3THNA

Crystal structure of mre11 core with manganese
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
319
structure length
313
Chain Sequence
b'MKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNQDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDSCRNFPGYVRVVYEEDSLPDLMGEIDNLVKIER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title ATP driven structural changes of the bacterial Mre11:Rad50 catalytic head complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 104
structure length 313
sequence length 319
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 3thnA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3thnA01
4WWLA 4UT2A 4NZVA 2IE3C 4H1SA 4O43A 4IYPC 4H1YP 4DT2A 4ZVZA 5JPEA 2Z72A 3PSOA 1S3MA 2NXFA 4KKZA 3QFKA 5F3WA 2XMOA 2NYMC 4OR9A 5EQVA 3QFNA 3IVDA 1WAO1 1XM7A 4KBPA 2AHDA 3H69A 4G9JA 4O4KA 3FGAC 1U32A 2USHA 1T70A 4I5LC 4TUGA 3N5UA 1OIEA 4UT3A 1HO5A 4YKEA 1UF3A 3E7BA 1NNWA 3GVEA 3H61A 3H67A 4FBWA 1M63A 3H63A 4FBKA 2Q8UA 3EGHA 3H66A 3AV0A 3IB8A 4ORCA 3HVQA 4FCXA 3C5WC 3RL5A 2IE4C 1SU1A 4UWQA 4V0WA 4JA7A 1S95A 2Z06A 2WDFA 3RQZA 2BDXA 2NYLC 4TUIA 4H2BA 1Z2WA 3H64A 3DSDA 5JJTA 1UTEA 1HP1A 3H68A 2P6BA 4MP0A 1HPUA 4MOYA 2IAEC 2WDEA 4MOVA 4DHLA 1S3LA 2KKNA 3DSCA 1TCOA 3JYFA 4UT3B 1WARA 5INBA 2GJUA 4FBQA 2O8AA 1OIDA 4H2FA 5DNYA 3QFOA 4H2IA 5C1VA 3AUZA 3P71C 2HYPA 1MF8A 2JOGA 4ZX2A 2CV9A 3LL8A 3THNA 1AUIA 3DW8C 4IL1A 1JK7A 2R17A 4O5GA 3ZU0A 1USHA 3QFMA 4ORAA 3THOB 2Z1AA 3QG5C 2QFRA 3EGGA 2QFPA 5J28A 3CK2A 4O24A 3K7WC 2WDDA 2HYOA 1IT6A 2BQ8X 2DFJA 1Z2XA 3H60A 4LTYA 4V0VA 1QFCA 1OI8A 4J6OA 2QJCA 1S3NA 1XZWA 3K7VC 4XPNA 2YVTA 4DSYA 1QHWA 2WDCA 1S8EA 4V0XA 3C9FA 3RL3A 5JPFA 1FJMA 2NPPC 1W24A 4F0ZA 3IVEA 3KBPA 5GTUA 3TGHA 3H62B 1T71A 3IB7A 4M0VA 3T1IA 2A22A 4LACC 3ICFA 5IOHA 4JA9A 1V73A 3RL4A 5HPEA 4Q7FA 2O8GA 2ZBMA 4ORBA 2HY1A 4HD0A 2BCDA 4I5NC 4B2OA 1KBPA 1II7A 3V4YA 3PSNA 4H2GA 3ZTVA 1S70A 3E7AA 5B8IA 1G5BA 4LU9A
chains in the Genus database with same CATH superfamily
4NZVA 3F6HA 2RTXA 2IE3C 2L3CA 1MEYC 4IYPC 4H1YP 4DT2A 3RMPA 2Z72A 4M9VC 2JXPA 3J81C 2DLKA 3IWBA 3EPKA 4X64E 2LTRA 5EQVA 4DR6E 2VF1A 2K4VA 4KZSA 2B7TA 4BC9A 1U32A 4TUGA 1PJTA 4NXME 2EN1A 4UT3A 1ZBTA 2FGGA 3JTZA 2VE7C 1N34E 3HPZA 1STUA 3IWDA 2EOSA 2EPAA 5ADZA 2GPIA 4DV4E 2RSIA 4FBWA 4DV6E 1M63A 4F54A 2Q8UA 5LMUE 2YWQA 3IB8A 3RL5A 1RC7A 3C5WC 2CPNA 2F8BA 2EQ1A 4F6NA 3EPJA 4M2ZA 1XNQE 4MP0A 1HNXE 2F4VE 1AAYA 3H64A 4GKKE 2LUQA 4B3ME 1IBKE 3D03A 2JPAA 1HNZE 2EL4A 3H68A 1YYOA 4MOYA 2LV2A 2RS6A 2WDEA 2UUBE 2YSOA 3DSCA 4NXNE 1TCOA 3E0JA 2LUPB 2GJUA 3EPLA 1OIDA 2EOXA 4H2IA 5C1VA 3AUZA 2CSHA 3UK3C 2ENHA 2M1SA 4F6MA 4OX9E 1X3CA 2HYPA 4WFTA 1SR9A 2EM7A 2YRKA 3THNA 2K7IA 4JI5E 4B3SE 4GEQB 4O5GA 2WCC3 2M7QA 3T1HE 1F2IG 4DR5E 3MHHC 5KL6A 1IQOA 2M4IA 1G2DC 2YEQA 3THOB 2B9DA 4KHPE 4N4RB 4O24A 2L2KB 4DR2E 2EPXA 5AC5A 4LTYA 2DFJA 3J7AG 2I9IA 2EMZA 1S3NA 1XZWA 1I94E 4DSYA 2EJ4A 4ZYEA 2EOFA 4Q35B 2EMAA 2DGCA 4LFBE 4WSPA 2EM0A 2GLIA 5GTUA 3DF6A 4BMJA 2MKNA 2A22A 3ICFA 2L33A 3DJWA 3RL4A 1WJPA 2O8GA 2YRHA 2FTXB 3VHTB 4ORBA 1GQEA 4R2EA 1BBOA 1X49A 2EOIA 2YSPA 1X47A 1G2FC 2MKDA 2NA2A 4JI0E 3EPHA 3V4YA 2KHXA 2EM3A 2N8XA 3IWCA 5AE3A 1HNWE 3ZTVA 3OMLA 2EM9A 3VYXA 5IV8B 2CTDA 4WWLA 3P1XA 3LLHA 5A6KA 1A1KA 4H1SA 4WXDA 2EPPA 2LJHA 4X62E 5FLXC 1X5WA 1EH8A 4IJDA 5T6JA 2MDGA 2DMIA 3PSOA 4DMIA 1X6HA 2BBGA 2LO3A 2MC5A 4R2QA 2XMOA 2NYMC 2DLQA 3QFNA 1FKAE 4WXCA 2YTPA 1XM7A 4G9JA 2E1MA 1PJQA 3FGAC 3ADIA 1WHQA 1T70A 2RQLA 3N5UA 1OIEA 2YTDA 4DV3E 4DV7E 2JOBA 4L8NA 2ADRA 1EH7A 1DGCA 4J8ZA 2EL6A 3H61A 1A1HA 3KWRA 2YTGA 3HXLA 4ORCA 3EGHA 5KL5A 3AV0A 3H66A 3H09A 2LCEA 3ZOQB 3C4BA 4IS1C 2IE4C 1SFEA 4V0WA 2EOJA 2L8TA 2BDXA 2NYLC 3LMLA 4JI8E 2LTSA 5JJTA 1EH6A 3KZZA 3J80C 4LF7E 3ADJA 1UTEA 1BBGA 5CFFE 4X9JA 4K0KE 2B7VA 4MOVA 1T39A 4DHLA 1S3LA 3BIDA 2KKNA 2EOEA 3JYFA 4UT3B 1WARA 2V8QB 2V87A 1YSAC 4FBQA 4L5NC 2JOXA 2EN7A 5IWAE 4X66E 2HGHA 1T38A 2EMIA 1JK2A 2BB8A 4F9AB 2EMKA 2JY9A 2CV9A 2EL5A 4IL1A 2FV4B 2R17A 3ZU0A 4DV0E 2H36X 3QFMA 2EPNA 2LJUA 4LFCE 2R1FA 3HPSA 4R2PA 2LBSB 2EMFA 2YTIA 2ZOAA 3CK2A 3K7WC 1Z2XA 1QNTA 2EMCA 1N3GA 1TN9A 4LF8E 2RPCA 2NUFA 2YVTA 4M30A 2YRMA 3C6KA 4JI6E 4V0XA 3C9FA 2EN2A 2DXNA 1YUIA 5JPFA 2LMZA 2NPPC 2V89A 1YYKA 4F0ZA 2EPUA 2EPCA 2EM5A 4BHBA 5TSEA 2YT4A 3IVEA 1T4NA 1LLMC 3TGHA 1P47A 3IB7A 5A69A 2A25A 3BF2A 2DSYA 4LF6E 1RQ0A 4DR3E 4WPYA 2EMLA 2EOZA 2YPNA 1KYQA 4JI4E 4F9BB 2EORA 2EN3A 1WRJA 4JV5E 1XNRE 2JVAA 4B2OA 1WXRA 4GZNC 4DR7E 5A6BA 1KBPA 1II7A 4H2GA 2YZTA 4JYAE 2YTFA 1S70A 3E7AA 1X6FA 1G5BA 2YU8A 4LU9A 2UUCE 2LRSA 2NABA 4NHRA 4O43A 4JI1E 1YZ9A 4LF5E 1EKZA 3VYYA 1IBME 4ZVZA 4BHCA 2YTOA 4X65E 4KKZA 5F3WA 2KOUA 2L3JA 4BCAA 4Q28A 4KBPA 4RHBB 4F2JC 3H69A 5KL3A 4FK5C 2V86A 1WHNA 2EPKX 2EMXA 2EOYA 4BC7A 5AASA 1IMUA 2EPLX 4YKEA 2WBTA 3E7BA 1NNWA 4BBYA 3GVEA 5A2QC 3H67A 3T1YE 4B3TE 3H63A 2LT7A 2RS7A 2EM2A 2L2MA 1A1GA 1SU1A 2N3GA 4JA7A 1AH5A 1QU6A 4TUIA 2UUAE 1KJKA 3RQZA 2V83A 4AQYE 1O0WA 1XMOE 2EQ3A 2JYAA 2I13A 1HP1A 5A6AA 1IBLE 4LF4E 2E5LE 1HPUA 2P6BA 3ADGA 4HEIA 4MLVA 5A6JA 5LMNE 4RH8A 3JAMC 3JU0A 1UBDC 2DXLA 3FIGA 5INBA 2G7HA 5DNYA 1J5EE 4P78A 2JR1A 2VRDA 3P71C 1ZU1A 2YTEA 4X8WA 2UXCE 5LLQA 1MF8A 4WX9A 4WSGA 2JOGA 4ZX2A 2EMBA 4B3RE 1Z1BA 1FJGE 3LL8A 5A6BD 3DW8C 2YTJA 1JK7A 2EP3A 2EM6A 4ORAA 4R2DA 2L2NA 2VQEE 3HQ1A 2WZOA 2QFRA 4GKJE 3EGGA 1DQ3A 2ELZA 5J28A 1PKPA 1IT6A 2B3TB 2L92A 3ECRA 4V0VA 2EOHA 2EOOA 2GHFA 4J6OA 2QJCA 2EMGA 2WDCA 2EPOA 3BGHA 4DR1E 4LF9E 1FJMA 2EPMX 1W24A 2YTQA 2IHR1 4R2SA 2V85A 1ZR9A 2M9AA 1T4LB 1T71A 1N33E 2EPZA 4DKKA 2EMWA 2EZ6A 4KWYA 3K6QA 2EWLA 1A1LA 4Q7FA 1UILA 4P7DA 2CT1A 2DB2A 2DRPA 2YU5A 4ZYGA 2D9HA 2JWOA 1XMQE 4JI3E 2BCDA 2NUGA 2EN6A 1PJSA 3L00A 5KL4A 3PSNA 2NUEA 1MGTA 3F6GA 3HTXA 3VK6A 2ODRD 5B8IA 4R2AA 4UT2A 5KL2A 1GZ6A 1IQSA 5AE2A 1YPNA 4HTGA 3OTOE 2ZO9B 1TF3A 2EM4A 2VQFE 5JPEA 4R2RA 1J26A 1YFHA 1S3MA 2NXFA 2WBSA 4LFAE 2EMHA 2ZM6E 3QFKA 4DV2E 2ODRC 4OR9A 1DI2A 3IVDA 3ADLA 5AC4A 1WAO1 2EOMA 2AHDA 4O4KA 2HJJA 2HC5A 3MHSC 2USHA 4I5LC 2MDRA 2UU9E 2DMYA 1HO5A 2PRTA 1BB8A 1UF3A 1TF6A 2MC6A 3M99B 2EM8A 1A1JA 1NCSA 4DUYE 4FBKA 1N36E 2J7JA 2RSMA 4WYQB 3HVQA 4FCXA 4UWQA 3EQ1A 1S95A 2Z06A 2WDFA 4JI2E 2WBUA 4I8OA 1ZAAC 4H2BA 1Z2WA 2EE8A 3DSDA 3BBGA 5KL7A 3KZYA 1X48A 4BS9A 1B69A 2IAEC 2L6MA 3TQMA 1A1FA 2N3HA 2EPRA 5BR8E 1L4SA 2O8AA 2E72A 4H2FA 3QFOA 2UXDE 1GTKA 2EN4A 1PDAA 3MSWA 2YTNA 3C6MA 1AUIA 2EN8A 4JI7E 1YUJA 1YYWA 4DUZE 1USHA 2Z1AA 3QG5C 2QFPA 4ZYHA 2KONA 2R76A 5LL6R 4ZYDA 2BQ8X 2HYOA 2WDDA 3H60A 5IXMB 4F9CB 1QFCA 1OI8A 4XPNA 3K7VC 1QHWA 1A1IA 1UHZA 1S8EA 2EQ0A 3RL3A 1JK1A 1UN6B 1N32E 2LVHA 4DV5E 5AE1A 1RMDA 2ENCA 2DIXA 3KBPA 2LE2A 3J7Yp 4DR4E 4R8OA 3H62B 4DV1E 3C4TA 4M0VA 4R03A 3FLOA 4LACC 2HHHE 3T1IA 4MLQA 5IOHA 4JA9A 1V73A 1ZBQA 2UXBE 5HPEA 2ZBMA 1HR0E 2EOQA 2EMYA 2HY1A 4HD0A 2JP9A 4I5NC 1X6EA 2ELYA 2ENAA 4OOGC 1T4OA 4YY3E 2V88A 4R2CA 1NEIA 5IT9C 4YHHE
chains in the Genus database with same CATH topology
4WWLA 4UT2A 4NZVA 2IE3C 4H1SA 4O43A 4IYPC 2ZO9B 4H1YP 4DT2A 4ZVZA 5JPEA 2Z72A 3PSOA 1S3MA 2NXFA 4KKZA 3QFKA 5F3WA 2XMOA 2NYMC 4OR9A 5EQVA 3QFNA 3IVDA 1WAO1 1XM7A 4KBPA 2AHDA 3H69A 4G9JA 4O4KA 3FGAC 1U32A 2USHA 1T70A 4I5LC 4TUGA 3N5UA 1OIEA 4UT3A 1HO5A 4YKEA 1UF3A 3E7BA 1NNWA 3GVEA 3H61A 3H67A 4FBWA 1M63A 3H63A 4FBKA 2Q8UA 3EGHA 3H66A 3AV0A 3IB8A 4ORCA 3HVQA 4FCXA 3C5WC 3RL5A 2IE4C 1SU1A 4UWQA 4V0WA 4JA7A 1S95A 2Z06A 2WDFA 3RQZA 2BDXA 2NYLC 4TUIA 4H2BA 1Z2WA 3H64A 3DSDA 5JJTA 3D03A 1UTEA 1HP1A 3H68A 2P6BA 4MP0A 1HPUA 4MOYA 2IAEC 2WDEA 4MOVA 4DHLA 1S3LA 2KKNA 3DSCA 1TCOA 2DXLA 3JYFA 4UT3B 3E0JA 1WARA 5INBA 2GJUA 4FBQA 2O8AA 1OIDA 4H2FA 5DNYA 3QFOA 4H2IA 5C1VA 3AUZA 3P71C 2HYPA 1MF8A 2JOGA 4ZX2A 2CV9A 3LL8A 3THNA 1AUIA 3DW8C 4IL1A 1JK7A 2R17A 4O5GA 3ZU0A 1USHA 3QFMA 2YEQA 4ORAA 3THOB 2Z1AA 3QG5C 2QFRA 3EGGA 2QFPA 5J28A 3CK2A 4O24A 2ZOAA 3K7WC 2WDDA 2HYOA 1IT6A 2BQ8X 2DFJA 1Z2XA 3H60A 4LTYA 4V0VA 1QFCA 1OI8A 4J6OA 1S3NA 1XZWA 2QJCA 3K7VC 4XPNA 2YVTA 4DSYA 1QHWA 2WDCA 1S8EA 4V0XA 3C9FA 2DXNA 3RL3A 5JPFA 1FJMA 2NPPC 1W24A 4F0ZA 3IVEA 3KBPA 5GTUA 3TGHA 3H62B 1T71A 3IB7A 3FLOA 4M0VA 3T1IA 2A22A 4LACC 3ICFA 5IOHA 4JA9A 1V73A 3RL4A 5HPEA 4Q7FA 2O8GA 2ZBMA 4ORBA 2HY1A 4HD0A 2BCDA 4I5NC 4B2OA 1KBPA 1II7A 3V4YA 3PSNA 4H2GA 3ZTVA 1S70A 3E7AA 5B8IA 1G5BA 4LU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWL A;  4UT2 A;  4NZV A;  2IE3 C;  4H1S A;  4O43 A;  4IYP C;  4H1Y P;  4DT2 A;  4ZVZ A;  5JPE A;  2Z72 A;  3PSO A;  1S3M A;  2NXF A;  4KKZ A;  3QFK A;  5F3W A;  2XMO A;  2NYM C;  4OR9 A;  5EQV A;  3QFN A;  3IVD A;  1WAO 1;  1XM7 A;  4KBP A;  2AHD A;  3H69 A;  4G9J A;  4O4K A;  3FGA C;  1U32 A;  2USH A;  1T70 A;  4I5L C;  4TUG A;  3N5U A;  1OIE A;  4UT3 A;  1HO5 A;  4YKE A;  1UF3 A;  3E7B A;  1NNW A;  3GVE A;  3H61 A;  3H67 A;  4FBW A;  1M63 A;  3H63 A;  4FBK A;  2Q8U A;  3EGH A;  3H66 A;  3AV0 A;  3IB8 A;  4ORC A;  3HVQ A;  4FCX A;  3C5W C;  3RL5 A;  2IE4 C;  1SU1 A;  4UWQ A;  4V0W A;  4JA7 A;  1S95 A;  2Z06 A;  2WDF A;  3RQZ A;  2BDX A;  2NYL C;  4TUI A;  4H2B A;  1Z2W A;  3H64 A;  3DSD A;  5JJT A;  1UTE A;  1HP1 A;  3H68 A;  2P6B A;  4MP0 A;  1HPU A;  4MOY A;  2IAE C;  2WDE A;  4MOV A;  4DHL A;  1S3L A;  2KKN A;  3DSC A;  1TCO A;  3JYF A;  4UT3 B;  1WAR A;  5INB A;  2GJU A;  4FBQ A;  2O8A A;  1OID A;  4H2F A;  5DNY A;  3QFO A;  4H2I A;  5C1V A;  3AUZ A;  3P71 C;  2HYP A;  1MF8 A;  2JOG A;  4ZX2 A;  2CV9 A;  3LL8 A;  3THN A;  1AUI A;  3DW8 C;  4IL1 A;  1JK7 A;  2R17 A;  4O5G A;  3ZU0 A;  1USH A;  3QFM A;  4ORA A;  3THO B;  2Z1A A;  3QG5 C;  2QFR A;  3EGG A;  2QFP A;  5J28 A;  3CK2 A;  4O24 A;  3K7W C;  2WDD A;  2HYO A;  1IT6 A;  2BQ8 X;  2DFJ A;  1Z2X A;  3H60 A;  4LTY A;  4V0V A;  1QFC A;  1OI8 A;  4J6O A;  2QJC A;  1S3N A;  1XZW A;  3K7V C;  4XPN A;  2YVT A;  4DSY A;  1QHW A;  2WDC A;  1S8E A;  4V0X A;  3C9F A;  3RL3 A;  5JPF A;  1FJM A;  2NPP C;  1W24 A;  4F0Z A;  3IVE A;  3KBP A;  5GTU A;  3TGH A;  3H62 B;  1T71 A;  3IB7 A;  4M0V A;  3T1I A;  2A22 A;  4LAC C;  3ICF A;  5IOH A;  4JA9 A;  1V73 A;  3RL4 A;  5HPE A;  4Q7F A;  2O8G A;  2ZBM A;  4ORB A;  2HY1 A;  4HD0 A;  2BCD A;  4I5N C;  4B2O A;  1KBP A;  1II7 A;  3V4Y A;  3PSN A;  4H2G A;  3ZTV A;  1S70 A;  3E7A A;  5B8I A;  1G5B A;  4LU9 A; 
#chains in the Genus database with same CATH topology
 4NZV A;  3F6H A;  2RTX A;  2IE3 C;  2L3C A;  1MEY C;  4IYP C;  4H1Y P;  4DT2 A;  3RMP A;  2Z72 A;  4M9V C;  2JXP A;  3J81 C;  2DLK A;  3IWB A;  3EPK A;  4X64 E;  2LTR A;  5EQV A;  4DR6 E;  2VF1 A;  2K4V A;  4KZS A;  2B7T A;  4BC9 A;  1U32 A;  4TUG A;  1PJT A;  4NXM E;  2EN1 A;  4UT3 A;  1ZBT A;  2FGG A;  3JTZ A;  2VE7 C;  1N34 E;  3HPZ A;  1STU A;  3IWD A;  2EOS A;  2EPA A;  5ADZ A;  2GPI A;  4DV4 E;  2RSI A;  4FBW A;  4DV6 E;  1M63 A;  4F54 A;  2Q8U A;  5LMU E;  2YWQ A;  3IB8 A;  3RL5 A;  1RC7 A;  3C5W C;  2CPN A;  2F8B A;  2EQ1 A;  4F6N A;  3EPJ A;  4M2Z A;  1XNQ E;  4MP0 A;  1HNX E;  2F4V E;  1AAY A;  3H64 A;  4GKK E;  2LUQ A;  4B3M E;  1IBK E;  3D03 A;  2JPA A;  1HNZ E;  2EL4 A;  3H68 A;  1YYO A;  4MOY A;  2LV2 A;  2RS6 A;  2WDE A;  2UUB E;  2YSO A;  3DSC A;  4NXN E;  1TCO A;  3E0J A;  2LUP B;  2GJU A;  3EPL A;  1OID A;  2EOX A;  4H2I A;  5C1V A;  3AUZ A;  2CSH A;  3UK3 C;  2ENH A;  2M1S A;  4F6M A;  4OX9 E;  1X3C A;  2HYP A;  4WFT A;  1SR9 A;  2EM7 A;  2YRK A;  3THN A;  2K7I A;  4JI5 E;  4B3S E;  4GEQ B;  4O5G A;  2WCC 3;  2M7Q A;  3T1H E;  1F2I G;  4DR5 E;  3MHH C;  5KL6 A;  1IQO A;  2M4I A;  1G2D C;  2YEQ A;  3THO B;  2B9D A;  4KHP E;  4N4R B;  4O24 A;  2L2K B;  4DR2 E;  2EPX A;  5AC5 A;  4LTY A;  2DFJ A;  3J7A G;  2I9I A;  2EMZ A;  1S3N A;  1XZW A;  1I94 E;  4DSY A;  2EJ4 A;  4ZYE A;  2EOF A;  4Q35 B;  2EMA A;  2DGC A;  4LFB E;  4WSP A;  2EM0 A;  2GLI A;  5GTU A;  3DF6 A;  4BMJ A;  2MKN A;  2A22 A;  3ICF A;  2L33 A;  3DJW A;  3RL4 A;  1WJP A;  2O8G A;  2YRH A;  2FTX B;  3VHT B;  4ORB A;  1GQE A;  4R2E A;  1BBO A;  1X49 A;  2EOI A;  2YSP A;  1X47 A;  1G2F C;  2MKD A;  2NA2 A;  4JI0 E;  3EPH A;  3V4Y A;  2KHX A;  2EM3 A;  2N8X A;  3IWC A;  5AE3 A;  1HNW E;  3ZTV A;  3OML A;  2EM9 A;  3VYX A;  5IV8 B;  2CTD A;  4WWL A;  3P1X A;  3LLH A;  5A6K A;  1A1K A;  4H1S A;  4WXD A;  2EPP A;  2LJH A;  4X62 E;  5FLX C;  1X5W A;  1EH8 A;  4IJD A;  5T6J A;  2MDG A;  2DMI A;  3PSO A;  4DMI A;  1X6H A;  2BBG A;  2LO3 A;  2MC5 A;  4R2Q A;  2XMO A;  2NYM C;  2DLQ A;  3QFN A;  1FKA E;  4WXC A;  2YTP A;  1XM7 A;  4G9J A;  2E1M A;  1PJQ A;  3FGA C;  3ADI A;  1WHQ A;  1T70 A;  2RQL A;  3N5U A;  1OIE A;  2YTD A;  4DV3 E;  4DV7 E;  2JOB A;  4L8N A;  2ADR A;  1EH7 A;  1DGC A;  4J8Z A;  2EL6 A;  3H61 A;  1A1H A;  3KWR A;  2YTG A;  3HXL A;  4ORC A;  3EGH A;  5KL5 A;  3AV0 A;  3H66 A;  3H09 A;  2LCE A;  3ZOQ B;  3C4B A;  4IS1 C;  2IE4 C;  1SFE A;  4V0W A;  2EOJ A;  2L8T A;  2BDX A;  2NYL C;  3LML A;  4JI8 E;  2LTS A;  5JJT A;  1EH6 A;  3KZZ A;  3J80 C;  4LF7 E;  3ADJ A;  1UTE A;  1BBG A;  5CFF E;  4X9J A;  4K0K E;  2B7V A;  4MOV A;  1T39 A;  4DHL A;  1S3L A;  3BID A;  2KKN A;  2EOE A;  3JYF A;  4UT3 B;  1WAR A;  2V8Q B;  2V87 A;  1YSA C;  4FBQ A;  4L5N C;  2JOX A;  2EN7 A;  5IWA E;  4X66 E;  2HGH A;  1T38 A;  2EMI A;  1JK2 A;  2BB8 A;  4F9A B;  2EMK A;  2JY9 A;  2CV9 A;  2EL5 A;  4IL1 A;  2FV4 B;  2R17 A;  3ZU0 A;  4DV0 E;  2H36 X;  3QFM A;  2EPN A;  2LJU A;  4LFC E;  2R1F A;  3HPS A;  4R2P A;  2LBS B;  2EMF A;  2YTI A;  2ZOA A;  3CK2 A;  3K7W C;  1Z2X A;  1QNT A;  2EMC A;  1N3G A;  1TN9 A;  4LF8 E;  2RPC A;  2NUF A;  2YVT A;  4M30 A;  2YRM A;  3C6K A;  4JI6 E;  4V0X A;  3C9F A;  2EN2 A;  2DXN A;  1YUI A;  5JPF A;  2LMZ A;  2NPP C;  2V89 A;  1YYK A;  4F0Z A;  2EPU A;  2EPC A;  2EM5 A;  4BHB A;  5TSE A;  2YT4 A;  3IVE A;  1T4N A;  1LLM C;  3TGH A;  1P47 A;  3IB7 A;  5A69 A;  2A25 A;  3BF2 A;  2DSY A;  4LF6 E;  1RQ0 A;  4DR3 E;  4WPY A;  2EML A;  2EOZ A;  2YPN A;  1KYQ A;  4JI4 E;  4F9B B;  2EOR A;  2EN3 A;  1WRJ A;  4JV5 E;  1XNR E;  2JVA A;  4B2O A;  1WXR A;  4GZN C;  4DR7 E;  5A6B A;  1KBP A;  1II7 A;  4H2G A;  2YZT A;  4JYA E;  2YTF A;  1S70 A;  3E7A A;  1X6F A;  1G5B A;  2YU8 A;  4LU9 A;  2UUC E;  2LRS A;  2NAB A;  4NHR A;  4O43 A;  4JI1 E;  1YZ9 A;  4LF5 E;  1EKZ A;  3VYY A;  1IBM E;  4ZVZ A;  4BHC A;  2YTO A;  4X65 E;  4KKZ A;  5F3W A;  2KOU A;  2L3J A;  4BCA A;  4Q28 A;  4KBP A;  4RHB B;  4F2J C;  3H69 A;  5KL3 A;  4FK5 C;  2V86 A;  1WHN A;  2EPK X;  2EMX A;  2EOY A;  4BC7 A;  5AAS A;  1IMU A;  2EPL X;  4YKE A;  2WBT A;  3E7B A;  1NNW A;  4BBY A;  3GVE A;  5A2Q C;  3H67 A;  3T1Y E;  4B3T E;  3H63 A;  2LT7 A;  2RS7 A;  2EM2 A;  2L2M A;  1A1G A;  1SU1 A;  2N3G A;  4JA7 A;  1AH5 A;  1QU6 A;  4TUI A;  2UUA E;  1KJK A;  3RQZ A;  2V83 A;  4AQY E;  1O0W A;  1XMO E;  2EQ3 A;  2JYA A;  2I13 A;  1HP1 A;  5A6A A;  1IBL E;  4LF4 E;  2E5L E;  1HPU A;  2P6B A;  3ADG A;  4HEI A;  4MLV A;  5A6J A;  5LMN E;  4RH8 A;  3JAM C;  3JU0 A;  1UBD C;  2DXL A;  3FIG A;  5INB A;  2G7H A;  5DNY A;  1J5E E;  4P78 A;  2JR1 A;  2VRD A;  3P71 C;  1ZU1 A;  2YTE A;  4X8W A;  2UXC E;  5LLQ A;  1MF8 A;  4WX9 A;  4WSG A;  2JOG A;  4ZX2 A;  2EMB A;  4B3R E;  1Z1B A;  1FJG E;  3LL8 A;  5A6B D;  3DW8 C;  2YTJ A;  1JK7 A;  2EP3 A;  2EM6 A;  4ORA A;  4R2D A;  2L2N A;  2VQE E;  3HQ1 A;  2WZO A;  2QFR A;  4GKJ E;  3EGG A;  1DQ3 A;  2ELZ A;  5J28 A;  1PKP A;  1IT6 A;  2B3T B;  2L92 A;  3ECR A;  4V0V A;  2EOH A;  2EOO A;  2GHF A;  4J6O A;  2QJC A;  2EMG A;  2WDC A;  2EPO A;  3BGH A;  4DR1 E;  4LF9 E;  1FJM A;  2EPM X;  1W24 A;  2YTQ A;  2IHR 1;  4R2S A;  2V85 A;  1ZR9 A;  2M9A A;  1T4L B;  1T71 A;  1N33 E;  2EPZ A;  4DKK A;  2EMW A;  2EZ6 A;  4KWY A;  3K6Q A;  2EWL A;  1A1L A;  4Q7F A;  1UIL A;  4P7D A;  2CT1 A;  2DB2 A;  2DRP A;  2YU5 A;  4ZYG A;  2D9H A;  2JWO A;  1XMQ E;  4JI3 E;  2BCD A;  2NUG A;  2EN6 A;  1PJS A;  3L00 A;  5KL4 A;  3PSN A;  2NUE A;  1MGT A;  3F6G A;  3HTX A;  3VK6 A;  2ODR D;  5B8I A;  4R2A A;  4UT2 A;  5KL2 A;  1GZ6 A;  1IQS A;  5AE2 A;  1YPN A;  4HTG A;  3OTO E;  2ZO9 B;  1TF3 A;  2EM4 A;  2VQF E;  5JPE A;  4R2R A;  1J26 A;  1YFH A;  1S3M A;  2NXF A;  2WBS A;  4LFA E;  2EMH A;  2ZM6 E;  3QFK A;  4DV2 E;  2ODR C;  4OR9 A;  1DI2 A;  3IVD A;  3ADL A;  5AC4 A;  1WAO 1;  2EOM A;  2AHD A;  4O4K A;  2HJJ A;  2HC5 A;  3MHS C;  2USH A;  4I5L C;  2MDR A;  2UU9 E;  2DMY A;  1HO5 A;  2PRT A;  1BB8 A;  1UF3 A;  1TF6 A;  2MC6 A;  3M99 B;  2EM8 A;  1A1J A;  1NCS A;  4DUY E;  4FBK A;  1N36 E;  2J7J A;  2RSM A;  4WYQ B;  3HVQ A;  4FCX A;  4UWQ A;  3EQ1 A;  1S95 A;  2Z06 A;  2WDF A;  4JI2 E;  2WBU A;  4I8O A;  1ZAA C;  4H2B A;  1Z2W A;  2EE8 A;  3DSD A;  3BBG A;  5KL7 A;  3KZY A;  1X48 A;  4BS9 A;  1B69 A;  2IAE C;  2L6M A;  3TQM A;  1A1F A;  2N3H A;  2EPR A;  5BR8 E;  1L4S A;  2O8A A;  2E72 A;  4H2F A;  3QFO A;  2UXD E;  1GTK A;  2EN4 A;  1PDA A;  3MSW A;  2YTN A;  3C6M A;  1AUI A;  2EN8 A;  4JI7 E;  1YUJ A;  1YYW A;  4DUZ E;  1USH A;  2Z1A A;  3QG5 C;  2QFP A;  4ZYH A;  2KON A;  2R76 A;  5LL6 R;  4ZYD A;  2BQ8 X;  2HYO A;  2WDD A;  3H60 A;  5IXM B;  4F9C B;  1QFC A;  1OI8 A;  4XPN A;  3K7V C;  1QHW A;  1A1I A;  1UHZ A;  1S8E A;  2EQ0 A;  3RL3 A;  1JK1 A;  1UN6 B;  1N32 E;  2LVH A;  4DV5 E;  5AE1 A;  1RMD A;  2ENC A;  2DIX A;  3KBP A;  2LE2 A;  3J7Y p;  4DR4 E;  4R8O A;  3H62 B;  4DV1 E;  3C4T A;  4M0V A;  4R03 A;  3FLO A;  4LAC C;  2HHH E;  3T1I A;  4MLQ A;  5IOH A;  4JA9 A;  1V73 A;  1ZBQ A;  2UXB E;  5HPE A;  2ZBM A;  1HR0 E;  2EOQ A;  2EMY A;  2HY1 A;  4HD0 A;  2JP9 A;  4I5N C;  1X6E A;  2ELY A;  2ENA A;  4OOG C;  1T4O A;  4YY3 E;  2V88 A;  4R2C A;  1NEI A;  5IT9 C;  4YHH E; 
#chains in the Genus database with same CATH homology
 4WWL A;  4UT2 A;  4NZV A;  2IE3 C;  4H1S A;  4O43 A;  4IYP C;  2ZO9 B;  4H1Y P;  4DT2 A;  4ZVZ A;  5JPE A;  2Z72 A;  3PSO A;  1S3M A;  2NXF A;  4KKZ A;  3QFK A;  5F3W A;  2XMO A;  2NYM C;  4OR9 A;  5EQV A;  3QFN A;  3IVD A;  1WAO 1;  1XM7 A;  4KBP A;  2AHD A;  3H69 A;  4G9J A;  4O4K A;  3FGA C;  1U32 A;  2USH A;  1T70 A;  4I5L C;  4TUG A;  3N5U A;  1OIE A;  4UT3 A;  1HO5 A;  4YKE A;  1UF3 A;  3E7B A;  1NNW A;  3GVE A;  3H61 A;  3H67 A;  4FBW A;  1M63 A;  3H63 A;  4FBK A;  2Q8U A;  3EGH A;  3H66 A;  3AV0 A;  3IB8 A;  4ORC A;  3HVQ A;  4FCX A;  3C5W C;  3RL5 A;  2IE4 C;  1SU1 A;  4UWQ A;  4V0W A;  4JA7 A;  1S95 A;  2Z06 A;  2WDF A;  3RQZ A;  2BDX A;  2NYL C;  4TUI A;  4H2B A;  1Z2W A;  3H64 A;  3DSD A;  5JJT A;  3D03 A;  1UTE A;  1HP1 A;  3H68 A;  2P6B A;  4MP0 A;  1HPU A;  4MOY A;  2IAE C;  2WDE A;  4MOV A;  4DHL A;  1S3L A;  2KKN A;  3DSC A;  1TCO A;  2DXL A;  3JYF A;  4UT3 B;  3E0J A;  1WAR A;  5INB A;  2GJU A;  4FBQ A;  2O8A A;  1OID A;  4H2F A;  5DNY A;  3QFO A;  4H2I A;  5C1V A;  3AUZ A;  3P71 C;  2HYP A;  1MF8 A;  2JOG A;  4ZX2 A;  2CV9 A;  3LL8 A;  3THN A;  1AUI A;  3DW8 C;  4IL1 A;  1JK7 A;  2R17 A;  4O5G A;  3ZU0 A;  1USH A;  3QFM A;  2YEQ A;  4ORA A;  3THO B;  2Z1A A;  3QG5 C;  2QFR A;  3EGG A;  2QFP A;  5J28 A;  3CK2 A;  4O24 A;  2ZOA A;  3K7W C;  2WDD A;  2HYO A;  1IT6 A;  2BQ8 X;  2DFJ A;  1Z2X A;  3H60 A;  4LTY A;  4V0V A;  1QFC A;  1OI8 A;  4J6O A;  1S3N A;  1XZW A;  2QJC A;  3K7V C;  4XPN A;  2YVT A;  4DSY A;  1QHW A;  2WDC A;  1S8E A;  4V0X A;  3C9F A;  2DXN A;  3RL3 A;  5JPF A;  1FJM A;  2NPP C;  1W24 A;  4F0Z A;  3IVE A;  3KBP A;  5GTU A;  3TGH A;  3H62 B;  1T71 A;  3IB7 A;  3FLO A;  4M0V A;  3T1I A;  2A22 A;  4LAC C;  3ICF A;  5IOH A;  4JA9 A;  1V73 A;  3RL4 A;  5HPE A;  4Q7F A;  2O8G A;  2ZBM A;  4ORB A;  2HY1 A;  4HD0 A;  2BCD A;  4I5N C;  4B2O A;  1KBP A;  1II7 A;  3V4Y A;  3PSN A;  4H2G A;  3ZTV A;  1S70 A;  3E7A A;  5B8I A;  1G5B A;  4LU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...