1UF3A

Crystal structure of tt1561 of thermus thermophilus hb8
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
228
structure length
228
Chain Sequence
MRRTVRYILATSNPMGDLEALEKFVKLAPDTGADAIALIGNLMPKAAKSRDYAAFFRILSEAHLPTAYVPGPQDAPIWEYLREAANVELVHPEMRNVHETFTFWRGPYLVAGVGGEIADEGEPEEHEALRYPAWVAEYRLKALWELKDYPKIFLFHTMPYHKGLNEQGSHEVAHLIKTHNPLLVLVAGKGQKHEMLGASWVVVPGDLSEGEYSLLDLRARKLETGNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TT1561
publication title Crystal structure of TT1561 of thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 72
structure length 228
sequence length 228
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14582 Metallophos_3 Metallophosphoesterase, calcineurin superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1uf3A00
1G5BA 4UWQA 4Q7FA 4H2GA 3ZTVA 1XZWA 1QHWA 1II7A 1Z2WA 3DSCA 3QFMA 4G9JA 2Z1AA 2NYMC 4H2FA 2P6BA 4O24A 1HPUA 4DSYA 3H60A 5INBA 3ZU0A 4ZX2A 4ORCA 3FGAC 2AHDA 4J6OA 3IB8A 4WWLA 1QFCA 3RL3A 4DHLA 4ZVZA 3DW8C 3KBPA 1S3MA 4JA9A 1MF8A 4F0ZA 4M0VA 3E7AA 3V4YA 5J28A 2DFJA 4O4KA 2WDEA 4TUGA 1OIEA 4FBQA 2HY1A 1WARA 4YKEA 4UT3A 2NYLC 4LU9A 4LTYA 1S8EA 1SU1A 5DNYA 4H1YP 4NZVA 5C1VA 3THOB 3DSDA 3QFKA 4IYPC 2Z72A 3HVQA 1TCOA 4V0VA 3QFOA 4I5LC 4MP0A 2O8AA 3E7BA 2XMOA 5IOHA 3GVEA 2NXFA 2QJCA 3K7VC 1UF3A 1S3NA 3EGGA 1OIDA 2BDXA 2JOGA 5JPFA 2IE4C 2QFRA 3PSNA 3H63A 2BCDA 1KBPA 1UTEA 3AUZA 4IL1A 4ORBA 4UT3B 2USHA 4OR9A 3T1IA 1JK7A 3K7WC 2IAEC 2GJUA 3IVDA 3PSOA 2BQ8X 2O8GA 4TUIA 2A22A 2WDCA 4FBKA 4H2BA 3IB7A 3H66A 4FBWA 1XM7A 4H1SA 1FJMA 2ZBMA 1NNWA 2IE3C 2QFPA 3EGHA 5GTUA 1OI8A 1T71A 3CK2A 1HP1A 1Z2XA 5B8IA 2Z06A 4MOVA 4XPNA 1S95A 4JA7A 3C5WC 4KKZA 3ICFA 3H62B 3AV0A 3H68A 2Q8UA 1M63A 3QG5C 4O5GA 2R17A 4H2IA 1T70A 1U32A 1USHA 3H67A 3JYFA 4V0WA 3H69A 1HO5A 3P71C 3RQZA 4DT2A 4UT2A 3QFNA 2WDDA 5JPEA 5EQVA 4HD0A 5F3WA 2HYPA 3H61A 4B2OA 3C9FA 4V0XA 4I5NC 4FCXA 4MOYA 1S3LA 3THNA 1W24A 2HYOA 5HPEA 4LACC 5JJTA 1IT6A 1V73A 3N5UA 3RL4A 1AUIA 4O43A 3TGHA 1WAO1 2CV9A 2WDFA 3LL8A 3IVEA 1S70A 2NPPC 3H64A 3RL5A 4KBPA 2KKNA 4ORAA 2YVTA
chains in the Genus database with same CATH superfamily
1G5BA 4UWQA 4Q7FA 4H2GA 3ZTVA 1XZWA 1QHWA 2DXLA 1II7A 1Z2WA 3DSCA 3QFMA 4G9JA 2Z1AA 2NYMC 4H2FA 2P6BA 4O24A 1HPUA 4DSYA 3H60A 5INBA 3ZU0A 4ZX2A 4ORCA 3FGAC 2AHDA 4J6OA 3IB8A 4WWLA 1QFCA 3RL3A 4DHLA 4ZVZA 3DW8C 3KBPA 1S3MA 4JA9A 1MF8A 4F0ZA 4M0VA 3E7AA 3V4YA 5J28A 2DFJA 4O4KA 2WDEA 4TUGA 1OIEA 4FBQA 2HY1A 1WARA 4YKEA 4UT3A 2NYLC 4LU9A 4LTYA 1S8EA 1SU1A 5DNYA 4H1YP 4NZVA 5C1VA 3THOB 2ZO9B 2DXNA 3DSDA 3QFKA 4IYPC 2Z72A 3HVQA 1TCOA 4V0VA 3QFOA 4I5LC 4MP0A 2O8AA 3E7BA 2XMOA 5IOHA 3GVEA 2NXFA 2QJCA 3K7VC 1UF3A 4ORAA 1S3NA 3EGGA 1OIDA 2BDXA 2JOGA 5JPFA 2IE4C 2QFRA 3PSNA 3H63A 2BCDA 1KBPA 1UTEA 3AUZA 4IL1A 4ORBA 4UT3B 2USHA 4OR9A 3T1IA 2ZOAA 1JK7A 3K7WC 2IAEC 2GJUA 3IVDA 3PSOA 2BQ8X 2O8GA 4TUIA 2A22A 2WDCA 4FBKA 4H2BA 3IB7A 3H66A 4FBWA 1XM7A 4H1SA 1FJMA 2ZBMA 1NNWA 2IE3C 2QFPA 3EGHA 5GTUA 1OI8A 1T71A 3CK2A 1HP1A 1Z2XA 5B8IA 2Z06A 4MOVA 4XPNA 1S95A 4JA7A 3C5WC 4KKZA 3ICFA 3H62B 3AV0A 3H68A 2Q8UA 3E0JA 1M63A 3QG5C 4O5GA 2R17A 4H2IA 1T70A 1U32A 1USHA 3H67A 3JYFA 4V0WA 3H69A 1HO5A 3P71C 3RQZA 4DT2A 4UT2A 3QFNA 2WDDA 2YEQA 5JPEA 3FLOA 5EQVA 4HD0A 5F3WA 2HYPA 3H61A 4B2OA 3C9FA 4V0XA 4I5NC 4FCXA 4MOYA 1S3LA 3THNA 1W24A 2HYOA 5HPEA 4LACC 5JJTA 1IT6A 1V73A 3N5UA 3RL4A 1AUIA 4O43A 3TGHA 1WAO1 2CV9A 2WDFA 3LL8A 3IVEA 1S70A 2NPPC 3H64A 3RL5A 4KBPA 2KKNA 3D03A 2YVTA
chains in the Genus database with same CATH topology
1G5BA 4UWQA 4Q7FA 4H2GA 3ZTVA 1XZWA 1QHWA 2DXLA 1II7A 1Z2WA 3DSCA 3QFMA 4G9JA 2Z1AA 2NYMC 4H2FA 2P6BA 4O24A 1HPUA 4DSYA 3H60A 5INBA 3ZU0A 4ZX2A 4ORCA 3FGAC 2AHDA 4J6OA 3IB8A 4WWLA 1QFCA 3RL3A 4DHLA 4ZVZA 3DW8C 3KBPA 1S3MA 4JA9A 1MF8A 4F0ZA 4M0VA 3E7AA 3V4YA 5J28A 2DFJA 4O4KA 2WDEA 4TUGA 1OIEA 4FBQA 2HY1A 1WARA 4YKEA 4UT3A 2NYLC 4LU9A 4LTYA 1S8EA 1SU1A 5DNYA 4H1YP 4NZVA 5C1VA 3THOB 2ZO9B 2DXNA 3DSDA 3QFKA 4IYPC 2Z72A 3HVQA 1TCOA 4V0VA 3QFOA 4I5LC 4MP0A 2O8AA 3E7BA 2XMOA 5IOHA 3GVEA 2NXFA 2QJCA 3K7VC 1UF3A 4ORAA 1S3NA 3EGGA 1OIDA 2BDXA 2JOGA 5JPFA 2IE4C 2QFRA 3PSNA 3H63A 2BCDA 1KBPA 1UTEA 3AUZA 4IL1A 4ORBA 4UT3B 2USHA 4OR9A 3T1IA 2ZOAA 1JK7A 3K7WC 2IAEC 2GJUA 3IVDA 3PSOA 2BQ8X 2O8GA 4TUIA 2A22A 2WDCA 4FBKA 4H2BA 3IB7A 3H66A 4FBWA 1XM7A 4H1SA 1FJMA 2ZBMA 1NNWA 2IE3C 2QFPA 3EGHA 5GTUA 1OI8A 1T71A 3CK2A 1HP1A 1Z2XA 5B8IA 2Z06A 4MOVA 4XPNA 1S95A 4JA7A 3C5WC 4KKZA 3ICFA 3H62B 3AV0A 3H68A 2Q8UA 3E0JA 1M63A 3QG5C 4O5GA 2R17A 4H2IA 1T70A 1U32A 1USHA 3H67A 3JYFA 4V0WA 3H69A 1HO5A 3P71C 3RQZA 4DT2A 4UT2A 3QFNA 2WDDA 2YEQA 5JPEA 3FLOA 5EQVA 4HD0A 5F3WA 2HYPA 3H61A 4B2OA 3C9FA 4V0XA 4I5NC 4FCXA 4MOYA 1S3LA 3THNA 1W24A 2HYOA 5HPEA 4LACC 5JJTA 1IT6A 1V73A 3N5UA 3RL4A 1AUIA 4O43A 3TGHA 1WAO1 2CV9A 2WDFA 3LL8A 3IVEA 1S70A 2NPPC 3H64A 3RL5A 4KBPA 2KKNA 3D03A 2YVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G5B A;  4UWQ A;  4Q7F A;  4H2G A;  3ZTV A;  1XZW A;  1QHW A;  1II7 A;  1Z2W A;  3DSC A;  3QFM A;  4G9J A;  2Z1A A;  2NYM C;  4H2F A;  2P6B A;  4O24 A;  1HPU A;  4DSY A;  3H60 A;  5INB A;  3ZU0 A;  4ZX2 A;  4ORC A;  3FGA C;  2AHD A;  4J6O A;  3IB8 A;  4WWL A;  1QFC A;  3RL3 A;  4DHL A;  4ZVZ A;  3DW8 C;  3KBP A;  1S3M A;  4JA9 A;  1MF8 A;  4F0Z A;  4M0V A;  3E7A A;  3V4Y A;  5J28 A;  2DFJ A;  4O4K A;  2WDE A;  4TUG A;  1OIE A;  4FBQ A;  2HY1 A;  1WAR A;  4YKE A;  4UT3 A;  2NYL C;  4LU9 A;  4LTY A;  1S8E A;  1SU1 A;  5DNY A;  4H1Y P;  4NZV A;  5C1V A;  3THO B;  3DSD A;  3QFK A;  4IYP C;  2Z72 A;  3HVQ A;  1TCO A;  4V0V A;  3QFO A;  4I5L C;  4MP0 A;  2O8A A;  3E7B A;  2XMO A;  5IOH A;  3GVE A;  2NXF A;  2QJC A;  3K7V C;  1UF3 A;  1S3N A;  3EGG A;  1OID A;  2BDX A;  2JOG A;  5JPF A;  2IE4 C;  2QFR A;  3PSN A;  3H63 A;  2BCD A;  1KBP A;  1UTE A;  3AUZ A;  4IL1 A;  4ORB A;  4UT3 B;  2USH A;  4OR9 A;  3T1I A;  1JK7 A;  3K7W C;  2IAE C;  2GJU A;  3IVD A;  3PSO A;  2BQ8 X;  2O8G A;  4TUI A;  2A22 A;  2WDC A;  4FBK A;  4H2B A;  3IB7 A;  3H66 A;  4FBW A;  1XM7 A;  4H1S A;  1FJM A;  2ZBM A;  1NNW A;  2IE3 C;  2QFP A;  3EGH A;  5GTU A;  1OI8 A;  1T71 A;  3CK2 A;  1HP1 A;  1Z2X A;  5B8I A;  2Z06 A;  4MOV A;  4XPN A;  1S95 A;  4JA7 A;  3C5W C;  4KKZ A;  3ICF A;  3H62 B;  3AV0 A;  3H68 A;  2Q8U A;  1M63 A;  3QG5 C;  4O5G A;  2R17 A;  4H2I A;  1T70 A;  1U32 A;  1USH A;  3H67 A;  3JYF A;  4V0W A;  3H69 A;  1HO5 A;  3P71 C;  3RQZ A;  4DT2 A;  4UT2 A;  3QFN A;  2WDD A;  5JPE A;  5EQV A;  4HD0 A;  5F3W A;  2HYP A;  3H61 A;  4B2O A;  3C9F A;  4V0X A;  4I5N C;  4FCX A;  4MOY A;  1S3L A;  3THN A;  1W24 A;  2HYO A;  5HPE A;  4LAC C;  5JJT A;  1IT6 A;  1V73 A;  3N5U A;  3RL4 A;  1AUI A;  4O43 A;  3TGH A;  1WAO 1;  2CV9 A;  2WDF A;  3LL8 A;  3IVE A;  1S70 A;  2NPP C;  3H64 A;  3RL5 A;  4KBP A;  2KKN A;  4ORA A;  2YVT A; 
#chains in the Genus database with same CATH topology
 1G5B A;  4UWQ A;  4Q7F A;  4H2G A;  3ZTV A;  1XZW A;  1QHW A;  2DXL A;  1II7 A;  1Z2W A;  3DSC A;  3QFM A;  4G9J A;  2Z1A A;  2NYM C;  4H2F A;  2P6B A;  4O24 A;  1HPU A;  4DSY A;  3H60 A;  5INB A;  3ZU0 A;  4ZX2 A;  4ORC A;  3FGA C;  2AHD A;  4J6O A;  3IB8 A;  4WWL A;  1QFC A;  3RL3 A;  4DHL A;  4ZVZ A;  3DW8 C;  3KBP A;  1S3M A;  4JA9 A;  1MF8 A;  4F0Z A;  4M0V A;  3E7A A;  3V4Y A;  5J28 A;  2DFJ A;  4O4K A;  2WDE A;  4TUG A;  1OIE A;  4FBQ A;  2HY1 A;  1WAR A;  4YKE A;  4UT3 A;  2NYL C;  4LU9 A;  4LTY A;  1S8E A;  1SU1 A;  5DNY A;  4H1Y P;  4NZV A;  5C1V A;  3THO B;  2ZO9 B;  2DXN A;  3DSD A;  3QFK A;  4IYP C;  2Z72 A;  3HVQ A;  1TCO A;  4V0V A;  3QFO A;  4I5L C;  4MP0 A;  2O8A A;  3E7B A;  2XMO A;  5IOH A;  3GVE A;  2NXF A;  2QJC A;  3K7V C;  1UF3 A;  4ORA A;  1S3N A;  3EGG A;  1OID A;  2BDX A;  2JOG A;  5JPF A;  2IE4 C;  2QFR A;  3PSN A;  3H63 A;  2BCD A;  1KBP A;  1UTE A;  3AUZ A;  4IL1 A;  4ORB A;  4UT3 B;  2USH A;  4OR9 A;  3T1I A;  2ZOA A;  1JK7 A;  3K7W C;  2IAE C;  2GJU A;  3IVD A;  3PSO A;  2BQ8 X;  2O8G A;  4TUI A;  2A22 A;  2WDC A;  4FBK A;  4H2B A;  3IB7 A;  3H66 A;  4FBW A;  1XM7 A;  4H1S A;  1FJM A;  2ZBM A;  1NNW A;  2IE3 C;  2QFP A;  3EGH A;  5GTU A;  1OI8 A;  1T71 A;  3CK2 A;  1HP1 A;  1Z2X A;  5B8I A;  2Z06 A;  4MOV A;  4XPN A;  1S95 A;  4JA7 A;  3C5W C;  4KKZ A;  3ICF A;  3H62 B;  3AV0 A;  3H68 A;  2Q8U A;  3E0J A;  1M63 A;  3QG5 C;  4O5G A;  2R17 A;  4H2I A;  1T70 A;  1U32 A;  1USH A;  3H67 A;  3JYF A;  4V0W A;  3H69 A;  1HO5 A;  3P71 C;  3RQZ A;  4DT2 A;  4UT2 A;  3QFN A;  2WDD A;  2YEQ A;  5JPE A;  3FLO A;  5EQV A;  4HD0 A;  5F3W A;  2HYP A;  3H61 A;  4B2O A;  3C9F A;  4V0X A;  4I5N C;  4FCX A;  4MOY A;  1S3L A;  3THN A;  1W24 A;  2HYO A;  5HPE A;  4LAC C;  5JJT A;  1IT6 A;  1V73 A;  3N5U A;  3RL4 A;  1AUI A;  4O43 A;  3TGH A;  1WAO 1;  2CV9 A;  2WDF A;  3LL8 A;  3IVE A;  1S70 A;  2NPP C;  3H64 A;  3RL5 A;  4KBP A;  2KKN A;  3D03 A;  2YVT A; 
#chains in the Genus database with same CATH homology
 1G5B A;  4UWQ A;  4Q7F A;  4H2G A;  3ZTV A;  1XZW A;  1QHW A;  2DXL A;  1II7 A;  1Z2W A;  3DSC A;  3QFM A;  4G9J A;  2Z1A A;  2NYM C;  4H2F A;  2P6B A;  4O24 A;  1HPU A;  4DSY A;  3H60 A;  5INB A;  3ZU0 A;  4ZX2 A;  4ORC A;  3FGA C;  2AHD A;  4J6O A;  3IB8 A;  4WWL A;  1QFC A;  3RL3 A;  4DHL A;  4ZVZ A;  3DW8 C;  3KBP A;  1S3M A;  4JA9 A;  1MF8 A;  4F0Z A;  4M0V A;  3E7A A;  3V4Y A;  5J28 A;  2DFJ A;  4O4K A;  2WDE A;  4TUG A;  1OIE A;  4FBQ A;  2HY1 A;  1WAR A;  4YKE A;  4UT3 A;  2NYL C;  4LU9 A;  4LTY A;  1S8E A;  1SU1 A;  5DNY A;  4H1Y P;  4NZV A;  5C1V A;  3THO B;  2ZO9 B;  2DXN A;  3DSD A;  3QFK A;  4IYP C;  2Z72 A;  3HVQ A;  1TCO A;  4V0V A;  3QFO A;  4I5L C;  4MP0 A;  2O8A A;  3E7B A;  2XMO A;  5IOH A;  3GVE A;  2NXF A;  2QJC A;  3K7V C;  1UF3 A;  4ORA A;  1S3N A;  3EGG A;  1OID A;  2BDX A;  2JOG A;  5JPF A;  2IE4 C;  2QFR A;  3PSN A;  3H63 A;  2BCD A;  1KBP A;  1UTE A;  3AUZ A;  4IL1 A;  4ORB A;  4UT3 B;  2USH A;  4OR9 A;  3T1I A;  2ZOA A;  1JK7 A;  3K7W C;  2IAE C;  2GJU A;  3IVD A;  3PSO A;  2BQ8 X;  2O8G A;  4TUI A;  2A22 A;  2WDC A;  4FBK A;  4H2B A;  3IB7 A;  3H66 A;  4FBW A;  1XM7 A;  4H1S A;  1FJM A;  2ZBM A;  1NNW A;  2IE3 C;  2QFP A;  3EGH A;  5GTU A;  1OI8 A;  1T71 A;  3CK2 A;  1HP1 A;  1Z2X A;  5B8I A;  2Z06 A;  4MOV A;  4XPN A;  1S95 A;  4JA7 A;  3C5W C;  4KKZ A;  3ICF A;  3H62 B;  3AV0 A;  3H68 A;  2Q8U A;  3E0J A;  1M63 A;  3QG5 C;  4O5G A;  2R17 A;  4H2I A;  1T70 A;  1U32 A;  1USH A;  3H67 A;  3JYF A;  4V0W A;  3H69 A;  1HO5 A;  3P71 C;  3RQZ A;  4DT2 A;  4UT2 A;  3QFN A;  2WDD A;  2YEQ A;  5JPE A;  3FLO A;  5EQV A;  4HD0 A;  5F3W A;  2HYP A;  3H61 A;  4B2O A;  3C9F A;  4V0X A;  4I5N C;  4FCX A;  4MOY A;  1S3L A;  3THN A;  1W24 A;  2HYO A;  5HPE A;  4LAC C;  5JJT A;  1IT6 A;  1V73 A;  3N5U A;  3RL4 A;  1AUI A;  4O43 A;  3TGH A;  1WAO 1;  2CV9 A;  2WDF A;  3LL8 A;  3IVE A;  1S70 A;  2NPP C;  3H64 A;  3RL5 A;  4KBP A;  2KKN A;  3D03 A;  2YVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...