4TUIA

Crystal structure of mjmre11-dna1 complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
molecule keywords DNA double-strand break repair protein Mre11
total genus 94
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tuiA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tuiA01
3H67A 4ZX2A 3H62B 4NZVA 4O4KA 3T1IA 2NYLC 2QFPA 3V4YA 3P71C 4UT3A 3K7VC 2USHA 4ORAA 1OI8A 5B8IA 1QHWA 3RL4A 2JOGA 4KKZA 4H2IA 2NXFA 1S3LA 1W24A 2P6BA 3IVEA 3ZU0A 4FBQA 2QJCA 3H61A 2Z72A 2HYOA 4WWLA 2Z1AA 1S3MA 3IB8A 4MOYA 4FBWA 1QFCA 4H2GA 1V73A 2IAEC 4LTYA 4V0WA 4YKEA 2NPPC 3E7BA 1HPUA 4I5LC 4IYPC 4ORCA 4UT2A 3DSCA 3H69A 1FJMA 3JYFA 1S70A 4O5GA 4IL1A 4JA7A 2O8GA 5HPEA 3C9FA 3FGAC 1S8EA 2IE4C 3PSNA 2ZBMA 3C5WC 4H2FA 4B2OA 4FBKA 4OR9A 2QFRA 3RL3A 3HVQA 4DHLA 3H64A 2XMOA 4DT2A 3EGHA 5F3WA 3H68A 2IE3C 5EQVA 1TCOA 5JJTA 4M0VA 1HO5A 1UF3A 4DSYA 1JK7A 1G5BA 5GTUA 4V0VA 1T70A 3E7AA 4KBPA 2R17A 3DSDA 2HYPA 4UWQA 4XPNA 3H63A 2WDDA 3DW8C 3K7WC 1NNWA 4I5NC 4LACC 3RL5A 3LL8A 4F0ZA 3KBPA 1XM7A 3AUZA 1KBPA 3THNA 4J6OA 1USHA 2DFJA 2Q8UA 3IVDA 1XZWA 5J28A 3EGGA 5DNYA 1WARA 2CV9A 4FCXA 4ORBA 5JPFA 4HD0A 4MOVA 2WDCA 3TGHA 1S95A 2GJUA 3ZTVA 3CK2A 4TUIA 4G9JA 1SU1A 3GVEA 1U32A 1OIEA 3ICFA 1S3NA 4JA9A 1OIDA 4O43A 1II7A 4V0XA 1M63A 4ZVZA 3RQZA 2HY1A 1MF8A 4H1SA 3QFNA 3QFOA 1Z2WA 5JPEA 5INBA 1HP1A 3PSOA 2O8AA 4O24A 1UTEA 1T71A 2AHDA 2BCDA 2Z06A 3QFMA 4H2BA 2KKNA 3QFKA 2A22A 4H1YP 4LU9A 4Q7FA 2WDEA 2NYMC 5IOHA 2YVTA 3AV0A 3N5UA 2BDXA 2BQ8X 1IT6A 4TUGA 1WAO1 3H60A 4MP0A 4UT3B 5C1VA 3QG5C 3THOB 1AUIA 3H66A 2WDFA 3IB7A 1Z2XA
chains in the Genus database with same CATH superfamily
3F6GA 2RS7A 1EH6A 1ZU1A 2UU9E 3KZYA 3H62B 2F4VE 4NZVA 4DMIA 1QNTA 2ENHA 2NYLC 1PJQA 2YEQA 2V88A 4DV5E 4DR4E 2FTXB 1OI8A 2D9HA 1QHWA 4LF6E 2YTPA 1YYKA 4KHPE 2JOGA 2CPNA 1PJTA 4B3TE 2NXFA 4H2IA 2EPKX 2YTJA 1HNXE 1P47A 2UUAE 2Z1AA 4R2QA 2V85A 4FBWA 4ZYGA 3JU0A 4HTGA 1IBKE 2EE8A 1FJMA 3JYFA 1KJKA 2EPRA 1S70A 4IL1A 4JA7A 5AASA 5AE3A 2E72A 4X9JA 4DV6E 1L4SA 2LBSB 1S8EA 2NUGA 4BHCA 2RSIA 4DR5E 4FBKA 4DHLA 2YTIA 2UUCE 2LRSA 1TN9A 2EM8A 1TF6A 4LF8E 5A6AA 4I8OA 2EOIA 4JYAE 4M0VA 5LL6R 1EH8A 3L00A 1UF3A 5GTUA 4BS9A 2JP9A 2I9IA 2R17A 3EQ1A 2WDDA 1X48A 4DV2E 2B7TA 2L2NA 2EM7A 2MKNA 3J80C 2L2KB 1YZ9A 4LACC 4B3RE 2EOMA 2EPMX 3AUZA 1EH7A 1KBPA 2LUQA 2E1MA 2Q8UA 4JI5E 2EN4A 2MDRA 2CT1A 2A25A 2ZOAA 5DNYA 2RS6A 5LMNE 2CV9A 2B9DA 2L6MA 5KL5A 2F8BA 4MOVA 4RHBB 2L3JA 3MHSC 5T6JA 3ADJA 2WBUA 2EMBA 2YTNA 2N3HA 4TUIA 3EPHA 4G9JA 1X5WA 1OIEA 2ZM6E 4F9CB 2EOYA 2VF1A 3OTOE 2DIXA 3EPJA 4BCAA 5A6BD 1M63A 1SFEA 2HY1A 2EPXA 4H1SA 2EN6A 4J8ZA 2EMXA 1EKZA 2DLQA 2EOFA 2O8AA 3EPKA 2V89A 4H2BA 2KKNA 3C6KA 5LMUE 2E5LE 2K4VA 3ADLA 2A22A 2JOXA 4LF4E 3QFKA 4DR1E 2EJ4A 2EMGA 2EL5A 1TF3A 2UXBE 1DI2A 2BDXA 4F9BB 1ZR9A 1IT6A 1WAO1 1UN6B 3H60A 3ADIA 1N33E 4UT3B 2MDGA 2EOEA 1X6FA 4RH8A 2BBGA 1Z2XA 3H61A 4ZX2A 5KL2A 4K0KE 2KOUA 4Q28A 2WBTA 3MHHC 2LMZA 4AQYE 3ADGA 3VYYA 3HTXA 4DV3E 4IS1C 2YPNA 2EMYA 5B8IA 2YT4A 3RL4A 1PKPA 4R8OA 1J5EE 2P6BA 3IVEA 3ZU0A 4FBQA 1RC7A 2QJCA 1MGTA 1FKAE 4R2EA 1F2IG 2ZO9B 4WWLA 4MOYA 1S3MA 2EPNA 2KHXA 2EM5A 3E7BA 1JK2A 4ORCA 2YU8A 3HPSA 1AAYA 4R2PA 2YRMA 1G2FC 3C9FA 4M30A 2UXDE 2FV4B 3PSNA 2V86A 3C5WC 1HR0E 2KONA 4B3ME 2NA2A 4R2SA 3HVQA 2XMOA 2L33A 3TQMA 4YHHE 1ZBTA 2EOHA 1YSAC 4R2AA 1YUJA 3VK6A 5A2QC 2VQFE 2JOBA 4F6NA 1T4OA 4DSYA 4BBYA 4F54A 1JK7A 1T70A 2DLKA 4L8NA 4F9AB 4XPNA 3H63A 2ENCA 2G7HA 3E0JA 1NNWA 3LL8A 4F0ZA 2HJJA 3THNA 2L3CA 2LVHA 2LJUA 3IVDA 2YTFA 2DMIA 5J28A 1X6EA 2EWLA 2JYAA 4F6MA 3BF2A 4WPYA 3HQ1A 4DR6E 1WARA 4X8WA 4FCXA 3M99B 3D03A 2R76A 5JPFA 3F6HA 4MLQA 2WDCA 3TGHA 1J26A 5KL7A 1GTKA 4GKJE 2GHFA 2YTEA 2EP3A 2M4IA 1IQSA 2LO3A 2DXNA 1U32A 3KWRA 3C4BA 4O43A 1XNRE 1OIDA 2V8QB 2LT7A 1II7A 1KYQA 2R1FA 4NXNE 4JI2E 2VRDA 3RQZA 2LTRA 1IBME 5JPEA 4WSGA 1B69A 4M9VC 4X66E 3OMLA 1YPNA 4JI4E 1X3CA 1UTEA 5KL3A 1T71A 2AHDA 2BCDA 2V87A 4H1YP 2WDEA 3BBGA 5IOHA 2CSHA 3LLHA 3T1YE 1O0WA 3MSWA 4KZSA 5C1VA 4DKKA 1STUA 1A1FA 3H09A 3QG5C 4X62E 1A1IA 5IT9C 4JI3E 2V83A 3IB7A 3H67A 1FJGE 4GKKE 2EL6A 4WYQB 4BC9A 4NXME 2FGGA 4MLVA 3T1IA 2JVAA 2K7IA 2M1SA 2DRPA 3V4YA 2RTXA 4WFTA 4DV4E 4UT3A 4ORAA 2UUBE 3EPLA 4KKZA 1WJPA 1W24A 2ENAA 2L92A 4GZNC 2EZ6A 2HYOA 5AC4A 4LTYA 1QFCA 1V73A 2EN1A 4HEIA 3P1XA 2M7QA 4H2GA 2NPPC 2NUFA 2PRTA 4UT2A 3HXLA 1SR9A 4Q35B 3H69A 1T38A 1A1KA 2EPUA 1HNZE 1XMQE 2YWQA 2ZBMA 1N3GA 2N8XA 3UK3C 3BIDA 4H2FA 2QFRA 2YTDA 4ZYEA 3RL3A 3H64A 3EGHA 5KL6A 4LF9E 2JWOA 5EQVA 1TCOA 1HNWE 4WXDA 4YY3E 5TSEA 2LV2A 3HPZA 1YYOA 2EPCA 4BMJA 1G5BA 3E7AA 4KBPA 3DSDA 2HYPA 4X64E 3IWCA 2EPAA 5BR8E 5IV8B 3RL5A 5A6KA 2DSYA 4LFBE 3KBPA 3J7AG 1XM7A 1USHA 3BGHA 2DFJA 3ECRA 3IWDA 2ADRA 2N3GA 2RQLA 1A1HA 2ELZA 4ORBA 4M2ZA 1WHNA 1AH5A 4LFCE 1IQOA 4P7DA 1DGCA 1X49A 1S95A 1ZBQA 2IHR1 4DUYE 2GJUA 1PDAA 1NCSA 3J7Yp 4DV0E 3CK2A 2DB2A 1SU1A 2ELYA 2EOXA 3T1HE 2LCEA 4JA9A 1GQEA 4P78A 2GPIA 4V0XA 2JXPA 4ZVZA 1MF8A 2MKDA 2M9AA 5KL4A 1Z2WA 1T39A 5INBA 4GEQB 5LLQA 2I13A 3C4TA 1HP1A 4O24A 2EMHA 2YSPA 1YUIA 2BB8A 3VYXA 1BBGA 1N32E 4BC7A 4IJDA 2EOQA 2EN7A 1T4LB 4R2CA 4JI6E 4JI8E 4LFAE 4OX9E 2L2MA 4KWYA 2YVTA 5CFFE 2YRHA 1BB8A 3AV0A 1PJSA 2DMYA 1UBDC 4TUGA 4MP0A 5A69A 2VQEE 1I94E 1AUIA 2EQ3A 2RPCA 1X6HA 1ZAAC 2WDFA 4DT2A 1WXRA 2YTQA 2NABA 4JI7E 4ZYDA 2MC5A 4O4KA 2QFPA 4DV1E 2EOJA 1XNQE 2ODRC 3P71C 2EQ0A 5IXMB 3FLOA 2EMFA 2USHA 3K7VC 2J7JA 2EMWA 1GZ6A 2EM0A 4B3SE 1IBLE 1S3LA 2EPPA 4JI0E 4R2DA 2WBSA 2EOZA 1T4NA 1RQ0A 4DR7E 4R2RA 2Z72A 3C6MA 3ZOQB 4DR3E 1Z1BA 3IB8A 4DUZE 4X65E 2EMIA 4V0WA 2IAEC 4FK5C 2EM3A 4YKEA 2YTOA 5A6JA 1MEYC 1HPUA 4I5LC 2LUPB 2EN3A 4IYPC 3DSCA 2EL4A 1UILA 2B7VA 4O5GA 3LMLA 2O8GA 2EM9A 2EQ1A 2UXCE 1UHZA 5HPEA 4DR2E 2EMKA 4L5NC 3FGAC 2IE4C 5AC5A 2MC6A 4F2JC 2LE2A 2EMLA 2YRKA 5ADZA 4B2OA 2EORA 4OR9A 5AE2A 4LF7E 2EN2A 5F3WA 2WCC3 4OOGC 4WX9A 2EPOA 2LTSA 2YTGA 4R03A 2IE3C 3H68A 4BHBA 5JJTA 1HO5A 2JR1A 1A1JA 3VHTB 1BBOA 2EM6A 2HGHA 2JPAA 3DF6A 2ODRD 3KZZA 2EMAA 4V0VA 4UWQA 2YU5A 2H36X 3DW8C 3K7WC 4I5NC 1N36E 2DGCA 2YZTA 1WHQA 2HC5A 4J6OA 1XZWA 2EMZA 3EGGA 3JAMC 2EN8A 2HHHE 2JY9A 4ZYHA 2LJHA 1QU6A 2EPZA 5AE1A 4WXCA 4N4RB 2NUEA 4HD0A 4DV7E 1RMDA 5A6BA 1IMUA 3ZTVA 4JV5E 3RMPA 2EOOA 4JI1E 3FIGA 3GVEA 3ICFA 1JK1A 3K6QA 1A1GA 1S3NA 2L8TA 2VE7C 2GLIA 2EM2A 1YYWA 3JTZA 3IWBA 4LF5E 3QFNA 1G2DC 2EMCA 3QFOA 1NEIA 2EPLX 1A1LA 3PSOA 1LLMC 2CTDA 2WZOA 1YFHA 4WSPA 2Z06A 3QFMA 5FLXC 4Q7FA 4LU9A 1DQ3A 3DJWA 4NHRA 2NYMC 1WRJA 2YSOA 5IWAE 3J81C 3N5UA 1X47A 2BQ8X 1XMOE 2DXLA 2B3TB 3THOB 2EM4A 2EOSA 3H66A 1N34E 2RSMA
chains in the Genus database with same CATH topology
3F6GA 2RS7A 3H62B 2UU9E 2F4VE 4DMIA 4NZVA 2NYLC 2YEQA 2V88A 4DV5E 4DR4E 2FTXB 1OI8A 1QHWA 4LF6E 1YYKA 4KHPE 2JOGA 2CPNA 4B3TE 2NXFA 4H2IA 1HNXE 2UUAE 2Z1AA 4FBWA 2V85A 3JU0A 1IBKE 1FJMA 3JYFA 1S70A 4IL1A 4JA7A 5AASA 5AE3A 4DV6E 2LBSB 1S8EA 2NUGA 4DR5E 4FBKA 4DHLA 2UUCE 2LRSA 4LF8E 4I8OA 4JYAE 4M0VA 5LL6R 1UF3A 5GTUA 4BS9A 2R17A 2WDDA 1X48A 4DV2E 2B7TA 2L2NA 4LACC 1YZ9A 3J80C 2L2KB 4B3RE 3AUZA 1KBPA 2LUQA 2E1MA 4JI5E 2Q8UA 2MDRA 2ZOAA 5DNYA 2RS6A 5LMNE 2CV9A 2B9DA 2L6MA 2F8BA 4MOVA 2L3JA 5T6JA 3ADJA 2N3HA 4TUIA 4G9JA 1OIEA 2ZM6E 4F9CB 2VF1A 3OTOE 2DIXA 4BCAA 1M63A 2HY1A 4H1SA 4J8ZA 1EKZA 2O8AA 2V89A 4H2BA 2KKNA 3QFKA 5LMUE 2A22A 2E5LE 2K4VA 3ADLA 2JOXA 4LF4E 4DR1E 2UXBE 2BDXA 1DI2A 1IT6A 4F9BB 1WAO1 3H60A 4UT3B 3ADIA 1N33E 1Z2XA 3H61A 4ZX2A 4K0KE 2KOUA 4Q28A 2LMZA 4AQYE 3ADGA 3VYYA 3HTXA 4DV3E 5B8IA 2YT4A 3RL4A 1PKPA 4R8OA 1J5EE 2P6BA 3IVEA 3ZU0A 4FBQA 1RC7A 2QJCA 1FKAE 2ZO9B 4WWLA 4MOYA 1S3MA 2KHXA 3E7BA 4ORCA 3HPSA 3C9FA 4M30A 2UXDE 2FV4B 3PSNA 2V86A 3C5WC 1HR0E 2KONA 4B3ME 2NA2A 3HVQA 2XMOA 2L33A 4YHHE 1ZBTA 3VK6A 5A2QC 2VQFE 2JOBA 1T4OA 4DSYA 4BBYA 4F54A 1JK7A 1T70A 4L8NA 4F9AB 4XPNA 3H63A 2G7HA 3E0JA 1NNWA 3LL8A 4F0ZA 3THNA 2L3CA 3IVDA 5J28A 2EWLA 4WPYA 3HQ1A 4DR6E 1WARA 4X8WA 4FCXA 3D03A 5JPFA 3F6HA 2WDCA 3TGHA 1J26A 4GKJE 2M4IA 2DXNA 1U32A 3KWRA 3C4BA 1OIDA 1XNRE 4O43A 2V8QB 1II7A 4NXNE 4JI2E 3RQZA 2LTRA 1IBME 5JPEA 4X66E 3OMLA 4JI4E 1UTEA 1T71A 2AHDA 2BCDA 2V87A 4H1YP 2WDEA 5IOHA 3LLHA 3T1YE 1O0WA 3MSWA 4KZSA 5C1VA 4DKKA 1STUA 3H09A 4X62E 3QG5C 5IT9C 4JI3E 2V83A 3IB7A 3H67A 1FJGE 4GKKE 4WYQB 4BC9A 4NXME 2FGGA 3T1IA 2JVAA 2M1SA 3V4YA 2RTXA 4WFTA 4DV4E 4UT3A 4ORAA 2UUBE 4KKZA 1W24A 2L92A 2EZ6A 2HYOA 4LTYA 1QFCA 1V73A 2M7QA 4H2GA 3P1XA 2NPPC 2NUFA 4UT2A 3HXLA 1SR9A 3H69A 1HNZE 1XMQE 2ZBMA 4H2FA 2QFRA 3RL3A 3H64A 3EGHA 4LF9E 2JWOA 5EQVA 1TCOA 1HNWE 4YY3E 3HPZA 1YYOA 4BMJA 1G5BA 3E7AA 4KBPA 3DSDA 2HYPA 4X64E 3IWCA 5BR8E 3RL5A 2DSYA 4LFBE 3KBPA 3J7AG 1XM7A 1USHA 2DFJA 3IWDA 2N3GA 4ORBA 4M2ZA 1WHNA 4LFCE 4P7DA 1S95A 1X49A 1ZBQA 2IHR1 4DUYE 2GJUA 3J7Yp 4DV0E 3CK2A 2DB2A 1SU1A 3T1HE 4JA9A 1GQEA 4P78A 4V0XA 4ZVZA 1MF8A 1Z2WA 5INBA 4GEQB 1HP1A 3C4TA 4O24A 3VYXA 1N32E 4BC7A 4OX9E 1T4LB 4JI6E 4LFAE 4JI8E 2L2MA 2YVTA 5CFFE 3AV0A 2DMYA 4TUGA 4MP0A 2VQEE 1I94E 1AUIA 2WDFA 4DT2A 1WXRA 4JI7E 2MC5A 4O4KA 2QFPA 4DV1E 1XNQE 2ODRC 3P71C 3FLOA 3K7VC 2USHA 1GZ6A 4B3SE 1IBLE 1S3LA 4JI0E 1T4NA 1RQ0A 4DR7E 2Z72A 3ZOQB 4DR3E 3IB8A 4DUZE 4X65E 4V0WA 2IAEC 4YKEA 1HPUA 4I5LC 2LUPB 4IYPC 3DSCA 1UILA 2B7VA 4O5GA 3LMLA 2O8GA 2UXCE 5HPEA 1UHZA 4DR2E 4L5NC 3FGAC 2IE4C 2MC6A 2LE2A 5ADZA 4B2OA 4OR9A 5AE2A 4LF7E 5F3WA 4OOGC 3H68A 2LTSA 4R03A 2IE3C 5JJTA 1HO5A 2JR1A 4V0VA 3DF6A 2ODRD 4UWQA 2H36X 3DW8C 3K7WC 4I5NC 1N36E 2YZTA 1WHQA 4J6OA 1XZWA 3EGGA 3JAMC 2HHHE 2JY9A 2LJHA 1QU6A 5AE1A 2NUEA 4HD0A 4DV7E 3ZTVA 4JV5E 3RMPA 4JI1E 3FIGA 3GVEA 3ICFA 3K6QA 1S3NA 2L8TA 2VE7C 1YYWA 3JTZA 3IWBA 4LF5E 3QFNA 3QFOA 3PSOA 2WZOA 4WSPA 2Z06A 3QFMA 5FLXC 4Q7FA 4LU9A 1DQ3A 3DJWA 2NYMC 5IWAE 3J81C 3N5UA 1X47A 2DXLA 2BQ8X 1XMOE 2B3TB 3THOB 3H66A 1N34E 2RSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H67 A;  4ZX2 A;  3H62 B;  4NZV A;  4O4K A;  3T1I A;  2NYL C;  2QFP A;  3V4Y A;  3P71 C;  4UT3 A;  3K7V C;  2USH A;  4ORA A;  1OI8 A;  5B8I A;  1QHW A;  3RL4 A;  2JOG A;  4KKZ A;  4H2I A;  2NXF A;  1S3L A;  1W24 A;  2P6B A;  3IVE A;  3ZU0 A;  4FBQ A;  2QJC A;  3H61 A;  2Z72 A;  2HYO A;  4WWL A;  2Z1A A;  1S3M A;  3IB8 A;  4MOY A;  4FBW A;  1QFC A;  4H2G A;  1V73 A;  2IAE C;  4LTY A;  4V0W A;  4YKE A;  2NPP C;  3E7B A;  1HPU A;  4I5L C;  4IYP C;  4ORC A;  4UT2 A;  3DSC A;  3H69 A;  1FJM A;  3JYF A;  1S70 A;  4O5G A;  4IL1 A;  4JA7 A;  2O8G A;  5HPE A;  3C9F A;  3FGA C;  1S8E A;  2IE4 C;  3PSN A;  2ZBM A;  3C5W C;  4H2F A;  4B2O A;  4FBK A;  4OR9 A;  2QFR A;  3RL3 A;  3HVQ A;  4DHL A;  3H64 A;  2XMO A;  4DT2 A;  3EGH A;  5F3W A;  3H68 A;  2IE3 C;  5EQV A;  1TCO A;  5JJT A;  4M0V A;  1HO5 A;  1UF3 A;  4DSY A;  1JK7 A;  1G5B A;  5GTU A;  4V0V A;  1T70 A;  3E7A A;  4KBP A;  2R17 A;  3DSD A;  2HYP A;  4UWQ A;  4XPN A;  3H63 A;  2WDD A;  3DW8 C;  3K7W C;  1NNW A;  4I5N C;  4LAC C;  3RL5 A;  3LL8 A;  4F0Z A;  3KBP A;  1XM7 A;  3AUZ A;  1KBP A;  3THN A;  4J6O A;  1USH A;  2DFJ A;  2Q8U A;  3IVD A;  1XZW A;  5J28 A;  3EGG A;  5DNY A;  1WAR A;  2CV9 A;  4FCX A;  4ORB A;  5JPF A;  4HD0 A;  4MOV A;  2WDC A;  3TGH A;  1S95 A;  2GJU A;  3ZTV A;  3CK2 A;  4TUI A;  4G9J A;  1SU1 A;  3GVE A;  1U32 A;  1OIE A;  3ICF A;  1S3N A;  4JA9 A;  1OID A;  4O43 A;  1II7 A;  4V0X A;  1M63 A;  4ZVZ A;  3RQZ A;  2HY1 A;  1MF8 A;  4H1S A;  3QFN A;  3QFO A;  1Z2W A;  5JPE A;  5INB A;  1HP1 A;  3PSO A;  2O8A A;  4O24 A;  1UTE A;  1T71 A;  2AHD A;  2BCD A;  2Z06 A;  3QFM A;  4H2B A;  2KKN A;  3QFK A;  2A22 A;  4H1Y P;  4LU9 A;  4Q7F A;  2WDE A;  2NYM C;  5IOH A;  2YVT A;  3AV0 A;  3N5U A;  2BDX A;  2BQ8 X;  1IT6 A;  4TUG A;  1WAO 1;  3H60 A;  4MP0 A;  4UT3 B;  5C1V A;  3QG5 C;  3THO B;  1AUI A;  3H66 A;  2WDF A;  3IB7 A;  1Z2X A; 
#chains in the Genus database with same CATH topology
 3F6G A;  2RS7 A;  1EH6 A;  1ZU1 A;  2UU9 E;  3KZY A;  3H62 B;  2F4V E;  4NZV A;  4DMI A;  1QNT A;  2ENH A;  2NYL C;  1PJQ A;  2YEQ A;  2V88 A;  4DV5 E;  4DR4 E;  2FTX B;  1OI8 A;  2D9H A;  1QHW A;  4LF6 E;  2YTP A;  1YYK A;  4KHP E;  2JOG A;  2CPN A;  1PJT A;  4B3T E;  2NXF A;  4H2I A;  2EPK X;  2YTJ A;  1HNX E;  1P47 A;  2UUA E;  2Z1A A;  4R2Q A;  2V85 A;  4FBW A;  4ZYG A;  3JU0 A;  4HTG A;  1IBK E;  2EE8 A;  1FJM A;  3JYF A;  1KJK A;  2EPR A;  1S70 A;  4IL1 A;  4JA7 A;  5AAS A;  5AE3 A;  2E72 A;  4X9J A;  4DV6 E;  1L4S A;  2LBS B;  1S8E A;  2NUG A;  4BHC A;  2RSI A;  4DR5 E;  4FBK A;  4DHL A;  2YTI A;  2UUC E;  2LRS A;  1TN9 A;  2EM8 A;  1TF6 A;  4LF8 E;  5A6A A;  4I8O A;  2EOI A;  4JYA E;  4M0V A;  5LL6 R;  1EH8 A;  3L00 A;  1UF3 A;  5GTU A;  4BS9 A;  2JP9 A;  2I9I A;  2R17 A;  3EQ1 A;  2WDD A;  1X48 A;  4DV2 E;  2B7T A;  2L2N A;  2EM7 A;  2MKN A;  3J80 C;  2L2K B;  1YZ9 A;  4LAC C;  4B3R E;  2EOM A;  2EPM X;  3AUZ A;  1EH7 A;  1KBP A;  2LUQ A;  2E1M A;  2Q8U A;  4JI5 E;  2EN4 A;  2MDR A;  2CT1 A;  2A25 A;  2ZOA A;  5DNY A;  2RS6 A;  5LMN E;  2CV9 A;  2B9D A;  2L6M A;  5KL5 A;  2F8B A;  4MOV A;  4RHB B;  2L3J A;  3MHS C;  5T6J A;  3ADJ A;  2WBU A;  2EMB A;  2YTN A;  2N3H A;  4TUI A;  3EPH A;  4G9J A;  1X5W A;  1OIE A;  2ZM6 E;  4F9C B;  2EOY A;  2VF1 A;  3OTO E;  2DIX A;  3EPJ A;  4BCA A;  5A6B D;  1M63 A;  1SFE A;  2HY1 A;  2EPX A;  4H1S A;  2EN6 A;  4J8Z A;  2EMX A;  1EKZ A;  2DLQ A;  2EOF A;  2O8A A;  3EPK A;  2V89 A;  4H2B A;  2KKN A;  3C6K A;  5LMU E;  2E5L E;  2K4V A;  3ADL A;  2A22 A;  2JOX A;  4LF4 E;  3QFK A;  4DR1 E;  2EJ4 A;  2EMG A;  2EL5 A;  1TF3 A;  2UXB E;  1DI2 A;  2BDX A;  4F9B B;  1ZR9 A;  1IT6 A;  1WAO 1;  1UN6 B;  3H60 A;  3ADI A;  1N33 E;  4UT3 B;  2MDG A;  2EOE A;  1X6F A;  4RH8 A;  2BBG A;  1Z2X A;  3H61 A;  4ZX2 A;  5KL2 A;  4K0K E;  2KOU A;  4Q28 A;  2WBT A;  3MHH C;  2LMZ A;  4AQY E;  3ADG A;  3VYY A;  3HTX A;  4DV3 E;  4IS1 C;  2YPN A;  2EMY A;  5B8I A;  2YT4 A;  3RL4 A;  1PKP A;  4R8O A;  1J5E E;  2P6B A;  3IVE A;  3ZU0 A;  4FBQ A;  1RC7 A;  2QJC A;  1MGT A;  1FKA E;  4R2E A;  1F2I G;  2ZO9 B;  4WWL A;  4MOY A;  1S3M A;  2EPN A;  2KHX A;  2EM5 A;  3E7B A;  1JK2 A;  4ORC A;  2YU8 A;  3HPS A;  1AAY A;  4R2P A;  2YRM A;  1G2F C;  3C9F A;  4M30 A;  2UXD E;  2FV4 B;  3PSN A;  2V86 A;  3C5W C;  1HR0 E;  2KON A;  4B3M E;  2NA2 A;  4R2S A;  3HVQ A;  2XMO A;  2L33 A;  3TQM A;  4YHH E;  1ZBT A;  2EOH A;  1YSA C;  4R2A A;  1YUJ A;  3VK6 A;  5A2Q C;  2VQF E;  2JOB A;  4F6N A;  1T4O A;  4DSY A;  4BBY A;  4F54 A;  1JK7 A;  1T70 A;  2DLK A;  4L8N A;  4F9A B;  4XPN A;  3H63 A;  2ENC A;  2G7H A;  3E0J A;  1NNW A;  3LL8 A;  4F0Z A;  2HJJ A;  3THN A;  2L3C A;  2LVH A;  2LJU A;  3IVD A;  2YTF A;  2DMI A;  5J28 A;  1X6E A;  2EWL A;  2JYA A;  4F6M A;  3BF2 A;  4WPY A;  3HQ1 A;  4DR6 E;  1WAR A;  4X8W A;  4FCX A;  3M99 B;  3D03 A;  2R76 A;  5JPF A;  3F6H A;  4MLQ A;  2WDC A;  3TGH A;  1J26 A;  5KL7 A;  1GTK A;  4GKJ E;  2GHF A;  2YTE A;  2EP3 A;  2M4I A;  1IQS A;  2LO3 A;  2DXN A;  1U32 A;  3KWR A;  3C4B A;  4O43 A;  1XNR E;  1OID A;  2V8Q B;  2LT7 A;  1II7 A;  1KYQ A;  2R1F A;  4NXN E;  4JI2 E;  2VRD A;  3RQZ A;  2LTR A;  1IBM E;  5JPE A;  4WSG A;  1B69 A;  4M9V C;  4X66 E;  3OML A;  1YPN A;  4JI4 E;  1X3C A;  1UTE A;  5KL3 A;  1T71 A;  2AHD A;  2BCD A;  2V87 A;  4H1Y P;  2WDE A;  3BBG A;  5IOH A;  2CSH A;  3LLH A;  3T1Y E;  1O0W A;  3MSW A;  4KZS A;  5C1V A;  4DKK A;  1STU A;  1A1F A;  3H09 A;  3QG5 C;  4X62 E;  1A1I A;  5IT9 C;  4JI3 E;  2V83 A;  3IB7 A;  3H67 A;  1FJG E;  4GKK E;  2EL6 A;  4WYQ B;  4BC9 A;  4NXM E;  2FGG A;  4MLV A;  3T1I A;  2JVA A;  2K7I A;  2M1S A;  2DRP A;  3V4Y A;  2RTX A;  4WFT A;  4DV4 E;  4UT3 A;  4ORA A;  2UUB E;  3EPL A;  4KKZ A;  1WJP A;  1W24 A;  2ENA A;  2L92 A;  4GZN C;  2EZ6 A;  2HYO A;  5AC4 A;  4LTY A;  1QFC A;  1V73 A;  2EN1 A;  4HEI A;  3P1X A;  2M7Q A;  4H2G A;  2NPP C;  2NUF A;  2PRT A;  4UT2 A;  3HXL A;  1SR9 A;  4Q35 B;  3H69 A;  1T38 A;  1A1K A;  2EPU A;  1HNZ E;  1XMQ E;  2YWQ A;  2ZBM A;  1N3G A;  2N8X A;  3UK3 C;  3BID A;  4H2F A;  2QFR A;  2YTD A;  4ZYE A;  3RL3 A;  3H64 A;  3EGH A;  5KL6 A;  4LF9 E;  2JWO A;  5EQV A;  1TCO A;  1HNW E;  4WXD A;  4YY3 E;  5TSE A;  2LV2 A;  3HPZ A;  1YYO A;  2EPC A;  4BMJ A;  1G5B A;  3E7A A;  4KBP A;  3DSD A;  2HYP A;  4X64 E;  3IWC A;  2EPA A;  5BR8 E;  5IV8 B;  3RL5 A;  5A6K A;  2DSY A;  4LFB E;  3KBP A;  3J7A G;  1XM7 A;  1USH A;  3BGH A;  2DFJ A;  3ECR A;  3IWD A;  2ADR A;  2N3G A;  2RQL A;  1A1H A;  2ELZ A;  4ORB A;  4M2Z A;  1WHN A;  1AH5 A;  4LFC E;  1IQO A;  4P7D A;  1DGC A;  1X49 A;  1S95 A;  1ZBQ A;  2IHR 1;  4DUY E;  2GJU A;  1PDA A;  1NCS A;  3J7Y p;  4DV0 E;  3CK2 A;  2DB2 A;  1SU1 A;  2ELY A;  2EOX A;  3T1H E;  2LCE A;  4JA9 A;  1GQE A;  4P78 A;  2GPI A;  4V0X A;  2JXP A;  4ZVZ A;  1MF8 A;  2MKD A;  2M9A A;  5KL4 A;  1Z2W A;  1T39 A;  5INB A;  4GEQ B;  5LLQ A;  2I13 A;  3C4T A;  1HP1 A;  4O24 A;  2EMH A;  2YSP A;  1YUI A;  2BB8 A;  3VYX A;  1BBG A;  1N32 E;  4BC7 A;  4IJD A;  2EOQ A;  2EN7 A;  1T4L B;  4R2C A;  4JI6 E;  4JI8 E;  4LFA E;  4OX9 E;  2L2M A;  4KWY A;  2YVT A;  5CFF E;  2YRH A;  1BB8 A;  3AV0 A;  1PJS A;  2DMY A;  1UBD C;  4TUG A;  4MP0 A;  5A69 A;  2VQE E;  1I94 E;  1AUI A;  2EQ3 A;  2RPC A;  1X6H A;  1ZAA C;  2WDF A;  4DT2 A;  1WXR A;  2YTQ A;  2NAB A;  4JI7 E;  4ZYD A;  2MC5 A;  4O4K A;  2QFP A;  4DV1 E;  2EOJ A;  1XNQ E;  2ODR C;  3P71 C;  2EQ0 A;  5IXM B;  3FLO A;  2EMF A;  2USH A;  3K7V C;  2J7J A;  2EMW A;  1GZ6 A;  2EM0 A;  4B3S E;  1IBL E;  1S3L A;  2EPP A;  4JI0 E;  4R2D A;  2WBS A;  2EOZ A;  1T4N A;  1RQ0 A;  4DR7 E;  4R2R A;  2Z72 A;  3C6M A;  3ZOQ B;  4DR3 E;  1Z1B A;  3IB8 A;  4DUZ E;  4X65 E;  2EMI A;  4V0W A;  2IAE C;  4FK5 C;  2EM3 A;  4YKE A;  2YTO A;  5A6J A;  1MEY C;  1HPU A;  4I5L C;  2LUP B;  2EN3 A;  4IYP C;  3DSC A;  2EL4 A;  1UIL A;  2B7V A;  4O5G A;  3LML A;  2O8G A;  2EM9 A;  2EQ1 A;  2UXC E;  1UHZ A;  5HPE A;  4DR2 E;  2EMK A;  4L5N C;  3FGA C;  2IE4 C;  5AC5 A;  2MC6 A;  4F2J C;  2LE2 A;  2EML A;  2YRK A;  5ADZ A;  4B2O A;  2EOR A;  4OR9 A;  5AE2 A;  4LF7 E;  2EN2 A;  5F3W A;  2WCC 3;  4OOG C;  4WX9 A;  2EPO A;  2LTS A;  2YTG A;  4R03 A;  2IE3 C;  3H68 A;  4BHB A;  5JJT A;  1HO5 A;  2JR1 A;  1A1J A;  3VHT B;  1BBO A;  2EM6 A;  2HGH A;  2JPA A;  3DF6 A;  2ODR D;  3KZZ A;  2EMA A;  4V0V A;  4UWQ A;  2YU5 A;  2H36 X;  3DW8 C;  3K7W C;  4I5N C;  1N36 E;  2DGC A;  2YZT A;  1WHQ A;  2HC5 A;  4J6O A;  1XZW A;  2EMZ A;  3EGG A;  3JAM C;  2EN8 A;  2HHH E;  2JY9 A;  4ZYH A;  2LJH A;  1QU6 A;  2EPZ A;  5AE1 A;  4WXC A;  4N4R B;  2NUE A;  4HD0 A;  4DV7 E;  1RMD A;  5A6B A;  1IMU A;  3ZTV A;  4JV5 E;  3RMP A;  2EOO A;  4JI1 E;  3FIG A;  3GVE A;  3ICF A;  1JK1 A;  3K6Q A;  1A1G A;  1S3N A;  2L8T A;  2VE7 C;  2GLI A;  2EM2 A;  1YYW A;  3JTZ A;  3IWB A;  4LF5 E;  3QFN A;  1G2D C;  2EMC A;  3QFO A;  1NEI A;  2EPL X;  1A1L A;  3PSO A;  1LLM C;  2CTD A;  2WZO A;  1YFH A;  4WSP A;  2Z06 A;  3QFM A;  5FLX C;  4Q7F A;  4LU9 A;  1DQ3 A;  3DJW A;  4NHR A;  2NYM C;  1WRJ A;  2YSO A;  5IWA E;  3J81 C;  3N5U A;  1X47 A;  2BQ8 X;  1XMO E;  2DXL A;  2B3T B;  3THO B;  2EM4 A;  2EOS A;  3H66 A;  1N34 E;  2RSM A; 
#chains in the Genus database with same CATH homology
 3F6G A;  2RS7 A;  3H62 B;  2UU9 E;  2F4V E;  4DMI A;  4NZV A;  2NYL C;  2YEQ A;  2V88 A;  4DV5 E;  4DR4 E;  2FTX B;  1OI8 A;  1QHW A;  4LF6 E;  1YYK A;  4KHP E;  2JOG A;  2CPN A;  4B3T E;  2NXF A;  4H2I A;  1HNX E;  2UUA E;  2Z1A A;  4FBW A;  2V85 A;  3JU0 A;  1IBK E;  1FJM A;  3JYF A;  1S70 A;  4IL1 A;  4JA7 A;  5AAS A;  5AE3 A;  4DV6 E;  2LBS B;  1S8E A;  2NUG A;  4DR5 E;  4FBK A;  4DHL A;  2UUC E;  2LRS A;  4LF8 E;  4I8O A;  4JYA E;  4M0V A;  5LL6 R;  1UF3 A;  5GTU A;  4BS9 A;  2R17 A;  2WDD A;  1X48 A;  4DV2 E;  2B7T A;  2L2N A;  4LAC C;  1YZ9 A;  3J80 C;  2L2K B;  4B3R E;  3AUZ A;  1KBP A;  2LUQ A;  2E1M A;  4JI5 E;  2Q8U A;  2MDR A;  2ZOA A;  5DNY A;  2RS6 A;  5LMN E;  2CV9 A;  2B9D A;  2L6M A;  2F8B A;  4MOV A;  2L3J A;  5T6J A;  3ADJ A;  2N3H A;  4TUI A;  4G9J A;  1OIE A;  2ZM6 E;  4F9C B;  2VF1 A;  3OTO E;  2DIX A;  4BCA A;  1M63 A;  2HY1 A;  4H1S A;  4J8Z A;  1EKZ A;  2O8A A;  2V89 A;  4H2B A;  2KKN A;  3QFK A;  5LMU E;  2A22 A;  2E5L E;  2K4V A;  3ADL A;  2JOX A;  4LF4 E;  4DR1 E;  2UXB E;  2BDX A;  1DI2 A;  1IT6 A;  4F9B B;  1WAO 1;  3H60 A;  4UT3 B;  3ADI A;  1N33 E;  1Z2X A;  3H61 A;  4ZX2 A;  4K0K E;  2KOU A;  4Q28 A;  2LMZ A;  4AQY E;  3ADG A;  3VYY A;  3HTX A;  4DV3 E;  5B8I A;  2YT4 A;  3RL4 A;  1PKP A;  4R8O A;  1J5E E;  2P6B A;  3IVE A;  3ZU0 A;  4FBQ A;  1RC7 A;  2QJC A;  1FKA E;  2ZO9 B;  4WWL A;  4MOY A;  1S3M A;  2KHX A;  3E7B A;  4ORC A;  3HPS A;  3C9F A;  4M30 A;  2UXD E;  2FV4 B;  3PSN A;  2V86 A;  3C5W C;  1HR0 E;  2KON A;  4B3M E;  2NA2 A;  3HVQ A;  2XMO A;  2L33 A;  4YHH E;  1ZBT A;  3VK6 A;  5A2Q C;  2VQF E;  2JOB A;  1T4O A;  4DSY A;  4BBY A;  4F54 A;  1JK7 A;  1T70 A;  4L8N A;  4F9A B;  4XPN A;  3H63 A;  2G7H A;  3E0J A;  1NNW A;  3LL8 A;  4F0Z A;  3THN A;  2L3C A;  3IVD A;  5J28 A;  2EWL A;  4WPY A;  3HQ1 A;  4DR6 E;  1WAR A;  4X8W A;  4FCX A;  3D03 A;  5JPF A;  3F6H A;  2WDC A;  3TGH A;  1J26 A;  4GKJ E;  2M4I A;  2DXN A;  1U32 A;  3KWR A;  3C4B A;  1OID A;  1XNR E;  4O43 A;  2V8Q B;  1II7 A;  4NXN E;  4JI2 E;  3RQZ A;  2LTR A;  1IBM E;  5JPE A;  4X66 E;  3OML A;  4JI4 E;  1UTE A;  1T71 A;  2AHD A;  2BCD A;  2V87 A;  4H1Y P;  2WDE A;  5IOH A;  3LLH A;  3T1Y E;  1O0W A;  3MSW A;  4KZS A;  5C1V A;  4DKK A;  1STU A;  3H09 A;  4X62 E;  3QG5 C;  5IT9 C;  4JI3 E;  2V83 A;  3IB7 A;  3H67 A;  1FJG E;  4GKK E;  4WYQ B;  4BC9 A;  4NXM E;  2FGG A;  3T1I A;  2JVA A;  2M1S A;  3V4Y A;  2RTX A;  4WFT A;  4DV4 E;  4UT3 A;  4ORA A;  2UUB E;  4KKZ A;  1W24 A;  2L92 A;  2EZ6 A;  2HYO A;  4LTY A;  1QFC A;  1V73 A;  2M7Q A;  4H2G A;  3P1X A;  2NPP C;  2NUF A;  4UT2 A;  3HXL A;  1SR9 A;  3H69 A;  1HNZ E;  1XMQ E;  2ZBM A;  4H2F A;  2QFR A;  3RL3 A;  3H64 A;  3EGH A;  4LF9 E;  2JWO A;  5EQV A;  1TCO A;  1HNW E;  4YY3 E;  3HPZ A;  1YYO A;  4BMJ A;  1G5B A;  3E7A A;  4KBP A;  3DSD A;  2HYP A;  4X64 E;  3IWC A;  5BR8 E;  3RL5 A;  2DSY A;  4LFB E;  3KBP A;  3J7A G;  1XM7 A;  1USH A;  2DFJ A;  3IWD A;  2N3G A;  4ORB A;  4M2Z A;  1WHN A;  4LFC E;  4P7D A;  1S95 A;  1X49 A;  1ZBQ A;  2IHR 1;  4DUY E;  2GJU A;  3J7Y p;  4DV0 E;  3CK2 A;  2DB2 A;  1SU1 A;  3T1H E;  4JA9 A;  1GQE A;  4P78 A;  4V0X A;  4ZVZ A;  1MF8 A;  1Z2W A;  5INB A;  4GEQ B;  1HP1 A;  3C4T A;  4O24 A;  3VYX A;  1N32 E;  4BC7 A;  4OX9 E;  1T4L B;  4JI6 E;  4LFA E;  4JI8 E;  2L2M A;  2YVT A;  5CFF E;  3AV0 A;  2DMY A;  4TUG A;  4MP0 A;  2VQE E;  1I94 E;  1AUI A;  2WDF A;  4DT2 A;  1WXR A;  4JI7 E;  2MC5 A;  4O4K A;  2QFP A;  4DV1 E;  1XNQ E;  2ODR C;  3P71 C;  3FLO A;  3K7V C;  2USH A;  1GZ6 A;  4B3S E;  1IBL E;  1S3L A;  4JI0 E;  1T4N A;  1RQ0 A;  4DR7 E;  2Z72 A;  3ZOQ B;  4DR3 E;  3IB8 A;  4DUZ E;  4X65 E;  4V0W A;  2IAE C;  4YKE A;  1HPU A;  4I5L C;  2LUP B;  4IYP C;  3DSC A;  1UIL A;  2B7V A;  4O5G A;  3LML A;  2O8G A;  2UXC E;  5HPE A;  1UHZ A;  4DR2 E;  4L5N C;  3FGA C;  2IE4 C;  2MC6 A;  2LE2 A;  5ADZ A;  4B2O A;  4OR9 A;  5AE2 A;  4LF7 E;  5F3W A;  4OOG C;  3H68 A;  2LTS A;  4R03 A;  2IE3 C;  5JJT A;  1HO5 A;  2JR1 A;  4V0V A;  3DF6 A;  2ODR D;  4UWQ A;  2H36 X;  3DW8 C;  3K7W C;  4I5N C;  1N36 E;  2YZT A;  1WHQ A;  4J6O A;  1XZW A;  3EGG A;  3JAM C;  2HHH E;  2JY9 A;  2LJH A;  1QU6 A;  5AE1 A;  2NUE A;  4HD0 A;  4DV7 E;  3ZTV A;  4JV5 E;  3RMP A;  4JI1 E;  3FIG A;  3GVE A;  3ICF A;  3K6Q A;  1S3N A;  2L8T A;  2VE7 C;  1YYW A;  3JTZ A;  3IWB A;  4LF5 E;  3QFN A;  3QFO A;  3PSO A;  2WZO A;  4WSP A;  2Z06 A;  3QFM A;  5FLX C;  4Q7F A;  4LU9 A;  1DQ3 A;  3DJW A;  2NYM C;  5IWA E;  3J81 C;  3N5U A;  1X47 A;  2DXL A;  2BQ8 X;  1XMO E;  2B3T B;  3THO B;  3H66 A;  1N34 E;  2RSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...