3THNA

Crystal structure of mre11 core with manganese
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
319
structure length
313
Chain Sequence
MKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNQDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDSCRNFPGYVRVVYEEDSLPDLMGEIDNLVKIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP driven structural changes of the bacterial Mre11:Rad50 catalytic head complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Exonuclease, putative
total genus 104
structure length 313
sequence length 319
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 3thnA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3thnA01
3H68A 2QJCA 4IL1A 5GTUA 4DHLA 1AUIA 3DSCA 4ORBA 3H66A 2AHDA 2Z1AA 1XM7A 5B8IA 1IT6A 1S3MA 4TUGA 2IE4C 3IVEA 5C1VA 1HP1A 2WDCA 4UWQA 2BDXA 3C5WC 4ORCA 1WARA 3DW8C 4H2GA 1KBPA 4ZVZA 2CV9A 2P6BA 5JJTA 1OI8A 3K7WC 2NXFA 5J28A 1HO5A 3THOB 1UTEA 2XMOA 1V73A 4B2OA 2WDDA 3ICFA 1HPUA 3FGAC 3IB8A 2JOGA 4Q7FA 4YKEA 4I5NC 1QHWA 1USHA 4F0ZA 1UF3A 3H61A 2HY1A 1JK7A 2HYOA 3H64A 1S95A 3V4YA 4HD0A 3GVEA 1W24A 3H62B 3T1IA 1QFCA 1OIEA 4LTYA 3DSDA 3JYFA 2DFJA 4DSYA 1T70A 2QFRA 2YVTA 4H2BA 4FCXA 4NZVA 4DT2A 4H1SA 1WAO1 4MOVA 1Z2XA 3IB7A 5JPEA 2O8AA 4LU9A 3C9FA 3K7VC 1MF8A 1Z2WA 2Z06A 4WWLA 2BQ8X 2NYLC 3RL3A 1FJMA 4FBWA 4UT3A 4JA7A 3H63A 4H2IA 1NNWA 3P71C 2ZBMA 1XZWA 3E7AA 4FBKA 3AUZA 3QFMA 3EGGA 2IAEC 4M0VA 4UT2A 4UT3B 4O43A 1II7A 2QFPA 4O4KA 2WDFA 4J6OA 3RL5A 2WDEA 2GJUA 1TCOA 5HPEA 2USHA 2O8GA 4O5GA 1T71A 2NYMC 2HYPA 2A22A 4I5LC 1S70A 4FBQA 4ORAA 4H2FA 4XPNA 3EGHA 2IE3C 1SU1A 3QFNA 3H67A 2Q8UA 2R17A 3KBPA 1S3LA 2KKNA 3H60A 4V0VA 2Z72A 3RQZA 5JPFA 3QFOA 5EQVA 3RL4A 3H69A 3THNA 4V0XA 3TGHA 5F3WA 1G5BA 4JA9A 4KBPA 2NPPC 3HVQA 5DNYA 4MP0A 3ZTVA 3LL8A 4ZX2A 3QG5C 1U32A 4G9JA 4TUIA 4O24A 3E7BA 4OR9A 4V0WA 4KKZA 1S3NA 3CK2A 1M63A 3PSNA 4LACC 5IOHA 4H1YP 3QFKA 3IVDA 1OIDA 3N5UA 4IYPC 3PSOA 3ZU0A 4MOYA 5INBA 1S8EA 3AV0A 2BCDA
chains in the Genus database with same CATH superfamily
2EL6A 2EM3A 3H68A 2RSMA 1A1KA 4ORBA 3DSCA 3BF2A 3BIDA 5B8IA 3D03A 2EOFA 3L00A 4Q28A 2WBSA 3VHTB 2E5LE 1HP1A 2WDCA 4R2SA 2BDXA 2EMXA 3C5WC 4X66E 1P47A 2EOSA 1N32E 1A1LA 1KBPA 4H2GA 4ZVZA 2LCEA 2P6BA 1OI8A 1IBME 3MSWA 4R8OA 1HO5A 1O0WA 3HTXA 1IMUA 3KZYA 3T1HE 2V85A 2EMIA 2FTXB 5AC4A 2F4VE 2V88A 3IB8A 3JU0A 2EM9A 4DV6E 2EOHA 5KL3A 4F9BB 2DRPA 1JK2A 2EN7A 1USHA 2HC5A 1TF6A 2ZOAA 1YYWA 3H64A 4R2CA 4R2EA 2L3JA 2HGHA 2MDRA 1JK7A 4HD0A 3GVEA 1W24A 3EPKA 3H62B 2L8TA 1A1JA 4X64E 4JI3E 1HNWE 4DSYA 1XMOE 2EL4A 1T70A 2DXLA 2EN2A 4AQYE 4X8WA 2DB2A 2K4VA 2IHR1 2D9HA 1UILA 1EKZA 1YUIA 1Z2WA 1ZBQA 3RL3A 3ADJA 2YSOA 4R2PA 4JA7A 3VK6A 2A25A 2YTJA 3E7AA 1BBGA 4M0VA 2IAEC 3EGGA 3DJWA 1FKAE 3QFMA 4O4KA 4DR4E 4J6OA 2EPNA 2WDEA 2EQ0A 4DV4E 5A6AA 5HPEA 4KHPE 1SR9A 3OMLA 2O8GA 2EPLX 2RSIA 4Q35B 2HYPA 4L8NA 3OTOE 4I5LC 4F6NA 3M99B 4ORAA 1YYKA 1UBDC 3ADIA 1N33E 2M9AA 4XPNA 5TSEA 2EMFA 3EGHA 1SU1A 3H67A 2Q8UA 1F2IG 1YZ9A 3RMPA 1HR0E 5LL6R 2DMYA 1X49A 2KKNA 2GLIA 4GZNC 1X6HA 2Z72A 1NCSA 3RQZA 2EPOA 3H69A 4LF4E 2NUFA 4KBPA 2V8QB 2JR1A 5DNYA 1G2FC 2ZO9B 1HNZE 2EE8A 3T1YE 2UXBE 4OX9E 4ZX2A 2KHXA 1ZR9A 4TUIA 2VRDA 2EL5A 1IBLE 1DI2A 4JI8E 1S3NA 2LO3A 4LACC 2YTIA 3QFKA 3IVDA 2EOEA 2L6MA 4IYPC 4MOYA 4J8ZA 3EPLA 2EMLA 2JP9A 5AE2A 3DF6A 1X3CA 4BBYA 4IL1A 2MDGA 2EPRA 2VF1A 5BR8E 1X6EA 5CFFE 2AHDA 2UXCE 4WPYA 3LLHA 1YYOA 2VQFE 3EPJA 3IVEA 5C1VA 2ZM6E 4UWQA 2EZ6A 2M4IA 4ORCA 2EPZA 1WARA 4BC9A 2MC6A 1LLMC 2ENCA 2CV9A 2LJUA 3J80C 1A1GA 5KL7A 2NXFA 5J28A 2EM8A 3P1XA 1UTEA 2XMOA 2EPPA 2MKNA 2UXDE 2MKDA 2WDDA 2UU9E 3FGAC 2EMZA 2JOGA 4F2JC 1YSAC 4I5NC 1N3GA 2YTDA 1KJKA 4F0ZA 5IV8B 3TQMA 4DR5E 4DMIA 4X9JA 4JI5E 2HY1A 2HYOA 3HPSA 2EQ3A 5AASA 3BGHA 4LFCE 3EQ1A 1DQ3A 1WHQA 1JK1A 1OIEA 2EQ1A 5A6BD 3JYFA 2DXNA 2EMKA 2YTEA 1RMDA 2ELZA 2DFJA 2QFRA 5A6BA 4FCXA 1BB8A 2YEQA 2EM0A 2EPMX 5JPEA 1Z2XA 4LFBE 2O8AA 2DIXA 3C9FA 3K7VC 1MF8A 2Z06A 1WXRA 4JV5E 4FBWA 5KL2A 2ZBMA 5T6JA 4UT3B 3FLOA 4UT2A 1IQSA 3JTZA 2QFPA 3RL5A 4YY3E 4B3RE 5IXMB 4F6MA 2USHA 3ZOQB 2K7IA 1T4NA 4O5GA 4MLQA 1TN9A 2A22A 5KL5A 2EOZA 4K0KE 2KONA 4NXNE 2R1FA 2YU5A 3MHHC 2EMWA 3ADLA 1QU6A 2JYAA 3QFNA 2UUCE 3KBPA 4JI4E 5KL6A 2NUGA 2EN1A 2ODRC 2DMIA 4V0VA 4DR7E 5JPFA 3QFOA 4DKKA 3UK3C 3THNA 4V0XA 2V83A 1YUJA 2I13A 4LF9E 2CPNA 2YRMA 2BBGA 2EM6A 2V86A 3HVQA 4MP0A 1X5WA 3LL8A 1YFHA 4G9JA 1HNXE 3F6GA 4DUZE 2EN4A 4GKJE 5LLQA 4OR9A 2EMCA 1GTKA 4KKZA 3CK2A 2GPIA 4NXME 1IBKE 4B3TE 1OIDA 2H36X 2EM5A 3PSOA 3ZU0A 2JOBA 2ODRD 5INBA 4YKEA 4H2FA 4DV0E 2BCDA 2WZOA 2LRSA 2QJCA 3HQ1A 5GTUA 4DHLA 2JXPA 1AUIA 1NEIA 2FV4B 3H66A 1AAYA 2Z1AA 4BHCA 2EN8A 5ADZA 2EN3A 5AC5A 2L2NA 1XNRE 1IT6A 1S3MA 2LVHA 2IE4C 2EOYA 2FGGA 2YTNA 1XNQE 2EN6A 2LMZA 2NABA 2JWOA 3K7WC 1RC7A 4YHHE 3THOB 3JAMC 1ZU1A 5AE1A 1V73A 4B2OA 1HPUA 1N36E 2RPCA 4Q7FA 5IWAE 2EPXA 2LBSB 1QHWA 2B3TB 2B7VA 1GZ6A 2F8BA 1UF3A 3H61A 2VQEE 3BBGA 1S95A 1MGTA 2DLKA 2EM2A 2YTFA 4JYAE 2V89A 1QFCA 2RS6A 4DV3E 3J7Yp 4P78A 1T4OA 1A1FA 4F54A 2G7HA 2JY9A 2V87A 2LTSA 2YT4A 2YVTA 3F6HA 4NZVA 4DR6E 4R2DA 4DV2E 5IT9C 4M30A 1WAO1 1T39A 4MOVA 2L3CA 1A1IA 3ECRA 4DV5E 4LU9A 2UUAE 4UT3A 2CSHA 4WWLA 4FK5C 2BQ8X 1STUA 1FJMA 4R03A 3H63A 2RS7A 4H2IA 1NNWA 3P71C 1XZWA 4GEQB 2EWLA 2LT7A 1PJQA 4DV7E 2EOJA 4I8OA 1BBOA 1TCOA 4DR2E 4IJDA 1T71A 1PJTA 2EM4A 2NYMC 4RH8A 4NHRA 5LMUE 1S70A 4OOGC 4LF8E 2YRHA 2PRTA 4ZYDA 5A69A 1B69A 3K6QA 1T38A 1X47A 1J26A 4L5NC 5FLXC 3VYYA 4BHBA 1Z1BA 1QNTA 2E1MA 2B7TA 4DR3E 3H60A 1AH5A 2N3GA 2DSYA 2WBTA 2LE2A 3MHSC 1IQOA 2L92A 3RL4A 2CTDA 5F3WA 3TGHA 4JA9A 1A1HA 2B9DA 1N34E 2NPPC 2WBUA 4HTGA 2M7QA 2L2KB 4M2ZA 2LJHA 3QG5C 1U32A 3KZZA 2ADRA 2EMBA 4BC7A 4O24A 3E7BA 2EOMA 1WHNA 2EORA 1TF3A 4V0WA 4WXDA 1M63A 2DGCA 3PSNA 1SFEA 4BS9A 5IOHA 4H1YP 2NUEA 4WSGA 4P7DA 2YU8A 4ZYEA 4F9CB 4KZSA 4WX9A 3C4TA 4DT2A 3AV0A 2EMHA 2EM7A 1UN6B 2HJJA 3IWCA 4BCAA 4X62E 1XM7A 2LTRA 5A2QC 4TUGA 2NA2A 2EOQA 5KL4A 2JOXA 4N4RB 3DW8C 5LMNE 1J5EE 4JI2E 3H09A 2J7JA 5JJTA 1I94E 2L2MA 4R2AA 3J7AG 3C6MA 2UUBE 1DGCA 2WCC3 3C4BA 3IWDA 4F9AB 2YPNA 4DUYE 2EPAA 2GHFA 2ENAA 2R76A 1MEYC 3ICFA 3FIGA 3LMLA 4JI6E 2EPUA 4B3SE 3VYXA 2YSPA 2E72A 4JI0E 1KYQA 3V4YA 2MC5A 2CT1A 3IWBA 1WRJA 4KWYA 5AE3A 3T1IA 4LTYA 4WXCA 3DSDA 2EOXA 2YTQA 2LUQA 4GKKE 4H2BA 2YRKA 2YWQA 2EOIA 2LUPB 1G2DC 4H1SA 2N8XA 4HEIA 3IB7A 4ZYHA 2JPAA 1RQ0A 4WFTA 2KOUA 2YTOA 4WYQB 4DR1E 4M9VC 2NYLC 1GQEA 5A6JA 1X6FA 3ADGA 4JI1E 2EP3A 4B3ME 1X48A 4FBKA 3AUZA 2BB8A 4O43A 1II7A 2WDFA 4LF5E 2GJUA 2DLQA 4JI7E 2ELYA 2VE7C 1PJSA 2EMGA 2JVAA 2I9IA 4FBQA 2EPCA 1WJPA 2M1SA 1ZBTA 2IE3C 2EOOA 2YTPA 2R17A 1PDAA 4LF6E 1S3LA 2YZTA 4ZYGA 1EH7A 4R2QA 3KWRA 2EMAA 5EQVA 2EMYA 1T4LB 2L33A 2YTGA 1XMQE 1UHZA 4X65E 1G5BA 2ENHA 2EJ4A 3EPHA 1ZAAC 3J81C 1YPNA 2EPKX 3ZTVA 1FJGE 4MLVA 4LF7E 1EH8A 1EH6A 2LV2A 3C6KA 2RQLA 4DV1E 1L4SA 4LFAE 5A6KA 4BMJA 2RTXA 4RHBB 3HPZA 2N3HA 4IS1C 4WSPA 2HHHE 3N5UA 3HXLA 3E0JA 4R2RA 1PKPA 1S8EA
chains in the Genus database with same CATH topology
3H68A 2QJCA 4IL1A 5GTUA 4DHLA 1AUIA 3DSCA 4ORBA 3H66A 2AHDA 2Z1AA 1XM7A 5B8IA 1IT6A 1S3MA 3D03A 4TUGA 2IE4C 3IVEA 5C1VA 1HP1A 2WDCA 4UWQA 2BDXA 3C5WC 4ORCA 1WARA 3DW8C 4H2GA 1KBPA 4UT3B 4ZVZA 2CV9A 2P6BA 5JJTA 1OI8A 3K7WC 2NXFA 5J28A 1HO5A 3THOB 1UTEA 2XMOA 1V73A 4B2OA 2WDDA 3ICFA 1HPUA 3FGAC 3IB8A 2JOGA 4Q7FA 4YKEA 4I5NC 1QHWA 1USHA 4F0ZA 1UF3A 2ZOAA 3H61A 2HY1A 1JK7A 2HYOA 3H64A 1S95A 3V4YA 4HD0A 3GVEA 1W24A 3H62B 3T1IA 1QFCA 3DSDA 1OIEA 4LTYA 3JYFA 2DXNA 2DFJA 4DSYA 1T70A 2DXLA 2QFRA 2YVTA 4H2BA 4FCXA 4NZVA 4DT2A 4H1SA 1WAO1 2YEQA 4MOVA 1Z2XA 3IB7A 5JPEA 2O8AA 4LU9A 3C9FA 3K7VC 1MF8A 1Z2WA 2Z06A 4WWLA 2BQ8X 2NYLC 3RL3A 1FJMA 4FBWA 4UT3A 4JA7A 3H63A 4H2IA 1NNWA 3P71C 2ZBMA 1XZWA 3E7AA 3FLOA 3AUZA 3QFMA 3EGGA 2IAEC 4FBKA 4M0VA 4UT2A 1II7A 4O43A 2QFPA 4O4KA 2WDFA 4J6OA 3RL5A 2WDEA 2GJUA 1TCOA 5HPEA 2USHA 2O8GA 4O5GA 1T71A 2NYMC 2HYPA 2A22A 4I5LC 1S70A 4FBQA 4ORAA 4H2FA 4XPNA 3EGHA 2IE3C 1SU1A 3QFNA 3H67A 2Q8UA 2R17A 3KBPA 1S3LA 2KKNA 3H60A 4V0VA 2Z72A 3RQZA 5JPFA 3QFOA 5EQVA 3RL4A 3H69A 3THNA 4V0XA 3TGHA 5F3WA 1G5BA 4JA9A 4KBPA 2NPPC 3HVQA 5DNYA 2ZO9B 4MP0A 3ZTVA 3LL8A 4ZX2A 3QG5C 1U32A 4G9JA 4TUIA 4O24A 3E7BA 4OR9A 4V0WA 4KKZA 1S3NA 3CK2A 1M63A 3PSNA 4LACC 5IOHA 4H1YP 3QFKA 3IVDA 1OIDA 3N5UA 4IYPC 3PSOA 3ZU0A 4MOYA 5INBA 3E0JA 1S8EA 3AV0A 2BCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H68 A;  2QJC A;  4IL1 A;  5GTU A;  4DHL A;  1AUI A;  3DSC A;  4ORB A;  3H66 A;  2AHD A;  2Z1A A;  1XM7 A;  5B8I A;  1IT6 A;  1S3M A;  4TUG A;  2IE4 C;  3IVE A;  5C1V A;  1HP1 A;  2WDC A;  4UWQ A;  2BDX A;  3C5W C;  4ORC A;  1WAR A;  3DW8 C;  4H2G A;  1KBP A;  4ZVZ A;  2CV9 A;  2P6B A;  5JJT A;  1OI8 A;  3K7W C;  2NXF A;  5J28 A;  1HO5 A;  3THO B;  1UTE A;  2XMO A;  1V73 A;  4B2O A;  2WDD A;  3ICF A;  1HPU A;  3FGA C;  3IB8 A;  2JOG A;  4Q7F A;  4YKE A;  4I5N C;  1QHW A;  1USH A;  4F0Z A;  1UF3 A;  3H61 A;  2HY1 A;  1JK7 A;  2HYO A;  3H64 A;  1S95 A;  3V4Y A;  4HD0 A;  3GVE A;  1W24 A;  3H62 B;  3T1I A;  1QFC A;  1OIE A;  4LTY A;  3DSD A;  3JYF A;  2DFJ A;  4DSY A;  1T70 A;  2QFR A;  2YVT A;  4H2B A;  4FCX A;  4NZV A;  4DT2 A;  4H1S A;  1WAO 1;  4MOV A;  1Z2X A;  3IB7 A;  5JPE A;  2O8A A;  4LU9 A;  3C9F A;  3K7V C;  1MF8 A;  1Z2W A;  2Z06 A;  4WWL A;  2BQ8 X;  2NYL C;  3RL3 A;  1FJM A;  4FBW A;  4UT3 A;  4JA7 A;  3H63 A;  4H2I A;  1NNW A;  3P71 C;  2ZBM A;  1XZW A;  3E7A A;  4FBK A;  3AUZ A;  3QFM A;  3EGG A;  2IAE C;  4M0V A;  4UT2 A;  4UT3 B;  4O43 A;  1II7 A;  2QFP A;  4O4K A;  2WDF A;  4J6O A;  3RL5 A;  2WDE A;  2GJU A;  1TCO A;  5HPE A;  2USH A;  2O8G A;  4O5G A;  1T71 A;  2NYM C;  2HYP A;  2A22 A;  4I5L C;  1S70 A;  4FBQ A;  4ORA A;  4H2F A;  4XPN A;  3EGH A;  2IE3 C;  1SU1 A;  3QFN A;  3H67 A;  2Q8U A;  2R17 A;  3KBP A;  1S3L A;  2KKN A;  3H60 A;  4V0V A;  2Z72 A;  3RQZ A;  5JPF A;  3QFO A;  5EQV A;  3RL4 A;  3H69 A;  3THN A;  4V0X A;  3TGH A;  5F3W A;  1G5B A;  4JA9 A;  4KBP A;  2NPP C;  3HVQ A;  5DNY A;  4MP0 A;  3ZTV A;  3LL8 A;  4ZX2 A;  3QG5 C;  1U32 A;  4G9J A;  4TUI A;  4O24 A;  3E7B A;  4OR9 A;  4V0W A;  4KKZ A;  1S3N A;  3CK2 A;  1M63 A;  3PSN A;  4LAC C;  5IOH A;  4H1Y P;  3QFK A;  3IVD A;  1OID A;  3N5U A;  4IYP C;  3PSO A;  3ZU0 A;  4MOY A;  5INB A;  1S8E A;  3AV0 A;  2BCD A; 
#chains in the Genus database with same CATH topology
 2EL6 A;  2EM3 A;  3H68 A;  2RSM A;  1A1K A;  4ORB A;  3DSC A;  3BF2 A;  3BID A;  5B8I A;  3D03 A;  2EOF A;  3L00 A;  4Q28 A;  2WBS A;  3VHT B;  2E5L E;  1HP1 A;  2WDC A;  4R2S A;  2BDX A;  2EMX A;  3C5W C;  4X66 E;  1P47 A;  2EOS A;  1N32 E;  1A1L A;  1KBP A;  4H2G A;  4ZVZ A;  2LCE A;  2P6B A;  1OI8 A;  1IBM E;  3MSW A;  4R8O A;  1HO5 A;  1O0W A;  3HTX A;  1IMU A;  3KZY A;  3T1H E;  2V85 A;  2EMI A;  2FTX B;  5AC4 A;  2F4V E;  2V88 A;  3IB8 A;  3JU0 A;  2EM9 A;  4DV6 E;  2EOH A;  5KL3 A;  4F9B B;  2DRP A;  1JK2 A;  2EN7 A;  1USH A;  2HC5 A;  1TF6 A;  2ZOA A;  1YYW A;  3H64 A;  4R2C A;  4R2E A;  2L3J A;  2HGH A;  2MDR A;  1JK7 A;  4HD0 A;  3GVE A;  1W24 A;  3EPK A;  3H62 B;  2L8T A;  1A1J A;  4X64 E;  4JI3 E;  1HNW E;  4DSY A;  1XMO E;  2EL4 A;  1T70 A;  2DXL A;  2EN2 A;  4AQY E;  4X8W A;  2DB2 A;  2K4V A;  2IHR 1;  2D9H A;  1UIL A;  1EKZ A;  1YUI A;  1Z2W A;  1ZBQ A;  3RL3 A;  3ADJ A;  2YSO A;  4R2P A;  4JA7 A;  3VK6 A;  2A25 A;  2YTJ A;  3E7A A;  1BBG A;  4M0V A;  2IAE C;  3EGG A;  3DJW A;  1FKA E;  3QFM A;  4O4K A;  4DR4 E;  4J6O A;  2EPN A;  2WDE A;  2EQ0 A;  4DV4 E;  5A6A A;  5HPE A;  4KHP E;  1SR9 A;  3OML A;  2O8G A;  2EPL X;  2RSI A;  4Q35 B;  2HYP A;  4L8N A;  3OTO E;  4I5L C;  4F6N A;  3M99 B;  4ORA A;  1YYK A;  1UBD C;  3ADI A;  1N33 E;  2M9A A;  4XPN A;  5TSE A;  2EMF A;  3EGH A;  1SU1 A;  3H67 A;  2Q8U A;  1F2I G;  1YZ9 A;  3RMP A;  1HR0 E;  5LL6 R;  2DMY A;  1X49 A;  2KKN A;  2GLI A;  4GZN C;  1X6H A;  2Z72 A;  1NCS A;  3RQZ A;  2EPO A;  3H69 A;  4LF4 E;  2NUF A;  4KBP A;  2V8Q B;  2JR1 A;  5DNY A;  1G2F C;  2ZO9 B;  1HNZ E;  2EE8 A;  3T1Y E;  2UXB E;  4OX9 E;  4ZX2 A;  2KHX A;  1ZR9 A;  4TUI A;  2VRD A;  2EL5 A;  1IBL E;  1DI2 A;  4JI8 E;  1S3N A;  2LO3 A;  4LAC C;  2YTI A;  3QFK A;  3IVD A;  2EOE A;  2L6M A;  4IYP C;  4MOY A;  4J8Z A;  3EPL A;  2EML A;  2JP9 A;  5AE2 A;  3DF6 A;  1X3C A;  4BBY A;  4IL1 A;  2MDG A;  2EPR A;  2VF1 A;  5BR8 E;  1X6E A;  5CFF E;  2AHD A;  2UXC E;  4WPY A;  3LLH A;  1YYO A;  2VQF E;  3EPJ A;  3IVE A;  5C1V A;  2ZM6 E;  4UWQ A;  2EZ6 A;  2M4I A;  4ORC A;  2EPZ A;  1WAR A;  4BC9 A;  2MC6 A;  1LLM C;  2ENC A;  2CV9 A;  2LJU A;  3J80 C;  1A1G A;  5KL7 A;  2NXF A;  5J28 A;  2EM8 A;  3P1X A;  1UTE A;  2XMO A;  2EPP A;  2MKN A;  2UXD E;  2MKD A;  2WDD A;  2UU9 E;  3FGA C;  2EMZ A;  2JOG A;  4F2J C;  1YSA C;  4I5N C;  1N3G A;  2YTD A;  1KJK A;  4F0Z A;  5IV8 B;  3TQM A;  4DR5 E;  4DMI A;  4X9J A;  4JI5 E;  2HY1 A;  2HYO A;  3HPS A;  2EQ3 A;  5AAS A;  3BGH A;  4LFC E;  3EQ1 A;  1DQ3 A;  1WHQ A;  1JK1 A;  1OIE A;  2EQ1 A;  5A6B D;  3JYF A;  2DXN A;  2EMK A;  2YTE A;  1RMD A;  2ELZ A;  2DFJ A;  2QFR A;  5A6B A;  4FCX A;  1BB8 A;  2YEQ A;  2EM0 A;  2EPM X;  5JPE A;  1Z2X A;  4LFB E;  2O8A A;  2DIX A;  3C9F A;  3K7V C;  1MF8 A;  2Z06 A;  1WXR A;  4JV5 E;  4FBW A;  5KL2 A;  2ZBM A;  5T6J A;  4UT3 B;  3FLO A;  4UT2 A;  1IQS A;  3JTZ A;  2QFP A;  3RL5 A;  4YY3 E;  4B3R E;  5IXM B;  4F6M A;  2USH A;  3ZOQ B;  2K7I A;  1T4N A;  4O5G A;  4MLQ A;  1TN9 A;  2A22 A;  5KL5 A;  2EOZ A;  4K0K E;  2KON A;  4NXN E;  2R1F A;  2YU5 A;  3MHH C;  2EMW A;  3ADL A;  1QU6 A;  2JYA A;  3QFN A;  2UUC E;  3KBP A;  4JI4 E;  5KL6 A;  2NUG A;  2EN1 A;  2ODR C;  2DMI A;  4V0V A;  4DR7 E;  5JPF A;  3QFO A;  4DKK A;  3UK3 C;  3THN A;  4V0X A;  2V83 A;  1YUJ A;  2I13 A;  4LF9 E;  2CPN A;  2YRM A;  2BBG A;  2EM6 A;  2V86 A;  3HVQ A;  4MP0 A;  1X5W A;  3LL8 A;  1YFH A;  4G9J A;  1HNX E;  3F6G A;  4DUZ E;  2EN4 A;  4GKJ E;  5LLQ A;  4OR9 A;  2EMC A;  1GTK A;  4KKZ A;  3CK2 A;  2GPI A;  4NXM E;  1IBK E;  4B3T E;  1OID A;  2H36 X;  2EM5 A;  3PSO A;  3ZU0 A;  2JOB A;  2ODR D;  5INB A;  4YKE A;  4H2F A;  4DV0 E;  2BCD A;  2WZO A;  2LRS A;  2QJC A;  3HQ1 A;  5GTU A;  4DHL A;  2JXP A;  1AUI A;  1NEI A;  2FV4 B;  3H66 A;  1AAY A;  2Z1A A;  4BHC A;  2EN8 A;  5ADZ A;  2EN3 A;  5AC5 A;  2L2N A;  1XNR E;  1IT6 A;  1S3M A;  2LVH A;  2IE4 C;  2EOY A;  2FGG A;  2YTN A;  1XNQ E;  2EN6 A;  2LMZ A;  2NAB A;  2JWO A;  3K7W C;  1RC7 A;  4YHH E;  3THO B;  3JAM C;  1ZU1 A;  5AE1 A;  1V73 A;  4B2O A;  1HPU A;  1N36 E;  2RPC A;  4Q7F A;  5IWA E;  2EPX A;  2LBS B;  1QHW A;  2B3T B;  2B7V A;  1GZ6 A;  2F8B A;  1UF3 A;  3H61 A;  2VQE E;  3BBG A;  1S95 A;  1MGT A;  2DLK A;  2EM2 A;  2YTF A;  4JYA E;  2V89 A;  1QFC A;  2RS6 A;  4DV3 E;  3J7Y p;  4P78 A;  1T4O A;  1A1F A;  4F54 A;  2G7H A;  2JY9 A;  2V87 A;  2LTS A;  2YT4 A;  2YVT A;  3F6H A;  4NZV A;  4DR6 E;  4R2D A;  4DV2 E;  5IT9 C;  4M30 A;  1WAO 1;  1T39 A;  4MOV A;  2L3C A;  1A1I A;  3ECR A;  4DV5 E;  4LU9 A;  2UUA E;  4UT3 A;  2CSH A;  4WWL A;  4FK5 C;  2BQ8 X;  1STU A;  1FJM A;  4R03 A;  3H63 A;  2RS7 A;  4H2I A;  1NNW A;  3P71 C;  1XZW A;  4GEQ B;  2EWL A;  2LT7 A;  1PJQ A;  4DV7 E;  2EOJ A;  4I8O A;  1BBO A;  1TCO A;  4DR2 E;  4IJD A;  1T71 A;  1PJT A;  2EM4 A;  2NYM C;  4RH8 A;  4NHR A;  5LMU E;  1S70 A;  4OOG C;  4LF8 E;  2YRH A;  2PRT A;  4ZYD A;  5A69 A;  1B69 A;  3K6Q A;  1T38 A;  1X47 A;  1J26 A;  4L5N C;  5FLX C;  3VYY A;  4BHB A;  1Z1B A;  1QNT A;  2E1M A;  2B7T A;  4DR3 E;  3H60 A;  1AH5 A;  2N3G A;  2DSY A;  2WBT A;  2LE2 A;  3MHS C;  1IQO A;  2L92 A;  3RL4 A;  2CTD A;  5F3W A;  3TGH A;  4JA9 A;  1A1H A;  2B9D A;  1N34 E;  2NPP C;  2WBU A;  4HTG A;  2M7Q A;  2L2K B;  4M2Z A;  2LJH A;  3QG5 C;  1U32 A;  3KZZ A;  2ADR A;  2EMB A;  4BC7 A;  4O24 A;  3E7B A;  2EOM A;  1WHN A;  2EOR A;  1TF3 A;  4V0W A;  4WXD A;  1M63 A;  2DGC A;  3PSN A;  1SFE A;  4BS9 A;  5IOH A;  4H1Y P;  2NUE A;  4WSG A;  4P7D A;  2YU8 A;  4ZYE A;  4F9C B;  4KZS A;  4WX9 A;  3C4T A;  4DT2 A;  3AV0 A;  2EMH A;  2EM7 A;  1UN6 B;  2HJJ A;  3IWC A;  4BCA A;  4X62 E;  1XM7 A;  2LTR A;  5A2Q C;  4TUG A;  2NA2 A;  2EOQ A;  5KL4 A;  2JOX A;  4N4R B;  3DW8 C;  5LMN E;  1J5E E;  4JI2 E;  3H09 A;  2J7J A;  5JJT A;  1I94 E;  2L2M A;  4R2A A;  3J7A G;  3C6M A;  2UUB E;  1DGC A;  2WCC 3;  3C4B A;  3IWD A;  4F9A B;  2YPN A;  4DUY E;  2EPA A;  2GHF A;  2ENA A;  2R76 A;  1MEY C;  3ICF A;  3FIG A;  3LML A;  4JI6 E;  2EPU A;  4B3S E;  3VYX A;  2YSP A;  2E72 A;  4JI0 E;  1KYQ A;  3V4Y A;  2MC5 A;  2CT1 A;  3IWB A;  1WRJ A;  4KWY A;  5AE3 A;  3T1I A;  4LTY A;  4WXC A;  3DSD A;  2EOX A;  2YTQ A;  2LUQ A;  4GKK E;  4H2B A;  2YRK A;  2YWQ A;  2EOI A;  2LUP B;  1G2D C;  4H1S A;  2N8X A;  4HEI A;  3IB7 A;  4ZYH A;  2JPA A;  1RQ0 A;  4WFT A;  2KOU A;  2YTO A;  4WYQ B;  4DR1 E;  4M9V C;  2NYL C;  1GQE A;  5A6J A;  1X6F A;  3ADG A;  4JI1 E;  2EP3 A;  4B3M E;  1X48 A;  4FBK A;  3AUZ A;  2BB8 A;  4O43 A;  1II7 A;  2WDF A;  4LF5 E;  2GJU A;  2DLQ A;  4JI7 E;  2ELY A;  2VE7 C;  1PJS A;  2EMG A;  2JVA A;  2I9I A;  4FBQ A;  2EPC A;  1WJP A;  2M1S A;  1ZBT A;  2IE3 C;  2EOO A;  2YTP A;  2R17 A;  1PDA A;  4LF6 E;  1S3L A;  2YZT A;  4ZYG A;  1EH7 A;  4R2Q A;  3KWR A;  2EMA A;  5EQV A;  2EMY A;  1T4L B;  2L33 A;  2YTG A;  1XMQ E;  1UHZ A;  4X65 E;  1G5B A;  2ENH A;  2EJ4 A;  3EPH A;  1ZAA C;  3J81 C;  1YPN A;  2EPK X;  3ZTV A;  1FJG E;  4MLV A;  4LF7 E;  1EH8 A;  1EH6 A;  2LV2 A;  3C6K A;  2RQL A;  4DV1 E;  1L4S A;  4LFA E;  5A6K A;  4BMJ A;  2RTX A;  4RHB B;  3HPZ A;  2N3H A;  4IS1 C;  4WSP A;  2HHH E;  3N5U A;  3HXL A;  3E0J A;  4R2R A;  1PKP A;  1S8E A; 
#chains in the Genus database with same CATH homology
 3H68 A;  2QJC A;  4IL1 A;  5GTU A;  4DHL A;  1AUI A;  3DSC A;  4ORB A;  3H66 A;  2AHD A;  2Z1A A;  1XM7 A;  5B8I A;  1IT6 A;  1S3M A;  3D03 A;  4TUG A;  2IE4 C;  3IVE A;  5C1V A;  1HP1 A;  2WDC A;  4UWQ A;  2BDX A;  3C5W C;  4ORC A;  1WAR A;  3DW8 C;  4H2G A;  1KBP A;  4UT3 B;  4ZVZ A;  2CV9 A;  2P6B A;  5JJT A;  1OI8 A;  3K7W C;  2NXF A;  5J28 A;  1HO5 A;  3THO B;  1UTE A;  2XMO A;  1V73 A;  4B2O A;  2WDD A;  3ICF A;  1HPU A;  3FGA C;  3IB8 A;  2JOG A;  4Q7F A;  4YKE A;  4I5N C;  1QHW A;  1USH A;  4F0Z A;  1UF3 A;  2ZOA A;  3H61 A;  2HY1 A;  1JK7 A;  2HYO A;  3H64 A;  1S95 A;  3V4Y A;  4HD0 A;  3GVE A;  1W24 A;  3H62 B;  3T1I A;  1QFC A;  3DSD A;  1OIE A;  4LTY A;  3JYF A;  2DXN A;  2DFJ A;  4DSY A;  1T70 A;  2DXL A;  2QFR A;  2YVT A;  4H2B A;  4FCX A;  4NZV A;  4DT2 A;  4H1S A;  1WAO 1;  2YEQ A;  4MOV A;  1Z2X A;  3IB7 A;  5JPE A;  2O8A A;  4LU9 A;  3C9F A;  3K7V C;  1MF8 A;  1Z2W A;  2Z06 A;  4WWL A;  2BQ8 X;  2NYL C;  3RL3 A;  1FJM A;  4FBW A;  4UT3 A;  4JA7 A;  3H63 A;  4H2I A;  1NNW A;  3P71 C;  2ZBM A;  1XZW A;  3E7A A;  3FLO A;  3AUZ A;  3QFM A;  3EGG A;  2IAE C;  4FBK A;  4M0V A;  4UT2 A;  1II7 A;  4O43 A;  2QFP A;  4O4K A;  2WDF A;  4J6O A;  3RL5 A;  2WDE A;  2GJU A;  1TCO A;  5HPE A;  2USH A;  2O8G A;  4O5G A;  1T71 A;  2NYM C;  2HYP A;  2A22 A;  4I5L C;  1S70 A;  4FBQ A;  4ORA A;  4H2F A;  4XPN A;  3EGH A;  2IE3 C;  1SU1 A;  3QFN A;  3H67 A;  2Q8U A;  2R17 A;  3KBP A;  1S3L A;  2KKN A;  3H60 A;  4V0V A;  2Z72 A;  3RQZ A;  5JPF A;  3QFO A;  5EQV A;  3RL4 A;  3H69 A;  3THN A;  4V0X A;  3TGH A;  5F3W A;  1G5B A;  4JA9 A;  4KBP A;  2NPP C;  3HVQ A;  5DNY A;  2ZO9 B;  4MP0 A;  3ZTV A;  3LL8 A;  4ZX2 A;  3QG5 C;  1U32 A;  4G9J A;  4TUI A;  4O24 A;  3E7B A;  4OR9 A;  4V0W A;  4KKZ A;  1S3N A;  3CK2 A;  1M63 A;  3PSN A;  4LAC C;  5IOH A;  4H1Y P;  3QFK A;  3IVD A;  1OID A;  3N5U A;  4IYP C;  3PSO A;  3ZU0 A;  4MOY A;  5INB A;  3E0J A;  1S8E A;  3AV0 A;  2BCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...