1UF3A

Crystal structure of tt1561 of thermus thermophilus hb8
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
228
structure length
228
Chain Sequence
MRRTVRYILATSNPMGDLEALEKFVKLAPDTGADAIALIGNLMPKAAKSRDYAAFFRILSEAHLPTAYVPGPQDAPIWEYLREAANVELVHPEMRNVHETFTFWRGPYLVAGVGGEIADEGEPEEHEALRYPAWVAEYRLKALWELKDYPKIFLFHTMPYHKGLNEQGSHEVAHLIKTHNPLLVLVAGKGQKHEMLGASWVVVPGDLSEGEYSLLDLRARKLETGNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TT1561 of thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TT1561
total genus 72
structure length 228
sequence length 228
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14582 Metallophos_3 Metallophosphoesterase, calcineurin superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1uf3A00
4UWQA 4WWLA 4IL1A 1T71A 1W24A 1S3NA 3N5UA 1QFCA 1FJMA 4DT2A 2CV9A 3C5WC 3JYFA 4YKEA 3H61A 4F0ZA 3QFNA 4UT3A 2Z1AA 3H60A 3RL3A 2A22A 4DSYA 2O8AA 2WDDA 4FBKA 4ORBA 5DNYA 3AUZA 4TUIA 3V4YA 5B8IA 1TCOA 4ZVZA 4XPNA 4MOYA 2IE4C 3ZU0A 2BCDA 3H68A 1S3LA 5JPFA 3DW8C 3IVDA 1II7A 3QFKA 2KKNA 2Q8UA 5INBA 2AHDA 4HD0A 2P6BA 3H63A 4V0XA 4OR9A 2QJCA 5JJTA 2XMOA 4B2OA 5HPEA 4H1YP 1G5BA 4FBQA 3AV0A 4KKZA 3H67A 3RL5A 1HP1A 2HYPA 3FGAC 3GVEA 3E7AA 3THOB 3HVQA 4TUGA 1JK7A 1V73A 5F3WA 1OI8A 3H69A 4H2GA 4FCXA 1S95A 1Z2XA 4LU9A 1USHA 3E7BA 2NYLC 2YVTA 4O24A 1WAO1 2NYMC 1OIEA 5IOHA 1UF3A 1S3MA 2R17A 2JOGA 4Q7FA 3KBPA 2HY1A 3EGHA 4ORAA 1OIDA 3IB8A 3T1IA 4LACC 3K7VC 4UT3B 1KBPA 2QFRA 3ICFA 3RQZA 3DSDA 2DFJA 3H62B 1MF8A 2USHA 2WDEA 4O5GA 4ZX2A 5JPEA 1NNWA 3THNA 5EQVA 2QFPA 4O4KA 4V0WA 4LTYA 3RL4A 1SU1A 2WDCA 4MP0A 2Z72A 1S8EA 3K7WC 2WDFA 3QFMA 4H2FA 4J6OA 1HPUA 2NPPC 4JA9A 3LL8A 3QG5C 3H64A 4H2BA 5C1VA 2BDXA 1M63A 1HO5A 2IAEC 4M0VA 3IVEA 4NZVA 4FBWA 1WARA 4H1SA 3ZTVA 3DSCA 1XM7A 2BQ8X 5J28A 4DHLA 1Z2WA 3IB7A 2Z06A 4UT2A 4ORCA 1IT6A 1U32A 3EGGA 4IYPC 4MOVA 3H66A 3PSNA 3PSOA 2IE3C 1T70A 1QHWA 1UTEA 4O43A 1S70A 3P71C 3QFOA 3C9FA 4I5LC 4KBPA 2HYOA 3CK2A 4G9JA 2O8GA 3TGHA 4V0VA 2NXFA 1AUIA 5GTUA 4JA7A 2GJUA 4I5NC 2ZBMA 1XZWA 4H2IA
chains in the Genus database with same CATH superfamily
4UWQA 4WWLA 4IL1A 1T71A 1W24A 1S3NA 3N5UA 1QFCA 1FJMA 2YEQA 4DT2A 2CV9A 3C5WC 3JYFA 4YKEA 3H61A 4F0ZA 3QFNA 4UT3A 2Z1AA 3H60A 3RL3A 2A22A 4DSYA 2O8AA 2WDDA 4FBKA 4ORBA 5DNYA 3AUZA 3D03A 4TUIA 3V4YA 5B8IA 1TCOA 4ZVZA 4XPNA 4MOYA 2IE4C 3ZU0A 2BCDA 3H68A 1S3LA 5JPFA 3DW8C 3IVDA 1II7A 3QFKA 2KKNA 2Q8UA 5INBA 2AHDA 4HD0A 2P6BA 3H63A 4V0XA 4OR9A 2QJCA 5JJTA 2XMOA 4B2OA 5HPEA 4H1YP 1G5BA 4FBQA 3AV0A 4KKZA 3H67A 3RL5A 1HP1A 2HYPA 3FGAC 3GVEA 3E7AA 3THOB 3HVQA 4TUGA 1JK7A 1V73A 5F3WA 1OI8A 3H69A 4H2GA 4FCXA 1S95A 1Z2XA 4LU9A 1USHA 3E7BA 2NYLC 2YVTA 4O24A 1WAO1 2ZO9B 2NYMC 1OIEA 5IOHA 1UF3A 1S3MA 2R17A 2JOGA 4Q7FA 3KBPA 2HY1A 3EGHA 3FLOA 4ORAA 1OIDA 3IB8A 3T1IA 4LACC 3K7VC 4UT3B 1KBPA 2QFRA 3ICFA 3RQZA 3DSDA 2DFJA 3H62B 1MF8A 2USHA 2WDEA 4O5GA 2DXNA 4ZX2A 5JPEA 1NNWA 3THNA 5EQVA 2QFPA 4O4KA 4V0WA 4LTYA 3RL4A 1SU1A 2WDCA 4MP0A 2Z72A 1S8EA 2ZOAA 3K7WC 2WDFA 3QFMA 4H2FA 4J6OA 1HPUA 2NPPC 4JA9A 3LL8A 3QG5C 3H64A 3E0JA 4H2BA 5C1VA 2BDXA 1M63A 1HO5A 2IAEC 4M0VA 3IVEA 4NZVA 4FBWA 1WARA 4H1SA 3ZTVA 3DSCA 1XM7A 2BQ8X 5J28A 4DHLA 1Z2WA 3IB7A 2Z06A 4UT2A 4ORCA 1IT6A 1U32A 3EGGA 4IYPC 4MOVA 3H66A 3PSNA 3PSOA 2IE3C 1T70A 1QHWA 1UTEA 4O43A 1S70A 3P71C 3QFOA 3C9FA 4I5LC 4KBPA 2HYOA 3CK2A 4G9JA 2O8GA 3TGHA 4V0VA 2NXFA 1AUIA 5GTUA 4JA7A 2GJUA 4I5NC 2DXLA 2ZBMA 1XZWA 4H2IA
chains in the Genus database with same CATH topology
4UWQA 4WWLA 4IL1A 1T71A 1W24A 1S3NA 3N5UA 1QFCA 1FJMA 2YEQA 4DT2A 2CV9A 3C5WC 3JYFA 4YKEA 3H61A 4F0ZA 3QFNA 4UT3A 2Z1AA 3H60A 3RL3A 2A22A 4DSYA 2O8AA 2WDDA 4FBKA 4ORBA 5DNYA 3AUZA 3D03A 4TUIA 3V4YA 5B8IA 1TCOA 4ZVZA 4XPNA 4MOYA 2IE4C 3ZU0A 2BCDA 3H68A 1S3LA 5JPFA 3DW8C 3IVDA 1II7A 3QFKA 2KKNA 2Q8UA 5INBA 2AHDA 4HD0A 2P6BA 3H63A 4V0XA 4OR9A 2QJCA 5JJTA 2XMOA 4B2OA 5HPEA 4H1YP 1G5BA 4FBQA 3AV0A 4KKZA 3H67A 3RL5A 1HP1A 2HYPA 3FGAC 3GVEA 3E7AA 3THOB 3HVQA 4TUGA 1JK7A 1V73A 5F3WA 1OI8A 3H69A 4H2GA 4FCXA 1S95A 1Z2XA 4LU9A 1USHA 3E7BA 2NYLC 2YVTA 4O24A 1WAO1 2ZO9B 2NYMC 1OIEA 5IOHA 1UF3A 1S3MA 2R17A 2JOGA 4Q7FA 3KBPA 2HY1A 3EGHA 3FLOA 4ORAA 1OIDA 3IB8A 3T1IA 4LACC 3K7VC 4UT3B 1KBPA 2QFRA 3ICFA 3RQZA 3DSDA 2DFJA 3H62B 1MF8A 2USHA 2WDEA 4O5GA 2DXNA 4ZX2A 5JPEA 1NNWA 3THNA 5EQVA 2QFPA 4O4KA 4V0WA 4LTYA 3RL4A 1SU1A 2WDCA 4MP0A 2Z72A 1S8EA 2ZOAA 3K7WC 2WDFA 3QFMA 4H2FA 4J6OA 1HPUA 2NPPC 4JA9A 3LL8A 3QG5C 3H64A 3E0JA 4H2BA 5C1VA 2BDXA 1M63A 1HO5A 2IAEC 4M0VA 3IVEA 4NZVA 4FBWA 1WARA 4H1SA 3ZTVA 3DSCA 1XM7A 2BQ8X 5J28A 4DHLA 1Z2WA 3IB7A 2Z06A 4UT2A 4ORCA 1IT6A 1U32A 3EGGA 4IYPC 4MOVA 3H66A 3PSNA 3PSOA 2IE3C 1T70A 1QHWA 1UTEA 4O43A 1S70A 3P71C 3QFOA 3C9FA 4I5LC 4KBPA 2HYOA 3CK2A 4G9JA 2O8GA 3TGHA 4V0VA 2NXFA 1AUIA 5GTUA 4JA7A 2GJUA 4I5NC 2DXLA 2ZBMA 1XZWA 4H2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWQ A;  4WWL A;  4IL1 A;  1T71 A;  1W24 A;  1S3N A;  3N5U A;  1QFC A;  1FJM A;  4DT2 A;  2CV9 A;  3C5W C;  3JYF A;  4YKE A;  3H61 A;  4F0Z A;  3QFN A;  4UT3 A;  2Z1A A;  3H60 A;  3RL3 A;  2A22 A;  4DSY A;  2O8A A;  2WDD A;  4FBK A;  4ORB A;  5DNY A;  3AUZ A;  4TUI A;  3V4Y A;  5B8I A;  1TCO A;  4ZVZ A;  4XPN A;  4MOY A;  2IE4 C;  3ZU0 A;  2BCD A;  3H68 A;  1S3L A;  5JPF A;  3DW8 C;  3IVD A;  1II7 A;  3QFK A;  2KKN A;  2Q8U A;  5INB A;  2AHD A;  4HD0 A;  2P6B A;  3H63 A;  4V0X A;  4OR9 A;  2QJC A;  5JJT A;  2XMO A;  4B2O A;  5HPE A;  4H1Y P;  1G5B A;  4FBQ A;  3AV0 A;  4KKZ A;  3H67 A;  3RL5 A;  1HP1 A;  2HYP A;  3FGA C;  3GVE A;  3E7A A;  3THO B;  3HVQ A;  4TUG A;  1JK7 A;  1V73 A;  5F3W A;  1OI8 A;  3H69 A;  4H2G A;  4FCX A;  1S95 A;  1Z2X A;  4LU9 A;  1USH A;  3E7B A;  2NYL C;  2YVT A;  4O24 A;  1WAO 1;  2NYM C;  1OIE A;  5IOH A;  1UF3 A;  1S3M A;  2R17 A;  2JOG A;  4Q7F A;  3KBP A;  2HY1 A;  3EGH A;  4ORA A;  1OID A;  3IB8 A;  3T1I A;  4LAC C;  3K7V C;  4UT3 B;  1KBP A;  2QFR A;  3ICF A;  3RQZ A;  3DSD A;  2DFJ A;  3H62 B;  1MF8 A;  2USH A;  2WDE A;  4O5G A;  4ZX2 A;  5JPE A;  1NNW A;  3THN A;  5EQV A;  2QFP A;  4O4K A;  4V0W A;  4LTY A;  3RL4 A;  1SU1 A;  2WDC A;  4MP0 A;  2Z72 A;  1S8E A;  3K7W C;  2WDF A;  3QFM A;  4H2F A;  4J6O A;  1HPU A;  2NPP C;  4JA9 A;  3LL8 A;  3QG5 C;  3H64 A;  4H2B A;  5C1V A;  2BDX A;  1M63 A;  1HO5 A;  2IAE C;  4M0V A;  3IVE A;  4NZV A;  4FBW A;  1WAR A;  4H1S A;  3ZTV A;  3DSC A;  1XM7 A;  2BQ8 X;  5J28 A;  4DHL A;  1Z2W A;  3IB7 A;  2Z06 A;  4UT2 A;  4ORC A;  1IT6 A;  1U32 A;  3EGG A;  4IYP C;  4MOV A;  3H66 A;  3PSN A;  3PSO A;  2IE3 C;  1T70 A;  1QHW A;  1UTE A;  4O43 A;  1S70 A;  3P71 C;  3QFO A;  3C9F A;  4I5L C;  4KBP A;  2HYO A;  3CK2 A;  4G9J A;  2O8G A;  3TGH A;  4V0V A;  2NXF A;  1AUI A;  5GTU A;  4JA7 A;  2GJU A;  4I5N C;  2ZBM A;  1XZW A;  4H2I A; 
#chains in the Genus database with same CATH topology
 4UWQ A;  4WWL A;  4IL1 A;  1T71 A;  1W24 A;  1S3N A;  3N5U A;  1QFC A;  1FJM A;  2YEQ A;  4DT2 A;  2CV9 A;  3C5W C;  3JYF A;  4YKE A;  3H61 A;  4F0Z A;  3QFN A;  4UT3 A;  2Z1A A;  3H60 A;  3RL3 A;  2A22 A;  4DSY A;  2O8A A;  2WDD A;  4FBK A;  4ORB A;  5DNY A;  3AUZ A;  3D03 A;  4TUI A;  3V4Y A;  5B8I A;  1TCO A;  4ZVZ A;  4XPN A;  4MOY A;  2IE4 C;  3ZU0 A;  2BCD A;  3H68 A;  1S3L A;  5JPF A;  3DW8 C;  3IVD A;  1II7 A;  3QFK A;  2KKN A;  2Q8U A;  5INB A;  2AHD A;  4HD0 A;  2P6B A;  3H63 A;  4V0X A;  4OR9 A;  2QJC A;  5JJT A;  2XMO A;  4B2O A;  5HPE A;  4H1Y P;  1G5B A;  4FBQ A;  3AV0 A;  4KKZ A;  3H67 A;  3RL5 A;  1HP1 A;  2HYP A;  3FGA C;  3GVE A;  3E7A A;  3THO B;  3HVQ A;  4TUG A;  1JK7 A;  1V73 A;  5F3W A;  1OI8 A;  3H69 A;  4H2G A;  4FCX A;  1S95 A;  1Z2X A;  4LU9 A;  1USH A;  3E7B A;  2NYL C;  2YVT A;  4O24 A;  1WAO 1;  2ZO9 B;  2NYM C;  1OIE A;  5IOH A;  1UF3 A;  1S3M A;  2R17 A;  2JOG A;  4Q7F A;  3KBP A;  2HY1 A;  3EGH A;  3FLO A;  4ORA A;  1OID A;  3IB8 A;  3T1I A;  4LAC C;  3K7V C;  4UT3 B;  1KBP A;  2QFR A;  3ICF A;  3RQZ A;  3DSD A;  2DFJ A;  3H62 B;  1MF8 A;  2USH A;  2WDE A;  4O5G A;  2DXN A;  4ZX2 A;  5JPE A;  1NNW A;  3THN A;  5EQV A;  2QFP A;  4O4K A;  4V0W A;  4LTY A;  3RL4 A;  1SU1 A;  2WDC A;  4MP0 A;  2Z72 A;  1S8E A;  2ZOA A;  3K7W C;  2WDF A;  3QFM A;  4H2F A;  4J6O A;  1HPU A;  2NPP C;  4JA9 A;  3LL8 A;  3QG5 C;  3H64 A;  3E0J A;  4H2B A;  5C1V A;  2BDX A;  1M63 A;  1HO5 A;  2IAE C;  4M0V A;  3IVE A;  4NZV A;  4FBW A;  1WAR A;  4H1S A;  3ZTV A;  3DSC A;  1XM7 A;  2BQ8 X;  5J28 A;  4DHL A;  1Z2W A;  3IB7 A;  2Z06 A;  4UT2 A;  4ORC A;  1IT6 A;  1U32 A;  3EGG A;  4IYP C;  4MOV A;  3H66 A;  3PSN A;  3PSO A;  2IE3 C;  1T70 A;  1QHW A;  1UTE A;  4O43 A;  1S70 A;  3P71 C;  3QFO A;  3C9F A;  4I5L C;  4KBP A;  2HYO A;  3CK2 A;  4G9J A;  2O8G A;  3TGH A;  4V0V A;  2NXF A;  1AUI A;  5GTU A;  4JA7 A;  2GJU A;  4I5N C;  2DXL A;  2ZBM A;  1XZW A;  4H2I A; 
#chains in the Genus database with same CATH homology
 4UWQ A;  4WWL A;  4IL1 A;  1T71 A;  1W24 A;  1S3N A;  3N5U A;  1QFC A;  1FJM A;  2YEQ A;  4DT2 A;  2CV9 A;  3C5W C;  3JYF A;  4YKE A;  3H61 A;  4F0Z A;  3QFN A;  4UT3 A;  2Z1A A;  3H60 A;  3RL3 A;  2A22 A;  4DSY A;  2O8A A;  2WDD A;  4FBK A;  4ORB A;  5DNY A;  3AUZ A;  3D03 A;  4TUI A;  3V4Y A;  5B8I A;  1TCO A;  4ZVZ A;  4XPN A;  4MOY A;  2IE4 C;  3ZU0 A;  2BCD A;  3H68 A;  1S3L A;  5JPF A;  3DW8 C;  3IVD A;  1II7 A;  3QFK A;  2KKN A;  2Q8U A;  5INB A;  2AHD A;  4HD0 A;  2P6B A;  3H63 A;  4V0X A;  4OR9 A;  2QJC A;  5JJT A;  2XMO A;  4B2O A;  5HPE A;  4H1Y P;  1G5B A;  4FBQ A;  3AV0 A;  4KKZ A;  3H67 A;  3RL5 A;  1HP1 A;  2HYP A;  3FGA C;  3GVE A;  3E7A A;  3THO B;  3HVQ A;  4TUG A;  1JK7 A;  1V73 A;  5F3W A;  1OI8 A;  3H69 A;  4H2G A;  4FCX A;  1S95 A;  1Z2X A;  4LU9 A;  1USH A;  3E7B A;  2NYL C;  2YVT A;  4O24 A;  1WAO 1;  2ZO9 B;  2NYM C;  1OIE A;  5IOH A;  1UF3 A;  1S3M A;  2R17 A;  2JOG A;  4Q7F A;  3KBP A;  2HY1 A;  3EGH A;  3FLO A;  4ORA A;  1OID A;  3IB8 A;  3T1I A;  4LAC C;  3K7V C;  4UT3 B;  1KBP A;  2QFR A;  3ICF A;  3RQZ A;  3DSD A;  2DFJ A;  3H62 B;  1MF8 A;  2USH A;  2WDE A;  4O5G A;  2DXN A;  4ZX2 A;  5JPE A;  1NNW A;  3THN A;  5EQV A;  2QFP A;  4O4K A;  4V0W A;  4LTY A;  3RL4 A;  1SU1 A;  2WDC A;  4MP0 A;  2Z72 A;  1S8E A;  2ZOA A;  3K7W C;  2WDF A;  3QFM A;  4H2F A;  4J6O A;  1HPU A;  2NPP C;  4JA9 A;  3LL8 A;  3QG5 C;  3H64 A;  3E0J A;  4H2B A;  5C1V A;  2BDX A;  1M63 A;  1HO5 A;  2IAE C;  4M0V A;  3IVE A;  4NZV A;  4FBW A;  1WAR A;  4H1S A;  3ZTV A;  3DSC A;  1XM7 A;  2BQ8 X;  5J28 A;  4DHL A;  1Z2W A;  3IB7 A;  2Z06 A;  4UT2 A;  4ORC A;  1IT6 A;  1U32 A;  3EGG A;  4IYP C;  4MOV A;  3H66 A;  3PSN A;  3PSO A;  2IE3 C;  1T70 A;  1QHW A;  1UTE A;  4O43 A;  1S70 A;  3P71 C;  3QFO A;  3C9F A;  4I5L C;  4KBP A;  2HYO A;  3CK2 A;  4G9J A;  2O8G A;  3TGH A;  4V0V A;  2NXF A;  1AUI A;  5GTU A;  4JA7 A;  2GJU A;  4I5N C;  2DXL A;  2ZBM A;  1XZW A;  4H2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...