3THNA

Crystal structure of mre11 core with manganese
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
319
structure length
313
Chain Sequence
MKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNQDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDSCRNFPGYVRVVYEEDSLPDLMGEIDNLVKIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Exonuclease, putative
publication title ATP driven structural changes of the bacterial Mre11:Rad50 catalytic head complex.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 104
structure length 313
sequence length 319
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 3thnA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3thnA01
3QFKA 2QFPA 2IE4C 4O43A 4MOYA 1MF8A 1QFCA 4O5GA 3RL4A 4B2OA 3N5UA 3THOB 2BDXA 1JK7A 5DNYA 2HY1A 3GVEA 1QHWA 4UWQA 1HPUA 4V0VA 1UF3A 4H1YP 3AV0A 3H68A 3JYFA 4NZVA 4ORCA 3E7AA 4O4KA 3QFNA 1OI8A 3HVQA 4UT2A 4MOVA 1S3LA 1W24A 2NYLC 4I5LC 2Z06A 1OIDA 3QG5C 2IAEC 3K7VC 4OR9A 4JA7A 2QJCA 2O8AA 1AUIA 1HO5A 2USHA 3KBPA 3P71C 5JPFA 1IT6A 4WWLA 2JOGA 4J6OA 1FJMA 1NNWA 1V73A 4ZX2A 3IVDA 1M63A 1U32A 3H64A 2Q8UA 2HYOA 4V0WA 4IL1A 1Z2XA 4ORAA 4DT2A 5INBA 4KBPA 5HPEA 2YVTA 4TUIA 5F3WA 4KKZA 2HYPA 3DSDA 2WDDA 2P6BA 5C1VA 4XPNA 4V0XA 3H66A 5JJTA 4I5NC 4FCXA 1WAO1 2Z1AA 4Q7FA 4O24A 1S8EA 4FBQA 2WDEA 4DHLA 5IOHA 1II7A 4UT3B 1T71A 5JPEA 2A22A 1T70A 3V4YA 4H2IA 1XM7A 1KBPA 2AHDA 2DFJA 3IVEA 4MP0A 3H63A 2GJUA 2NYMC 3K7WC 3QFMA 3RQZA 3RL5A 1TCOA 3PSNA 3EGGA 4JA9A 3ZU0A 3THNA 1S70A 4LU9A 2O8GA 4H2GA 1USHA 4DSYA 4FBKA 4UT3A 3ICFA 1S3NA 3RL3A 2QFRA 4HD0A 5GTUA 3IB7A 3H61A 2KKNA 4YKEA 4ZVZA 1S3MA 4H2FA 5B8IA 2R17A 3CK2A 5EQVA 1Z2WA 2BCDA 1UTEA 3H62B 1G5BA 4IYPC 3FGAC 3E7BA 3T1IA 2NXFA 1XZWA 3C5WC 3H60A 3LL8A 4LTYA 2Z72A 1S95A 4FBWA 3AUZA 3QFOA 4M0VA 4ORBA 3H69A 2NPPC 4H1SA 2CV9A 3ZTVA 2XMOA 3C9FA 3TGHA 3IB8A 3PSOA 4H2BA 1WARA 4F0ZA 1HP1A 3EGHA 4G9JA 4LACC 4TUGA 3H67A 2WDFA 2WDCA 2ZBMA 1OIEA 1SU1A 3DW8C 5J28A 2IE3C 2BQ8X 3DSCA
chains in the Genus database with same CATH superfamily
1NCSA 2EPUA 4ZYGA 3MSWA 3ADLA 2YRKA 1B69A 2YTEA 2EN1A 2EM2A 3IWBA 1GQEA 2RS7A 1FJGE 1JK7A 5AE2A 1QHWA 5LMUE 4V0VA 1UF3A 4X64E 1RMDA 3HXLA 2HC5A 1IBLE 2EMHA 4M30A 4B3ME 3IWCA 1OI8A 3HVQA 2EMIA 4F6MA 4UT2A 3VYYA 2DIXA 4P78A 1UN6B 2HGHA 3QG5C 2KOUA 3ECRA 4BHCA 4R2QA 4JA7A 1TN9A 1WHNA 4BMJA 2EMAA 3C6MA 2EOYA 4F54A 4JI8E 4JI0E 2V86A 2USHA 1UBDC 2CSHA 4BBYA 4HTGA 2JOGA 2EOHA 4J6OA 3FIGA 1YUIA 2ZOAA 3IVDA 1O0WA 1U32A 4ZYHA 2KONA 5INBA 1Z2XA 3LLHA 4RH8A 2EPOA 4TUIA 2RPCA 2M1SA 4I8OA 5LL6R 5F3WA 2EOOA 4F9AB 4GKJE 2DSYA 3C4BA 2WDDA 5C1VA 2YTOA 2YSOA 4DR2E 1AAYA 2V89A 4V0XA 4L5NC 2EJ4A 3MHHC 3K6QA 4GEQB 1EH6A 2EPNA 2IHR1 1SR9A 2E1MA 2LUQA 4DV3E 1II7A 2EM6A 2K4VA 2LO3A 2RQLA 4R2EA 4UT3B 5JPEA 2UXCE 2YT4A 5TSEA 3OMLA 2EPKX 1XMQE 4MP0A 2GJUA 4M2ZA 3K7WC 2VF1A 2EM9A 3DF6A 3RL5A 1TCOA 2EQ3A 2YEQA 1UHZA 4LF6E 3OTOE 1DQ3A 1T38A 5A6BA 3JAMC 1YYWA 4DV1E 2O8GA 2L33A 1YZ9A 2CPNA 3BGHA 1HNXE 2YPNA 3C4TA 3L00A 3RL3A 3H61A 2KKNA 2MDRA 2FTXB 4ZVZA 4N4RB 4F9CB 4X9JA 5EQVA 1PJQA 2BCDA 1UTEA 3H62B 1X48A 2EM8A 1MGTA 5KL2A 4JI5E 3DJWA 3J7AG 1BB8A 5KL7A 1S95A 1EKZA 2DXNA 2JXPA 2L8TA 4FBWA 5KL4A 2L2MA 2A25A 4ORBA 2VQEE 1PKPA 2EMBA 2ZM6E 1WARA 2EQ1A 3J80C 2YTDA 5T6JA 2WBSA 2EPAA 4F2JC 4X66E 1SU1A 3DW8C 2DXLA 2IE3C 2ENCA 2EM0A 4OX9E 1G2FC 2QFPA 2CT1A 2ENAA 4LF4E 4O43A 1QFCA 2YTJA 4WXCA 3RL4A 3THOB 2BDXA 4R8OA 1XMOE 1X47A 2HY1A 4UWQA 4WXDA 4DKKA 4K0KE 1DI2A 3AV0A 4JI7E 3JYFA 2VRDA 1SFEA 2MC5A 4O4KA 2YRHA 3QFNA 2YTIA 1W24A 2NYLC 2EN6A 4R2AA 1OIDA 5A69A 3K7VC 4LF5E 2JY9A 2DRPA 2EN2A 2EMXA 3KBPA 3ZOQB 5JPFA 1N33E 2LT7A 1N3GA 4WWLA 1NNWA 1V73A 1T4OA 4Q35B 1HNWE 1X6HA 2EM4A 2Q8UA 4DT2A 1N36E 2B7TA 2MDGA 1ZAAC 2UUBE 2E72A 4FK5C 2HYPA 2ENHA 4R2SA 1L4SA 4X65E 2WBTA 2EOJA 2MKDA 5AC5A 3VHTB 4YY3E 4FCXA 2EMYA 2EN4A 2E5LE 4B3TE 2Z1AA 4MLQA 4P7DA 2WDEA 3JU0A 2EP3A 2HHHE 1XM7A 1DGCA 2V83A 4DUZE 1F2IG 2JPAA 3QFMA 2GPIA 2NUFA 1A1IA 3PSNA 3BIDA 2L3JA 4JA9A 1MEYC 2ODRC 1S70A 4JI4E 1QNTA 2JR1A 5A6AA 5ADZA 2EPCA 2JOXA 4DSYA 2ADRA 4BHBA 2GLIA 1WXRA 2NUEA 2D9HA 4F9BB 4DR5E 1S3NA 3ICFA 3M99B 1QU6A 1ZR9A 4YKEA 2EPMX 2EOIA 2DGCA 4NHRA 2EWLA 1XZWA 1YYOA 2NXFA 4YHHE 3C5WC 4R2PA 3LL8A 4LTYA 2F8BA 2YRMA 4LF7E 2VE7C 2F4VE 2EN8A 1A1JA 3HTXA 3QFOA 2V8QB 5A6KA 2EM7A 4H1SA 2EE8A 3ZTVA 3TGHA 4DR7E 2WBUA 1P47A 1NEIA 2N8XA 4JV5E 4H2BA 2BBGA 2VQFE 1HP1A 4G9JA 1G2DC 2V85A 3EPKA 2EN7A 4LACC 4TUGA 1A1HA 2YTQA 1AH5A 4ZYDA 3IWDA 2ZBMA 1OIEA 5J28A 3JTZA 2EOFA 2BB8A 2BQ8X 1UILA 2JYAA 2EPRA 1MF8A 2EMZA 4B2OA 5DNYA 1HPUA 1I94E 1GTKA 3H68A 2PRTA 4NZVA 1A1LA 2R76A 3HQ1A 5CFFE 2UUAE 2UUCE 3E7AA 1KYQA 1TF6A 1X49A 2ODRD 2EQ0A 4MOVA 4BC7A 4DV4E 2Z06A 4GKKE 4OR9A 3MHSC 4DUYE 4LF9E 2QJCA 1IBKE 2EMKA 2EORA 3UK3C 4Q28A 4GZNC 1AUIA 4JI2E 5LMNE 2L3CA 1HO5A 3P71C 2N3HA 2ELYA 3ADIA 2DLQA 2JWOA 1FJMA 2M4IA 1M63A 1WHQA 4IS1C 2RSMA 1A1FA 4IL1A 2M7QA 4JI1E 4KBPA 4LF8E 5HPEA 2YVTA 5IXMB 4R2CA 1IQSA 5AASA 4KKZA 3KWRA 2LRSA 2RS6A 2P6BA 2DB2A 2EMCA 2LJHA 3FLOA 3H66A 4KHPE 1KJKA 2KHXA 4I5NC 2L2NA 1WJPA 2WZOA 3BF2A 3HPSA 1JK1A 1S8EA 4FBQA 4DHLA 5IOHA 2J7JA 1T71A 1J26A 3P1XA 1T70A 2N3GA 1PJTA 1EH8A 2EMGA 3IVEA 2EPZA 2V87A 2NYMC 1Z1BA 3VK6A 3T1YE 5IT9C 3BBGA 2EM3A 2NUGA 3J81C 3EGGA 3KZZA 2G7HA 4LFBE 2EOQA 2MC6A 4LFCE 1IMUA 2MKNA 2B3TB 4DR6E 1T4NA 4H2GA 2LUPB 3J7Yp 1ZBTA 5GTUA 2HJJA 5AC4A 3IB7A 4AQYE 3EQ1A 3EPJA 2L92A 1J5EE 2UU9E 2M9AA 1S3MA 2L6MA 4KWYA 3CK2A 2K7IA 2NABA 1Z2WA 1N32E 1G5BA 1X6EA 5AE1A 1RC7A 1T4LB 2LTRA 1IBME 2DMIA 2RSIA 2YTFA 1XNQE 1IQOA 2DMYA 1STUA 2EMFA 4IJDA 4JI3E 2Z72A 2EOZA 4MLVA 3RMPA 2LCEA 1GZ6A 2R1FA 4BC9A 4BS9A 3H69A 2XMOA 3C9FA 2EL6A 2ELZA 2LE2A 1ZU1A 3IB8A 2YZTA 4UT3A 2EOSA 4R03A 2LMZA 2EM5A 5IWAE 2WDFA 4LFAE 4NXME 4DV2E 2LVHA 4B3SE 1BBGA 2I13A 2JOBA 3DSCA 1WRJA 3QFKA 5A2QC 2IE4C 4MOYA 4O5GA 2UXBE 5IV8B 2GHFA 3N5UA 3GVEA 3E0JA 2EOXA 4J8ZA 1YYKA 3F6HA 4H1YP 1YSAC 4ORCA 4KZSA 1S3LA 4I5LC 1X3CA 2IAEC 1HR0E 3C6KA 1T39A 2EPLX 2O8AA 2LBSB 2EMLA 2EPXA 1IT6A 2YWQA 3EPHA 4ZYEA 4DR4E 5KL6A 5A6BD 2EMWA 4ZX2A 4DR1E 3H64A 5KL3A 4V0WA 2EOMA 2HYOA 4ORAA 2JVAA 4WX9A 2NA2A 2YSPA 2EL5A 3ADGA 3T1HE 3DSDA 2RTXA 5A6JA 4XPNA 4OOGC 4NXNE 5JJTA 1LLMC 1WAO1 2YU8A 2I9IA 3H09A 4WSGA 1X6FA 4O24A 4Q7FA 2JP9A 1YPNA 3VYXA 4DR3E 1YUJA 2YU5A 2EZ6A 4WFTA 2A22A 2B9DA 3KZYA 1YFHA 4B3RE 1KBPA 2AHDA 2DFJA 4H2IA 3V4YA 4WYQB 3H63A 4JI6E 1HNZE 4DMIA 2EPPA 5AE3A 5LLQA 4DV6E 4F6NA 1X5WA 3RQZA 2LTSA 4BCAA 4M9VC 5FLXC 3ZU0A 3TQMA 2ZO9B 1FKAE 2FGGA 1A1KA 2CTDA 3THNA 4L8NA 4LU9A 4DV7E 2YTGA 2L2KB 1TF3A 1USHA 4FBKA 2EOEA 2YTPA 2QFRA 4HD0A 4RHBB 2V88A 1JK2A 4R2DA 4WSPA 1A1GA 4H2FA 5B8IA 2R17A 2YTNA 4IYPC 2EN3A 2WCC3 3FGAC 3E7BA 3T1IA 3F6GA 2LV2A 3H60A 1RQ0A 4X62E 2FV4B 1N34E 1PJSA 5KL5A 4WPYA 3AUZA 4M0VA 1ZBQA 2NPPC 3ADJA 2CV9A 3EPLA 2EL4A 4R2RA 4DV0E 3PSOA 5BR8E 4F0ZA 1BBOA 1EH7A 2H36X 3HPZA 4JYAE 3EGHA 2UXDE 3LMLA 3H67A 4DV5E 2DLKA 2B7VA 4HEIA 2WDCA 1XNRE 3D03A 4X8WA 2LJUA 1PDAA
chains in the Genus database with same CATH topology
3QFKA 2QFPA 2IE4C 4O43A 4MOYA 1MF8A 1QFCA 4O5GA 3RL4A 4B2OA 3N5UA 3THOB 2BDXA 1JK7A 5DNYA 2HY1A 3GVEA 1QHWA 3E0JA 4UWQA 1HPUA 4V0VA 1UF3A 4H1YP 3AV0A 3H68A 3JYFA 4NZVA 4ORCA 3E7AA 4O4KA 3QFNA 1OI8A 3HVQA 4UT2A 4MOVA 1S3LA 1W24A 2NYLC 4I5LC 2Z06A 1OIDA 3QG5C 2IAEC 3K7VC 4OR9A 4JA7A 2QJCA 2O8AA 1AUIA 1HO5A 2USHA 3KBPA 3P71C 5JPFA 1IT6A 4WWLA 2JOGA 4J6OA 1FJMA 1NNWA 1V73A 2ZOAA 4ZX2A 3IVDA 1M63A 1U32A 3H64A 2Q8UA 2HYOA 4V0WA 4IL1A 1Z2XA 4ORAA 4DT2A 5INBA 4KBPA 5HPEA 2YVTA 4TUIA 5F3WA 4KKZA 3DSDA 2HYPA 2WDDA 2P6BA 5C1VA 4XPNA 3FLOA 4V0XA 3H66A 5JJTA 4I5NC 4FCXA 1WAO1 2Z1AA 4Q7FA 1S8EA 4O24A 4FBQA 2WDEA 4DHLA 5IOHA 1II7A 4UT3B 1T71A 5JPEA 2A22A 1T70A 3V4YA 4H2IA 1XM7A 1KBPA 2AHDA 2DFJA 3IVEA 4MP0A 3H63A 2GJUA 2NYMC 3K7WC 3QFMA 3RQZA 3RL5A 1TCOA 3PSNA 3EGGA 4JA9A 3ZU0A 2ZO9B 2YEQA 3THNA 1S70A 4LU9A 2O8GA 4H2GA 1USHA 4DSYA 4FBKA 4UT3A 3ICFA 1S3NA 3RL3A 2QFRA 4HD0A 5GTUA 3IB7A 3H61A 2KKNA 4YKEA 4ZVZA 1S3MA 4H2FA 5B8IA 2R17A 3CK2A 5EQVA 1Z2WA 2BCDA 1UTEA 3H62B 1G5BA 4IYPC 3FGAC 3E7BA 3T1IA 2NXFA 1XZWA 3C5WC 3H60A 3LL8A 4LTYA 2Z72A 1S95A 2DXNA 4FBWA 3AUZA 3QFOA 4M0VA 4ORBA 3H69A 2NPPC 4H1SA 2CV9A 3ZTVA 2XMOA 3C9FA 3TGHA 3IB8A 3PSOA 4H2BA 1WARA 4F0ZA 1HP1A 3EGHA 4G9JA 4LACC 4TUGA 3H67A 2WDFA 2WDCA 2ZBMA 3D03A 1OIEA 1SU1A 3DW8C 2DXLA 5J28A 2IE3C 2BQ8X 3DSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QFK A;  2QFP A;  2IE4 C;  4O43 A;  4MOY A;  1MF8 A;  1QFC A;  4O5G A;  3RL4 A;  4B2O A;  3N5U A;  3THO B;  2BDX A;  1JK7 A;  5DNY A;  2HY1 A;  3GVE A;  1QHW A;  4UWQ A;  1HPU A;  4V0V A;  1UF3 A;  4H1Y P;  3AV0 A;  3H68 A;  3JYF A;  4NZV A;  4ORC A;  3E7A A;  4O4K A;  3QFN A;  1OI8 A;  3HVQ A;  4UT2 A;  4MOV A;  1S3L A;  1W24 A;  2NYL C;  4I5L C;  2Z06 A;  1OID A;  3QG5 C;  2IAE C;  3K7V C;  4OR9 A;  4JA7 A;  2QJC A;  2O8A A;  1AUI A;  1HO5 A;  2USH A;  3KBP A;  3P71 C;  5JPF A;  1IT6 A;  4WWL A;  2JOG A;  4J6O A;  1FJM A;  1NNW A;  1V73 A;  4ZX2 A;  3IVD A;  1M63 A;  1U32 A;  3H64 A;  2Q8U A;  2HYO A;  4V0W A;  4IL1 A;  1Z2X A;  4ORA A;  4DT2 A;  5INB A;  4KBP A;  5HPE A;  2YVT A;  4TUI A;  5F3W A;  4KKZ A;  2HYP A;  3DSD A;  2WDD A;  2P6B A;  5C1V A;  4XPN A;  4V0X A;  3H66 A;  5JJT A;  4I5N C;  4FCX A;  1WAO 1;  2Z1A A;  4Q7F A;  4O24 A;  1S8E A;  4FBQ A;  2WDE A;  4DHL A;  5IOH A;  1II7 A;  4UT3 B;  1T71 A;  5JPE A;  2A22 A;  1T70 A;  3V4Y A;  4H2I A;  1XM7 A;  1KBP A;  2AHD A;  2DFJ A;  3IVE A;  4MP0 A;  3H63 A;  2GJU A;  2NYM C;  3K7W C;  3QFM A;  3RQZ A;  3RL5 A;  1TCO A;  3PSN A;  3EGG A;  4JA9 A;  3ZU0 A;  3THN A;  1S70 A;  4LU9 A;  2O8G A;  4H2G A;  1USH A;  4DSY A;  4FBK A;  4UT3 A;  3ICF A;  1S3N A;  3RL3 A;  2QFR A;  4HD0 A;  5GTU A;  3IB7 A;  3H61 A;  2KKN A;  4YKE A;  4ZVZ A;  1S3M A;  4H2F A;  5B8I A;  2R17 A;  3CK2 A;  5EQV A;  1Z2W A;  2BCD A;  1UTE A;  3H62 B;  1G5B A;  4IYP C;  3FGA C;  3E7B A;  3T1I A;  2NXF A;  1XZW A;  3C5W C;  3H60 A;  3LL8 A;  4LTY A;  2Z72 A;  1S95 A;  4FBW A;  3AUZ A;  3QFO A;  4M0V A;  4ORB A;  3H69 A;  2NPP C;  4H1S A;  2CV9 A;  3ZTV A;  2XMO A;  3C9F A;  3TGH A;  3IB8 A;  3PSO A;  4H2B A;  1WAR A;  4F0Z A;  1HP1 A;  3EGH A;  4G9J A;  4LAC C;  4TUG A;  3H67 A;  2WDF A;  2WDC A;  2ZBM A;  1OIE A;  1SU1 A;  3DW8 C;  5J28 A;  2IE3 C;  2BQ8 X;  3DSC A; 
#chains in the Genus database with same CATH topology
 1NCS A;  2EPU A;  4ZYG A;  3MSW A;  3ADL A;  2YRK A;  1B69 A;  2YTE A;  2EN1 A;  2EM2 A;  3IWB A;  1GQE A;  2RS7 A;  1FJG E;  1JK7 A;  5AE2 A;  1QHW A;  5LMU E;  4V0V A;  1UF3 A;  4X64 E;  1RMD A;  3HXL A;  2HC5 A;  1IBL E;  2EMH A;  4M30 A;  4B3M E;  3IWC A;  1OI8 A;  3HVQ A;  2EMI A;  4F6M A;  4UT2 A;  3VYY A;  2DIX A;  4P78 A;  1UN6 B;  2HGH A;  3QG5 C;  2KOU A;  3ECR A;  4BHC A;  4R2Q A;  4JA7 A;  1TN9 A;  1WHN A;  4BMJ A;  2EMA A;  3C6M A;  2EOY A;  4F54 A;  4JI8 E;  4JI0 E;  2V86 A;  2USH A;  1UBD C;  2CSH A;  4BBY A;  4HTG A;  2JOG A;  2EOH A;  4J6O A;  3FIG A;  1YUI A;  2ZOA A;  3IVD A;  1O0W A;  1U32 A;  4ZYH A;  2KON A;  5INB A;  1Z2X A;  3LLH A;  4RH8 A;  2EPO A;  4TUI A;  2RPC A;  2M1S A;  4I8O A;  5LL6 R;  5F3W A;  2EOO A;  4F9A B;  4GKJ E;  2DSY A;  3C4B A;  2WDD A;  5C1V A;  2YTO A;  2YSO A;  4DR2 E;  1AAY A;  2V89 A;  4V0X A;  4L5N C;  2EJ4 A;  3MHH C;  3K6Q A;  4GEQ B;  1EH6 A;  2EPN A;  2IHR 1;  1SR9 A;  2E1M A;  2LUQ A;  4DV3 E;  1II7 A;  2EM6 A;  2K4V A;  2LO3 A;  2RQL A;  4R2E A;  4UT3 B;  5JPE A;  2UXC E;  2YT4 A;  5TSE A;  3OML A;  2EPK X;  1XMQ E;  4MP0 A;  2GJU A;  4M2Z A;  3K7W C;  2VF1 A;  2EM9 A;  3DF6 A;  3RL5 A;  1TCO A;  2EQ3 A;  2YEQ A;  1UHZ A;  4LF6 E;  3OTO E;  1DQ3 A;  1T38 A;  5A6B A;  3JAM C;  1YYW A;  4DV1 E;  2O8G A;  2L33 A;  1YZ9 A;  2CPN A;  3BGH A;  1HNX E;  2YPN A;  3C4T A;  3L00 A;  3RL3 A;  3H61 A;  2KKN A;  2MDR A;  2FTX B;  4ZVZ A;  4N4R B;  4F9C B;  4X9J A;  5EQV A;  1PJQ A;  2BCD A;  1UTE A;  3H62 B;  1X48 A;  2EM8 A;  1MGT A;  5KL2 A;  4JI5 E;  3DJW A;  3J7A G;  1BB8 A;  5KL7 A;  1S95 A;  1EKZ A;  2DXN A;  2JXP A;  2L8T A;  4FBW A;  5KL4 A;  2L2M A;  2A25 A;  4ORB A;  2VQE E;  1PKP A;  2EMB A;  2ZM6 E;  1WAR A;  2EQ1 A;  3J80 C;  2YTD A;  5T6J A;  2WBS A;  2EPA A;  4F2J C;  4X66 E;  1SU1 A;  3DW8 C;  2DXL A;  2IE3 C;  2ENC A;  2EM0 A;  4OX9 E;  1G2F C;  2QFP A;  2CT1 A;  2ENA A;  4LF4 E;  4O43 A;  1QFC A;  2YTJ A;  4WXC A;  3RL4 A;  3THO B;  2BDX A;  4R8O A;  1XMO E;  1X47 A;  2HY1 A;  4UWQ A;  4WXD A;  4DKK A;  4K0K E;  1DI2 A;  3AV0 A;  4JI7 E;  3JYF A;  2VRD A;  1SFE A;  2MC5 A;  4O4K A;  2YRH A;  3QFN A;  2YTI A;  1W24 A;  2NYL C;  2EN6 A;  4R2A A;  1OID A;  5A69 A;  3K7V C;  4LF5 E;  2JY9 A;  2DRP A;  2EN2 A;  2EMX A;  3KBP A;  3ZOQ B;  5JPF A;  1N33 E;  2LT7 A;  1N3G A;  4WWL A;  1NNW A;  1V73 A;  1T4O A;  4Q35 B;  1HNW E;  1X6H A;  2EM4 A;  2Q8U A;  4DT2 A;  1N36 E;  2B7T A;  2MDG A;  1ZAA C;  2UUB E;  2E72 A;  4FK5 C;  2HYP A;  2ENH A;  4R2S A;  1L4S A;  4X65 E;  2WBT A;  2EOJ A;  2MKD A;  5AC5 A;  3VHT B;  4YY3 E;  4FCX A;  2EMY A;  2EN4 A;  2E5L E;  4B3T E;  2Z1A A;  4MLQ A;  4P7D A;  2WDE A;  3JU0 A;  2EP3 A;  2HHH E;  1XM7 A;  1DGC A;  2V83 A;  4DUZ E;  1F2I G;  2JPA A;  3QFM A;  2GPI A;  2NUF A;  1A1I A;  3PSN A;  3BID A;  2L3J A;  4JA9 A;  1MEY C;  2ODR C;  1S70 A;  4JI4 E;  1QNT A;  2JR1 A;  5A6A A;  5ADZ A;  2EPC A;  2JOX A;  4DSY A;  2ADR A;  4BHB A;  2GLI A;  1WXR A;  2NUE A;  2D9H A;  4F9B B;  4DR5 E;  1S3N A;  3ICF A;  3M99 B;  1QU6 A;  1ZR9 A;  4YKE A;  2EPM X;  2EOI A;  2DGC A;  4NHR A;  2EWL A;  1XZW A;  1YYO A;  2NXF A;  4YHH E;  3C5W C;  4R2P A;  3LL8 A;  4LTY A;  2F8B A;  2YRM A;  4LF7 E;  2VE7 C;  2F4V E;  2EN8 A;  1A1J A;  3HTX A;  3QFO A;  2V8Q B;  5A6K A;  2EM7 A;  4H1S A;  2EE8 A;  3ZTV A;  3TGH A;  4DR7 E;  2WBU A;  1P47 A;  1NEI A;  2N8X A;  4JV5 E;  4H2B A;  2BBG A;  2VQF E;  1HP1 A;  4G9J A;  1G2D C;  2V85 A;  3EPK A;  2EN7 A;  4LAC C;  4TUG A;  1A1H A;  2YTQ A;  1AH5 A;  4ZYD A;  3IWD A;  2ZBM A;  1OIE A;  5J28 A;  3JTZ A;  2EOF A;  2BB8 A;  2BQ8 X;  1UIL A;  2JYA A;  2EPR A;  1MF8 A;  2EMZ A;  4B2O A;  5DNY A;  1HPU A;  1I94 E;  1GTK A;  3H68 A;  2PRT A;  4NZV A;  1A1L A;  2R76 A;  3HQ1 A;  5CFF E;  2UUA E;  2UUC E;  3E7A A;  1KYQ A;  1TF6 A;  1X49 A;  2ODR D;  2EQ0 A;  4MOV A;  4BC7 A;  4DV4 E;  2Z06 A;  4GKK E;  4OR9 A;  3MHS C;  4DUY E;  4LF9 E;  2QJC A;  1IBK E;  2EMK A;  2EOR A;  3UK3 C;  4Q28 A;  4GZN C;  1AUI A;  4JI2 E;  5LMN E;  2L3C A;  1HO5 A;  3P71 C;  2N3H A;  2ELY A;  3ADI A;  2DLQ A;  2JWO A;  1FJM A;  2M4I A;  1M63 A;  1WHQ A;  4IS1 C;  2RSM A;  1A1F A;  4IL1 A;  2M7Q A;  4JI1 E;  4KBP A;  4LF8 E;  5HPE A;  2YVT A;  5IXM B;  4R2C A;  1IQS A;  5AAS A;  4KKZ A;  3KWR A;  2LRS A;  2RS6 A;  2P6B A;  2DB2 A;  2EMC A;  2LJH A;  3FLO A;  3H66 A;  4KHP E;  1KJK A;  2KHX A;  4I5N C;  2L2N A;  1WJP A;  2WZO A;  3BF2 A;  3HPS A;  1JK1 A;  1S8E A;  4FBQ A;  4DHL A;  5IOH A;  2J7J A;  1T71 A;  1J26 A;  3P1X A;  1T70 A;  2N3G A;  1PJT A;  1EH8 A;  2EMG A;  3IVE A;  2EPZ A;  2V87 A;  2NYM C;  1Z1B A;  3VK6 A;  3T1Y E;  5IT9 C;  3BBG A;  2EM3 A;  2NUG A;  3J81 C;  3EGG A;  3KZZ A;  2G7H A;  4LFB E;  2EOQ A;  2MC6 A;  4LFC E;  1IMU A;  2MKN A;  2B3T B;  4DR6 E;  1T4N A;  4H2G A;  2LUP B;  3J7Y p;  1ZBT A;  5GTU A;  2HJJ A;  5AC4 A;  3IB7 A;  4AQY E;  3EQ1 A;  3EPJ A;  2L92 A;  1J5E E;  2UU9 E;  2M9A A;  1S3M A;  2L6M A;  4KWY A;  3CK2 A;  2K7I A;  2NAB A;  1Z2W A;  1N32 E;  1G5B A;  1X6E A;  5AE1 A;  1RC7 A;  1T4L B;  2LTR A;  1IBM E;  2DMI A;  2RSI A;  2YTF A;  1XNQ E;  1IQO A;  2DMY A;  1STU A;  2EMF A;  4IJD A;  4JI3 E;  2Z72 A;  2EOZ A;  4MLV A;  3RMP A;  2LCE A;  1GZ6 A;  2R1F A;  4BC9 A;  4BS9 A;  3H69 A;  2XMO A;  3C9F A;  2EL6 A;  2ELZ A;  2LE2 A;  1ZU1 A;  3IB8 A;  2YZT A;  4UT3 A;  2EOS A;  4R03 A;  2LMZ A;  2EM5 A;  5IWA E;  2WDF A;  4LFA E;  4NXM E;  4DV2 E;  2LVH A;  4B3S E;  1BBG A;  2I13 A;  2JOB A;  3DSC A;  1WRJ A;  3QFK A;  5A2Q C;  2IE4 C;  4MOY A;  4O5G A;  2UXB E;  5IV8 B;  2GHF A;  3N5U A;  3GVE A;  3E0J A;  2EOX A;  4J8Z A;  1YYK A;  3F6H A;  4H1Y P;  1YSA C;  4ORC A;  4KZS A;  1S3L A;  4I5L C;  1X3C A;  2IAE C;  1HR0 E;  3C6K A;  1T39 A;  2EPL X;  2O8A A;  2LBS B;  2EML A;  2EPX A;  1IT6 A;  2YWQ A;  3EPH A;  4ZYE A;  4DR4 E;  5KL6 A;  5A6B D;  2EMW A;  4ZX2 A;  4DR1 E;  3H64 A;  5KL3 A;  4V0W A;  2EOM A;  2HYO A;  4ORA A;  2JVA A;  4WX9 A;  2NA2 A;  2YSP A;  2EL5 A;  3ADG A;  3T1H E;  3DSD A;  2RTX A;  5A6J A;  4XPN A;  4OOG C;  4NXN E;  5JJT A;  1LLM C;  1WAO 1;  2YU8 A;  2I9I A;  3H09 A;  4WSG A;  1X6F A;  4O24 A;  4Q7F A;  2JP9 A;  1YPN A;  3VYX A;  4DR3 E;  1YUJ A;  2YU5 A;  2EZ6 A;  4WFT A;  2A22 A;  2B9D A;  3KZY A;  1YFH A;  4B3R E;  1KBP A;  2AHD A;  2DFJ A;  4H2I A;  3V4Y A;  4WYQ B;  3H63 A;  4JI6 E;  1HNZ E;  4DMI A;  2EPP A;  5AE3 A;  5LLQ A;  4DV6 E;  4F6N A;  1X5W A;  3RQZ A;  2LTS A;  4BCA A;  4M9V C;  5FLX C;  3ZU0 A;  3TQM A;  2ZO9 B;  1FKA E;  2FGG A;  1A1K A;  2CTD A;  3THN A;  4L8N A;  4LU9 A;  4DV7 E;  2YTG A;  2L2K B;  1TF3 A;  1USH A;  4FBK A;  2EOE A;  2YTP A;  2QFR A;  4HD0 A;  4RHB B;  2V88 A;  1JK2 A;  4R2D A;  4WSP A;  1A1G A;  4H2F A;  5B8I A;  2R17 A;  2YTN A;  4IYP C;  2EN3 A;  2WCC 3;  3FGA C;  3E7B A;  3T1I A;  3F6G A;  2LV2 A;  3H60 A;  1RQ0 A;  4X62 E;  2FV4 B;  1N34 E;  1PJS A;  5KL5 A;  4WPY A;  3AUZ A;  4M0V A;  1ZBQ A;  2NPP C;  3ADJ A;  2CV9 A;  3EPL A;  2EL4 A;  4R2R A;  4DV0 E;  3PSO A;  5BR8 E;  4F0Z A;  1BBO A;  1EH7 A;  2H36 X;  3HPZ A;  4JYA E;  3EGH A;  2UXD E;  3LML A;  3H67 A;  4DV5 E;  2DLK A;  2B7V A;  4HEI A;  2WDC A;  1XNR E;  3D03 A;  4X8W A;  2LJU A;  1PDA A; 
#chains in the Genus database with same CATH homology
 3QFK A;  2QFP A;  2IE4 C;  4O43 A;  4MOY A;  1MF8 A;  1QFC A;  4O5G A;  3RL4 A;  4B2O A;  3N5U A;  3THO B;  2BDX A;  1JK7 A;  5DNY A;  2HY1 A;  3GVE A;  1QHW A;  3E0J A;  4UWQ A;  1HPU A;  4V0V A;  1UF3 A;  4H1Y P;  3AV0 A;  3H68 A;  3JYF A;  4NZV A;  4ORC A;  3E7A A;  4O4K A;  3QFN A;  1OI8 A;  3HVQ A;  4UT2 A;  4MOV A;  1S3L A;  1W24 A;  2NYL C;  4I5L C;  2Z06 A;  1OID A;  3QG5 C;  2IAE C;  3K7V C;  4OR9 A;  4JA7 A;  2QJC A;  2O8A A;  1AUI A;  1HO5 A;  2USH A;  3KBP A;  3P71 C;  5JPF A;  1IT6 A;  4WWL A;  2JOG A;  4J6O A;  1FJM A;  1NNW A;  1V73 A;  2ZOA A;  4ZX2 A;  3IVD A;  1M63 A;  1U32 A;  3H64 A;  2Q8U A;  2HYO A;  4V0W A;  4IL1 A;  1Z2X A;  4ORA A;  4DT2 A;  5INB A;  4KBP A;  5HPE A;  2YVT A;  4TUI A;  5F3W A;  4KKZ A;  3DSD A;  2HYP A;  2WDD A;  2P6B A;  5C1V A;  4XPN A;  3FLO A;  4V0X A;  3H66 A;  5JJT A;  4I5N C;  4FCX A;  1WAO 1;  2Z1A A;  4Q7F A;  1S8E A;  4O24 A;  4FBQ A;  2WDE A;  4DHL A;  5IOH A;  1II7 A;  4UT3 B;  1T71 A;  5JPE A;  2A22 A;  1T70 A;  3V4Y A;  4H2I A;  1XM7 A;  1KBP A;  2AHD A;  2DFJ A;  3IVE A;  4MP0 A;  3H63 A;  2GJU A;  2NYM C;  3K7W C;  3QFM A;  3RQZ A;  3RL5 A;  1TCO A;  3PSN A;  3EGG A;  4JA9 A;  3ZU0 A;  2ZO9 B;  2YEQ A;  3THN A;  1S70 A;  4LU9 A;  2O8G A;  4H2G A;  1USH A;  4DSY A;  4FBK A;  4UT3 A;  3ICF A;  1S3N A;  3RL3 A;  2QFR A;  4HD0 A;  5GTU A;  3IB7 A;  3H61 A;  2KKN A;  4YKE A;  4ZVZ A;  1S3M A;  4H2F A;  5B8I A;  2R17 A;  3CK2 A;  5EQV A;  1Z2W A;  2BCD A;  1UTE A;  3H62 B;  1G5B A;  4IYP C;  3FGA C;  3E7B A;  3T1I A;  2NXF A;  1XZW A;  3C5W C;  3H60 A;  3LL8 A;  4LTY A;  2Z72 A;  1S95 A;  2DXN A;  4FBW A;  3AUZ A;  3QFO A;  4M0V A;  4ORB A;  3H69 A;  2NPP C;  4H1S A;  2CV9 A;  3ZTV A;  2XMO A;  3C9F A;  3TGH A;  3IB8 A;  3PSO A;  4H2B A;  1WAR A;  4F0Z A;  1HP1 A;  3EGH A;  4G9J A;  4LAC C;  4TUG A;  3H67 A;  2WDF A;  2WDC A;  2ZBM A;  3D03 A;  1OIE A;  1SU1 A;  3DW8 C;  2DXL A;  5J28 A;  2IE3 C;  2BQ8 X;  3DSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...