4TUIA

Crystal structure of mjmre11-dna1 complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
317
structure length
317
Chain Sequence
b'RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
total genus 94
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tuiA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tuiA01
2IAEC 2NPPC 4TUIA 3CK2A 4H1SA 5EQVA 1HPUA 5GTUA 4I5NC 2NYLC 2O8GA 1WARA 4O5GA 1T71A 1UTEA 2NYMC 4DSYA 3HVQA 5JJTA 3H60A 2Z1AA 1QHWA 4LU9A 3JYFA 4H2FA 3GVEA 1M63A 4UT3A 4O24A 4IL1A 3QFNA 4YKEA 4B2OA 1SU1A 2WDCA 4LTYA 4WWLA 2USHA 1XM7A 4ORCA 1JK7A 3ICFA 4ZX2A 2WDFA 4MOVA 3H64A 4V0VA 4XPNA 5HPEA 1U32A 4IYPC 5J28A 5INBA 3C5WC 3DW8C 1KBPA 4I5LC 3QFOA 5B8IA 3T1IA 2IE4C 4KKZA 3AV0A 2XMOA 3K7WC 2A22A 2WDEA 3H63A 4H2GA 1NNWA 3RL4A 4DT2A 5JPFA 3H66A 4M0VA 1IT6A 4HD0A 1Z2WA 5IOHA 1S70A 2GJUA 4H1YP 4MOYA 1MF8A 1Z2XA 1TCOA 1WAO1 1W24A 2BDXA 1II7A 2ZBMA 4LACC 4ZVZA 4UWQA 2HY1A 3N5UA 2JOGA 3C9FA 3K7VC 3H68A 4ORAA 3RL3A 4UT2A 2R17A 2DFJA 4FBKA 3RL5A 2WDDA 5DNYA 1S3LA 2NXFA 4H2BA 1S3MA 4UT3B 4DHLA 4J6OA 1S3NA 1QFCA 3LL8A 4KBPA 4OR9A 2Z06A 3H69A 2Z72A 2AHDA 2KKNA 3IB7A 2BQ8X 3P71C 2O8AA 4MP0A 2Q8UA 1T70A 4FBQA 3E7AA 3ZU0A 1OIEA 1USHA 3IVDA 2YVTA 2HYOA 4Q7FA 3KBPA 4H2IA 2CV9A 3QG5C 4JA7A 4ORBA 2P6BA 3DSDA 4JA9A 1S8EA 3EGGA 1G5BA 1UF3A 3QFKA 3E7BA 1FJMA 3IVEA 1OIDA 5JPEA 3H61A 5F3WA 3AUZA 4NZVA 4O4KA 4V0XA 3THNA 1HP1A 3QFMA 4G9JA 2BCDA 1V73A 1OI8A 3RQZA 1AUIA 3H62B 4FCXA 3PSNA 3DSCA 4O43A 2QJCA 3IB8A 3V4YA 4TUGA 2QFRA 5C1VA 1S95A 3THOB 3EGHA 4F0ZA 4FBWA 3PSOA 2IE3C 2QFPA 4V0WA 1HO5A 3ZTVA 3H67A 3TGHA 2HYPA 1XZWA 3FGAC
chains in the Genus database with same CATH superfamily
2IAEC 3C4TA 4TUIA 5LMUE 1N34E 3CK2A 4NXNE 4L8NA 2EPNA 5AE3A 1Z1BA 4JYAE 2H36X 4KHPE 3HXLA 2O8GA 1XNRE 1UTEA 2VRDA 1AAYA 1KYQA 1UHZA 2EPRA 4H2FA 4LF6E 5KL5A 3GVEA 3EPKA 1A1KA 2LJUA 2BB8A 2DMYA 1X3CA 3HPSA 4BMJA 4BS9A 4JI0E 4YKEA 1N3GA 2B7TA 1WHQA 2ZO9B 2YT4A 5FLXC 1XMQE 4R8OA 4DV1E 2HHHE 1RQ0A 5B8IA 3K7WC 5KL6A 3RL4A 4ZYGA 1X47A 2EPXA 2VE7C 2EMBA 1S70A 1ZU1A 2EM8A 1IBME 1GZ6A 2R76A 3HQ1A 2CTDA 4DR3E 2CSHA 4UWQA 2EOEA 3DF6A 5LL6R 2JOGA 3K7VC 3H68A 4OX9E 4WPYA 3RL3A 4JV5E 1AH5A 1DGCA 5A69A 4FBKA 3RL5A 1A1LA 2EQ1A 2L6MA 5DNYA 4WYQB 2JWOA 4HEIA 3LL8A 1JK1A 2EMFA 3IB7A 2EMAA 3ADLA 4M30A 1A1GA 3IVDA 5BR8E 2L3CA 2LUPB 5AC4A 1YFHA 3L00A 2LVHA 4RHBB 4RH8A 2P6BA 3EGGA 1UF3A 3KWRA 2EMHA 3H61A 2WBUA 3HTXA 1YPNA 4F54A 2M1SA 2KOUA 2EPCA 4GZNC 1TN9A 5IXMB 2HGHA 4G9JA 4DR4E 4DR7E 4F9AB 2YTPA 1AUIA 3RMPA 2YTNA 2EMYA 1A1HA 4B3RE 1UN6B 4BHCA 2QFRA 5KL2A 1X6HA 1JK2A 1FKAE 4BC7A 3J7Yp 1A1JA 2DRPA 3FLOA 2EWLA 1IBLE 4F2JC 4WFTA 3PSOA 2JY9A 3H67A 3TGHA 4DV5E 2J7JA 2YPNA 1IMUA 1XZWA 2M4IA 2EPAA 2B9DA 1G2DC 1QU6A 3LMLA 1L4SA 2NPPC 5A6AA 1X6FA 2YTGA 2R1FA 1YYWA 2EPUA 1T4NA 2EM0A 2EM4A 2WCC3 4I5NC 4BBYA 5AC5A 1WARA 4M2ZA 4WX9A 4O5GA 1YUJA 1T71A 1FJGE 5JJTA 3ADGA 1TF3A 2Z1AA 2EPPA 1SR9A 2DLKA 4L5NC 2JPAA 4OOGC 3ECRA 3UK3C 2EN3A 3T1YE 4UT3A 2VF1A 3BBGA 4IL1A 2LRSA 3QFNA 4R2EA 5A6JA 3FIGA 2EP3A 2E72A 2USHA 2JOXA 1JK7A 3IWBA 5T6JA 4IS1C 3EPLA 3ICFA 4ZX2A 4MOVA 1XMOE 1HNXE 4V0VA 4MLQA 2WBSA 5LMNE 5HPEA 2UU9E 3C5WC 3DW8C 4B3SE 4DR6E 3QFOA 5KL3A 2EOFA 3T1IA 2XMOA 5TSEA 4DR5E 2LUQA 4BHBA 4H2GA 2MKNA 4M0VA 4GKJE 4ZYHA 4I8OA 3T1HE 4MOYA 2GJUA 1DI2A 3HPZA 1WAO1 4LACC 1II7A 4ZVZA 2YTIA 2EOYA 2B7VA 4LFAE 3C6MA 2EOJA 4ORAA 4UT2A 2R17A 3EPHA 2EQ3A 2EM3A 2NUGA 5IT9C 4B3TE 2DFJA 2GLIA 2EMCA 3ADIA 4J8ZA 1PKPA 4ZYEA 2MDRA 4H2BA 2N3HA 4J6OA 4LF4E 1QFCA 4AQYE 2UXBE 2EPZA 2RS7A 2AHDA 2EM5A 2HJJA 2IHR1 2O8AA 4MP0A 3MHSC 4WSPA 3BIDA 1A1IA 4IJDA 4X65E 2EOQA 1EH7A 1KJKA 4FBQA 2ADRA 3VK6A 1X49A 2YVTA 2HYOA 2HC5A 2I9IA 1NEIA 2ODRD 2V86A 3KBPA 2JR1A 4DV7E 3QG5C 2EMIA 2EN4A 3K6QA 2FGGA 3KZYA 2F8BA 2LTRA 5LLQA 2DB2A 1BBOA 1PJSA 3DSDA 1S8EA 2DGCA 1G5BA 2L2MA 2NA2A 4YHHE 2CPNA 2DSYA 2K7IA 2BBGA 4NZVA 4R2DA 4DR2E 4F6MA 2YRHA 1ZR9A 4X9JA 3H62B 2ELZA 3PSNA 4JI7E 4DV2E 2EMXA 2YSOA 4BC9A 1BB8A 2EN1A 2KONA 2MKDA 4R03A 5C1VA 1YZ9A 3THOB 4P78A 2YU8A 3EGHA 4WXDA 2QFPA 3MHHC 2G7HA 4FK5C 2YTJA 2ZOAA 3IWCA 2MC5A 2ENAA 2RTXA 4R2PA 4H1SA 2PRTA 1HPUA 2V87A 2EORA 1G2FC 4KWYA 2RPCA 4R2SA 2NYLC 2EQ0A 2EE8A 2EMGA 2EOZA 2NYMC 3HVQA 3H60A 3C6KA 3VYYA 3H09A 1EH6A 2DXLA 1UBDC 4JI2E 3VYXA 2YTQA 1M63A 4O24A 2YTFA 2LE2A 4F9BB 2WDFA 4DV4E 3ADJA 2EOIA 2RQLA 5CFFE 1I94E 3J81C 2L8TA 4XPNA 5J28A 3VHTB 5INBA 4LFCE 3JU0A 2UUBE 1KBPA 4KKZA 3AV0A 3EPJA 2DXNA 2WDEA 1PJQA 2F4VE 2EOSA 2YWQA 1T4LB 4H1YP 1MF8A 1Z2XA 1TCOA 1WRJA 4HTGA 5IV8B 3F6HA 1NCSA 5IWAE 1W24A 2BDXA 1F2IG 2HY1A 3N5UA 1PJTA 2A25A 1ZAAC 3C9FA 1BBGA 1P47A 2EMKA 3LLHA 4MLVA 3ZOQB 2YEQA 2L33A 5AE1A 2V83A 2RSIA 2LMZA 2N8XA 2EPOA 2L2KB 4M9VC 2ODRC 1GTKA 4F9CB 4X62E 1S3LA 2V89A 2NXFA 1S3MA 4GEQB 3TQMA 1IBKE 4KBPA 1J26A 2Z06A 3P1XA 2Z72A 2KKNA 2BQ8X 2EM7A 2YRMA 2GPIA 2DMIA 1T70A 2JP9A 2L2NA 3E7AA 1WHNA 3IWDA 1USHA 3ZU0A 1STUA 4Q7FA 4YY3E 2CV9A 2EOOA 1WJPA 4JI8E 4JA7A 2I13A 4ORBA 1T39A 2VQEE 2RSMA 4BCAA 2N3GA 3QFKA 1OIDA 2NUEA 3KZZA 1HNZE 1YUIA 1UILA 2UXDE 3AUZA 2EOHA 2V88A 4NHRA 2RS6A 2LTSA 2EMZA 4V0XA 4R2QA 2BCDA 3F6GA 1V73A 2LJHA 3RQZA 2ENHA 2JYAA 3DSCA 4O43A 2QJCA 5A6KA 2FV4B 1X5WA 3IB8A 4TUGA 2JXPA 2EOXA 1T4OA 3MSWA 2EPKX 4DR1E 1YYKA 1S95A 1TF6A 2EOMA 3OTOE 3ZTVA 4B3ME 4LF7E 2YSPA 1IQOA 2HYPA 3JAMC 4ZYDA 2LO3A 4X8WA 2EL6A 3FGAC 3J80C 1N32E 2EN2A 5EQVA 5GTUA 1ZBQA 2LCEA 1XNQE 4DSYA 2JVAA 1J5EE 3E0JA 2EJ4A 2EN8A 1QHWA 4LU9A 3JYFA 4WSGA 2CT1A 2EM6A 2KHXA 2ENCA 3BF2A 4B2OA 1SU1A 4LTYA 2WDCA 2WBTA 4WWLA 2EM2A 1XM7A 4ORCA 2JOBA 1RMDA 5A2QC 2L3JA 3H64A 1U32A 4IYPC 2EMLA 5AASA 1LLMC 3BGHA 2UXCE 4I5LC 2D9HA 4KZSA 2IE4C 4DMIA 2V8QB 5JPFA 2A22A 4DV6E 3H63A 4DT2A 4R2RA 1NNWA 2EZ6A 1A1FA 4GKKE 2LBSB 3H66A 1HR0E 2EPMX 1IT6A 2YRKA 1Z2WA 4HD0A 5IOHA 2MC6A 4WXCA 2EM9A 2ZBMA 4R2CA 5ADZA 3M99B 4N4RB 2NUFA 2E1MA 4LF5E 2FTXB 3OMLA 1YYOA 2MDGA 2GHFA 4LF8E 1O0WA 2V85A 1MEYC 2EMWA 2WDDA 1X48A 2LT7A 3DJWA 1RC7A 4LF9E 2M7QA 4NXME 3JTZA 2UUCE 4UT3B 4DHLA 2YTDA 1S3NA 4OR9A 4DUZE 4DV3E 3H69A 4Q35B 1DQ3A 3P71C 1SFEA 2EN7A 1WXRA 2VQFE 5A6BA 2Q8UA 5A6BD 4JI4E 4F6NA 3J7AG 2YU5A 1OIEA 5AE2A 2K4VA 1ZBTA 2M9AA 2YZTA 2E5LE 5KL4A 2ZM6E 2LV2A 2YTEA 4H2IA 2L92A 4X66E 4JA9A 4DKKA 4DV0E 4LFBE 1FJMA 3E7BA 1MGTA 3IVEA 5JPEA 2WZOA 1QNTA 4R2AA 5F3WA 3D03A 4X64E 4K0KE 1PDAA 2B3TB 2DLQA 4O4KA 3THNA 1HP1A 3EQ1A 1HNWE 3C4BA 3QFMA 1EKZA 4JI3E 1EH8A 2EL4A 4Q28A 1OI8A 4FCXA 1N36E 1T38A 4JI1E 1X6EA 2YTOA 1YSAC 2EL5A 3V4YA 2NABA 1IQSA 2EN6A 4JI6E 2ELYA 1GQEA 5KL7A 4FBWA 2UUAE 4F0ZA 2IE3C 4V0WA 1B69A 1N33E 1HO5A 4DUYE 4JI5E 2DIXA 2EPLX 4P7DA
chains in the Genus database with same CATH topology
2IAEC 3C4TA 4TUIA 5LMUE 1N34E 3CK2A 4NXNE 4L8NA 5AE3A 4JYAE 2H36X 4KHPE 3HXLA 2O8GA 1XNRE 1UTEA 1UHZA 4H2FA 4LF6E 3GVEA 4BMJA 2DMYA 3HPSA 4BS9A 4JI0E 4YKEA 2B7TA 1WHQA 2ZO9B 2YT4A 5FLXC 1XMQE 4R8OA 4DV1E 2HHHE 1RQ0A 5B8IA 3K7WC 3RL4A 1X47A 2VE7C 1S70A 1IBME 1GZ6A 3HQ1A 4DR3E 4UWQA 3DF6A 5LL6R 2JOGA 3K7VC 3H68A 4OX9E 4WPYA 3RL3A 4JV5E 4FBKA 3RL5A 2L6MA 5DNYA 4WYQB 2JWOA 3LL8A 3IB7A 3ADLA 4M30A 3IVDA 5BR8E 2L3CA 2LUPB 2P6BA 3EGGA 1UF3A 3KWRA 3H61A 3HTXA 4F54A 2M1SA 2KOUA 4G9JA 4DR4E 4DR7E 4F9AB 1AUIA 3RMPA 4B3RE 2QFRA 1FKAE 4BC7A 3J7Yp 3FLOA 2EWLA 1IBLE 4WFTA 3PSOA 2JY9A 3H67A 3TGHA 4DV5E 1XZWA 2M4IA 2B9DA 1QU6A 3LMLA 2NPPC 1YYWA 1T4NA 4I5NC 4BBYA 1WARA 4M2ZA 4O5GA 1T71A 1FJGE 5JJTA 3ADGA 2Z1AA 1SR9A 4L5NC 4OOGC 3T1YE 4UT3A 2VF1A 4IL1A 2LRSA 3QFNA 3FIGA 2USHA 2JOXA 1JK7A 3IWBA 5T6JA 3ICFA 4ZX2A 4MOVA 1XMOE 1HNXE 4V0VA 5LMNE 5HPEA 2UU9E 3C5WC 3DW8C 4B3SE 4DR6E 3QFOA 3T1IA 2XMOA 4DR5E 2LUQA 4H2GA 4M0VA 4GKJE 4I8OA 3T1HE 4MOYA 2GJUA 1DI2A 3HPZA 1WAO1 4LACC 1II7A 4ZVZA 2B7VA 4LFAE 4ORAA 4UT2A 2R17A 2NUGA 2DFJA 5IT9C 4B3TE 3ADIA 4J8ZA 1PKPA 2MDRA 4H2BA 2N3HA 4J6OA 4LF4E 1QFCA 4AQYE 2UXBE 2RS7A 2AHDA 2IHR1 2O8AA 4MP0A 4WSPA 4X65E 4FBQA 3VK6A 1X49A 2YVTA 2HYOA 2V86A 2ODRD 3KBPA 2JR1A 4DV7E 3QG5C 3K6QA 2FGGA 2F8BA 2LTRA 2DB2A 3DSDA 1S8EA 1G5BA 2L2MA 2NA2A 4YHHE 2CPNA 2DSYA 4NZVA 4DR2E 3H62B 3PSNA 4JI7E 4DV2E 4BC9A 2KONA 4R03A 5C1VA 1YZ9A 3THOB 4P78A 3EGHA 2QFPA 2G7HA 2ZOAA 3IWCA 2MC5A 2RTXA 4H1SA 1HPUA 2V87A 2NYLC 2NYMC 3HVQA 3H60A 3VYYA 3H09A 2DXLA 4JI2E 3VYXA 1M63A 4O24A 2LE2A 4F9BB 2WDFA 4DV4E 3ADJA 5CFFE 1I94E 3J81C 2L8TA 4XPNA 5J28A 5INBA 4LFCE 3JU0A 2UUBE 1KBPA 4KKZA 3AV0A 2DXNA 2WDEA 2F4VE 1T4LB 4H1YP 1MF8A 1Z2XA 1TCOA 1W24A 3F6HA 2BDXA 5IWAE 2HY1A 3N5UA 3C9FA 3LLHA 3ZOQB 2YEQA 2L33A 5AE1A 2V83A 2LMZA 2L2KB 2ODRC 4F9CB 4X62E 1S3LA 2V89A 2NXFA 1S3MA 4GEQB 1IBKE 4KBPA 1J26A 2Z06A 3P1XA 2Z72A 2KKNA 2BQ8X 1T70A 2L2NA 3E7AA 1WHNA 3IWDA 1USHA 3ZU0A 1STUA 4Q7FA 4YY3E 2CV9A 4JI8E 4JA7A 4ORBA 2VQEE 2RSMA 4BCAA 2N3GA 3QFKA 1OIDA 2NUEA 1HNZE 2UXDE 1UILA 3AUZA 2V88A 2RS6A 2LTSA 4V0XA 2BCDA 3F6GA 1V73A 2LJHA 3RQZA 3DSCA 4O43A 2QJCA 3IB8A 2FV4B 4TUGA 1T4OA 3MSWA 4DR1E 1YYKA 1S95A 3OTOE 3ZTVA 4B3ME 4LF7E 2HYPA 3JAMC 4X8WA 3FGAC 3J80C 1N32E 5EQVA 5GTUA 1ZBQA 1XNQE 4DSYA 2JVAA 1J5EE 3E0JA 1QHWA 4LU9A 3JYFA 2KHXA 4B2OA 1SU1A 4LTYA 2WDCA 4WWLA 1XM7A 4ORCA 2JOBA 5A2QC 2L3JA 3H64A 1U32A 4IYPC 5AASA 2UXCE 4I5LC 4KZSA 2IE4C 4DMIA 2V8QB 5JPFA 2A22A 4DV6E 3H63A 4DT2A 1NNWA 2EZ6A 4GKKE 2LBSB 3H66A 1HR0E 1IT6A 4HD0A 1Z2WA 5IOHA 2MC6A 2ZBMA 5ADZA 4LF5E 2NUFA 2E1MA 2FTXB 3OMLA 1YYOA 4LF8E 1O0WA 2V85A 2WDDA 1X48A 3DJWA 1RC7A 4LF9E 2M7QA 4NXME 3JTZA 2UUCE 4UT3B 4DHLA 1S3NA 4OR9A 4DUZE 4DV3E 3H69A 1DQ3A 3P71C 1WXRA 2VQFE 4JI4E 2Q8UA 3J7AG 1OIEA 5AE2A 2K4VA 1ZBTA 2YZTA 2E5LE 2ZM6E 4H2IA 2L92A 4X66E 4JA9A 4DKKA 4DV0E 4LFBE 1FJMA 3E7BA 3IVEA 5JPEA 2WZOA 3D03A 5F3WA 4X64E 4K0KE 2B3TB 4O4KA 3THNA 1HP1A 1HNWE 3C4BA 3QFMA 1EKZA 4JI3E 4Q28A 1OI8A 4FCXA 1N36E 4JI1E 3V4YA 4JI6E 1GQEA 4F0ZA 4FBWA 2UUAE 2IE3C 4V0WA 1N33E 1HO5A 4DUYE 4JI5E 2DIXA 4P7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAE C;  2NPP C;  4TUI A;  3CK2 A;  4H1S A;  5EQV A;  1HPU A;  5GTU A;  4I5N C;  2NYL C;  2O8G A;  1WAR A;  4O5G A;  1T71 A;  1UTE A;  2NYM C;  4DSY A;  3HVQ A;  5JJT A;  3H60 A;  2Z1A A;  1QHW A;  4LU9 A;  3JYF A;  4H2F A;  3GVE A;  1M63 A;  4UT3 A;  4O24 A;  4IL1 A;  3QFN A;  4YKE A;  4B2O A;  1SU1 A;  2WDC A;  4LTY A;  4WWL A;  2USH A;  1XM7 A;  4ORC A;  1JK7 A;  3ICF A;  4ZX2 A;  2WDF A;  4MOV A;  3H64 A;  4V0V A;  4XPN A;  5HPE A;  1U32 A;  4IYP C;  5J28 A;  5INB A;  3C5W C;  3DW8 C;  1KBP A;  4I5L C;  3QFO A;  5B8I A;  3T1I A;  2IE4 C;  4KKZ A;  3AV0 A;  2XMO A;  3K7W C;  2A22 A;  2WDE A;  3H63 A;  4H2G A;  1NNW A;  3RL4 A;  4DT2 A;  5JPF A;  3H66 A;  4M0V A;  1IT6 A;  4HD0 A;  1Z2W A;  5IOH A;  1S70 A;  2GJU A;  4H1Y P;  4MOY A;  1MF8 A;  1Z2X A;  1TCO A;  1WAO 1;  1W24 A;  2BDX A;  1II7 A;  2ZBM A;  4LAC C;  4ZVZ A;  4UWQ A;  2HY1 A;  3N5U A;  2JOG A;  3C9F A;  3K7V C;  3H68 A;  4ORA A;  3RL3 A;  4UT2 A;  2R17 A;  2DFJ A;  4FBK A;  3RL5 A;  2WDD A;  5DNY A;  1S3L A;  2NXF A;  4H2B A;  1S3M A;  4UT3 B;  4DHL A;  4J6O A;  1S3N A;  1QFC A;  3LL8 A;  4KBP A;  4OR9 A;  2Z06 A;  3H69 A;  2Z72 A;  2AHD A;  2KKN A;  3IB7 A;  2BQ8 X;  3P71 C;  2O8A A;  4MP0 A;  2Q8U A;  1T70 A;  4FBQ A;  3E7A A;  3ZU0 A;  1OIE A;  1USH A;  3IVD A;  2YVT A;  2HYO A;  4Q7F A;  3KBP A;  4H2I A;  2CV9 A;  3QG5 C;  4JA7 A;  4ORB A;  2P6B A;  3DSD A;  4JA9 A;  1S8E A;  3EGG A;  1G5B A;  1UF3 A;  3QFK A;  3E7B A;  1FJM A;  3IVE A;  1OID A;  5JPE A;  3H61 A;  5F3W A;  3AUZ A;  4NZV A;  4O4K A;  4V0X A;  3THN A;  1HP1 A;  3QFM A;  4G9J A;  2BCD A;  1V73 A;  1OI8 A;  3RQZ A;  1AUI A;  3H62 B;  4FCX A;  3PSN A;  3DSC A;  4O43 A;  2QJC A;  3IB8 A;  3V4Y A;  4TUG A;  2QFR A;  5C1V A;  1S95 A;  3THO B;  3EGH A;  4F0Z A;  4FBW A;  3PSO A;  2IE3 C;  2QFP A;  4V0W A;  1HO5 A;  3ZTV A;  3H67 A;  3TGH A;  2HYP A;  1XZW A;  3FGA C; 
#chains in the Genus database with same CATH topology
 2IAE C;  3C4T A;  4TUI A;  5LMU E;  1N34 E;  3CK2 A;  4NXN E;  4L8N A;  2EPN A;  5AE3 A;  1Z1B A;  4JYA E;  2H36 X;  4KHP E;  3HXL A;  2O8G A;  1XNR E;  1UTE A;  2VRD A;  1AAY A;  1KYQ A;  1UHZ A;  2EPR A;  4H2F A;  4LF6 E;  5KL5 A;  3GVE A;  3EPK A;  1A1K A;  2LJU A;  2BB8 A;  2DMY A;  1X3C A;  3HPS A;  4BMJ A;  4BS9 A;  4JI0 E;  4YKE A;  1N3G A;  2B7T A;  1WHQ A;  2ZO9 B;  2YT4 A;  5FLX C;  1XMQ E;  4R8O A;  4DV1 E;  2HHH E;  1RQ0 A;  5B8I A;  3K7W C;  5KL6 A;  3RL4 A;  4ZYG A;  1X47 A;  2EPX A;  2VE7 C;  2EMB A;  1S70 A;  1ZU1 A;  2EM8 A;  1IBM E;  1GZ6 A;  2R76 A;  3HQ1 A;  2CTD A;  4DR3 E;  2CSH A;  4UWQ A;  2EOE A;  3DF6 A;  5LL6 R;  2JOG A;  3K7V C;  3H68 A;  4OX9 E;  4WPY A;  3RL3 A;  4JV5 E;  1AH5 A;  1DGC A;  5A69 A;  4FBK A;  3RL5 A;  1A1L A;  2EQ1 A;  2L6M A;  5DNY A;  4WYQ B;  2JWO A;  4HEI A;  3LL8 A;  1JK1 A;  2EMF A;  3IB7 A;  2EMA A;  3ADL A;  4M30 A;  1A1G A;  3IVD A;  5BR8 E;  2L3C A;  2LUP B;  5AC4 A;  1YFH A;  3L00 A;  2LVH A;  4RHB B;  4RH8 A;  2P6B A;  3EGG A;  1UF3 A;  3KWR A;  2EMH A;  3H61 A;  2WBU A;  3HTX A;  1YPN A;  4F54 A;  2M1S A;  2KOU A;  2EPC A;  4GZN C;  1TN9 A;  5IXM B;  2HGH A;  4G9J A;  4DR4 E;  4DR7 E;  4F9A B;  2YTP A;  1AUI A;  3RMP A;  2YTN A;  2EMY A;  1A1H A;  4B3R E;  1UN6 B;  4BHC A;  2QFR A;  5KL2 A;  1X6H A;  1JK2 A;  1FKA E;  4BC7 A;  3J7Y p;  1A1J A;  2DRP A;  3FLO A;  2EWL A;  1IBL E;  4F2J C;  4WFT A;  3PSO A;  2JY9 A;  3H67 A;  3TGH A;  4DV5 E;  2J7J A;  2YPN A;  1IMU A;  1XZW A;  2M4I A;  2EPA A;  2B9D A;  1G2D C;  1QU6 A;  3LML A;  1L4S A;  2NPP C;  5A6A A;  1X6F A;  2YTG A;  2R1F A;  1YYW A;  2EPU A;  1T4N A;  2EM0 A;  2EM4 A;  2WCC 3;  4I5N C;  4BBY A;  5AC5 A;  1WAR A;  4M2Z A;  4WX9 A;  4O5G A;  1YUJ A;  1T71 A;  1FJG E;  5JJT A;  3ADG A;  1TF3 A;  2Z1A A;  2EPP A;  1SR9 A;  2DLK A;  4L5N C;  2JPA A;  4OOG C;  3ECR A;  3UK3 C;  2EN3 A;  3T1Y E;  4UT3 A;  2VF1 A;  3BBG A;  4IL1 A;  2LRS A;  3QFN A;  4R2E A;  5A6J A;  3FIG A;  2EP3 A;  2E72 A;  2USH A;  2JOX A;  1JK7 A;  3IWB A;  5T6J A;  4IS1 C;  3EPL A;  3ICF A;  4ZX2 A;  4MOV A;  1XMO E;  1HNX E;  4V0V A;  4MLQ A;  2WBS A;  5LMN E;  5HPE A;  2UU9 E;  3C5W C;  3DW8 C;  4B3S E;  4DR6 E;  3QFO A;  5KL3 A;  2EOF A;  3T1I A;  2XMO A;  5TSE A;  4DR5 E;  2LUQ A;  4BHB A;  4H2G A;  2MKN A;  4M0V A;  4GKJ E;  4ZYH A;  4I8O A;  3T1H E;  4MOY A;  2GJU A;  1DI2 A;  3HPZ A;  1WAO 1;  4LAC C;  1II7 A;  4ZVZ A;  2YTI A;  2EOY A;  2B7V A;  4LFA E;  3C6M A;  2EOJ A;  4ORA A;  4UT2 A;  2R17 A;  3EPH A;  2EQ3 A;  2EM3 A;  2NUG A;  5IT9 C;  4B3T E;  2DFJ A;  2GLI A;  2EMC A;  3ADI A;  4J8Z A;  1PKP A;  4ZYE A;  2MDR A;  4H2B A;  2N3H A;  4J6O A;  4LF4 E;  1QFC A;  4AQY E;  2UXB E;  2EPZ A;  2RS7 A;  2AHD A;  2EM5 A;  2HJJ A;  2IHR 1;  2O8A A;  4MP0 A;  3MHS C;  4WSP A;  3BID A;  1A1I A;  4IJD A;  4X65 E;  2EOQ A;  1EH7 A;  1KJK A;  4FBQ A;  2ADR A;  3VK6 A;  1X49 A;  2YVT A;  2HYO A;  2HC5 A;  2I9I A;  1NEI A;  2ODR D;  2V86 A;  3KBP A;  2JR1 A;  4DV7 E;  3QG5 C;  2EMI A;  2EN4 A;  3K6Q A;  2FGG A;  3KZY A;  2F8B A;  2LTR A;  5LLQ A;  2DB2 A;  1BBO A;  1PJS A;  3DSD A;  1S8E A;  2DGC A;  1G5B A;  2L2M A;  2NA2 A;  4YHH E;  2CPN A;  2DSY A;  2K7I A;  2BBG A;  4NZV A;  4R2D A;  4DR2 E;  4F6M A;  2YRH A;  1ZR9 A;  4X9J A;  3H62 B;  2ELZ A;  3PSN A;  4JI7 E;  4DV2 E;  2EMX A;  2YSO A;  4BC9 A;  1BB8 A;  2EN1 A;  2KON A;  2MKD A;  4R03 A;  5C1V A;  1YZ9 A;  3THO B;  4P78 A;  2YU8 A;  3EGH A;  4WXD A;  2QFP A;  3MHH C;  2G7H A;  4FK5 C;  2YTJ A;  2ZOA A;  3IWC A;  2MC5 A;  2ENA A;  2RTX A;  4R2P A;  4H1S A;  2PRT A;  1HPU A;  2V87 A;  2EOR A;  1G2F C;  4KWY A;  2RPC A;  4R2S A;  2NYL C;  2EQ0 A;  2EE8 A;  2EMG A;  2EOZ A;  2NYM C;  3HVQ A;  3H60 A;  3C6K A;  3VYY A;  3H09 A;  1EH6 A;  2DXL A;  1UBD C;  4JI2 E;  3VYX A;  2YTQ A;  1M63 A;  4O24 A;  2YTF A;  2LE2 A;  4F9B B;  2WDF A;  4DV4 E;  3ADJ A;  2EOI A;  2RQL A;  5CFF E;  1I94 E;  3J81 C;  2L8T A;  4XPN A;  5J28 A;  3VHT B;  5INB A;  4LFC E;  3JU0 A;  2UUB E;  1KBP A;  4KKZ A;  3AV0 A;  3EPJ A;  2DXN A;  2WDE A;  1PJQ A;  2F4V E;  2EOS A;  2YWQ A;  1T4L B;  4H1Y P;  1MF8 A;  1Z2X A;  1TCO A;  1WRJ A;  4HTG A;  5IV8 B;  3F6H A;  1NCS A;  5IWA E;  1W24 A;  2BDX A;  1F2I G;  2HY1 A;  3N5U A;  1PJT A;  2A25 A;  1ZAA C;  3C9F A;  1BBG A;  1P47 A;  2EMK A;  3LLH A;  4MLV A;  3ZOQ B;  2YEQ A;  2L33 A;  5AE1 A;  2V83 A;  2RSI A;  2LMZ A;  2N8X A;  2EPO A;  2L2K B;  4M9V C;  2ODR C;  1GTK A;  4F9C B;  4X62 E;  1S3L A;  2V89 A;  2NXF A;  1S3M A;  4GEQ B;  3TQM A;  1IBK E;  4KBP A;  1J26 A;  2Z06 A;  3P1X A;  2Z72 A;  2KKN A;  2BQ8 X;  2EM7 A;  2YRM A;  2GPI A;  2DMI A;  1T70 A;  2JP9 A;  2L2N A;  3E7A A;  1WHN A;  3IWD A;  1USH A;  3ZU0 A;  1STU A;  4Q7F A;  4YY3 E;  2CV9 A;  2EOO A;  1WJP A;  4JI8 E;  4JA7 A;  2I13 A;  4ORB A;  1T39 A;  2VQE E;  2RSM A;  4BCA A;  2N3G A;  3QFK A;  1OID A;  2NUE A;  3KZZ A;  1HNZ E;  1YUI A;  1UIL A;  2UXD E;  3AUZ A;  2EOH A;  2V88 A;  4NHR A;  2RS6 A;  2LTS A;  2EMZ A;  4V0X A;  4R2Q A;  2BCD A;  3F6G A;  1V73 A;  2LJH A;  3RQZ A;  2ENH A;  2JYA A;  3DSC A;  4O43 A;  2QJC A;  5A6K A;  2FV4 B;  1X5W A;  3IB8 A;  4TUG A;  2JXP A;  2EOX A;  1T4O A;  3MSW A;  2EPK X;  4DR1 E;  1YYK A;  1S95 A;  1TF6 A;  2EOM A;  3OTO E;  3ZTV A;  4B3M E;  4LF7 E;  2YSP A;  1IQO A;  2HYP A;  3JAM C;  4ZYD A;  2LO3 A;  4X8W A;  2EL6 A;  3FGA C;  3J80 C;  1N32 E;  2EN2 A;  5EQV A;  5GTU A;  1ZBQ A;  2LCE A;  1XNQ E;  4DSY A;  2JVA A;  1J5E E;  3E0J A;  2EJ4 A;  2EN8 A;  1QHW A;  4LU9 A;  3JYF A;  4WSG A;  2CT1 A;  2EM6 A;  2KHX A;  2ENC A;  3BF2 A;  4B2O A;  1SU1 A;  4LTY A;  2WDC A;  2WBT A;  4WWL A;  2EM2 A;  1XM7 A;  4ORC A;  2JOB A;  1RMD A;  5A2Q C;  2L3J A;  3H64 A;  1U32 A;  4IYP C;  2EML A;  5AAS A;  1LLM C;  3BGH A;  2UXC E;  4I5L C;  2D9H A;  4KZS A;  2IE4 C;  4DMI A;  2V8Q B;  5JPF A;  2A22 A;  4DV6 E;  3H63 A;  4DT2 A;  4R2R A;  1NNW A;  2EZ6 A;  1A1F A;  4GKK E;  2LBS B;  3H66 A;  1HR0 E;  2EPM X;  1IT6 A;  2YRK A;  1Z2W A;  4HD0 A;  5IOH A;  2MC6 A;  4WXC A;  2EM9 A;  2ZBM A;  4R2C A;  5ADZ A;  3M99 B;  4N4R B;  2NUF A;  2E1M A;  4LF5 E;  2FTX B;  3OML A;  1YYO A;  2MDG A;  2GHF A;  4LF8 E;  1O0W A;  2V85 A;  1MEY C;  2EMW A;  2WDD A;  1X48 A;  2LT7 A;  3DJW A;  1RC7 A;  4LF9 E;  2M7Q A;  4NXM E;  3JTZ A;  2UUC E;  4UT3 B;  4DHL A;  2YTD A;  1S3N A;  4OR9 A;  4DUZ E;  4DV3 E;  3H69 A;  4Q35 B;  1DQ3 A;  3P71 C;  1SFE A;  2EN7 A;  1WXR A;  2VQF E;  5A6B A;  2Q8U A;  5A6B D;  4JI4 E;  4F6N A;  3J7A G;  2YU5 A;  1OIE A;  5AE2 A;  2K4V A;  1ZBT A;  2M9A A;  2YZT A;  2E5L E;  5KL4 A;  2ZM6 E;  2LV2 A;  2YTE A;  4H2I A;  2L92 A;  4X66 E;  4JA9 A;  4DKK A;  4DV0 E;  4LFB E;  1FJM A;  3E7B A;  1MGT A;  3IVE A;  5JPE A;  2WZO A;  1QNT A;  4R2A A;  5F3W A;  3D03 A;  4X64 E;  4K0K E;  1PDA A;  2B3T B;  2DLQ A;  4O4K A;  3THN A;  1HP1 A;  3EQ1 A;  1HNW E;  3C4B A;  3QFM A;  1EKZ A;  4JI3 E;  1EH8 A;  2EL4 A;  4Q28 A;  1OI8 A;  4FCX A;  1N36 E;  1T38 A;  4JI1 E;  1X6E A;  2YTO A;  1YSA C;  2EL5 A;  3V4Y A;  2NAB A;  1IQS A;  2EN6 A;  4JI6 E;  2ELY A;  1GQE A;  5KL7 A;  4FBW A;  2UUA E;  4F0Z A;  2IE3 C;  4V0W A;  1B69 A;  1N33 E;  1HO5 A;  4DUY E;  4JI5 E;  2DIX A;  2EPL X;  4P7D A; 
#chains in the Genus database with same CATH homology
 2IAE C;  3C4T A;  4TUI A;  5LMU E;  1N34 E;  3CK2 A;  4NXN E;  4L8N A;  5AE3 A;  4JYA E;  2H36 X;  4KHP E;  3HXL A;  2O8G A;  1XNR E;  1UTE A;  1UHZ A;  4H2F A;  4LF6 E;  3GVE A;  4BMJ A;  2DMY A;  3HPS A;  4BS9 A;  4JI0 E;  4YKE A;  2B7T A;  1WHQ A;  2ZO9 B;  2YT4 A;  5FLX C;  1XMQ E;  4R8O A;  4DV1 E;  2HHH E;  1RQ0 A;  5B8I A;  3K7W C;  3RL4 A;  1X47 A;  2VE7 C;  1S70 A;  1IBM E;  1GZ6 A;  3HQ1 A;  4DR3 E;  4UWQ A;  3DF6 A;  5LL6 R;  2JOG A;  3K7V C;  3H68 A;  4OX9 E;  4WPY A;  3RL3 A;  4JV5 E;  4FBK A;  3RL5 A;  2L6M A;  5DNY A;  4WYQ B;  2JWO A;  3LL8 A;  3IB7 A;  3ADL A;  4M30 A;  3IVD A;  5BR8 E;  2L3C A;  2LUP B;  2P6B A;  3EGG A;  1UF3 A;  3KWR A;  3H61 A;  3HTX A;  4F54 A;  2M1S A;  2KOU A;  4G9J A;  4DR4 E;  4DR7 E;  4F9A B;  1AUI A;  3RMP A;  4B3R E;  2QFR A;  1FKA E;  4BC7 A;  3J7Y p;  3FLO A;  2EWL A;  1IBL E;  4WFT A;  3PSO A;  2JY9 A;  3H67 A;  3TGH A;  4DV5 E;  1XZW A;  2M4I A;  2B9D A;  1QU6 A;  3LML A;  2NPP C;  1YYW A;  1T4N A;  4I5N C;  4BBY A;  1WAR A;  4M2Z A;  4O5G A;  1T71 A;  1FJG E;  5JJT A;  3ADG A;  2Z1A A;  1SR9 A;  4L5N C;  4OOG C;  3T1Y E;  4UT3 A;  2VF1 A;  4IL1 A;  2LRS A;  3QFN A;  3FIG A;  2USH A;  2JOX A;  1JK7 A;  3IWB A;  5T6J A;  3ICF A;  4ZX2 A;  4MOV A;  1XMO E;  1HNX E;  4V0V A;  5LMN E;  5HPE A;  2UU9 E;  3C5W C;  3DW8 C;  4B3S E;  4DR6 E;  3QFO A;  3T1I A;  2XMO A;  4DR5 E;  2LUQ A;  4H2G A;  4M0V A;  4GKJ E;  4I8O A;  3T1H E;  4MOY A;  2GJU A;  1DI2 A;  3HPZ A;  1WAO 1;  4LAC C;  1II7 A;  4ZVZ A;  2B7V A;  4LFA E;  4ORA A;  4UT2 A;  2R17 A;  2NUG A;  2DFJ A;  5IT9 C;  4B3T E;  3ADI A;  4J8Z A;  1PKP A;  2MDR A;  4H2B A;  2N3H A;  4J6O A;  4LF4 E;  1QFC A;  4AQY E;  2UXB E;  2RS7 A;  2AHD A;  2IHR 1;  2O8A A;  4MP0 A;  4WSP A;  4X65 E;  4FBQ A;  3VK6 A;  1X49 A;  2YVT A;  2HYO A;  2V86 A;  2ODR D;  3KBP A;  2JR1 A;  4DV7 E;  3QG5 C;  3K6Q A;  2FGG A;  2F8B A;  2LTR A;  2DB2 A;  3DSD A;  1S8E A;  1G5B A;  2L2M A;  2NA2 A;  4YHH E;  2CPN A;  2DSY A;  4NZV A;  4DR2 E;  3H62 B;  3PSN A;  4JI7 E;  4DV2 E;  4BC9 A;  2KON A;  4R03 A;  5C1V A;  1YZ9 A;  3THO B;  4P78 A;  3EGH A;  2QFP A;  2G7H A;  2ZOA A;  3IWC A;  2MC5 A;  2RTX A;  4H1S A;  1HPU A;  2V87 A;  2NYL C;  2NYM C;  3HVQ A;  3H60 A;  3VYY A;  3H09 A;  2DXL A;  4JI2 E;  3VYX A;  1M63 A;  4O24 A;  2LE2 A;  4F9B B;  2WDF A;  4DV4 E;  3ADJ A;  5CFF E;  1I94 E;  3J81 C;  2L8T A;  4XPN A;  5J28 A;  5INB A;  4LFC E;  3JU0 A;  2UUB E;  1KBP A;  4KKZ A;  3AV0 A;  2DXN A;  2WDE A;  2F4V E;  1T4L B;  4H1Y P;  1MF8 A;  1Z2X A;  1TCO A;  1W24 A;  3F6H A;  2BDX A;  5IWA E;  2HY1 A;  3N5U A;  3C9F A;  3LLH A;  3ZOQ B;  2YEQ A;  2L33 A;  5AE1 A;  2V83 A;  2LMZ A;  2L2K B;  2ODR C;  4F9C B;  4X62 E;  1S3L A;  2V89 A;  2NXF A;  1S3M A;  4GEQ B;  1IBK E;  4KBP A;  1J26 A;  2Z06 A;  3P1X A;  2Z72 A;  2KKN A;  2BQ8 X;  1T70 A;  2L2N A;  3E7A A;  1WHN A;  3IWD A;  1USH A;  3ZU0 A;  1STU A;  4Q7F A;  4YY3 E;  2CV9 A;  4JI8 E;  4JA7 A;  4ORB A;  2VQE E;  2RSM A;  4BCA A;  2N3G A;  3QFK A;  1OID A;  2NUE A;  1HNZ E;  2UXD E;  1UIL A;  3AUZ A;  2V88 A;  2RS6 A;  2LTS A;  4V0X A;  2BCD A;  3F6G A;  1V73 A;  2LJH A;  3RQZ A;  3DSC A;  4O43 A;  2QJC A;  3IB8 A;  2FV4 B;  4TUG A;  1T4O A;  3MSW A;  4DR1 E;  1YYK A;  1S95 A;  3OTO E;  3ZTV A;  4B3M E;  4LF7 E;  2HYP A;  3JAM C;  4X8W A;  3FGA C;  3J80 C;  1N32 E;  5EQV A;  5GTU A;  1ZBQ A;  1XNQ E;  4DSY A;  2JVA A;  1J5E E;  3E0J A;  1QHW A;  4LU9 A;  3JYF A;  2KHX A;  4B2O A;  1SU1 A;  4LTY A;  2WDC A;  4WWL A;  1XM7 A;  4ORC A;  2JOB A;  5A2Q C;  2L3J A;  3H64 A;  1U32 A;  4IYP C;  5AAS A;  2UXC E;  4I5L C;  4KZS A;  2IE4 C;  4DMI A;  2V8Q B;  5JPF A;  2A22 A;  4DV6 E;  3H63 A;  4DT2 A;  1NNW A;  2EZ6 A;  4GKK E;  2LBS B;  3H66 A;  1HR0 E;  1IT6 A;  4HD0 A;  1Z2W A;  5IOH A;  2MC6 A;  2ZBM A;  5ADZ A;  4LF5 E;  2NUF A;  2E1M A;  2FTX B;  3OML A;  1YYO A;  4LF8 E;  1O0W A;  2V85 A;  2WDD A;  1X48 A;  3DJW A;  1RC7 A;  4LF9 E;  2M7Q A;  4NXM E;  3JTZ A;  2UUC E;  4UT3 B;  4DHL A;  1S3N A;  4OR9 A;  4DUZ E;  4DV3 E;  3H69 A;  1DQ3 A;  3P71 C;  1WXR A;  2VQF E;  4JI4 E;  2Q8U A;  3J7A G;  1OIE A;  5AE2 A;  2K4V A;  1ZBT A;  2YZT A;  2E5L E;  2ZM6 E;  4H2I A;  2L92 A;  4X66 E;  4JA9 A;  4DKK A;  4DV0 E;  4LFB E;  1FJM A;  3E7B A;  3IVE A;  5JPE A;  2WZO A;  3D03 A;  5F3W A;  4X64 E;  4K0K E;  2B3T B;  4O4K A;  3THN A;  1HP1 A;  1HNW E;  3C4B A;  3QFM A;  1EKZ A;  4JI3 E;  4Q28 A;  1OI8 A;  4FCX A;  1N36 E;  4JI1 E;  3V4Y A;  4JI6 E;  1GQE A;  4F0Z A;  4FBW A;  2UUA E;  2IE3 C;  4V0W A;  1N33 E;  1HO5 A;  4DUY E;  4JI5 E;  2DIX A;  4P7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...