z06A 1Z2XA 4FBQA 3KBPA 2DFJA 2BDXA 3H69A 2BCDA
chains in the Genus database with same CATH topology
1OIDA 1G5BA 4ZX2A 1IT6A 3GVEA 1TCOA 2ZOAA 3AV0A 1USHA 4KKZA 4LTYA 1XM7A 3CK2A 2QFRA 3N5UA 3FLOA 1U32A 2NPPC 1UF3A 4WWLA 5IOHA 5GTUA 3FGAC 2GJUA 3JYFA 3V4YA 4DT2A 2NYLC 1OIEA 4ZVZA 4Q7FA 3AUZA 5DNYA 2JOGA 3QG5C 2CV9A 2NYMC 3QFMA 1HO5A 3E7BA 3H67A 2WDCA 4ORCA 1S3LA 2XMOA 3PSNA 1S3NA 2O8AA 4UT2A 2DXLA 1S95A 1MF8A 2O8GA 4TUGA 4V0WA 3H61A 4JA7A 5B8IA 4FBWA 3QFNA 3EGGA 3H60A 1NNWA 5F3WA 2QFPA 2DXNA 4UT3A 3DSCA 3T1IA 4ORBA 1S8EA 4F0ZA 5JPEA 1XZWA 1QHWA 4OR9A 4DHLA 5C1VA 1AUIA 5JPFA 3LL8A 3IB8A 4M0VA 3P71C 4FBKA 4MOYA 4O43A 4V0XA 2Z72A 3H68A 3H63A 2KKNA 1WAO1 4J6OA 3RL3A 2BQ8X 2Z1AA 3H62B 1M63A 4FCXA 1HP1A 1Z2WA 3ICFA 3QFKA 4JA9A 3QFOA 2Q8UA 3EGHA 2YEQA 4MOVA 4YKEA 3RL4A 2IE3C 1HPUA 3K7VC 1KBPA 2WDDA 3RQZA 4I5NC 2WDFA 4IL1A 1WARA 1JK7A 4O4KA 3TGHA 3DW8C 4H1SA 5HPEA 1UTEA 5J28A 1QFCA 4XPNA 1II7A 3IVEA 4HD0A 1S70A 1FJMA 2ZO9B 4G9JA 2P6BA 3THOB 4I5LC 4V0VA 1W24A 2ZBMA 2YVTA 3ZTVA 4DSYA 2A22A 2USHA 4B2OA 2HYOA 4LU9A 3PSOA 3E7AA 2NXFA 3C9FA 2HYPA 3HVQA 4H2GA 4LACC 4TUIA 3E0JA 4NZVA 1S3MA 4UWQA 1SU1A 2IAEC 2QJCA 3H66A 3IVDA 3K7WC 3IB7A 4UT3B 5EQVA 3D03A 3DSDA 4ORAA 4H2IA 2WDEA 4KBPA 4O5GA 4O24A 4H2FA 1OI8A 4H1YP 5INBA 3RL5A 3C5WC 1V73A 3H64A 4H2BA 3THNA 4IYPC 2IE4C 5JJTA 1T71A 2AHDA 4MP0A 3ZU0A 2HY1A 1T70A 2R17A 2Z06A 1Z2XA 4FBQA 3KBPA 2DFJA 2BDXA 3H69A 2BCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OID A;  1G5B A;  4ZX2 A;  1IT6 A;  3GVE A;  1TCO A;  3AV0 A;  1USH A;  4KKZ A;  4LTY A;  1XM7 A;  3CK2 A;  2QFR A;  3N5U A;  1U32 A;  2NPP C;  1UF3 A;  4WWL A;  5IOH A;  5GTU A;  3FGA C;  2GJU A;  3JYF A;  3V4Y A;  4DT2 A;  2NYL C;  1OIE A;  4ZVZ A;  4Q7F A;  3AUZ A;  5DNY A;  2JOG A;  3QG5 C;  2CV9 A;  2NYM C;  3QFM A;  1HO5 A;  3E7B A;  3H67 A;  2WDC A;  4ORC A;  1S3L A;  2XMO A;  3PSN A;  1S3N A;  2O8A A;  4UT2 A;  1S95 A;  1MF8 A;  2O8G A;  4TUG A;  4V0W A;  3H61 A;  4JA7 A;  5B8I A;  4FBW A;  3QFN A;  3EGG A;  3H60 A;  1NNW A;  5F3W A;  2QFP A;  4UT3 A;  3DSC A;  3T1I A;  4ORB A;  1S8E A;  4F0Z A;  5JPE A;  1XZW A;  1QHW A;  4OR9 A;  4DHL A;  5C1V A;  1AUI A;  5JPF A;  3LL8 A;  3IB8 A;  4M0V A;  3P71 C;  4FBK A;  4MOY A;  4O43 A;  4V0X A;  2Z72 A;  3H68 A;  3H63 A;  2KKN A;  1WAO 1;  4J6O A;  3RL3 A;  2BQ8 X;  2Z1A A;  3H62 B;  1M63 A;  4FCX A;  1HP1 A;  1Z2W A;  3ICF A;  3QFK A;  4JA9 A;  3QFO A;  2Q8U A;  3EGH A;  4MOV A;  4YKE A;  3RL4 A;  2IE3 C;  1HPU A;  3K7V C;  1KBP A;  2WDD A;  3RQZ A;  4I5N C;  2WDF A;  4IL1 A;  1WAR A;  1JK7 A;  4O4K A;  3TGH A;  3DW8 C;  4H1S A;  5HPE A;  1UTE A;  5J28 A;  1QFC A;  4XPN A;  1II7 A;  3IVE A;  4HD0 A;  1S70 A;  1FJM A;  4G9J A;  2P6B A;  3THO B;  4I5L C;  4V0V A;  1W24 A;  2ZBM A;  2YVT A;  3ZTV A;  4DSY A;  2A22 A;  2USH A;  4B2O A;  2HYO A;  4LU9 A;  3PSO A;  3E7A A;  2NXF A;  3C9F A;  2HYP A;  3HVQ A;  4H2G A;  4LAC C;  4TUI A;  4NZV A;  1S3M A;  4UWQ A;  1SU1 A;  2IAE C;  2QJC A;  3H66 A;  3IVD A;  3K7W C;  3IB7 A;  4UT3 B;  5EQV A;  3DSD A;  4ORA A;  4H2I A;  2WDE A;  4KBP A;  4O5G A;  4O24 A;  4H2F A;  1OI8 A;  4H1Y P;  5INB A;  3RL5 A;  3C5W C;  1V73 A;  3H64 A;  4H2B A;  3THN A;  4IYP C;  2IE4 C;  5JJT A;  1T71 A;  2AHD A;  4MP0 A;  3ZU0 A;  2HY1 A;  1T70 A;  2R17 A;  2Z06 A;  1Z2X A;  4FBQ A;  3KBP A;  2DFJ A;  2BDX A;  3H69 A;  2BCD A; 
#chains in the Genus database with same CATH topology
 1OID A;  1G5B A;  4ZX2 A;  1IT6 A;  3GVE A;  1TCO A;  2ZOA A;  3AV0 A;  1USH A;  4KKZ A;  4LTY A;  1XM7 A;  3CK2 A;  2QFR A;  3N5U A;  3FLO A;  1U32 A;  2NPP C;  1UF3 A;  4WWL A;  5IOH A;  5GTU A;  3FGA C;  2GJU A;  3JYF A;  3V4Y A;  4DT2 A;  2NYL C;  1OIE A;  4ZVZ A;  4Q7F A;  3AUZ A;  5DNY A;  2JOG A;  3QG5 C;  2CV9 A;  2NYM C;  3QFM A;  1HO5 A;  3E7B A;  3H67 A;  2WDC A;  4ORC A;  1S3L A;  2XMO A;  3PSN A;  1S3N A;  2O8A A;  4UT2 A;  2DXL A;  1S95 A;  1MF8 A;  2O8G A;  4TUG A;  4V0W A;  3H61 A;  4JA7 A;  5B8I A;  4FBW A;  3QFN A;  3EGG A;  3H60 A;  1NNW A;  5F3W A;  2QFP A;  2DXN A;  4UT3 A;  3DSC A;  3T1I A;  4ORB A;  1S8E A;  4F0Z A;  5JPE A;  1XZW A;  1QHW A;  4OR9 A;  4DHL A;  5C1V A;  1AUI A;  5JPF A;  3LL8 A;  3IB8 A;  4M0V A;  3P71 C;  4FBK A;  4MOY A;  4O43 A;  4V0X A;  2Z72 A;  3H68 A;  3H63 A;  2KKN A;  1WAO 1;  4J6O A;  3RL3 A;  2BQ8 X;  2Z1A A;  3H62 B;  1M63 A;  4FCX A;  1HP1 A;  1Z2W A;  3ICF A;  3QFK A;  4JA9 A;  3QFO A;  2Q8U A;  3EGH A;  2YEQ A;  4MOV A;  4YKE A;  3RL4 A;  2IE3 C;  1HPU A;  3K7V C;  1KBP A;  2WDD A;  3RQZ A;  4I5N C;  2WDF A;  4IL1 A;  1WAR A;  1JK7 A;  4O4K A;  3TGH A;  3DW8 C;  4H1S A;  5HPE A;  1UTE A;  5J28 A;  1QFC A;  4XPN A;  1II7 A;  3IVE A;  4HD0 A;  1S70 A;  1FJM A;  2ZO9 B;  4G9J A;  2P6B A;  3THO B;  4I5L C;  4V0V A;  1W24 A;  2ZBM A;  2YVT A;  3ZTV A;  4DSY A;  2A22 A;  2USH A;  4B2O A;  2HYO A;  4LU9 A;  3PSO A;  3E7A A;  2NXF A;  3C9F A;  2HYP A;  3HVQ A;  4H2G A;  4LAC C;  4TUI A;  3E0J A;  4NZV A;  1S3M A;  4UWQ A;  1SU1 A;  2IAE C;  2QJC A;  3H66 A;  3IVD A;  3K7W C;  3IB7 A;  4UT3 B;  5EQV A;  3D03 A;  3DSD A;  4ORA A;  4H2I A;  2WDE A;  4KBP A;  4O5G A;  4O24 A;  4H2F A;  1OI8 A;  4H1Y P;  5INB A;  3RL5 A;  3C5W C;  1V73 A;  3H64 A;  4H2B A;  3THN A;  4IYP C;  2IE4 C;  5JJT A;  1T71 A;  2AHD A;  4MP0 A;  3ZU0 A;  2HY1 A;  1T70 A;  2R17 A;  2Z06 A;  1Z2X A;  4FBQ A;  3KBP A;  2DFJ A;  2BDX A;  3H69 A;  2BCD A; 
#chains in the Genus database with same CATH homology
 1OID A;  1G5B A;  4ZX2 A;  1IT6 A;  3GVE A;  1TCO A;  2ZOA A;  3AV0 A;  1USH A;  4KKZ A;  4LTY A;  1XM7 A;  3CK2 A;  2QFR A;  3N5U A;  3FLO A;  1U32 A;  2NPP C;  1UF3 A;  4WWL A;  5IOH A;  5GTU A;  3FGA C;  2GJU A;  3JYF A;  3V4Y A;  4DT2 A;  2NYL C;  1OIE A;  4ZVZ A;  4Q7F A;  3AUZ A;  5DNY A;  2JOG A;  3QG5 C;  2CV9 A;  2NYM C;  3QFM A;  1HO5 A;  3E7B A;  3H67 A;  2WDC A;  4ORC A;  1S3L A;  2XMO A;  3PSN A;  1S3N A;  2O8A A;  4UT2 A;  2DXL A;  1S95 A;  1MF8 A;  2O8G A;  4TUG A;  4V0W A;  3H61 A;  4JA7 A;  5B8I A;  4FBW A;  3QFN A;  3EGG A;  3H60 A;  1NNW A;  5F3W A;  2QFP A;  2DXN A;  4UT3 A;  3DSC A;  3T1I A;  4ORB A;  1S8E A;  4F0Z A;  5JPE A;  1XZW A;  1QHW A;  4OR9 A;  4DHL A;  5C1V A;  1AUI A;  5JPF A;  3LL8 A;  3IB8 A;  4M0V A;  3P71 C;  4FBK A;  4MOY A;  4O43 A;  4V0X A;  2Z72 A;  3H68 A;  3H63 A;  2KKN A;  1WAO 1;  4J6O A;  3RL3 A;  2BQ8 X;  2Z1A A;  3H62 B;  1M63 A;  4FCX A;  1HP1 A;  1Z2W A;  3ICF A;  3QFK A;  4JA9 A;  3QFO A;  2Q8U A;  3EGH A;  2YEQ A;  4MOV A;  4YKE A;  3RL4 A;  2IE3 C;  1HPU A;  3K7V C;  1KBP A;  2WDD A;  3RQZ A;  4I5N C;  2WDF A;  4IL1 A;  1WAR A;  1JK7 A;  4O4K A;  3TGH A;  3DW8 C;  4H1S A;  5HPE A;  1UTE A;  5J28 A;  1QFC A;  4XPN A;  1II7 A;  3IVE A;  4HD0 A;  1S70 A;  1FJM A;  2ZO9 B;  4G9J A;  2P6B A;  3THO B;  4I5L C;  4V0V A;  1W24 A;  2ZBM A;  2YVT A;  3ZTV A;  4DSY A;  2A22 A;  2USH A;  4B2O A;  2HYO A;  4LU9 A;  3PSO A;  3E7A A;  2NXF A;  3C9F A;  2HYP A;  3HVQ A;  4H2G A;  4LAC C;  4TUI A;  3E0J A;  4NZV A;  1S3M A;  4UWQ A;  1SU1 A;  2IAE C;  2QJC A;  3H66 A;  3IVD A;  3K7W C;  3IB7 A;  4UT3 B;  5EQV A;  3D03 A;  3DSD A;  4ORA A;  4H2I A;  2WDE A;  4KBP A;  4O5G A;  4O24 A;  4H2F A;  1OI8 A;  4H1Y P;  5INB A;  3RL5 A;  3C5W C;  1V73 A;  3H64 A;  4H2B A;  3THN A;  4IYP C;  2IE4 C;  5JJT A;  1T71 A;  2AHD A;  4MP0 A;  3ZU0 A;  2HY1 A;  1T70 A;  2R17 A;  2Z06 A;  1Z2X A;  4FBQ A;  3KBP A;  2DFJ A;  2BDX A;  3H69 A;  2BCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...