3THNA

Crystal structure of mre11 core with manganese
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
319
structure length
313
Chain Sequence
MKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNQDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDSCRNFPGYVRVVYEEDSLPDLMGEIDNLVKIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title ATP driven structural changes of the bacterial Mre11:Rad50 catalytic head complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 104
structure length 313
sequence length 319
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 3thnA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3thnA01
1V73A 4O43A 3THNA 1W24A 3IB7A 4UT3A 3H68A 3IVDA 1MF8A 3CK2A 1HP1A 4H1SA 4UT3B 1S3NA 4H2BA 3THOB 3LL8A 3QG5C 2HYOA 1IT6A 2QJCA 4LU9A 4FCXA 4UWQA 2WDCA 5GTUA 4J6OA 3DSCA 2YVTA 4UT2A 4OR9A 1KBPA 1M63A 3FGAC 4FBWA 1OI8A 1Z2XA 4I5NC 3KBPA 4KKZA 5JPFA 3ZTVA 2NYMC 2IE4C 3AUZA 3ZU0A 4IYPC 3H63A 5F3WA 3ICFA 4DSYA 1QHWA 3K7WC 1S3MA 3H62B 3QFKA 3H64A 5EQVA 1USHA 3QFNA 1TCOA 3QFOA 1UF3A 2WDDA 3EGHA 5B8IA 4O4KA 3C9FA 3AV0A 2Z72A 3H69A 2Z1AA 2JOGA 2BCDA 1S8EA 4LTYA 5INBA 4H2IA 4MP0A 1S70A 1JK7A 4B2OA 2GJUA 1OIDA 4MOVA 3RL3A 1T70A 4MOYA 1G5BA 2P6BA 1SU1A 4IL1A 4F0ZA 2HYPA 4V0WA 3EGGA 2O8AA 2QFPA 3DW8C 4H2GA 5HPEA 2HY1A 3JYFA 1II7A 1UTEA 2AHDA 4YKEA 1S95A 5C1VA 3GVEA 1NNWA 3RL4A 4M0VA 2A22A 2DFJA 3C5WC 2QFRA 3H61A 2NXFA 1S3LA 3QFMA 3TGHA 1T71A 2IAEC 3H66A 5JJTA 3DSDA 3H60A 4ZVZA 4WWLA 1OIEA 4H2FA 2WDEA 5IOHA 2WDFA 3PSOA 2XMOA 4V0VA 5DNYA 1HPUA 3K7VC 2NPPC 4JA9A 1QFCA 3V4YA 1U32A 4ZX2A 2BQ8X 4TUIA 2Z06A 3E7AA 3P71C 4G9JA 3PSNA 1WAO1 3RL5A 4ORBA 4LACC 1WARA 1AUIA 1XZWA 2Q8UA 1XM7A 4HD0A 4JA7A 1Z2WA 2O8GA 3HVQA 4H1YP 2R17A 4XPNA 4DT2A 4NZVA 1HO5A 3IVEA 4O24A 2USHA 4FBKA 3N5UA 4V0XA 4FBQA 4ORAA 5JPEA 3E7BA 4ORCA 4KBPA 4O5GA 5J28A 3IB8A 3RQZA 4Q7FA 4DHLA 2KKNA 3H67A 2ZBMA 4TUGA 2NYLC 1FJMA 3T1IA 4I5LC 2BDXA 2IE3C 2CV9A
chains in the Genus database with same CATH superfamily
4JI8E 5AE3A 2EOEA 2LJHA 1J26A 1MF8A 1DQ3A 1Z1BA 1N33E 4JI4E 1HP1A 1T4OA 2UUCE 4H2BA 1SR9A 3K6QA 2F4VE 1UN6B 4KZSA 2DXNA 2EOOA 2GHFA 3LL8A 1IQSA 2ADRA 4JV5E 4FCXA 5GTUA 2KOUA 2YVTA 4N4RB 4OR9A 3ADGA 1M63A 3FGAC 2EM5A 1OI8A 2BBGA 4DV4E 2HJJA 2JVAA 2EPPA 2JXPA 5IV8B 4KKZA 5JPFA 3ZTVA 4NXME 2YWQA 1A1FA 2IE4C 3AUZA 2NYMC 2VQEE 1WXRA 3H63A 4R2AA 2YRKA 2JOBA 3H62B 3QFKA 3C4BA 3BIDA 1FKAE 4BHCA 2DGCA 2A25A 3EQ1A 2EN3A 4BCAA 3AV0A 2Z72A 3BF2A 3H69A 2EMWA 2YEQA 3FLOA 1T38A 3HQ1A 4LTYA 2MKNA 4MP0A 2LCEA 2EOFA 1X49A 1YYWA 4R2QA 1A1GA 2EQ1A 4WXCA 2LUPB 4IL1A 1X48A 2DRPA 2O8AA 3J7AG 2QFPA 3FIGA 2EPRA 4GKKE 2EPAA 4R03A 3DW8C 2HY1A 2EOSA 2EPXA 2DLQA 2VE7C 1DI2A 2LT7A 1UHZA 1RC7A 1ZU1A 1TN9A 2I13A 3RL4A 1IQOA 4BBYA 2QFRA 3H61A 2WCC3 1IBLE 3TQMA 4LFCE 4NHRA 1JK2A 3J81C 2IAEC 3H66A 5JJTA 2M4IA 2DB2A 2WDEA 5IOHA 2YTQA 2WDFA 2RSMA 2F8BA 2NUFA 1QU6A 2B9DA 4AQYE 1IMUA 1QFCA 2HC5A 2ZO9B 4ZX2A 4DV6E 4M30A 3P71C 1WAO1 3RL5A 5ADZA 1WARA 3OMLA 1XZWA 2LJUA 2B3TB 1ZR9A 3BGHA 5IXMB 3IWBA 4ZYDA 4X9JA 2L2NA 2L92A 2EOQA 3H09A 2R17A 5AASA 4RH8A 2B7VA 2LRSA 4RHBB 2DSYA 3T1HE 3IVEA 2EPMX 4O24A 2KONA 2GLIA 3C4TA 4ORAA 1KJKA 5JPEA 1N34E 3E7BA 4O5GA 4ZYEA 5J28A 4R2DA 3RQZA 2EPZA 2L2MA 4P7DA 2UXBE 3H67A 4DHLA 2EMFA 4MLVA 2YTDA 4BHBA 2NYLC 4DR4E 4OX9E 1B69A 4O43A 2V85A 2JOXA 2V88A 3H68A 4K0KE 3CK2A 1AAYA 1X6EA 2GPIA 3BBGA 3QG5C 4JI5E 2EMHA 4UWQA 4L5NC 3DSCA 2EOIA 4UT2A 1PKPA 3MHSC 3C6KA 1KBPA 2V86A 1FJGE 4R2RA 2YRHA 1JK1A 2HGHA 2JYAA 2LV2A 4X66E 1IBME 4JYAE 4DR5E 4DV7E 2NUEA 1S3MA 1J5EE 4WXDA 2EJ4A 2YSPA 3H64A 4YY3E 1G2FC 1KYQA 4KHPE 1YPNA 2EE8A 1UF3A 3C9FA 2EMXA 2CT1A 3EPKA 2RSIA 4B3ME 2Z1AA 3VYYA 3ADIA 2YRMA 2BCDA 2I9IA 5A2QC 4R2EA 1ZBTA 2N3GA 1JK7A 4JI0E 4R2SA 1OIDA 4GEQB 1YZ9A 2LMZA 1G5BA 2P6BA 1SU1A 4BS9A 2ODRC 2DMIA 2EN6A 4F0ZA 2NABA 5KL3A 2EMLA 2EOYA 2R1FA 2EQ0A 4WPYA 4DR1E 2D9HA 1GZ6A 2H36X 2ELYA 1WRJA 3J80C 3D03A 4H2GA 5HPEA 3F6GA 1ZBQA 3IWDA 2IHR1 3GVEA 4M0VA 5A6JA 4DR6E 3C5WC 1PJTA 1S3LA 1X3CA 3QFMA 2EPKX 3TGHA 2M1SA 2LUQA 2DLKA 4R2PA 4ZVZA 1X47A 4YHHE 4H2FA 4MLQA 5LMUE 1T4LB 4M2ZA 5AC5A 2NPPC 3V4YA 2RS6A 1U32A 3JU0A 2VQFE 2EWLA 4G9JA 4WX9A 1AUIA 1GTKA 1BBGA 1XM7A 2EPOA 4JA7A 2YPNA 2O8GA 2JR1A 4ZYGA 2CPNA 4XPNA 4NZVA 1N36E 1HO5A 1T39A 4HEIA 1HNZE 4LFAE 1HNXE 1N32E 4JI6E 5KL5A 2WBSA 4KBPA 2LVHA 2UU9E 4DV2E 2EM7A 2RPCA 4DV5E 2JP9A 2ZBMA 2ENHA 2E1MA 3T1IA 4I5LC 1RQ0A 2RS7A 2FTXB 2CV9A 2YTGA 3THNA 2WBTA 3IVDA 4LF5E 3LMLA 5LL6R 4UT3B 1S3NA 1YYKA 2EMCA 3THOB 4DR2E 4I8OA 4LF4E 2EOZA 2WDCA 2V8QB 1EH8A 2ODRD 4FK5C 4J6OA 4LF6E 2YZTA 4DMIA 2EPNA 5KL2A 3EPHA 2EN7A 4FBWA 4DR7E 1PJSA 1A1KA 3KZYA 3KBPA 2EL6A 1HR0E 2FV4B 2V89A 2EQ3A 2WBUA 2VRDA 2L3JA 3ZU0A 4IYPC 1PJQA 4DSYA 4Q35B 1QHWA 3M99B 1A1JA 2EMGA 1USHA 3QFNA 2MDRA 1TCOA 2ELZA 2WDDA 3MSWA 5AE1A 3LLHA 4B3TE 2JOGA 1NCSA 1X6HA 4H2IA 3C6MA 4LF9E 1EKZA 2YU8A 2NA2A 3RL3A 2YT4A 4MOYA 3T1YE 2CSHA 2EMYA 4X62E 3UK3C 1YFHA 2L6MA 1WJPA 2G7HA 2V83A 4OOGC 3EGGA 4P78A 2MC5A 4F2JC 2E72A 2L33A 2JPAA 1EH7A 2FGGA 3JYFA 4F9AB 5CFFE 3L00A 1II7A 1LLMC 1MEYC 2EMKA 5A6KA 1NNWA 2EOHA 3IWCA 2KHXA 3DJWA 3P1XA 2V87A 5AC4A 4B3RE 1BBOA 2A22A 4JI3E 2EP3A 2ZOAA 5IT9C 4B3SE 4X8WA 1T71A 2EN8A 3ADJA 4DKKA 2MKDA 4DUYE 3H60A 4KWYA 4WSGA 1UBDC 4DR3E 5A6BD 2EZ6A 5DNYA 1F2IG 1HPUA 2HHHE 3K7VC 2L8TA 2R76A 2MDGA 2Z06A 2EOMA 2E5LE 3PSNA 3VK6A 4F9CB 2Q8UA 4R8OA 4HD0A 5KL6A 1Z2WA 2NUGA 2EMZA 4F6NA 4DT2A 5FLXC 2EM6A 2JY9A 2EN4A 5KL7A 4FBKA 3N5UA 3RMPA 3ADLA 2YU5A 4ORCA 1A1IA 2EMBA 1XMQE 2J7JA 1X5WA 4BC9A 2EL5A 4Q7FA 4WSPA 1X6FA 4F9BB 3ECRA 4TUGA 1FJMA 2N8XA 3HTXA 1V73A 2YSOA 5LMNE 1W24A 3IB7A 2EL4A 1TF6A 4UT3A 3KZZA 2YTEA 4DV1E 4H1SA 4DV0E 2LE2A 2UXDE 2HYOA 4LU9A 1IT6A 2QJCA 2EPUA 1GQEA 5A6BA 4GZNC 2EN1A 1DGCA 1G2DC 1NEIA 1WHNA 1A1HA 1PDAA 3F6HA 1Z2XA 4I5NC 1L4SA 1STUA 4M9VC 1N3GA 3HPSA 3EPJA 4F54A 3JTZA 5F3WA 2N3HA 3DF6A 2LBSB 4BMJA 3ICFA 2UUAE 3K7WC 2DMYA 4F6MA 1P47A 5EQVA 3HPZA 3JAMC 4LFBE 1TF3A 1A1LA 3QFOA 1RMDA 3EGHA 5B8IA 4O4KA 3VHTB 1O0WA 2EOJA 4ZYHA 2UXCE 4LF7E 4JI1E 1T4NA 1I94E 1ZAAC 1S8EA 5INBA 5TSEA 4DV3E 1UILA 1S70A 4J8ZA 1BB8A 2LTRA 4R2CA 4B2OA 2GJUA 2RTXA 2CTDA 2M7QA 4MOVA 2K7IA 4WFTA 5LLQA 4JI2E 1T70A 2EMIA 2K4VA 5A6AA 3EPLA 2WZOA 2YTIA 5AE2A 2HYPA 4V0WA 4IJDA 4BC7A 2EM3A 1YUJA 1XNRE 5KL4A 2YTOA 2JWOA 2VF1A 1UTEA 3OTOE 2AHDA 2EM9A 2EM0A 3MHHC 2EORA 5IWAE 1S95A 4YKEA 2DFJA 5C1VA 1YSAC 2NXFA 1IBKE 2ENAA 3DSDA 4HTGA 1YUIA 5A69A 1WHQA 4X65E 4WWLA 1OIEA 5BR8E 2PRTA 3J7Yp 1MGTA 1HNWE 5T6JA 4Q28A 3PSOA 2EM2A 2XMOA 1AH5A 4V0VA 2BB8A 2RQLA 2EPLX 2LTSA 2UUBE 4DUZE 4JA9A 2YTNA 2L2KB 2MC6A 2ZM6E 4TUIA 2BQ8X 3E0JA 3E7AA 2YTFA 4NXNE 1QNTA 3HXLA 2ENCA 4IS1C 3VYXA 4ORBA 4LACC 4L8NA 3ZOQB 2DIXA 3HVQA 4H1YP 2EM4A 4JI7E 2EM8A 4WYQB 3KWRA 2YTPA 1XMOE 4LF8E 2USHA 2EMAA 2EOXA 4V0XA 4FBQA 1SFEA 1EH6A 2DXLA 1YYOA 2YTJA 2L3CA 4GKJE 2LO3A 1XNQE 3IB8A 2M9AA 2B7TA 2KKNA 4X64E 2EN2A 2EPCA 2BDXA 2IE3C
chains in the Genus database with same CATH topology
1V73A 4O43A 3THNA 1W24A 3IB7A 4UT3A 3H68A 3IVDA 1MF8A 3CK2A 1HP1A 4H1SA 4UT3B 1S3NA 4H2BA 3THOB 2DXNA 3QG5C 3LL8A 2HYOA 1IT6A 2QJCA 4LU9A 4FCXA 4UWQA 2WDCA 5GTUA 3DSCA 4J6OA 2YVTA 4UT2A 4OR9A 1KBPA 1M63A 3FGAC 4FBWA 1OI8A 1Z2XA 4I5NC 3KBPA 4KKZA 5JPFA 3ZTVA 2NYMC 2IE4C 3AUZA 3ZU0A 4IYPC 3H63A 5F3WA 3ICFA 4DSYA 1QHWA 3K7WC 1S3MA 3H62B 3QFKA 3H64A 5EQVA 1USHA 3QFNA 1TCOA 3QFOA 1UF3A 2WDDA 3EGHA 5B8IA 4O4KA 3C9FA 3AV0A 2Z72A 3H69A 2Z1AA 2JOGA 2YEQA 3FLOA 2BCDA 1S8EA 4LTYA 5INBA 4H2IA 4MP0A 1S70A 1JK7A 4B2OA 2GJUA 1OIDA 4MOVA 3RL3A 1T70A 4MOYA 1G5BA 2P6BA 1SU1A 4IL1A 4F0ZA 2HYPA 4V0WA 3EGGA 2O8AA 2QFPA 3D03A 3DW8C 4H2GA 5HPEA 2HY1A 3JYFA 1II7A 1UTEA 2AHDA 4YKEA 1S95A 5C1VA 3GVEA 1NNWA 3RL4A 4M0VA 2A22A 2DFJA 3C5WC 2QFRA 3H61A 2NXFA 1S3LA 3QFMA 2ZOAA 3DSDA 1T71A 2IAEC 3H66A 3TGHA 5JJTA 3H60A 4ZVZA 4WWLA 1OIEA 4H2FA 2WDEA 5IOHA 2WDFA 3PSOA 2XMOA 4V0VA 5DNYA 1HPUA 3K7VC 2NPPC 4JA9A 1QFCA 3V4YA 1U32A 4ZX2A 2BQ8X 2ZO9B 2Z06A 3E0JA 3E7AA 4TUIA 3P71C 4G9JA 3PSNA 1WAO1 3RL5A 4ORBA 4LACC 1WARA 1AUIA 1XZWA 2Q8UA 1XM7A 4HD0A 4JA7A 1Z2WA 2O8GA 3HVQA 4H1YP 2R17A 4XPNA 4DT2A 4NZVA 1HO5A 3IVEA 4O24A 2USHA 4FBKA 3N5UA 4V0XA 4FBQA 2DXLA 4ORAA 5JPEA 3E7BA 4ORCA 4KBPA 4O5GA 5J28A 3IB8A 3RQZA 4Q7FA 4DHLA 2KKNA 3H67A 2ZBMA 4TUGA 2NYLC 1FJMA 3T1IA 4I5LC 2BDXA 2IE3C 2CV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V73 A;  4O43 A;  3THN A;  1W24 A;  3IB7 A;  4UT3 A;  3H68 A;  3IVD A;  1MF8 A;  3CK2 A;  1HP1 A;  4H1S A;  4UT3 B;  1S3N A;  4H2B A;  3THO B;  3LL8 A;  3QG5 C;  2HYO A;  1IT6 A;  2QJC A;  4LU9 A;  4FCX A;  4UWQ A;  2WDC A;  5GTU A;  4J6O A;  3DSC A;  2YVT A;  4UT2 A;  4OR9 A;  1KBP A;  1M63 A;  3FGA C;  4FBW A;  1OI8 A;  1Z2X A;  4I5N C;  3KBP A;  4KKZ A;  5JPF A;  3ZTV A;  2NYM C;  2IE4 C;  3AUZ A;  3ZU0 A;  4IYP C;  3H63 A;  5F3W A;  3ICF A;  4DSY A;  1QHW A;  3K7W C;  1S3M A;  3H62 B;  3QFK A;  3H64 A;  5EQV A;  1USH A;  3QFN A;  1TCO A;  3QFO A;  1UF3 A;  2WDD A;  3EGH A;  5B8I A;  4O4K A;  3C9F A;  3AV0 A;  2Z72 A;  3H69 A;  2Z1A A;  2JOG A;  2BCD A;  1S8E A;  4LTY A;  5INB A;  4H2I A;  4MP0 A;  1S70 A;  1JK7 A;  4B2O A;  2GJU A;  1OID A;  4MOV A;  3RL3 A;  1T70 A;  4MOY A;  1G5B A;  2P6B A;  1SU1 A;  4IL1 A;  4F0Z A;  2HYP A;  4V0W A;  3EGG A;  2O8A A;  2QFP A;  3DW8 C;  4H2G A;  5HPE A;  2HY1 A;  3JYF A;  1II7 A;  1UTE A;  2AHD A;  4YKE A;  1S95 A;  5C1V A;  3GVE A;  1NNW A;  3RL4 A;  4M0V A;  2A22 A;  2DFJ A;  3C5W C;  2QFR A;  3H61 A;  2NXF A;  1S3L A;  3QFM A;  3TGH A;  1T71 A;  2IAE C;  3H66 A;  5JJT A;  3DSD A;  3H60 A;  4ZVZ A;  4WWL A;  1OIE A;  4H2F A;  2WDE A;  5IOH A;  2WDF A;  3PSO A;  2XMO A;  4V0V A;  5DNY A;  1HPU A;  3K7V C;  2NPP C;  4JA9 A;  1QFC A;  3V4Y A;  1U32 A;  4ZX2 A;  2BQ8 X;  4TUI A;  2Z06 A;  3E7A A;  3P71 C;  4G9J A;  3PSN A;  1WAO 1;  3RL5 A;  4ORB A;  4LAC C;  1WAR A;  1AUI A;  1XZW A;  2Q8U A;  1XM7 A;  4HD0 A;  4JA7 A;  1Z2W A;  2O8G A;  3HVQ A;  4H1Y P;  2R17 A;  4XPN A;  4DT2 A;  4NZV A;  1HO5 A;  3IVE A;  4O24 A;  2USH A;  4FBK A;  3N5U A;  4V0X A;  4FBQ A;  4ORA A;  5JPE A;  3E7B A;  4ORC A;  4KBP A;  4O5G A;  5J28 A;  3IB8 A;  3RQZ A;  4Q7F A;  4DHL A;  2KKN A;  3H67 A;  2ZBM A;  4TUG A;  2NYL C;  1FJM A;  3T1I A;  4I5L C;  2BDX A;  2IE3 C;  2CV9 A; 
#chains in the Genus database with same CATH topology
 4JI8 E;  5AE3 A;  2EOE A;  2LJH A;  1J26 A;  1MF8 A;  1DQ3 A;  1Z1B A;  1N33 E;  4JI4 E;  1HP1 A;  1T4O A;  2UUC E;  4H2B A;  1SR9 A;  3K6Q A;  2F4V E;  1UN6 B;  4KZS A;  2DXN A;  2EOO A;  2GHF A;  3LL8 A;  1IQS A;  2ADR A;  4JV5 E;  4FCX A;  5GTU A;  2KOU A;  2YVT A;  4N4R B;  4OR9 A;  3ADG A;  1M63 A;  3FGA C;  2EM5 A;  1OI8 A;  2BBG A;  4DV4 E;  2HJJ A;  2JVA A;  2EPP A;  2JXP A;  5IV8 B;  4KKZ A;  5JPF A;  3ZTV A;  4NXM E;  2YWQ A;  1A1F A;  2IE4 C;  3AUZ A;  2NYM C;  2VQE E;  1WXR A;  3H63 A;  4R2A A;  2YRK A;  2JOB A;  3H62 B;  3QFK A;  3C4B A;  3BID A;  1FKA E;  4BHC A;  2DGC A;  2A25 A;  3EQ1 A;  2EN3 A;  4BCA A;  3AV0 A;  2Z72 A;  3BF2 A;  3H69 A;  2EMW A;  2YEQ A;  3FLO A;  1T38 A;  3HQ1 A;  4LTY A;  2MKN A;  4MP0 A;  2LCE A;  2EOF A;  1X49 A;  1YYW A;  4R2Q A;  1A1G A;  2EQ1 A;  4WXC A;  2LUP B;  4IL1 A;  1X48 A;  2DRP A;  2O8A A;  3J7A G;  2QFP A;  3FIG A;  2EPR A;  4GKK E;  2EPA A;  4R03 A;  3DW8 C;  2HY1 A;  2EOS A;  2EPX A;  2DLQ A;  2VE7 C;  1DI2 A;  2LT7 A;  1UHZ A;  1RC7 A;  1ZU1 A;  1TN9 A;  2I13 A;  3RL4 A;  1IQO A;  4BBY A;  2QFR A;  3H61 A;  2WCC 3;  1IBL E;  3TQM A;  4LFC E;  4NHR A;  1JK2 A;  3J81 C;  2IAE C;  3H66 A;  5JJT A;  2M4I A;  2DB2 A;  2WDE A;  5IOH A;  2YTQ A;  2WDF A;  2RSM A;  2F8B A;  2NUF A;  1QU6 A;  2B9D A;  4AQY E;  1IMU A;  1QFC A;  2HC5 A;  2ZO9 B;  4ZX2 A;  4DV6 E;  4M30 A;  3P71 C;  1WAO 1;  3RL5 A;  5ADZ A;  1WAR A;  3OML A;  1XZW A;  2LJU A;  2B3T B;  1ZR9 A;  3BGH A;  5IXM B;  3IWB A;  4ZYD A;  4X9J A;  2L2N A;  2L92 A;  2EOQ A;  3H09 A;  2R17 A;  5AAS A;  4RH8 A;  2B7V A;  2LRS A;  4RHB B;  2DSY A;  3T1H E;  3IVE A;  2EPM X;  4O24 A;  2KON A;  2GLI A;  3C4T A;  4ORA A;  1KJK A;  5JPE A;  1N34 E;  3E7B A;  4O5G A;  4ZYE A;  5J28 A;  4R2D A;  3RQZ A;  2EPZ A;  2L2M A;  4P7D A;  2UXB E;  3H67 A;  4DHL A;  2EMF A;  4MLV A;  2YTD A;  4BHB A;  2NYL C;  4DR4 E;  4OX9 E;  1B69 A;  4O43 A;  2V85 A;  2JOX A;  2V88 A;  3H68 A;  4K0K E;  3CK2 A;  1AAY A;  1X6E A;  2GPI A;  3BBG A;  3QG5 C;  4JI5 E;  2EMH A;  4UWQ A;  4L5N C;  3DSC A;  2EOI A;  4UT2 A;  1PKP A;  3MHS C;  3C6K A;  1KBP A;  2V86 A;  1FJG E;  4R2R A;  2YRH A;  1JK1 A;  2HGH A;  2JYA A;  2LV2 A;  4X66 E;  1IBM E;  4JYA E;  4DR5 E;  4DV7 E;  2NUE A;  1S3M A;  1J5E E;  4WXD A;  2EJ4 A;  2YSP A;  3H64 A;  4YY3 E;  1G2F C;  1KYQ A;  4KHP E;  1YPN A;  2EE8 A;  1UF3 A;  3C9F A;  2EMX A;  2CT1 A;  3EPK A;  2RSI A;  4B3M E;  2Z1A A;  3VYY A;  3ADI A;  2YRM A;  2BCD A;  2I9I A;  5A2Q C;  4R2E A;  1ZBT A;  2N3G A;  1JK7 A;  4JI0 E;  4R2S A;  1OID A;  4GEQ B;  1YZ9 A;  2LMZ A;  1G5B A;  2P6B A;  1SU1 A;  4BS9 A;  2ODR C;  2DMI A;  2EN6 A;  4F0Z A;  2NAB A;  5KL3 A;  2EML A;  2EOY A;  2R1F A;  2EQ0 A;  4WPY A;  4DR1 E;  2D9H A;  1GZ6 A;  2H36 X;  2ELY A;  1WRJ A;  3J80 C;  3D03 A;  4H2G A;  5HPE A;  3F6G A;  1ZBQ A;  3IWD A;  2IHR 1;  3GVE A;  4M0V A;  5A6J A;  4DR6 E;  3C5W C;  1PJT A;  1S3L A;  1X3C A;  3QFM A;  2EPK X;  3TGH A;  2M1S A;  2LUQ A;  2DLK A;  4R2P A;  4ZVZ A;  1X47 A;  4YHH E;  4H2F A;  4MLQ A;  5LMU E;  1T4L B;  4M2Z A;  5AC5 A;  2NPP C;  3V4Y A;  2RS6 A;  1U32 A;  3JU0 A;  2VQF E;  2EWL A;  4G9J A;  4WX9 A;  1AUI A;  1GTK A;  1BBG A;  1XM7 A;  2EPO A;  4JA7 A;  2YPN A;  2O8G A;  2JR1 A;  4ZYG A;  2CPN A;  4XPN A;  4NZV A;  1N36 E;  1HO5 A;  1T39 A;  4HEI A;  1HNZ E;  4LFA E;  1HNX E;  1N32 E;  4JI6 E;  5KL5 A;  2WBS A;  4KBP A;  2LVH A;  2UU9 E;  4DV2 E;  2EM7 A;  2RPC A;  4DV5 E;  2JP9 A;  2ZBM A;  2ENH A;  2E1M A;  3T1I A;  4I5L C;  1RQ0 A;  2RS7 A;  2FTX B;  2CV9 A;  2YTG A;  3THN A;  2WBT A;  3IVD A;  4LF5 E;  3LML A;  5LL6 R;  4UT3 B;  1S3N A;  1YYK A;  2EMC A;  3THO B;  4DR2 E;  4I8O A;  4LF4 E;  2EOZ A;  2WDC A;  2V8Q B;  1EH8 A;  2ODR D;  4FK5 C;  4J6O A;  4LF6 E;  2YZT A;  4DMI A;  2EPN A;  5KL2 A;  3EPH A;  2EN7 A;  4FBW A;  4DR7 E;  1PJS A;  1A1K A;  3KZY A;  3KBP A;  2EL6 A;  1HR0 E;  2FV4 B;  2V89 A;  2EQ3 A;  2WBU A;  2VRD A;  2L3J A;  3ZU0 A;  4IYP C;  1PJQ A;  4DSY A;  4Q35 B;  1QHW A;  3M99 B;  1A1J A;  2EMG A;  1USH A;  3QFN A;  2MDR A;  1TCO A;  2ELZ A;  2WDD A;  3MSW A;  5AE1 A;  3LLH A;  4B3T E;  2JOG A;  1NCS A;  1X6H A;  4H2I A;  3C6M A;  4LF9 E;  1EKZ A;  2YU8 A;  2NA2 A;  3RL3 A;  2YT4 A;  4MOY A;  3T1Y E;  2CSH A;  2EMY A;  4X62 E;  3UK3 C;  1YFH A;  2L6M A;  1WJP A;  2G7H A;  2V83 A;  4OOG C;  3EGG A;  4P78 A;  2MC5 A;  4F2J C;  2E72 A;  2L33 A;  2JPA A;  1EH7 A;  2FGG A;  3JYF A;  4F9A B;  5CFF E;  3L00 A;  1II7 A;  1LLM C;  1MEY C;  2EMK A;  5A6K A;  1NNW A;  2EOH A;  3IWC A;  2KHX A;  3DJW A;  3P1X A;  2V87 A;  5AC4 A;  4B3R E;  1BBO A;  2A22 A;  4JI3 E;  2EP3 A;  2ZOA A;  5IT9 C;  4B3S E;  4X8W A;  1T71 A;  2EN8 A;  3ADJ A;  4DKK A;  2MKD A;  4DUY E;  3H60 A;  4KWY A;  4WSG A;  1UBD C;  4DR3 E;  5A6B D;  2EZ6 A;  5DNY A;  1F2I G;  1HPU A;  2HHH E;  3K7V C;  2L8T A;  2R76 A;  2MDG A;  2Z06 A;  2EOM A;  2E5L E;  3PSN A;  3VK6 A;  4F9C B;  2Q8U A;  4R8O A;  4HD0 A;  5KL6 A;  1Z2W A;  2NUG A;  2EMZ A;  4F6N A;  4DT2 A;  5FLX C;  2EM6 A;  2JY9 A;  2EN4 A;  5KL7 A;  4FBK A;  3N5U A;  3RMP A;  3ADL A;  2YU5 A;  4ORC A;  1A1I A;  2EMB A;  1XMQ E;  2J7J A;  1X5W A;  4BC9 A;  2EL5 A;  4Q7F A;  4WSP A;  1X6F A;  4F9B B;  3ECR A;  4TUG A;  1FJM A;  2N8X A;  3HTX A;  1V73 A;  2YSO A;  5LMN E;  1W24 A;  3IB7 A;  2EL4 A;  1TF6 A;  4UT3 A;  3KZZ A;  2YTE A;  4DV1 E;  4H1S A;  4DV0 E;  2LE2 A;  2UXD E;  2HYO A;  4LU9 A;  1IT6 A;  2QJC A;  2EPU A;  1GQE A;  5A6B A;  4GZN C;  2EN1 A;  1DGC A;  1G2D C;  1NEI A;  1WHN A;  1A1H A;  1PDA A;  3F6H A;  1Z2X A;  4I5N C;  1L4S A;  1STU A;  4M9V C;  1N3G A;  3HPS A;  3EPJ A;  4F54 A;  3JTZ A;  5F3W A;  2N3H A;  3DF6 A;  2LBS B;  4BMJ A;  3ICF A;  2UUA E;  3K7W C;  2DMY A;  4F6M A;  1P47 A;  5EQV A;  3HPZ A;  3JAM C;  4LFB E;  1TF3 A;  1A1L A;  3QFO A;  1RMD A;  3EGH A;  5B8I A;  4O4K A;  3VHT B;  1O0W A;  2EOJ A;  4ZYH A;  2UXC E;  4LF7 E;  4JI1 E;  1T4N A;  1I94 E;  1ZAA C;  1S8E A;  5INB A;  5TSE A;  4DV3 E;  1UIL A;  1S70 A;  4J8Z A;  1BB8 A;  2LTR A;  4R2C A;  4B2O A;  2GJU A;  2RTX A;  2CTD A;  2M7Q A;  4MOV A;  2K7I A;  4WFT A;  5LLQ A;  4JI2 E;  1T70 A;  2EMI A;  2K4V A;  5A6A A;  3EPL A;  2WZO A;  2YTI A;  5AE2 A;  2HYP A;  4V0W A;  4IJD A;  4BC7 A;  2EM3 A;  1YUJ A;  1XNR E;  5KL4 A;  2YTO A;  2JWO A;  2VF1 A;  1UTE A;  3OTO E;  2AHD A;  2EM9 A;  2EM0 A;  3MHH C;  2EOR A;  5IWA E;  1S95 A;  4YKE A;  2DFJ A;  5C1V A;  1YSA C;  2NXF A;  1IBK E;  2ENA A;  3DSD A;  4HTG A;  1YUI A;  5A69 A;  1WHQ A;  4X65 E;  4WWL A;  1OIE A;  5BR8 E;  2PRT A;  3J7Y p;  1MGT A;  1HNW E;  5T6J A;  4Q28 A;  3PSO A;  2EM2 A;  2XMO A;  1AH5 A;  4V0V A;  2BB8 A;  2RQL A;  2EPL X;  2LTS A;  2UUB E;  4DUZ E;  4JA9 A;  2YTN A;  2L2K B;  2MC6 A;  2ZM6 E;  4TUI A;  2BQ8 X;  3E0J A;  3E7A A;  2YTF A;  4NXN E;  1QNT A;  3HXL A;  2ENC A;  4IS1 C;  3VYX A;  4ORB A;  4LAC C;  4L8N A;  3ZOQ B;  2DIX A;  3HVQ A;  4H1Y P;  2EM4 A;  4JI7 E;  2EM8 A;  4WYQ B;  3KWR A;  2YTP A;  1XMO E;  4LF8 E;  2USH A;  2EMA A;  2EOX A;  4V0X A;  4FBQ A;  1SFE A;  1EH6 A;  2DXL A;  1YYO A;  2YTJ A;  2L3C A;  4GKJ E;  2LO3 A;  1XNQ E;  3IB8 A;  2M9A A;  2B7T A;  2KKN A;  4X64 E;  2EN2 A;  2EPC A;  2BDX A;  2IE3 C; 
#chains in the Genus database with same CATH homology
 1V73 A;  4O43 A;  3THN A;  1W24 A;  3IB7 A;  4UT3 A;  3H68 A;  3IVD A;  1MF8 A;  3CK2 A;  1HP1 A;  4H1S A;  4UT3 B;  1S3N A;  4H2B A;  3THO B;  2DXN A;  3QG5 C;  3LL8 A;  2HYO A;  1IT6 A;  2QJC A;  4LU9 A;  4FCX A;  4UWQ A;  2WDC A;  5GTU A;  3DSC A;  4J6O A;  2YVT A;  4UT2 A;  4OR9 A;  1KBP A;  1M63 A;  3FGA C;  4FBW A;  1OI8 A;  1Z2X A;  4I5N C;  3KBP A;  4KKZ A;  5JPF A;  3ZTV A;  2NYM C;  2IE4 C;  3AUZ A;  3ZU0 A;  4IYP C;  3H63 A;  5F3W A;  3ICF A;  4DSY A;  1QHW A;  3K7W C;  1S3M A;  3H62 B;  3QFK A;  3H64 A;  5EQV A;  1USH A;  3QFN A;  1TCO A;  3QFO A;  1UF3 A;  2WDD A;  3EGH A;  5B8I A;  4O4K A;  3C9F A;  3AV0 A;  2Z72 A;  3H69 A;  2Z1A A;  2JOG A;  2YEQ A;  3FLO A;  2BCD A;  1S8E A;  4LTY A;  5INB A;  4H2I A;  4MP0 A;  1S70 A;  1JK7 A;  4B2O A;  2GJU A;  1OID A;  4MOV A;  3RL3 A;  1T70 A;  4MOY A;  1G5B A;  2P6B A;  1SU1 A;  4IL1 A;  4F0Z A;  2HYP A;  4V0W A;  3EGG A;  2O8A A;  2QFP A;  3D03 A;  3DW8 C;  4H2G A;  5HPE A;  2HY1 A;  3JYF A;  1II7 A;  1UTE A;  2AHD A;  4YKE A;  1S95 A;  5C1V A;  3GVE A;  1NNW A;  3RL4 A;  4M0V A;  2A22 A;  2DFJ A;  3C5W C;  2QFR A;  3H61 A;  2NXF A;  1S3L A;  3QFM A;  2ZOA A;  3DSD A;  1T71 A;  2IAE C;  3H66 A;  3TGH A;  5JJT A;  3H60 A;  4ZVZ A;  4WWL A;  1OIE A;  4H2F A;  2WDE A;  5IOH A;  2WDF A;  3PSO A;  2XMO A;  4V0V A;  5DNY A;  1HPU A;  3K7V C;  2NPP C;  4JA9 A;  1QFC A;  3V4Y A;  1U32 A;  4ZX2 A;  2BQ8 X;  2ZO9 B;  2Z06 A;  3E0J A;  3E7A A;  4TUI A;  3P71 C;  4G9J A;  3PSN A;  1WAO 1;  3RL5 A;  4ORB A;  4LAC C;  1WAR A;  1AUI A;  1XZW A;  2Q8U A;  1XM7 A;  4HD0 A;  4JA7 A;  1Z2W A;  2O8G A;  3HVQ A;  4H1Y P;  2R17 A;  4XPN A;  4DT2 A;  4NZV A;  1HO5 A;  3IVE A;  4O24 A;  2USH A;  4FBK A;  3N5U A;  4V0X A;  4FBQ A;  2DXL A;  4ORA A;  5JPE A;  3E7B A;  4ORC A;  4KBP A;  4O5G A;  5J28 A;  3IB8 A;  3RQZ A;  4Q7F A;  4DHL A;  2KKN A;  3H67 A;  2ZBM A;  4TUG A;  2NYL C;  1FJM A;  3T1I A;  4I5L C;  2BDX A;  2IE3 C;  2CV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...