3H60A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c)with two mn2+ atoms
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h60A00
1II7A 4MOVA 4B2OA 2QFPA 1HP1A 4HD0A 3C9FA 4MOYA 4I5NC 5JJTA 3THNA 2DFJA 2HYPA 3H69A 3KBPA 3IVEA 2Z06A 3K7VC 2Z72A 2Z1AA 1QFCA 4YKEA 1HPUA 4TUIA 2BQ8X 3THOB 2KKNA 1S8EA 2ZBMA 3LL8A 2BCDA 4DSYA 1HO5A 4FBKA 3H60A 3EGGA 4ZX2A 1WARA 5DNYA 3QFOA 4XPNA 3K7WC 3HVQA 1TCOA 5GTUA 4O5GA 4H2FA 1Z2WA 4ORCA 2QJCA 5C1VA 1UTEA 3H66A 3RL4A 2A22A 1G5BA 2USHA 1XZWA 4H1SA 2GJUA 2WDEA 3ZU0A 2CV9A 4OR9A 3DSDA 4FBWA 1UF3A 3JYFA 5J28A 1WAO1 2NYLC 4KKZA 4ORBA 4NZVA 5EQVA 2WDCA 3RL3A 2O8GA 2HY1A 3QFNA 1KBPA 3CK2A 3H67A 4IL1A 4JA9A 1QHWA 4DHLA 2O8AA 5JPEA 4F0ZA 5B8IA 2QFRA 3QFKA 2R17A 5INBA 4FBQA 3H63A 3V4YA 4UWQA 2HYOA 4UT3B 3H61A 2JOGA 4LU9A 1OIDA 3IVDA 3TGHA 4TUGA 4ORAA 1S70A 2NPPC 4M0VA 4MP0A 4UT2A 3T1IA 2YVTA 1Z2XA 1SU1A 2XMOA 3DW8C 1S95A 2AHDA 3RQZA 1S3MA 4O24A 5HPEA 1NNWA 4FCXA 1M63A 2BDXA 4O4KA 4V0VA 3PSOA 3N5UA 1AUIA 1OI8A 4KBPA 4H2GA 1V73A 3E7AA 3EGHA 2WDFA 1IT6A 4WWLA 2NXFA 4H2IA 1MF8A 1W24A 3QFMA 2IAEC 5IOHA 3QG5C 1USHA 3PSNA 4DT2A 4H2BA 5F3WA 4V0WA 3ICFA 1OIEA 1XM7A 4I5LC 1S3LA 3P71C 4J6OA 1S3NA 3ZTVA 3IB7A 1U32A 1T70A 2IE3C 3FGAC 4LTYA 1JK7A 3GVEA 4O43A 1FJMA 2NYMC 3AUZA 2IE4C 3H68A 3DSCA 3H62B 4V0XA 4ZVZA 3AV0A 4LACC 4UT3A 4G9JA 3RL5A 4H1YP 2WDDA 3C5WC 5JPFA 3IB8A 2P6BA 2Q8UA 3H64A 1T71A 4JA7A 4Q7FA 4IYPC 3E7BA
chains in the Genus database with same CATH superfamily
1II7A 4MOVA 4B2OA 2QFPA 3FLOA 1HP1A 2DXNA 4HD0A 3C9FA 4MOYA 4I5NC 5JJTA 3THNA 2DFJA 2HYPA 3H69A 3KBPA 3IVEA 2Z06A 3K7VC 2Z72A 2Z1AA 1QFCA 4YKEA 1HPUA 3E0JA 4TUIA 2BQ8X 3THOB 2KKNA 1S8EA 2ZBMA 3LL8A 2BCDA 4DSYA 1HO5A 4FBKA 3H60A 3EGGA 4ZX2A 1WARA 3D03A 5DNYA 3QFOA 4XPNA 3K7WC 3HVQA 1TCOA 5GTUA 4O5GA 4H2FA 1Z2WA 4ORCA 2QJCA 5C1VA 1UTEA 3H66A 3RL4A 2A22A 1G5BA 2USHA 1XZWA 4H1SA 2GJUA 2WDEA 3ZU0A 2CV9A 4OR9A 3DSDA 4FBWA 1UF3A 3JYFA 5J28A 1WAO1 2NYLC 4KKZA 4ORBA 2YEQA 4NZVA 5EQVA 2WDCA 3RL3A 2O8GA 2HY1A 3QFNA 1KBPA 2ZOAA 3CK2A 3H67A 4IL1A 4JA9A 2ZO9B 1QHWA 4DHLA 2O8AA 5JPEA 4F0ZA 5B8IA 2QFRA 3QFKA 2R17A 5INBA 4FBQA 3H63A 3V4YA 4UWQA 2HYOA 4UT3B 3H61A 2JOGA 4LU9A 1OIDA 3IVDA 3TGHA 4TUGA 4ORAA 1S70A 2NPPC 4M0VA 4MP0A 4UT2A 3T1IA 2YVTA 1Z2XA 1SU1A 2XMOA 3DW8C 1S95A 2AHDA 3RQZA 1S3MA 4O24A 5HPEA 1NNWA 4FCXA 2DXLA 1M63A 2BDXA 4O4KA 4V0VA 3PSOA 3N5UA 1AUIA 1OI8A 4KBPA 4H2GA 1V73A 3E7AA 3EGHA 2WDFA 1IT6A 4WWLA 2NXFA 4H2IA 1MF8A 1W24A 3QFMA 2IAEC 5IOHA 3QG5C 1USHA 3PSNA 4DT2A 4H2BA 5F3WA 4V0WA 3ICFA 1OIEA 1XM7A 4I5LC 1S3LA 3P71C 4J6OA 1S3NA 3ZTVA 3IB7A 1U32A 1T70A 2IE3C 3FGAC 4LTYA 1JK7A 3GVEA 4O43A 1FJMA 2NYMC 3AUZA 2IE4C 3H68A 3DSCA 3H62B 4V0XA 4ZVZA 3AV0A 4LACC 4UT3A 4G9JA 3RL5A 4H1YP 2WDDA 3C5WC 5JPFA 3IB8A 2P6BA 2Q8UA 3H64A 1T71A 4JA7A 4Q7FA 4IYPC 3E7BA
chains in the Genus database with same CATH topology
1II7A 4MOVA 4B2OA 2QFPA 3FLOA 1HP1A 2DXNA 4HD0A 3C9FA 4MOYA 4I5NC 5JJTA 3THNA 2DFJA 2HYPA 3H69A 3KBPA 3IVEA 2Z06A 3K7VC 2Z72A 2Z1AA 1QFCA 4YKEA 1HPUA 3E0JA 4TUIA 2BQ8X 3THOB 2KKNA 1S8EA 2ZBMA 3LL8A 2BCDA 4DSYA 1HO5A 4FBKA 3H60A 3EGGA 4ZX2A 1WARA 3D03A 5DNYA 3QFOA 4XPNA 3K7WC 3HVQA 1TCOA 5GTUA 4O5GA 4H2FA 1Z2WA 4ORCA 2QJCA 5C1VA 1UTEA 3H66A 3RL4A 2A22A 1G5BA 2USHA 1XZWA 4H1SA 2GJUA 2WDEA 3ZU0A 2CV9A 4OR9A 3DSDA 4FBWA 1UF3A 3JYFA 5J28A 1WAO1 2NYLC 4KKZA 4ORBA 2YEQA 4NZVA 5EQVA 2WDCA 3RL3A 2O8GA 2HY1A 3QFNA 1KBPA 2ZOAA 3CK2A 3H67A 4IL1A 4JA9A 2ZO9B 1QHWA 4DHLA 2O8AA 5JPEA 4F0ZA 5B8IA 2QFRA 3QFKA 2R17A 5INBA 4FBQA 3H63A 3V4YA 4UWQA 2HYOA 4UT3B 3H61A 2JOGA 4LU9A 1OIDA 3IVDA 3TGHA 4TUGA 4ORAA 1S70A 2NPPC 4M0VA 4MP0A 4UT2A 3T1IA 2YVTA 1Z2XA 1SU1A 2XMOA 3DW8C 1S95A 2AHDA 3RQZA 1S3MA 4O24A 5HPEA 1NNWA 4FCXA 2DXLA 1M63A 2BDXA 4O4KA 4V0VA 3PSOA 3N5UA 1AUIA 1OI8A 4KBPA 4H2GA 1V73A 3E7AA 3EGHA 2WDFA 1IT6A 4WWLA 2NXFA 4H2IA 1MF8A 1W24A 3QFMA 2IAEC 5IOHA 3QG5C 1USHA 3PSNA 4DT2A 4H2BA 5F3WA 4V0WA 3ICFA 1OIEA 1XM7A 4I5LC 1S3LA 3P71C 4J6OA 1S3NA 3ZTVA 3IB7A 1U32A 1T70A 2IE3C 3FGAC 4LTYA 1JK7A 3GVEA 4O43A 1FJMA 2NYMC 3AUZA 2IE4C 3H68A 3DSCA 3H62B 4V0XA 4ZVZA 3AV0A 4LACC 4UT3A 4G9JA 3RL5A 4H1YP 2WDDA 3C5WC 5JPFA 3IB8A 2P6BA 2Q8UA 3H64A 1T71A 4JA7A 4Q7FA 4IYPC 3E7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1II7 A;  4MOV A;  4B2O A;  2QFP A;  1HP1 A;  4HD0 A;  3C9F A;  4MOY A;  4I5N C;  5JJT A;  3THN A;  2DFJ A;  2HYP A;  3H69 A;  3KBP A;  3IVE A;  2Z06 A;  3K7V C;  2Z72 A;  2Z1A A;  1QFC A;  4YKE A;  1HPU A;  4TUI A;  2BQ8 X;  3THO B;  2KKN A;  1S8E A;  2ZBM A;  3LL8 A;  2BCD A;  4DSY A;  1HO5 A;  4FBK A;  3H60 A;  3EGG A;  4ZX2 A;  1WAR A;  5DNY A;  3QFO A;  4XPN A;  3K7W C;  3HVQ A;  1TCO A;  5GTU A;  4O5G A;  4H2F A;  1Z2W A;  4ORC A;  2QJC A;  5C1V A;  1UTE A;  3H66 A;  3RL4 A;  2A22 A;  1G5B A;  2USH A;  1XZW A;  4H1S A;  2GJU A;  2WDE A;  3ZU0 A;  2CV9 A;  4OR9 A;  3DSD A;  4FBW A;  1UF3 A;  3JYF A;  5J28 A;  1WAO 1;  2NYL C;  4KKZ A;  4ORB A;  4NZV A;  5EQV A;  2WDC A;  3RL3 A;  2O8G A;  2HY1 A;  3QFN A;  1KBP A;  3CK2 A;  3H67 A;  4IL1 A;  4JA9 A;  1QHW A;  4DHL A;  2O8A A;  5JPE A;  4F0Z A;  5B8I A;  2QFR A;  3QFK A;  2R17 A;  5INB A;  4FBQ A;  3H63 A;  3V4Y A;  4UWQ A;  2HYO A;  4UT3 B;  3H61 A;  2JOG A;  4LU9 A;  1OID A;  3IVD A;  3TGH A;  4TUG A;  4ORA A;  1S70 A;  2NPP C;  4M0V A;  4MP0 A;  4UT2 A;  3T1I A;  2YVT A;  1Z2X A;  1SU1 A;  2XMO A;  3DW8 C;  1S95 A;  2AHD A;  3RQZ A;  1S3M A;  4O24 A;  5HPE A;  1NNW A;  4FCX A;  1M63 A;  2BDX A;  4O4K A;  4V0V A;  3PSO A;  3N5U A;  1AUI A;  1OI8 A;  4KBP A;  4H2G A;  1V73 A;  3E7A A;  3EGH A;  2WDF A;  1IT6 A;  4WWL A;  2NXF A;  4H2I A;  1MF8 A;  1W24 A;  3QFM A;  2IAE C;  5IOH A;  3QG5 C;  1USH A;  3PSN A;  4DT2 A;  4H2B A;  5F3W A;  4V0W A;  3ICF A;  1OIE A;  1XM7 A;  4I5L C;  1S3L A;  3P71 C;  4J6O A;  1S3N A;  3ZTV A;  3IB7 A;  1U32 A;  1T70 A;  2IE3 C;  3FGA C;  4LTY A;  1JK7 A;  3GVE A;  4O43 A;  1FJM A;  2NYM C;  3AUZ A;  2IE4 C;  3H68 A;  3DSC A;  3H62 B;  4V0X A;  4ZVZ A;  3AV0 A;  4LAC C;  4UT3 A;  4G9J A;  3RL5 A;  4H1Y P;  2WDD A;  3C5W C;  5JPF A;  3IB8 A;  2P6B A;  2Q8U A;  3H64 A;  1T71 A;  4JA7 A;  4Q7F A;  4IYP C;  3E7B A; 
#chains in the Genus database with same CATH topology
 1II7 A;  4MOV A;  4B2O A;  2QFP A;  3FLO A;  1HP1 A;  2DXN A;  4HD0 A;  3C9F A;  4MOY A;  4I5N C;  5JJT A;  3THN A;  2DFJ A;  2HYP A;  3H69 A;  3KBP A;  3IVE A;  2Z06 A;  3K7V C;  2Z72 A;  2Z1A A;  1QFC A;  4YKE A;  1HPU A;  3E0J A;  4TUI A;  2BQ8 X;  3THO B;  2KKN A;  1S8E A;  2ZBM A;  3LL8 A;  2BCD A;  4DSY A;  1HO5 A;  4FBK A;  3H60 A;  3EGG A;  4ZX2 A;  1WAR A;  3D03 A;  5DNY A;  3QFO A;  4XPN A;  3K7W C;  3HVQ A;  1TCO A;  5GTU A;  4O5G A;  4H2F A;  1Z2W A;  4ORC A;  2QJC A;  5C1V A;  1UTE A;  3H66 A;  3RL4 A;  2A22 A;  1G5B A;  2USH A;  1XZW A;  4H1S A;  2GJU A;  2WDE A;  3ZU0 A;  2CV9 A;  4OR9 A;  3DSD A;  4FBW A;  1UF3 A;  3JYF A;  5J28 A;  1WAO 1;  2NYL C;  4KKZ A;  4ORB A;  2YEQ A;  4NZV A;  5EQV A;  2WDC A;  3RL3 A;  2O8G A;  2HY1 A;  3QFN A;  1KBP A;  2ZOA A;  3CK2 A;  3H67 A;  4IL1 A;  4JA9 A;  2ZO9 B;  1QHW A;  4DHL A;  2O8A A;  5JPE A;  4F0Z A;  5B8I A;  2QFR A;  3QFK A;  2R17 A;  5INB A;  4FBQ A;  3H63 A;  3V4Y A;  4UWQ A;  2HYO A;  4UT3 B;  3H61 A;  2JOG A;  4LU9 A;  1OID A;  3IVD A;  3TGH A;  4TUG A;  4ORA A;  1S70 A;  2NPP C;  4M0V A;  4MP0 A;  4UT2 A;  3T1I A;  2YVT A;  1Z2X A;  1SU1 A;  2XMO A;  3DW8 C;  1S95 A;  2AHD A;  3RQZ A;  1S3M A;  4O24 A;  5HPE A;  1NNW A;  4FCX A;  2DXL A;  1M63 A;  2BDX A;  4O4K A;  4V0V A;  3PSO A;  3N5U A;  1AUI A;  1OI8 A;  4KBP A;  4H2G A;  1V73 A;  3E7A A;  3EGH A;  2WDF A;  1IT6 A;  4WWL A;  2NXF A;  4H2I A;  1MF8 A;  1W24 A;  3QFM A;  2IAE C;  5IOH A;  3QG5 C;  1USH A;  3PSN A;  4DT2 A;  4H2B A;  5F3W A;  4V0W A;  3ICF A;  1OIE A;  1XM7 A;  4I5L C;  1S3L A;  3P71 C;  4J6O A;  1S3N A;  3ZTV A;  3IB7 A;  1U32 A;  1T70 A;  2IE3 C;  3FGA C;  4LTY A;  1JK7 A;  3GVE A;  4O43 A;  1FJM A;  2NYM C;  3AUZ A;  2IE4 C;  3H68 A;  3DSC A;  3H62 B;  4V0X A;  4ZVZ A;  3AV0 A;  4LAC C;  4UT3 A;  4G9J A;  3RL5 A;  4H1Y P;  2WDD A;  3C5W C;  5JPF A;  3IB8 A;  2P6B A;  2Q8U A;  3H64 A;  1T71 A;  4JA7 A;  4Q7F A;  4IYP C;  3E7B A; 
#chains in the Genus database with same CATH homology
 1II7 A;  4MOV A;  4B2O A;  2QFP A;  3FLO A;  1HP1 A;  2DXN A;  4HD0 A;  3C9F A;  4MOY A;  4I5N C;  5JJT A;  3THN A;  2DFJ A;  2HYP A;  3H69 A;  3KBP A;  3IVE A;  2Z06 A;  3K7V C;  2Z72 A;  2Z1A A;  1QFC A;  4YKE A;  1HPU A;  3E0J A;  4TUI A;  2BQ8 X;  3THO B;  2KKN A;  1S8E A;  2ZBM A;  3LL8 A;  2BCD A;  4DSY A;  1HO5 A;  4FBK A;  3H60 A;  3EGG A;  4ZX2 A;  1WAR A;  3D03 A;  5DNY A;  3QFO A;  4XPN A;  3K7W C;  3HVQ A;  1TCO A;  5GTU A;  4O5G A;  4H2F A;  1Z2W A;  4ORC A;  2QJC A;  5C1V A;  1UTE A;  3H66 A;  3RL4 A;  2A22 A;  1G5B A;  2USH A;  1XZW A;  4H1S A;  2GJU A;  2WDE A;  3ZU0 A;  2CV9 A;  4OR9 A;  3DSD A;  4FBW A;  1UF3 A;  3JYF A;  5J28 A;  1WAO 1;  2NYL C;  4KKZ A;  4ORB A;  2YEQ A;  4NZV A;  5EQV A;  2WDC A;  3RL3 A;  2O8G A;  2HY1 A;  3QFN A;  1KBP A;  2ZOA A;  3CK2 A;  3H67 A;  4IL1 A;  4JA9 A;  2ZO9 B;  1QHW A;  4DHL A;  2O8A A;  5JPE A;  4F0Z A;  5B8I A;  2QFR A;  3QFK A;  2R17 A;  5INB A;  4FBQ A;  3H63 A;  3V4Y A;  4UWQ A;  2HYO A;  4UT3 B;  3H61 A;  2JOG A;  4LU9 A;  1OID A;  3IVD A;  3TGH A;  4TUG A;  4ORA A;  1S70 A;  2NPP C;  4M0V A;  4MP0 A;  4UT2 A;  3T1I A;  2YVT A;  1Z2X A;  1SU1 A;  2XMO A;  3DW8 C;  1S95 A;  2AHD A;  3RQZ A;  1S3M A;  4O24 A;  5HPE A;  1NNW A;  4FCX A;  2DXL A;  1M63 A;  2BDX A;  4O4K A;  4V0V A;  3PSO A;  3N5U A;  1AUI A;  1OI8 A;  4KBP A;  4H2G A;  1V73 A;  3E7A A;  3EGH A;  2WDF A;  1IT6 A;  4WWL A;  2NXF A;  4H2I A;  1MF8 A;  1W24 A;  3QFM A;  2IAE C;  5IOH A;  3QG5 C;  1USH A;  3PSN A;  4DT2 A;  4H2B A;  5F3W A;  4V0W A;  3ICF A;  1OIE A;  1XM7 A;  4I5L C;  1S3L A;  3P71 C;  4J6O A;  1S3N A;  3ZTV A;  3IB7 A;  1U32 A;  1T70 A;  2IE3 C;  3FGA C;  4LTY A;  1JK7 A;  3GVE A;  4O43 A;  1FJM A;  2NYM C;  3AUZ A;  2IE4 C;  3H68 A;  3DSC A;  3H62 B;  4V0X A;  4ZVZ A;  3AV0 A;  4LAC C;  4UT3 A;  4G9J A;  3RL5 A;  4H1Y P;  2WDD A;  3C5W C;  5JPF A;  3IB8 A;  2P6B A;  2Q8U A;  3H64 A;  1T71 A;  4JA7 A;  4Q7F A;  4IYP C;  3E7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...