3THNA

Crystal structure of mre11 core with manganese
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
319
structure length
313
Chain Sequence
MKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNQDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDSCRNFPGYVRVVYEEDSLPDLMGEIDNLVKIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP driven structural changes of the bacterial Mre11:Rad50 catalytic head complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Exonuclease, putative
total genus 104
structure length 313
sequence length 319
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 3thnA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3thnA01
2HYOA 2QFRA 2WDCA 3IB7A 4Q7FA 5C1VA 1FJMA 2NPPC 2USHA 3P71C 1S3LA 2IAEC 3IB8A 1S95A 4I5LC 1QHWA 4IYPC 4KKZA 4H1SA 3KBPA 5GTUA 3H66A 3EGHA 4ORCA 4O43A 4LACC 4J6OA 4UT2A 3EGGA 5IOHA 2QFPA 1NNWA 3H61A 2WDEA 3E7AA 4FBWA 4JA7A 3H69A 5JPEA 2HYPA 3H62B 1OIEA 2KKNA 5HPEA 1HPUA 4OR9A 1UTEA 4MOYA 3RL5A 4DT2A 5JJTA 1M63A 2XMOA 2O8AA 3H63A 4TUGA 3E7BA 2BCDA 5F3WA 1V73A 1AUIA 3C5WC 2IE4C 2P6BA 4JA9A 3RL4A 2Q8UA 1HO5A 3N5UA 4ORBA 1TCOA 4MP0A 4IL1A 4O24A 4UT3B 1OIDA 2NYMC 2Z06A 1Z2WA 1MF8A 1OI8A 4FBQA 1W24A 1KBPA 1U32A 4KBPA 3C9FA 4UWQA 3AUZA 1XZWA 2ZBMA 1G5BA 3JYFA 1JK7A 2A22A 4ZVZA 3T1IA 2NYLC 4DHLA 3LL8A 2NXFA 1S3NA 5EQVA 1USHA 4O4KA 3V4YA 3PSNA 2GJUA 4B2OA 2AHDA 1S70A 3FGAC 1T70A 3QFMA 4M0VA 3QG5C 4I5NC 4FBKA 3TGHA 3THOB 4LTYA 3RQZA 5J28A 4TUIA 4DSYA 4ORAA 1T71A 1UF3A 2CV9A 5JPFA 3HVQA 4ZX2A 3ICFA 4MOVA 3IVDA 3H67A 1WAO1 4H2FA 4H2GA 2YVTA 1IT6A 4F0ZA 1WARA 3H64A 3ZU0A 1II7A 3QFKA 3QFOA 2BDXA 3DSCA 2O8GA 4UT3A 4H2BA 4H2IA 5B8IA 3DSDA 2R17A 4YKEA 3K7WC 4HD0A 3GVEA 3IVEA 4WWLA 1S8EA 4V0WA 1Z2XA 4FCXA 5DNYA 3AV0A 3DW8C 4LU9A 3THNA 4XPNA 4O5GA 1S3MA 4G9JA 3ZTVA 3H60A 4V0XA 2WDDA 3PSOA 4H1YP 2QJCA 4NZVA 3RL3A 1QFCA 3CK2A 1SU1A 1HP1A 2Z1AA 4V0VA 2DFJA 2HY1A 1XM7A 3H68A 3QFNA 2BQ8X 2Z72A 3K7VC 2JOGA 2IE3C 5INBA 2WDFA
chains in the Genus database with same CATH superfamily
2EN6A 1UHZA 1JK2A 2NABA 4DV4E 3IB8A 4KKZA 3KBPA 2R1FA 2E5LE 3H66A 3EGHA 5A2QC 2HGHA 1RC7A 4ZYHA 5CFFE 2E72A 4J6OA 2JOXA 5KL3A 3P1XA 5KL2A 4F9AB 5KL4A 1TF6A 2L33A 1NNWA 3E7AA 4FBWA 2LUQA 4R03A 2EMZA 1EH8A 1OIEA 1HPUA 4OR9A 1UTEA 5JJTA 4LFAE 1X6EA 2KOUA 2V85A 1PDAA 4WXDA 2M1SA 5F3WA 2P6BA 1HO5A 3N5UA 4DUYE 1YYKA 4DR6E 2JOBA 4X66E 4O24A 4P7DA 4ZYDA 4R2QA 4B3ME 2EM2A 2EOFA 4R2RA 1MF8A 4FBQA 1YFHA 1X6HA 5LMUE 2B7TA 1U32A 1PJQA 4UWQA 2RSMA 4JI8E 2GPIA 4M2ZA 3JYFA 2A22A 2WBSA 1UILA 2DMIA 4J8ZA 4BCAA 4X64E 2B3TB 1USHA 2EMIA 2RS7A 3V4YA 1QNTA 2JVAA 1NCSA 2FV4B 2V88A 3PSNA 1S70A 1WHNA 2V86A 2EPZA 2L8TA 4I5NC 2LJHA 4IJDA 2YTIA 2CT1A 3THOB 2ODRC 3RQZA 5J28A 1KJKA 2EM8A 3FIGA 2CV9A 3T1YE 3HVQA 2UU9E 4WFTA 2LO3A 4ZX2A 3JAMC 3H67A 3HTXA 4F6MA 1WAO1 4H2FA 2YVTA 1O0WA 2ODRD 2LMZA 4DUZE 1A1KA 3BIDA 4UT3A 3UK3C 1HR0E 1HNXE 2EOMA 2VF1A 3ADIA 3K7WC 2B7VA 3OTOE 5LL6R 1P47A 3GVEA 4YY3E 1DQ3A 3K6QA 2YU8A 2EOEA 2PRTA 1IBKE 4FCXA 4L8NA 2M7QA 4B3SE 3FLOA 3T1HE 3F6HA 3THNA 1S3MA 2HC5A 2EM6A 2UXBE 2HJJA 4BHBA 4NZVA 2EPXA 3CK2A 1SU1A 4MLQA 5A6BD 2EL6A 4N4RB 3C4BA 4V0VA 2MKNA 2HY1A 2EPOA 2BQ8X 1X49A 2LTSA 2DMYA 4JYAE 2V89A 2WCC3 2QFRA 4Q7FA 4X62E 2MDRA 5C1VA 2EM0A 2YTGA 1G2FC 4JI1E 2NPPC 2EMBA 4IS1C 2GLIA 3P71C 1S95A 1QHWA 2WBUA 2DLKA 2JWOA 5A6KA 1X48A 4H1SA 5A6JA 4DKKA 2EE8A 3MHSC 2EL4A 4WPYA 4ZYEA 1IMUA 2L3CA 4UT2A 5AC5A 4P78A 3ZOQB 5IOHA 1BBGA 3ADJA 2M4IA 2WDEA 2EOHA 3BBGA 1YYWA 2N3GA 4MLVA 2EM9A 3J81C 3H62B 4WSGA 4BC9A 1RMDA 2DLQA 1AAYA 4BS9A 4WX9A 4HTGA 2KKNA 1YPNA 5LLQA 4DT2A 2EPLX 3H63A 2BCDA 2EMXA 4DR3E 1V73A 1PKPA 2Q8UA 2FGGA 4MP0A 1DI2A 3IWDA 2EOZA 1N3GA 2YEQA 2F8BA 3RMPA 2EPCA 1T4OA 4KBPA 4LF8E 1YUIA 1JK1A 2L6MA 4JI6E 2RQLA 3M99B 1PJSA 1JK7A 3T1IA 2EP3A 2JP9A 2UUBE 4DHLA 5TSEA 2F4VE 4KHPE 1S3NA 2N3HA 4O4KA 4Q28A 4JI5E 1WHQA 4DV1E 2DSYA 2JXPA 4B2OA 2L92A 4BHCA 1G2DC 4GKJE 3FGAC 3HPZA 2ZO9B 3QFMA 1X3CA 1WRJA 3JU0A 2LVHA 3QG5C 2EPRA 4BC7A 1N33E 2KHXA 4LFCE 2B9DA 2L2MA 3F6GA 4LTYA 4TUIA 2ZM6E 2MDGA 1WJPA 2RSIA 1TF3A 1T71A 5ADZA 3ICFA 1MGTA 2JR1A 4JI2E 2V83A 1ZBTA 4H2GA 3H64A 1RQ0A 2EPUA 1FKAE 1II7A 3QFKA 2VE7C 3DSCA 2MKDA 3IWCA 4X65E 1F2IG 5B8IA 3DSDA 4GZNC 1S8EA 4KZSA 4LF5E 1PJTA 4LU9A 4O5GA 2ADRA 2EOOA 4L5NC 3H60A 4X8WA 1DGCA 1A1GA 2EPPA 1J26A 1YYOA 3ZTVA 3PSOA 1HNZE 1X47A 2DGCA 3J7AG 1XNQE 4DR5E 2FTXB 4F9CB 5LMNE 2EMAA 1ZAAC 1BBOA 4WSPA 2ENCA 2EN7A 3D03A 2EJ4A 3RL5A 2WDFA 1GQEA 4R2DA 2VRDA 5A6AA 2EOQA 4HEIA 4I8OA 2EPMX 2K4VA 2YTEA 1S3LA 1EH7A 1N32E 3VYXA 4KWYA 4LF6E 2ZOAA 4IYPC 1SFEA 3KZZA 3C6KA 4LACC 3KZYA 2EWLA 3EGGA 2QFPA 2V8QB 1T4LB 2EL5A 1XMQE 2RS6A 3H61A 1YZ9A 5JPEA 4OOGC 4M9VC 3EQ1A 4RH8A 4BBYA 4R2AA 2J7JA 2N8XA 4MOYA 2BBGA 1M63A 2XMOA 2JY9A 4NXME 2K7IA 3C5WC 3J7Yp 2EN8A 1UN6B 2UXDE 1TCOA 2EMGA 2YRHA 4IL1A 4UT3B 2A25A 2DRPA 3ADGA 2KONA 2YTJA 2R76A 2CPNA 1A1LA 2YTDA 1W24A 4LFBE 3C9FA 4JI7E 2ENAA 2EQ1A 2YT4A 1EH6A 2ZBMA 2ELYA 1G5BA 5FLXC 4ZVZA 3TQMA 4DV2E 4JI4E 2YWQA 3H09A 3C4TA 2NYLC 3LL8A 2YRMA 5AC4A 3EPLA 4DMIA 2NXFA 3EPHA 3VYYA 2AHDA 1KYQA 1IQOA 4K0KE 4FK5C 3MHHC 1ZBQA 2EPKX 1YSAC 2EM5A 4DR7E 1XMOE 2DXNA 3TGHA 3E0JA 2MC6A 4ORAA 5A6BA 4DV7E 3IVDA 3ADLA 3IWBA 4NHRA 1BB8A 1IT6A 5IXMB 1WARA 4F0ZA 4R2PA 4DR4E 2EM3A 3HPSA 2BDXA 1X5WA 2NA2A 4H2IA 1HNWE 4HD0A 3IVEA 2LJUA 4WWLA 2I9IA 4AQYE 2EORA 4JI3E 1QU6A 5AE3A 1SR9A 2HHHE 4BMJA 2DB2A 3AV0A 2ENHA 4OX9E 2RTXA 4B3TE 4V0XA 1AH5A 2I13A 2EN1A 4H1YP 2EOSA 2E1MA 2QJCA 1ZU1A 2UUCE 2M9AA 3MSWA 3VHTB 2LUPB 1A1HA 4LF4E 1HP1A 2EOXA 2CTDA 2Z1AA 2DFJA 5AE2A 1I94E 2LCEA 2IE3C 2EMFA 2HYOA 2WDCA 3IB7A 2EZ6A 2YTOA 2YPNA 2RPCA 2DIXA 2YTFA 1FJMA 2G7HA 2USHA 4I5LC 2IAEC 2EN4A 2L2NA 4LF7E 2NUEA 3HXLA 5GTUA 4M30A 2YSOA 4ORCA 2EQ0A 4O43A 1ZR9A 3ECRA 2EN2A 3DF6A 5KL7A 4LF9E 2JYAA 2YTNA 4DV0E 4F2JC 3HQ1A 2VQFE 5KL5A 2V87A 3BF2A 4JA7A 4F6NA 1A1FA 1L4SA 3H69A 2UXCE 2HYPA 2WBTA 2LT7A 2EMHA 5A69A 2EOJA 1IBME 2UUAE 2EN3A 5HPEA 2EMKA 4F54A 2BB8A 4TUGA 4GKKE 2EM7A 2O8AA 2WZOA 3VK6A 3E7BA 3C6MA 2LBSB 1FJGE 1AUIA 2IE4C 1Z1BA 4JA9A 3RL4A 1YUJA 2LTRA 4DV6E 2EQ3A 4ORBA 2CSHA 1OIDA 2NYMC 2Z06A 4F9BB 2H36X 1T4NA 2YTQA 1Z2WA 1OI8A 1GTKA 1GZ6A 4GEQB 2YTPA 2YSPA 3OMLA 2YZTA 1XNRE 1IQSA 1N36E 1KBPA 2GHFA 3AUZA 4DV5E 1XZWA 2NUFA 3KWRA 4NXNE 5EQVA 3LLHA 2GJUA 1J5EE 3BGHA 1LLMC 2L2KB 2EPAA 1T70A 1STUA 4M0VA 1TN9A 4WYQB 5AASA 4JV5E 4FBKA 4JI0E 4DSYA 1NEIA 1UF3A 2EPNA 1UBDC 2JPAA 5JPFA 2LE2A 2YU5A 1EKZA 4MOVA 2EMCA 5IT9C 2IHR1 4ZYGA 3ZU0A 2LRSA 5AE1A 2EMWA 4DR2E 3QFOA 2EMYA 3JTZA 2O8GA 4H2BA 2R17A 2EOYA 5KL6A 4YHHE 4YKEA 2YRKA 4R2CA 1A1JA 5IV8B 1T38A 3L00A 2DXLA 2ELZA 4V0WA 1Z2XA 1X6FA 5DNYA 2MC5A 5IWAE 1N34E 2VQEE 3LMLA 4R2SA 4DV3E 3DW8C 1MEYC 2LV2A 4XPNA 4G9JA 2EMLA 4R8OA 4WXCA 1A1IA 2WDDA 2NUGA 2D9HA 4B3RE 3EPJA 3RL3A 1QFCA 2L3JA 4X9JA 1B69A 1WXRA 3EPKA 2EM4A 5BR8E 4DR1E 2EOIA 3J80C 1XM7A 4RHBB 5T6JA 3DJWA 1T39A 3H68A 3QFNA 2Z72A 4Q35B 2JOGA 1IBLE 3K7VC 4R2EA 5INBA
chains in the Genus database with same CATH topology
2HYOA 2QFRA 2WDCA 3IB7A 4Q7FA 5C1VA 1FJMA 2NPPC 2USHA 3P71C 1S3LA 2IAEC 3IB8A 1S95A 2ZOAA 4I5LC 1QHWA 4IYPC 4KKZA 4H1SA 3KBPA 5GTUA 3H66A 3EGHA 4ORCA 4O43A 4LACC 4J6OA 4UT2A 3EGGA 5IOHA 2QFPA 1NNWA 3H61A 2WDEA 3E7AA 4FBWA 4JA7A 3H69A 5JPEA 2HYPA 3H62B 1OIEA 2KKNA 5HPEA 1HPUA 4OR9A 1UTEA 4MOYA 3RL5A 4DT2A 5JJTA 1M63A 2O8AA 2XMOA 3H63A 4TUGA 3E7BA 2BCDA 5F3WA 1V73A 1AUIA 3C5WC 2IE4C 2P6BA 4JA9A 3RL4A 2Q8UA 1HO5A 3N5UA 4ORBA 1TCOA 4MP0A 4IL1A 4O24A 4UT3B 1OIDA 2NYMC 2Z06A 1Z2WA 2YEQA 1MF8A 1OI8A 4FBQA 1W24A 1KBPA 1U32A 4KBPA 3C9FA 4UWQA 3AUZA 1XZWA 2ZBMA 1G5BA 3JYFA 1JK7A 2A22A 4ZVZA 3T1IA 2NYLC 4DHLA 3LL8A 2NXFA 1S3NA 5EQVA 1USHA 4O4KA 3V4YA 3PSNA 2GJUA 4B2OA 2AHDA 1S70A 3FGAC 1T70A 2ZO9B 3QFMA 4M0VA 3QG5C 4I5NC 2DXNA 4FBKA 3TGHA 3THOB 3E0JA 4LTYA 3RQZA 5J28A 4DSYA 4TUIA 4ORAA 1T71A 1UF3A 2CV9A 5JPFA 3HVQA 4ZX2A 3ICFA 4MOVA 3IVDA 3H67A 1WAO1 4H2FA 4H2GA 2YVTA 1IT6A 4F0ZA 1WARA 3H64A 3ZU0A 1II7A 3QFKA 3QFOA 2BDXA 3DSCA 2O8GA 4UT3A 4H2BA 4H2IA 5B8IA 3DSDA 2R17A 4YKEA 3K7WC 4HD0A 3GVEA 3IVEA 4WWLA 2DXLA 1S8EA 4V0WA 1Z2XA 4FCXA 5DNYA 3FLOA 3AV0A 3DW8C 4LU9A 3THNA 4XPNA 4O5GA 1S3MA 4G9JA 3ZTVA 3H60A 4V0XA 2WDDA 3PSOA 4H1YP 2QJCA 4NZVA 3RL3A 1QFCA 3CK2A 1SU1A 1HP1A 2Z1AA 4V0VA 2DFJA 2HY1A 1XM7A 3H68A 3QFNA 2BQ8X 2Z72A 3D03A 2JOGA 3K7VC 2IE3C 5INBA 2WDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYO A;  2QFR A;  2WDC A;  3IB7 A;  4Q7F A;  5C1V A;  1FJM A;  2NPP C;  2USH A;  3P71 C;  1S3L A;  2IAE C;  3IB8 A;  1S95 A;  4I5L C;  1QHW A;  4IYP C;  4KKZ A;  4H1S A;  3KBP A;  5GTU A;  3H66 A;  3EGH A;  4ORC A;  4O43 A;  4LAC C;  4J6O A;  4UT2 A;  3EGG A;  5IOH A;  2QFP A;  1NNW A;  3H61 A;  2WDE A;  3E7A A;  4FBW A;  4JA7 A;  3H69 A;  5JPE A;  2HYP A;  3H62 B;  1OIE A;  2KKN A;  5HPE A;  1HPU A;  4OR9 A;  1UTE A;  4MOY A;  3RL5 A;  4DT2 A;  5JJT A;  1M63 A;  2XMO A;  2O8A A;  3H63 A;  4TUG A;  3E7B A;  2BCD A;  5F3W A;  1V73 A;  1AUI A;  3C5W C;  2IE4 C;  2P6B A;  4JA9 A;  3RL4 A;  2Q8U A;  1HO5 A;  3N5U A;  4ORB A;  1TCO A;  4MP0 A;  4IL1 A;  4O24 A;  4UT3 B;  1OID A;  2NYM C;  2Z06 A;  1Z2W A;  1MF8 A;  1OI8 A;  4FBQ A;  1W24 A;  1KBP A;  1U32 A;  4KBP A;  3C9F A;  4UWQ A;  3AUZ A;  1XZW A;  2ZBM A;  1G5B A;  3JYF A;  1JK7 A;  2A22 A;  4ZVZ A;  3T1I A;  2NYL C;  4DHL A;  3LL8 A;  2NXF A;  1S3N A;  5EQV A;  1USH A;  4O4K A;  3V4Y A;  3PSN A;  2GJU A;  4B2O A;  2AHD A;  1S70 A;  3FGA C;  1T70 A;  3QFM A;  4M0V A;  3QG5 C;  4I5N C;  4FBK A;  3TGH A;  3THO B;  4LTY A;  3RQZ A;  5J28 A;  4TUI A;  4DSY A;  4ORA A;  1T71 A;  1UF3 A;  2CV9 A;  5JPF A;  3HVQ A;  4ZX2 A;  3ICF A;  4MOV A;  3IVD A;  3H67 A;  1WAO 1;  4H2F A;  4H2G A;  2YVT A;  1IT6 A;  4F0Z A;  1WAR A;  3H64 A;  3ZU0 A;  1II7 A;  3QFK A;  3QFO A;  2BDX A;  3DSC A;  2O8G A;  4UT3 A;  4H2B A;  4H2I A;  5B8I A;  3DSD A;  2R17 A;  4YKE A;  3K7W C;  4HD0 A;  3GVE A;  3IVE A;  4WWL A;  1S8E A;  4V0W A;  1Z2X A;  4FCX A;  5DNY A;  3AV0 A;  3DW8 C;  4LU9 A;  3THN A;  4XPN A;  4O5G A;  1S3M A;  4G9J A;  3ZTV A;  3H60 A;  4V0X A;  2WDD A;  3PSO A;  4H1Y P;  2QJC A;  4NZV A;  3RL3 A;  1QFC A;  3CK2 A;  1SU1 A;  1HP1 A;  2Z1A A;  4V0V A;  2DFJ A;  2HY1 A;  1XM7 A;  3H68 A;  3QFN A;  2BQ8 X;  2Z72 A;  3K7V C;  2JOG A;  2IE3 C;  5INB A;  2WDF A; 
#chains in the Genus database with same CATH topology
 2EN6 A;  1UHZ A;  1JK2 A;  2NAB A;  4DV4 E;  3IB8 A;  4KKZ A;  3KBP A;  2R1F A;  2E5L E;  3H66 A;  3EGH A;  5A2Q C;  2HGH A;  1RC7 A;  4ZYH A;  5CFF E;  2E72 A;  4J6O A;  2JOX A;  5KL3 A;  3P1X A;  5KL2 A;  4F9A B;  5KL4 A;  1TF6 A;  2L33 A;  1NNW A;  3E7A A;  4FBW A;  2LUQ A;  4R03 A;  2EMZ A;  1EH8 A;  1OIE A;  1HPU A;  4OR9 A;  1UTE A;  5JJT A;  4LFA E;  1X6E A;  2KOU A;  2V85 A;  1PDA A;  4WXD A;  2M1S A;  5F3W A;  2P6B A;  1HO5 A;  3N5U A;  4DUY E;  1YYK A;  4DR6 E;  2JOB A;  4X66 E;  4O24 A;  4P7D A;  4ZYD A;  4R2Q A;  4B3M E;  2EM2 A;  2EOF A;  4R2R A;  1MF8 A;  4FBQ A;  1YFH A;  1X6H A;  5LMU E;  2B7T A;  1U32 A;  1PJQ A;  4UWQ A;  2RSM A;  4JI8 E;  2GPI A;  4M2Z A;  3JYF A;  2A22 A;  2WBS A;  1UIL A;  2DMI A;  4J8Z A;  4BCA A;  4X64 E;  2B3T B;  1USH A;  2EMI A;  2RS7 A;  3V4Y A;  1QNT A;  2JVA A;  1NCS A;  2FV4 B;  2V88 A;  3PSN A;  1S70 A;  1WHN A;  2V86 A;  2EPZ A;  2L8T A;  4I5N C;  2LJH A;  4IJD A;  2YTI A;  2CT1 A;  3THO B;  2ODR C;  3RQZ A;  5J28 A;  1KJK A;  2EM8 A;  3FIG A;  2CV9 A;  3T1Y E;  3HVQ A;  2UU9 E;  4WFT A;  2LO3 A;  4ZX2 A;  3JAM C;  3H67 A;  3HTX A;  4F6M A;  1WAO 1;  4H2F A;  2YVT A;  1O0W A;  2ODR D;  2LMZ A;  4DUZ E;  1A1K A;  3BID A;  4UT3 A;  3UK3 C;  1HR0 E;  1HNX E;  2EOM A;  2VF1 A;  3ADI A;  3K7W C;  2B7V A;  3OTO E;  5LL6 R;  1P47 A;  3GVE A;  4YY3 E;  1DQ3 A;  3K6Q A;  2YU8 A;  2EOE A;  2PRT A;  1IBK E;  4FCX A;  4L8N A;  2M7Q A;  4B3S E;  3FLO A;  3T1H E;  3F6H A;  3THN A;  1S3M A;  2HC5 A;  2EM6 A;  2UXB E;  2HJJ A;  4BHB A;  4NZV A;  2EPX A;  3CK2 A;  1SU1 A;  4MLQ A;  5A6B D;  2EL6 A;  4N4R B;  3C4B A;  4V0V A;  2MKN A;  2HY1 A;  2EPO A;  2BQ8 X;  1X49 A;  2LTS A;  2DMY A;  4JYA E;  2V89 A;  2WCC 3;  2QFR A;  4Q7F A;  4X62 E;  2MDR A;  5C1V A;  2EM0 A;  2YTG A;  1G2F C;  4JI1 E;  2NPP C;  2EMB A;  4IS1 C;  2GLI A;  3P71 C;  1S95 A;  1QHW A;  2WBU A;  2DLK A;  2JWO A;  5A6K A;  1X48 A;  4H1S A;  5A6J A;  4DKK A;  2EE8 A;  3MHS C;  2EL4 A;  4WPY A;  4ZYE A;  1IMU A;  2L3C A;  4UT2 A;  5AC5 A;  4P78 A;  3ZOQ B;  5IOH A;  1BBG A;  3ADJ A;  2M4I A;  2WDE A;  2EOH A;  3BBG A;  1YYW A;  2N3G A;  4MLV A;  2EM9 A;  3J81 C;  3H62 B;  4WSG A;  4BC9 A;  1RMD A;  2DLQ A;  1AAY A;  4BS9 A;  4WX9 A;  4HTG A;  2KKN A;  1YPN A;  5LLQ A;  4DT2 A;  2EPL X;  3H63 A;  2BCD A;  2EMX A;  4DR3 E;  1V73 A;  1PKP A;  2Q8U A;  2FGG A;  4MP0 A;  1DI2 A;  3IWD A;  2EOZ A;  1N3G A;  2YEQ A;  2F8B A;  3RMP A;  2EPC A;  1T4O A;  4KBP A;  4LF8 E;  1YUI A;  1JK1 A;  2L6M A;  4JI6 E;  2RQL A;  3M99 B;  1PJS A;  1JK7 A;  3T1I A;  2EP3 A;  2JP9 A;  2UUB E;  4DHL A;  5TSE A;  2F4V E;  4KHP E;  1S3N A;  2N3H A;  4O4K A;  4Q28 A;  4JI5 E;  1WHQ A;  4DV1 E;  2DSY A;  2JXP A;  4B2O A;  2L92 A;  4BHC A;  1G2D C;  4GKJ E;  3FGA C;  3HPZ A;  2ZO9 B;  3QFM A;  1X3C A;  1WRJ A;  3JU0 A;  2LVH A;  3QG5 C;  2EPR A;  4BC7 A;  1N33 E;  2KHX A;  4LFC E;  2B9D A;  2L2M A;  3F6G A;  4LTY A;  4TUI A;  2ZM6 E;  2MDG A;  1WJP A;  2RSI A;  1TF3 A;  1T71 A;  5ADZ A;  3ICF A;  1MGT A;  2JR1 A;  4JI2 E;  2V83 A;  1ZBT A;  4H2G A;  3H64 A;  1RQ0 A;  2EPU A;  1FKA E;  1II7 A;  3QFK A;  2VE7 C;  3DSC A;  2MKD A;  3IWC A;  4X65 E;  1F2I G;  5B8I A;  3DSD A;  4GZN C;  1S8E A;  4KZS A;  4LF5 E;  1PJT A;  4LU9 A;  4O5G A;  2ADR A;  2EOO A;  4L5N C;  3H60 A;  4X8W A;  1DGC A;  1A1G A;  2EPP A;  1J26 A;  1YYO A;  3ZTV A;  3PSO A;  1HNZ E;  1X47 A;  2DGC A;  3J7A G;  1XNQ E;  4DR5 E;  2FTX B;  4F9C B;  5LMN E;  2EMA A;  1ZAA C;  1BBO A;  4WSP A;  2ENC A;  2EN7 A;  3D03 A;  2EJ4 A;  3RL5 A;  2WDF A;  1GQE A;  4R2D A;  2VRD A;  5A6A A;  2EOQ A;  4HEI A;  4I8O A;  2EPM X;  2K4V A;  2YTE A;  1S3L A;  1EH7 A;  1N32 E;  3VYX A;  4KWY A;  4LF6 E;  2ZOA A;  4IYP C;  1SFE A;  3KZZ A;  3C6K A;  4LAC C;  3KZY A;  2EWL A;  3EGG A;  2QFP A;  2V8Q B;  1T4L B;  2EL5 A;  1XMQ E;  2RS6 A;  3H61 A;  1YZ9 A;  5JPE A;  4OOG C;  4M9V C;  3EQ1 A;  4RH8 A;  4BBY A;  4R2A A;  2J7J A;  2N8X A;  4MOY A;  2BBG A;  1M63 A;  2XMO A;  2JY9 A;  4NXM E;  2K7I A;  3C5W C;  3J7Y p;  2EN8 A;  1UN6 B;  2UXD E;  1TCO A;  2EMG A;  2YRH A;  4IL1 A;  4UT3 B;  2A25 A;  2DRP A;  3ADG A;  2KON A;  2YTJ A;  2R76 A;  2CPN A;  1A1L A;  2YTD A;  1W24 A;  4LFB E;  3C9F A;  4JI7 E;  2ENA A;  2EQ1 A;  2YT4 A;  1EH6 A;  2ZBM A;  2ELY A;  1G5B A;  5FLX C;  4ZVZ A;  3TQM A;  4DV2 E;  4JI4 E;  2YWQ A;  3H09 A;  3C4T A;  2NYL C;  3LL8 A;  2YRM A;  5AC4 A;  3EPL A;  4DMI A;  2NXF A;  3EPH A;  3VYY A;  2AHD A;  1KYQ A;  1IQO A;  4K0K E;  4FK5 C;  3MHH C;  1ZBQ A;  2EPK X;  1YSA C;  2EM5 A;  4DR7 E;  1XMO E;  2DXN A;  3TGH A;  3E0J A;  2MC6 A;  4ORA A;  5A6B A;  4DV7 E;  3IVD A;  3ADL A;  3IWB A;  4NHR A;  1BB8 A;  1IT6 A;  5IXM B;  1WAR A;  4F0Z A;  4R2P A;  4DR4 E;  2EM3 A;  3HPS A;  2BDX A;  1X5W A;  2NA2 A;  4H2I A;  1HNW E;  4HD0 A;  3IVE A;  2LJU A;  4WWL A;  2I9I A;  4AQY E;  2EOR A;  4JI3 E;  1QU6 A;  5AE3 A;  1SR9 A;  2HHH E;  4BMJ A;  2DB2 A;  3AV0 A;  2ENH A;  4OX9 E;  2RTX A;  4B3T E;  4V0X A;  1AH5 A;  2I13 A;  2EN1 A;  4H1Y P;  2EOS A;  2E1M A;  2QJC A;  1ZU1 A;  2UUC E;  2M9A A;  3MSW A;  3VHT B;  2LUP B;  1A1H A;  4LF4 E;  1HP1 A;  2EOX A;  2CTD A;  2Z1A A;  2DFJ A;  5AE2 A;  1I94 E;  2LCE A;  2IE3 C;  2EMF A;  2HYO A;  2WDC A;  3IB7 A;  2EZ6 A;  2YTO A;  2YPN A;  2RPC A;  2DIX A;  2YTF A;  1FJM A;  2G7H A;  2USH A;  4I5L C;  2IAE C;  2EN4 A;  2L2N A;  4LF7 E;  2NUE A;  3HXL A;  5GTU A;  4M30 A;  2YSO A;  4ORC A;  2EQ0 A;  4O43 A;  1ZR9 A;  3ECR A;  2EN2 A;  3DF6 A;  5KL7 A;  4LF9 E;  2JYA A;  2YTN A;  4DV0 E;  4F2J C;  3HQ1 A;  2VQF E;  5KL5 A;  2V87 A;  3BF2 A;  4JA7 A;  4F6N A;  1A1F A;  1L4S A;  3H69 A;  2UXC E;  2HYP A;  2WBT A;  2LT7 A;  2EMH A;  5A69 A;  2EOJ A;  1IBM E;  2UUA E;  2EN3 A;  5HPE A;  2EMK A;  4F54 A;  2BB8 A;  4TUG A;  4GKK E;  2EM7 A;  2O8A A;  2WZO A;  3VK6 A;  3E7B A;  3C6M A;  2LBS B;  1FJG E;  1AUI A;  2IE4 C;  1Z1B A;  4JA9 A;  3RL4 A;  1YUJ A;  2LTR A;  4DV6 E;  2EQ3 A;  4ORB A;  2CSH A;  1OID A;  2NYM C;  2Z06 A;  4F9B B;  2H36 X;  1T4N A;  2YTQ A;  1Z2W A;  1OI8 A;  1GTK A;  1GZ6 A;  4GEQ B;  2YTP A;  2YSP A;  3OML A;  2YZT A;  1XNR E;  1IQS A;  1N36 E;  1KBP A;  2GHF A;  3AUZ A;  4DV5 E;  1XZW A;  2NUF A;  3KWR A;  4NXN E;  5EQV A;  3LLH A;  2GJU A;  1J5E E;  3BGH A;  1LLM C;  2L2K B;  2EPA A;  1T70 A;  1STU A;  4M0V A;  1TN9 A;  4WYQ B;  5AAS A;  4JV5 E;  4FBK A;  4JI0 E;  4DSY A;  1NEI A;  1UF3 A;  2EPN A;  1UBD C;  2JPA A;  5JPF A;  2LE2 A;  2YU5 A;  1EKZ A;  4MOV A;  2EMC A;  5IT9 C;  2IHR 1;  4ZYG A;  3ZU0 A;  2LRS A;  5AE1 A;  2EMW A;  4DR2 E;  3QFO A;  2EMY A;  3JTZ A;  2O8G A;  4H2B A;  2R17 A;  2EOY A;  5KL6 A;  4YHH E;  4YKE A;  2YRK A;  4R2C A;  1A1J A;  5IV8 B;  1T38 A;  3L00 A;  2DXL A;  2ELZ A;  4V0W A;  1Z2X A;  1X6F A;  5DNY A;  2MC5 A;  5IWA E;  1N34 E;  2VQE E;  3LML A;  4R2S A;  4DV3 E;  3DW8 C;  1MEY C;  2LV2 A;  4XPN A;  4G9J A;  2EML A;  4R8O A;  4WXC A;  1A1I A;  2WDD A;  2NUG A;  2D9H A;  4B3R E;  3EPJ A;  3RL3 A;  1QFC A;  2L3J A;  4X9J A;  1B69 A;  1WXR A;  3EPK A;  2EM4 A;  5BR8 E;  4DR1 E;  2EOI A;  3J80 C;  1XM7 A;  4RHB B;  5T6J A;  3DJW A;  1T39 A;  3H68 A;  3QFN A;  2Z72 A;  4Q35 B;  2JOG A;  1IBL E;  3K7V C;  4R2E A;  5INB A; 
#chains in the Genus database with same CATH homology
 2HYO A;  2QFR A;  2WDC A;  3IB7 A;  4Q7F A;  5C1V A;  1FJM A;  2NPP C;  2USH A;  3P71 C;  1S3L A;  2IAE C;  3IB8 A;  1S95 A;  2ZOA A;  4I5L C;  1QHW A;  4IYP C;  4KKZ A;  4H1S A;  3KBP A;  5GTU A;  3H66 A;  3EGH A;  4ORC A;  4O43 A;  4LAC C;  4J6O A;  4UT2 A;  3EGG A;  5IOH A;  2QFP A;  1NNW A;  3H61 A;  2WDE A;  3E7A A;  4FBW A;  4JA7 A;  3H69 A;  5JPE A;  2HYP A;  3H62 B;  1OIE A;  2KKN A;  5HPE A;  1HPU A;  4OR9 A;  1UTE A;  4MOY A;  3RL5 A;  4DT2 A;  5JJT A;  1M63 A;  2O8A A;  2XMO A;  3H63 A;  4TUG A;  3E7B A;  2BCD A;  5F3W A;  1V73 A;  1AUI A;  3C5W C;  2IE4 C;  2P6B A;  4JA9 A;  3RL4 A;  2Q8U A;  1HO5 A;  3N5U A;  4ORB A;  1TCO A;  4MP0 A;  4IL1 A;  4O24 A;  4UT3 B;  1OID A;  2NYM C;  2Z06 A;  1Z2W A;  2YEQ A;  1MF8 A;  1OI8 A;  4FBQ A;  1W24 A;  1KBP A;  1U32 A;  4KBP A;  3C9F A;  4UWQ A;  3AUZ A;  1XZW A;  2ZBM A;  1G5B A;  3JYF A;  1JK7 A;  2A22 A;  4ZVZ A;  3T1I A;  2NYL C;  4DHL A;  3LL8 A;  2NXF A;  1S3N A;  5EQV A;  1USH A;  4O4K A;  3V4Y A;  3PSN A;  2GJU A;  4B2O A;  2AHD A;  1S70 A;  3FGA C;  1T70 A;  2ZO9 B;  3QFM A;  4M0V A;  3QG5 C;  4I5N C;  2DXN A;  4FBK A;  3TGH A;  3THO B;  3E0J A;  4LTY A;  3RQZ A;  5J28 A;  4DSY A;  4TUI A;  4ORA A;  1T71 A;  1UF3 A;  2CV9 A;  5JPF A;  3HVQ A;  4ZX2 A;  3ICF A;  4MOV A;  3IVD A;  3H67 A;  1WAO 1;  4H2F A;  4H2G A;  2YVT A;  1IT6 A;  4F0Z A;  1WAR A;  3H64 A;  3ZU0 A;  1II7 A;  3QFK A;  3QFO A;  2BDX A;  3DSC A;  2O8G A;  4UT3 A;  4H2B A;  4H2I A;  5B8I A;  3DSD A;  2R17 A;  4YKE A;  3K7W C;  4HD0 A;  3GVE A;  3IVE A;  4WWL A;  2DXL A;  1S8E A;  4V0W A;  1Z2X A;  4FCX A;  5DNY A;  3FLO A;  3AV0 A;  3DW8 C;  4LU9 A;  3THN A;  4XPN A;  4O5G A;  1S3M A;  4G9J A;  3ZTV A;  3H60 A;  4V0X A;  2WDD A;  3PSO A;  4H1Y P;  2QJC A;  4NZV A;  3RL3 A;  1QFC A;  3CK2 A;  1SU1 A;  1HP1 A;  2Z1A A;  4V0V A;  2DFJ A;  2HY1 A;  1XM7 A;  3H68 A;  3QFN A;  2BQ8 X;  2Z72 A;  3D03 A;  2JOG A;  3K7V C;  2IE3 C;  5INB A;  2WDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...