4XPNA

Crystal structure of protein phosphate 1 complexed with pp1 binding domain of gadd34
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
MGSLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Structural and Functional Analysis of the GADD34:PP1 eIF2 alpha Phosphatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 296
sequence length 296
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4xpnA00
4UT2A 1NNWA 1S3LA 4FBWA 4O4KA 4J6OA 4WWLA 4UT3A 2XMOA 3E7BA 4G9JA 1HO5A 4H1YP 5GTUA 5INBA 1USHA 4DHLA 5HPEA 1OIEA 3E7AA 2JOGA 5EQVA 4O5GA 3N5UA 4LACC 4ORBA 2QFPA 4HD0A 3K7WC 4TUIA 1IT6A 4ZVZA 4FBKA 3H61A 3THNA 3DW8C 5C1VA 3RL3A 1Z2WA 1QHWA 3IVDA 4F0ZA 5B8IA 3TGHA 3AUZA 3H67A 1S3NA 2DFJA 4FCXA 1T71A 2BCDA 4MOVA 2CV9A 3ZU0A 5IOHA 3IB8A 4H2BA 1OIDA 3CK2A 1G5BA 1SU1A 4FBQA 4V0WA 1XZWA 3H64A 5JPFA 2HYOA 4JA9A 3HVQA 2QJCA 3QFNA 4H2IA 2HY1A 3DSCA 2YVTA 1UTEA 2IE4C 3RQZA 4I5NC 3PSNA 3EGGA 1FJMA 2AHDA 3C5WC 4H2GA 3H68A 4O24A 3PSOA 4ORCA 1W24A 1JK7A 1UF3A 3IB7A 1MF8A 5JPEA 2P6BA 4OR9A 2KKNA 4KKZA 2NYMC 3K7VC 1OI8A 4NZVA 3H69A 4DT2A 2R17A 2NPPC 3LL8A 2WDCA 2Z72A 2ZBMA 2IAEC 4UT3B 1HP1A 3T1IA 3GVEA 4I5LC 5DNYA 3H60A 1HPUA 1QFCA 2QFRA 3KBPA 3QFMA 4IYPC 4Q7FA 1U32A 2GJUA 3QFKA 2NYLC 4ORAA 3C9FA 2WDFA 4H2FA 2IE3C 3P71C 1WAO1 4O43A 2USHA 4TUGA 3DSDA 1AUIA 1S95A 4V0VA 2BDXA 3EGHA 2NXFA 1V73A 1M63A 4MOYA 4LTYA 4UWQA 4ZX2A 5F3WA 4YKEA 2Q8UA 2HYPA 3ZTVA 3H62B 1KBPA 2O8GA 1WARA 1Z2XA 3QG5C 5J28A 4IL1A 3H63A 4MP0A 4KBPA 1XM7A 3V4YA 1TCOA 4V0XA 4DSYA 2WDDA 3AV0A 2Z1AA 4XPNA 1S70A 3QFOA 1S8EA 3JYFA 3ICFA 3H66A 3IVEA 4H1SA 2WDEA 1II7A 2Z06A 2O8AA 3THOB 1T70A 4B2OA 3RL4A 4LU9A 3RL5A 2A22A 5JJTA 4M0VA 1S3MA 3FGAC 2BQ8X 4JA7A
chains in the Genus database with same CATH superfamily
2DXLA 4UT2A 1NNWA 1S3LA 2ZOAA 4FBWA 4O4KA 4J6OA 4WWLA 4UT3A 2XMOA 3E7BA 4G9JA 1HO5A 4H1YP 5GTUA 5INBA 1USHA 4DHLA 5HPEA 1OIEA 3E7AA 2JOGA 5EQVA 4O5GA 3N5UA 4LACC 4ORBA 2QFPA 4HD0A 3K7WC 4TUIA 1IT6A 4ZVZA 4FBKA 3H61A 3THNA 3DW8C 5C1VA 3RL3A 1Z2WA 1QHWA 3IVDA 4F0ZA 5B8IA 3TGHA 3AUZA 3H67A 3D03A 1S3NA 2DFJA 4FCXA 1T71A 2BCDA 4MOVA 2CV9A 3ZU0A 5IOHA 3IB8A 4H2BA 1OIDA 3CK2A 1G5BA 1SU1A 4FBQA 4V0WA 1XZWA 3FLOA 3H64A 5JPFA 2HYOA 4JA9A 3HVQA 2QJCA 3QFNA 4H2IA 2HY1A 2DXNA 3DSCA 2YVTA 1UTEA 2IE4C 3RQZA 2ZO9B 4I5NC 3PSNA 3EGGA 1FJMA 2AHDA 3C5WC 4H2GA 3H68A 4O24A 3PSOA 4ORCA 1W24A 1JK7A 1UF3A 3IB7A 1MF8A 5JPEA 2P6BA 4OR9A 2KKNA 4KKZA 2NYMC 3K7VC 1OI8A 4NZVA 3H69A 4DT2A 2R17A 2NPPC 3LL8A 2WDCA 2Z72A 2ZBMA 2IAEC 4UT3B 1HP1A 3T1IA 3GVEA 4I5LC 5DNYA 3H60A 1HPUA 1QFCA 2QFRA 3KBPA 3QFMA 4IYPC 4Q7FA 1U32A 2GJUA 3QFKA 2NYLC 4ORAA 3C9FA 2WDFA 4H2FA 2IE3C 3P71C 1WAO1 4O43A 2USHA 4TUGA 3DSDA 1AUIA 1S95A 4V0VA 2BDXA 3EGHA 3E0JA 2NXFA 1V73A 1M63A 4MOYA 4LTYA 4UWQA 4ZX2A 5F3WA 4YKEA 2Q8UA 2HYPA 3ZTVA 3H62B 1KBPA 2O8GA 1WARA 1Z2XA 3QG5C 5J28A 4IL1A 3H63A 4MP0A 4KBPA 1XM7A 3V4YA 1TCOA 4V0XA 4DSYA 2WDDA 3AV0A 2Z1AA 4XPNA 1S70A 3QFOA 1S8EA 3JYFA 3ICFA 3H66A 3IVEA 4H1SA 2WDEA 1II7A 2Z06A 2O8AA 3THOB 1T70A 4B2OA 2YEQA 3RL4A 4LU9A 3RL5A 2A22A 5JJTA 4M0VA 1S3MA 3FGAC 2BQ8X 4JA7A
chains in the Genus database with same CATH topology
2DXLA 4UT2A 1NNWA 1S3LA 2ZOAA 4FBWA 4O4KA 4J6OA 4WWLA 4UT3A 2XMOA 3E7BA 4G9JA 1HO5A 4H1YP 5GTUA 5INBA 1USHA 4DHLA 5HPEA 1OIEA 3E7AA 2JOGA 5EQVA 4O5GA 3N5UA 4LACC 4ORBA 2QFPA 4HD0A 3K7WC 4TUIA 1IT6A 4ZVZA 4FBKA 3H61A 3THNA 3DW8C 5C1VA 3RL3A 1Z2WA 1QHWA 3IVDA 4F0ZA 5B8IA 3TGHA 3AUZA 3H67A 3D03A 1S3NA 2DFJA 4FCXA 1T71A 2BCDA 4MOVA 2CV9A 3ZU0A 5IOHA 3IB8A 4H2BA 1OIDA 3CK2A 1G5BA 1SU1A 4FBQA 4V0WA 1XZWA 3FLOA 3H64A 5JPFA 2HYOA 4JA9A 3HVQA 2QJCA 3QFNA 4H2IA 2HY1A 2DXNA 3DSCA 2YVTA 1UTEA 2IE4C 3RQZA 2ZO9B 4I5NC 3PSNA 3EGGA 1FJMA 2AHDA 3C5WC 4H2GA 3H68A 4O24A 3PSOA 4ORCA 1W24A 1JK7A 1UF3A 3IB7A 1MF8A 5JPEA 2P6BA 4OR9A 2KKNA 4KKZA 2NYMC 3K7VC 1OI8A 4NZVA 3H69A 4DT2A 2R17A 2NPPC 3LL8A 2WDCA 2Z72A 2ZBMA 2IAEC 4UT3B 1HP1A 3T1IA 3GVEA 4I5LC 5DNYA 3H60A 1HPUA 1QFCA 2QFRA 3KBPA 3QFMA 4IYPC 4Q7FA 1U32A 2GJUA 3QFKA 2NYLC 4ORAA 3C9FA 2WDFA 4H2FA 2IE3C 3P71C 1WAO1 4O43A 2USHA 4TUGA 3DSDA 1AUIA 1S95A 4V0VA 2BDXA 3EGHA 3E0JA 2NXFA 1V73A 1M63A 4MOYA 4LTYA 4UWQA 4ZX2A 5F3WA 4YKEA 2Q8UA 2HYPA 3ZTVA 3H62B 1KBPA 2O8GA 1WARA 1Z2XA 3QG5C 5J28A 4IL1A 3H63A 4MP0A 4KBPA 1XM7A 3V4YA 1TCOA 4V0XA 4DSYA 2WDDA 3AV0A 2Z1AA 4XPNA 1S70A 3QFOA 1S8EA 3JYFA 3ICFA 3H66A 3IVEA 4H1SA 2WDEA 1II7A 2Z06A 2O8AA 3THOB 1T70A 4B2OA 2YEQA 3RL4A 4LU9A 3RL5A 2A22A 5JJTA 4M0VA 1S3MA 3FGAC 2BQ8X 4JA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UT2 A;  1NNW A;  1S3L A;  4FBW A;  4O4K A;  4J6O A;  4WWL A;  4UT3 A;  2XMO A;  3E7B A;  4G9J A;  1HO5 A;  4H1Y P;  5GTU A;  5INB A;  1USH A;  4DHL A;  5HPE A;  1OIE A;  3E7A A;  2JOG A;  5EQV A;  4O5G A;  3N5U A;  4LAC C;  4ORB A;  2QFP A;  4HD0 A;  3K7W C;  4TUI A;  1IT6 A;  4ZVZ A;  4FBK A;  3H61 A;  3THN A;  3DW8 C;  5C1V A;  3RL3 A;  1Z2W A;  1QHW A;  3IVD A;  4F0Z A;  5B8I A;  3TGH A;  3AUZ A;  3H67 A;  1S3N A;  2DFJ A;  4FCX A;  1T71 A;  2BCD A;  4MOV A;  2CV9 A;  3ZU0 A;  5IOH A;  3IB8 A;  4H2B A;  1OID A;  3CK2 A;  1G5B A;  1SU1 A;  4FBQ A;  4V0W A;  1XZW A;  3H64 A;  5JPF A;  2HYO A;  4JA9 A;  3HVQ A;  2QJC A;  3QFN A;  4H2I A;  2HY1 A;  3DSC A;  2YVT A;  1UTE A;  2IE4 C;  3RQZ A;  4I5N C;  3PSN A;  3EGG A;  1FJM A;  2AHD A;  3C5W C;  4H2G A;  3H68 A;  4O24 A;  3PSO A;  4ORC A;  1W24 A;  1JK7 A;  1UF3 A;  3IB7 A;  1MF8 A;  5JPE A;  2P6B A;  4OR9 A;  2KKN A;  4KKZ A;  2NYM C;  3K7V C;  1OI8 A;  4NZV A;  3H69 A;  4DT2 A;  2R17 A;  2NPP C;  3LL8 A;  2WDC A;  2Z72 A;  2ZBM A;  2IAE C;  4UT3 B;  1HP1 A;  3T1I A;  3GVE A;  4I5L C;  5DNY A;  3H60 A;  1HPU A;  1QFC A;  2QFR A;  3KBP A;  3QFM A;  4IYP C;  4Q7F A;  1U32 A;  2GJU A;  3QFK A;  2NYL C;  4ORA A;  3C9F A;  2WDF A;  4H2F A;  2IE3 C;  3P71 C;  1WAO 1;  4O43 A;  2USH A;  4TUG A;  3DSD A;  1AUI A;  1S95 A;  4V0V A;  2BDX A;  3EGH A;  2NXF A;  1V73 A;  1M63 A;  4MOY A;  4LTY A;  4UWQ A;  4ZX2 A;  5F3W A;  4YKE A;  2Q8U A;  2HYP A;  3ZTV A;  3H62 B;  1KBP A;  2O8G A;  1WAR A;  1Z2X A;  3QG5 C;  5J28 A;  4IL1 A;  3H63 A;  4MP0 A;  4KBP A;  1XM7 A;  3V4Y A;  1TCO A;  4V0X A;  4DSY A;  2WDD A;  3AV0 A;  2Z1A A;  4XPN A;  1S70 A;  3QFO A;  1S8E A;  3JYF A;  3ICF A;  3H66 A;  3IVE A;  4H1S A;  2WDE A;  1II7 A;  2Z06 A;  2O8A A;  3THO B;  1T70 A;  4B2O A;  3RL4 A;  4LU9 A;  3RL5 A;  2A22 A;  5JJT A;  4M0V A;  1S3M A;  3FGA C;  2BQ8 X;  4JA7 A; 
#chains in the Genus database with same CATH topology
 2DXL A;  4UT2 A;  1NNW A;  1S3L A;  2ZOA A;  4FBW A;  4O4K A;  4J6O A;  4WWL A;  4UT3 A;  2XMO A;  3E7B A;  4G9J A;  1HO5 A;  4H1Y P;  5GTU A;  5INB A;  1USH A;  4DHL A;  5HPE A;  1OIE A;  3E7A A;  2JOG A;  5EQV A;  4O5G A;  3N5U A;  4LAC C;  4ORB A;  2QFP A;  4HD0 A;  3K7W C;  4TUI A;  1IT6 A;  4ZVZ A;  4FBK A;  3H61 A;  3THN A;  3DW8 C;  5C1V A;  3RL3 A;  1Z2W A;  1QHW A;  3IVD A;  4F0Z A;  5B8I A;  3TGH A;  3AUZ A;  3H67 A;  3D03 A;  1S3N A;  2DFJ A;  4FCX A;  1T71 A;  2BCD A;  4MOV A;  2CV9 A;  3ZU0 A;  5IOH A;  3IB8 A;  4H2B A;  1OID A;  3CK2 A;  1G5B A;  1SU1 A;  4FBQ A;  4V0W A;  1XZW A;  3FLO A;  3H64 A;  5JPF A;  2HYO A;  4JA9 A;  3HVQ A;  2QJC A;  3QFN A;  4H2I A;  2HY1 A;  2DXN A;  3DSC A;  2YVT A;  1UTE A;  2IE4 C;  3RQZ A;  2ZO9 B;  4I5N C;  3PSN A;  3EGG A;  1FJM A;  2AHD A;  3C5W C;  4H2G A;  3H68 A;  4O24 A;  3PSO A;  4ORC A;  1W24 A;  1JK7 A;  1UF3 A;  3IB7 A;  1MF8 A;  5JPE A;  2P6B A;  4OR9 A;  2KKN A;  4KKZ A;  2NYM C;  3K7V C;  1OI8 A;  4NZV A;  3H69 A;  4DT2 A;  2R17 A;  2NPP C;  3LL8 A;  2WDC A;  2Z72 A;  2ZBM A;  2IAE C;  4UT3 B;  1HP1 A;  3T1I A;  3GVE A;  4I5L C;  5DNY A;  3H60 A;  1HPU A;  1QFC A;  2QFR A;  3KBP A;  3QFM A;  4IYP C;  4Q7F A;  1U32 A;  2GJU A;  3QFK A;  2NYL C;  4ORA A;  3C9F A;  2WDF A;  4H2F A;  2IE3 C;  3P71 C;  1WAO 1;  4O43 A;  2USH A;  4TUG A;  3DSD A;  1AUI A;  1S95 A;  4V0V A;  2BDX A;  3EGH A;  3E0J A;  2NXF A;  1V73 A;  1M63 A;  4MOY A;  4LTY A;  4UWQ A;  4ZX2 A;  5F3W A;  4YKE A;  2Q8U A;  2HYP A;  3ZTV A;  3H62 B;  1KBP A;  2O8G A;  1WAR A;  1Z2X A;  3QG5 C;  5J28 A;  4IL1 A;  3H63 A;  4MP0 A;  4KBP A;  1XM7 A;  3V4Y A;  1TCO A;  4V0X A;  4DSY A;  2WDD A;  3AV0 A;  2Z1A A;  4XPN A;  1S70 A;  3QFO A;  1S8E A;  3JYF A;  3ICF A;  3H66 A;  3IVE A;  4H1S A;  2WDE A;  1II7 A;  2Z06 A;  2O8A A;  3THO B;  1T70 A;  4B2O A;  2YEQ A;  3RL4 A;  4LU9 A;  3RL5 A;  2A22 A;  5JJT A;  4M0V A;  1S3M A;  3FGA C;  2BQ8 X;  4JA7 A; 
#chains in the Genus database with same CATH homology
 2DXL A;  4UT2 A;  1NNW A;  1S3L A;  2ZOA A;  4FBW A;  4O4K A;  4J6O A;  4WWL A;  4UT3 A;  2XMO A;  3E7B A;  4G9J A;  1HO5 A;  4H1Y P;  5GTU A;  5INB A;  1USH A;  4DHL A;  5HPE A;  1OIE A;  3E7A A;  2JOG A;  5EQV A;  4O5G A;  3N5U A;  4LAC C;  4ORB A;  2QFP A;  4HD0 A;  3K7W C;  4TUI A;  1IT6 A;  4ZVZ A;  4FBK A;  3H61 A;  3THN A;  3DW8 C;  5C1V A;  3RL3 A;  1Z2W A;  1QHW A;  3IVD A;  4F0Z A;  5B8I A;  3TGH A;  3AUZ A;  3H67 A;  3D03 A;  1S3N A;  2DFJ A;  4FCX A;  1T71 A;  2BCD A;  4MOV A;  2CV9 A;  3ZU0 A;  5IOH A;  3IB8 A;  4H2B A;  1OID A;  3CK2 A;  1G5B A;  1SU1 A;  4FBQ A;  4V0W A;  1XZW A;  3FLO A;  3H64 A;  5JPF A;  2HYO A;  4JA9 A;  3HVQ A;  2QJC A;  3QFN A;  4H2I A;  2HY1 A;  2DXN A;  3DSC A;  2YVT A;  1UTE A;  2IE4 C;  3RQZ A;  2ZO9 B;  4I5N C;  3PSN A;  3EGG A;  1FJM A;  2AHD A;  3C5W C;  4H2G A;  3H68 A;  4O24 A;  3PSO A;  4ORC A;  1W24 A;  1JK7 A;  1UF3 A;  3IB7 A;  1MF8 A;  5JPE A;  2P6B A;  4OR9 A;  2KKN A;  4KKZ A;  2NYM C;  3K7V C;  1OI8 A;  4NZV A;  3H69 A;  4DT2 A;  2R17 A;  2NPP C;  3LL8 A;  2WDC A;  2Z72 A;  2ZBM A;  2IAE C;  4UT3 B;  1HP1 A;  3T1I A;  3GVE A;  4I5L C;  5DNY A;  3H60 A;  1HPU A;  1QFC A;  2QFR A;  3KBP A;  3QFM A;  4IYP C;  4Q7F A;  1U32 A;  2GJU A;  3QFK A;  2NYL C;  4ORA A;  3C9F A;  2WDF A;  4H2F A;  2IE3 C;  3P71 C;  1WAO 1;  4O43 A;  2USH A;  4TUG A;  3DSD A;  1AUI A;  1S95 A;  4V0V A;  2BDX A;  3EGH A;  3E0J A;  2NXF A;  1V73 A;  1M63 A;  4MOY A;  4LTY A;  4UWQ A;  4ZX2 A;  5F3W A;  4YKE A;  2Q8U A;  2HYP A;  3ZTV A;  3H62 B;  1KBP A;  2O8G A;  1WAR A;  1Z2X A;  3QG5 C;  5J28 A;  4IL1 A;  3H63 A;  4MP0 A;  4KBP A;  1XM7 A;  3V4Y A;  1TCO A;  4V0X A;  4DSY A;  2WDD A;  3AV0 A;  2Z1A A;  4XPN A;  1S70 A;  3QFO A;  1S8E A;  3JYF A;  3ICF A;  3H66 A;  3IVE A;  4H1S A;  2WDE A;  1II7 A;  2Z06 A;  2O8A A;  3THO B;  1T70 A;  4B2O A;  2YEQ A;  3RL4 A;  4LU9 A;  3RL5 A;  2A22 A;  5JJT A;  4M0V A;  1S3M A;  3FGA C;  2BQ8 X;  4JA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...