4TUIA

Crystal structure of mjmre11-dna1 complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
total genus 94
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tuiA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tuiA01
2HYOA 3RQZA 3N5UA 3C5WC 4H2IA 4UT2A 2P6BA 3AV0A 4UWQA 4XPNA 1UTEA 4M0VA 3QFKA 1NNWA 3H67A 1KBPA 2CV9A 3EGGA 3QG5C 2ZBMA 1U32A 3K7VC 4HD0A 3THNA 2USHA 4MOVA 4LTYA 1MF8A 5IOHA 1M63A 5EQVA 3TGHA 2NYLC 3DSDA 1S3NA 4V0VA 3HVQA 5DNYA 2NYMC 3E7BA 3H62B 3RL5A 2XMOA 1HO5A 2AHDA 3ZU0A 4UT3A 4LACC 2Q8UA 2NPPC 1QHWA 4DSYA 1JK7A 3H61A 3ICFA 2Z72A 3QFOA 4UT3B 3IB7A 1T71A 4J6OA 3H64A 3PSOA 2BCDA 3H63A 4H2GA 4V0XA 3DSCA 1W24A 2BDXA 3LL8A 1S8EA 1V73A 2R17A 4WWLA 4ZVZA 4MOYA 4DT2A 4O43A 3V4YA 1II7A 5JJTA 1WARA 3AUZA 4YKEA 2A22A 2HY1A 3H68A 3ZTVA 4H1YP 2WDFA 2QFRA 4I5LC 3THOB 3QFMA 4MP0A 1FJMA 4ORBA 4FBWA 2Z1AA 2YVTA 4TUIA 1Z2WA 4JA9A 5C1VA 1Z2XA 2Z06A 4O24A 4I5NC 5INBA 2DFJA 5F3WA 5J28A 4ORAA 4F0ZA 5B8IA 3IVDA 2HYPA 1SU1A 1XZWA 2QJCA 1S70A 2IAEC 5GTUA 1HPUA 4IL1A 2JOGA 4NZVA 4FBKA 4ZX2A 2WDEA 3H69A 3T1IA 1USHA 5JPEA 3GVEA 1OIEA 3H60A 3PSNA 1HP1A 2IE3C 3K7WC 1S95A 2O8AA 4B2OA 1UF3A 2QFPA 4TUGA 4FCXA 1G5BA 1OIDA 3C9FA 2IE4C 4DHLA 2WDCA 3QFNA 5JPFA 3IVEA 3IB8A 3DW8C 1S3LA 3E7AA 4IYPC 4H2BA 1AUIA 1OI8A 1XM7A 2WDDA 1IT6A 3H66A 4JA7A 2KKNA 4KBPA 1S3MA 4O5GA 2O8GA 2GJUA 1QFCA 3EGHA 3RL3A 2BQ8X 4O4KA 3JYFA 4ORCA 1TCOA 3FGAC 4KKZA 2NXFA 3KBPA 1T70A 3P71C 4LU9A 4Q7FA 4V0WA 4OR9A 4G9JA 4H2FA 4H1SA 3RL4A 4FBQA 1WAO1 5HPEA 3CK2A
chains in the Genus database with same CATH superfamily
5T6JA 2EMZA 2EMIA 2EWLA 3KZZA 2EM8A 3C5WC 3F6GA 2UXDE 4YHHE 4YY3E 4UWQA 4XPNA 1BBGA 4BC7A 1X48A 1NNWA 3H67A 1KBPA 2NA2A 3HTXA 3THNA 3OMLA 3K7VC 2USHA 4FK5C 2YWQA 5A6JA 3BIDA 5A2QC 2L2KB 4LF8E 4ZYHA 3TGHA 2EPAA 2NYLC 3DSDA 2EM2A 1L4SA 4WSGA 1O0WA 2JY9A 3E0JA 3E7BA 3H62B 2YSPA 4P78A 1N32E 3RL5A 2LRSA 2YTPA 1JK2A 1EH8A 2L6MA 2NPPC 2RS6A 3IWCA 1YSAC 2V83A 3VYYA 2EOMA 2EZ6A 2EL6A 4DV2E 2N8XA 1YFHA 1T71A 2EN2A 3PSOA 4R2CA 1PJSA 2LV2A 3EPLA 1RC7A 1ZR9A 2EMBA 4B3TE 3V4YA 2JWOA 1II7A 4BMJA 1EH6A 1AH5A 4F9BB 2A22A 3ECRA 1FJGE 2MDRA 3ZTVA 2I9IA 3THOB 3KZYA 2B3TB 5AC4A 4F6NA 1G2FC 4TUIA 2EPMX 2VF1A 2DMIA 3K6QA 4R2AA 1A1IA 2LJUA 4ZYDA 1I94E 2HYPA 2EORA 2GPIA 1XZWA 2QJCA 2YTOA 4IL1A 2EQ0A 2DLQA 3T1IA 2EMXA 2RSMA 2EMAA 2EL4A 1HP1A 4MLVA 2EL5A 1S95A 2UXCE 4R8OA 2EMFA 2EM9A 1UN6B 1OIDA 3LLHA 2EPOA 1A1JA 1J26A 1XNQE 4GKJE 2WZOA 1B69A 1A1KA 2B7VA 2LVHA 2YZTA 5KL7A 3DW8C 2D9HA 4LFAE 1S3LA 1PJQA 5A6AA 2YRKA 1SR9A 2YTDA 2ZO9B 2O8GA 2EMGA 2JR1A 4O4KA 2BQ8X 2YTFA 1KJKA 4KKZA 2NXFA 4JI4E 1T70A 4LFBE 1NEIA 2JYAA 4H2FA 4H1SA 2EN8A 3HPZA 2EPPA 5A6KA 1ZBQA 4NXNE 4NHRA 4X65E 2NUFA 3RQZA 1X3CA 3RMPA 2EMCA 4OOGC 3J80C 2I13A 2NUGA 1IQOA 4H2IA 5LLQA 5CFFE 4N4RB 5KL4A 3BGHA 1YPNA 4AQYE 4DR3E 2CV9A 2ZBMA 2RSIA 1KYQA 1U32A 1PJTA 4BHBA 3HXLA 1T4OA 4L5NC 2V85A 4LTYA 1IQSA 3J81C 1MF8A 5EQVA 3MHSC 4LF9E 2YEQA 3ZOQB 3ADJA 2AHDA 3BF2A 4GZNC 2YTGA 3F6HA 1QHWA 2NUEA 2DLKA 4DSYA 2YTQA 2EM3A 3QFOA 3C4TA 4UT3B 3IWBA 2GHFA 5IT9C 1ZU1A 2RPCA 1HNZE 1DI2A 2KHXA 1WJPA 3H63A 2HGHA 3JU0A 2EN4A 2EPNA 4X8WA 3J7AG 1S8EA 1GQEA 1V73A 2BDXA 2R17A 4HTGA 2EM5A 4MOYA 4B3SE 2EOIA 2LT7A 2WBSA 5A69A 4F2JC 3HPSA 2EPRA 2QFRA 4DR6E 2EM0A 2LO3A 2ZM6E 2MKDA 2EN7A 3L00A 4ORBA 4KHPE 2B9DA 4FBWA 4DV4E 4DUYE 2JP9A 2ENCA 1DQ3A 4I5NC 2JPAA 2IHR1 1TF3A 2N3HA 1Z1BA 1HNWE 3IVDA 2VRDA 5KL3A 1S70A 1HPUA 4BHCA 2V86A 2DXNA 3IWDA 4NZVA 1JK1A 4FBKA 4ZX2A 4M30A 4ZYEA 1F2IG 2WDEA 3J7Yp 1USHA 2L33A 2G7HA 4JI7E 2L92A 5AE3A 4BBYA 2LTSA 1AAYA 2ELZA 2EPXA 1UF3A 2LE2A 3HQ1A 4TUGA 1G2DC 5AC5A 4FCXA 1YUIA 3C9FA 2IE4C 2WDCA 2L8TA 3IB8A 4RHBB 2UUAE 1N33E 4F54A 2CT1A 4JI6E 1BB8A 2EE8A 1STUA 2KOUA 1XM7A 2EQ1A 4F9AB 4DV1E 5IWAE 5AASA 3JTZA 2LUPB 4KWYA 2UUBE 1N34E 1S3MA 5KL2A 3C4BA 2LTRA 2ODRD 4BS9A 2R76A 1T39A 4LU9A 4V0WA 4DV6E 1A1FA 4RH8A 1XMOE 1P47A 2YU8A 2EM4A 3LMLA 1A1HA 2EN1A 5LL6R 2B7TA 1YYOA 2P6BA 2VE7C 3D03A 1UTEA 3QFKA 1UHZA 2YSOA 5IV8B 4BCAA 2EQ3A 1FKAE 2EPKX 4ZYGA 3EPKA 3MSWA 1WXRA 2WCC3 2RS7A 2R1FA 3EQ1A 3FIGA 4DR4E 3VYXA 5IOHA 4WX9A 2LCEA 4R2DA 1GZ6A 4X64E 4DV7E 4WXDA 4V0VA 3HVQA 2NYMC 4F9CB 4DV0E 2XMOA 4I8OA 5FLXC 2ADRA 2F4VE 4J8ZA 2EOEA 4UT3A 4LACC 1HR0E 1XNRE 2JOBA 2HC5A 3M99B 5KL6A 1JK7A 3H61A 3C6KA 3ICFA 2Z72A 2K4VA 5AE1A 2HHHE 4DR7E 2BBGA 4F6MA 1A1LA 1PKPA 4JI0E 2BCDA 2EPUA 2YRMA 2K7IA 1X6HA 5LMNE 1W24A 2ELYA 3DSCA 4IJDA 2HJJA 2L2NA 4DR5E 1RQ0A 2FGGA 2LBSB 4WWLA 4ZVZA 4DT2A 4O43A 5JJTA 1WARA 3OTOE 3H09A 1X5WA 3MHHC 2EMLA 2EOYA 4B3ME 2WDFA 4I5LC 3ADIA 2VQEE 3QFMA 3FLOA 4MP0A 3EPJA 2YRHA 2YVTA 1Z2WA 2YTIA 5LMUE 4O24A 2Z06A 5INBA 2LJHA 2DFJA 1EKZA 5F3WA 4WSPA 4R2SA 4F0ZA 4JI3E 2F8BA 4X66E 3KWRA 1DGCA 2IAEC 5GTUA 2LMZA 2MDGA 1GTKA 2MC6A 4R2RA 2EOOA 3H69A 3VHTB 4Q35B 3P1XA 1N36E 1OIEA 4JI1E 4LF6E 4DV3E 1J5EE 4JV5E 3PSNA 2IE3C 2DGCA 3K7WC 2M1SA 4L8NA 2O8AA 2YPNA 1EH7A 2QFPA 3T1YE 3BBGA 3ADGA 4M2ZA 1G5BA 1NCSA 2EMWA 4DHLA 2RTXA 3QFNA 5A6BA 1ZAAC 3IVEA 1HNXE 4WFTA 4M9VC 2RQLA 5KL5A 2EN6A 4X9JA 1OI8A 3H66A 1T4LB 2N3GA 2GJUA 1IBKE 4K0KE 3RL3A 3JYFA 1WHNA 3FGAC 2JXPA 3KBPA 4WPYA 3P71C 4Q7FA 4OR9A 1BBOA 2WBUA 2V87A 4FBQA 4R2QA 1WAO1 2EOXA 3CK2A 3T1HE 2NABA 2HYOA 2CSHA 2J7JA 3N5UA 1UILA 4UT2A 4JI8E 3AV0A 1SFEA 2FV4B 4BC9A 4M0VA 2EM6A 4NXME 4JI5E 1LLMC 5A6BD 2EOQA 3QG5C 4R2PA 3EGGA 2DB2A 2UUCE 2YTNA 4HD0A 2DSYA 2MC5A 4MOVA 1YYKA 2UU9E 1QU6A 2ENHA 1M63A 2EMHA 2M9AA 1QNTA 2YT4A 1IBLE 1S3NA 2V88A 2V89A 1TF6A 5DNYA 4HEIA 1HO5A 2EM7A 4LF4E 3ZU0A 2Q8UA 1IMUA 1X47A 4LF5E 3DJWA 2BB8A 2FTXB 1MEYC 3IB7A 2EOSA 4DR2E 4J6OA 4Q28A 3H64A 4OX9E 4H2GA 4V0XA 3JAMC 2LUQA 3LL8A 1WRJA 4IS1C 1T4NA 1UBDC 4DUZE 2L2MA 3VK6A 4X62E 1RMDA 4JYAE 2CPNA 3AUZA 2V8QB 4YKEA 2HY1A 3H68A 1A1GA 2JVAA 3UK3C 4MLQA 4H1YP 2EJ4A 4R03A 5ADZA 2EMKA 2ZOAA 2L3CA 1FJMA 2Z1AA 2DRPA 3EPHA 4JA9A 5C1VA 1Z2XA 2M7QA 5IXMB 1N3GA 5J28A 4ORAA 5B8IA 2EPZA 2YTEA 2H36X 1SU1A 1YZ9A 2DXLA 1IBME 3DF6A 2EMYA 4B3RE 4DV5E 2ENAA 2EP3A 5BR8E 4KZSA 4JI2E 2JOGA 1X6EA 4GEQB 1MGTA 4R2EA 2WBTA 1YYWA 2DMYA 4GKKE 2EOFA 4DMIA 3GVEA 5JPEA 3H60A 2M4IA 2UXBE 1WHQA 4DR1E 4B2OA 1TN9A 2EN3A 2E1MA 2EOZA 4WXCA 2VQFE 1XMQE 5JPFA 4DKKA 3TQMA 4WYQB 1T38A 2E72A 2YU5A 2CTDA 3E7AA 4IYPC 1ZBTA 1YUJA 1AUIA 1PDAA 2WDDA 4H2BA 1IT6A 4O5GA 4JA7A 2KKNA 2EPLX 4P7DA 4KBPA 2EOHA 5TSEA 1QFCA 2GLIA 3EGHA 2EOJA 2A25A 4ORCA 3C6MA 1TCOA 1X6FA 2PRTA 2YTJA 2EPCA 2MKNA 2L3JA 5AE2A 4LFCE 1X49A 2ODRC 4G9JA 3ADLA 2JOXA 2E5LE 4LF7E 3RL4A 2KONA 5HPEA 2DIXA
chains in the Genus database with same CATH topology
5T6JA 2EWLA 3C5WC 3F6GA 2UXDE 4YHHE 4YY3E 4UWQA 4XPNA 4BC7A 1X48A 1NNWA 3H67A 1KBPA 2NA2A 3HTXA 3K7VC 3OMLA 3THNA 2USHA 5A2QC 2L2KB 4LF8E 3TGHA 2NYLC 3DSDA 1O0WA 2JY9A 3E0JA 3E7BA 3H62B 4P78A 1N32E 3RL5A 2LRSA 2L6MA 2NPPC 2RS6A 3IWCA 2V83A 3VYYA 2EZ6A 4DV2E 1T71A 3PSOA 1RC7A 4B3TE 3V4YA 2JWOA 1II7A 4BMJA 4F9BB 2A22A 1FJGE 2MDRA 3ZTVA 3THOB 2B3TB 4TUIA 2VF1A 3K6QA 1I94E 2HYPA 1XZWA 2QJCA 4IL1A 3T1IA 2RSMA 1HP1A 1S95A 2UXCE 4R8OA 1OIDA 3LLHA 1J26A 1XNQE 4GKJE 2WZOA 2B7VA 2YZTA 3DW8C 4LFAE 1S3LA 1SR9A 2ZO9B 2O8GA 2JR1A 2BQ8X 4O4KA 4KKZA 2NXFA 4JI4E 1T70A 4LFBE 4H2FA 4H1SA 3HPZA 1ZBQA 4NXNE 2NUFA 4X65E 3RQZA 3RMPA 4OOGC 3J80C 2NUGA 4H2IA 5CFFE 4AQYE 4DR3E 2CV9A 2ZBMA 1U32A 3HXLA 1T4OA 4L5NC 2V85A 4LTYA 3J81C 1MF8A 5EQVA 4LF9E 2YEQA 3ZOQB 3ADJA 2AHDA 3F6HA 1QHWA 2NUEA 4DSYA 3QFOA 3C4TA 4UT3B 3IWBA 5IT9C 1HNZE 1DI2A 2KHXA 3H63A 3JU0A 4X8WA 2BDXA 3J7AG 1S8EA 1GQEA 1V73A 2R17A 4MOYA 4B3SE 3HPSA 2QFRA 4DR6E 2ZM6E 4ORBA 4KHPE 2B9DA 4FBWA 4DV4E 4DUYE 1DQ3A 4I5NC 2IHR1 2N3HA 1HNWE 3IVDA 1S70A 1HPUA 2V86A 2DXNA 3IWDA 4FBKA 4NZVA 4ZX2A 4M30A 2WDEA 3J7Yp 1USHA 2L33A 2G7HA 4JI7E 2L92A 5AE3A 4BBYA 2LTSA 1UF3A 2LE2A 3HQ1A 4TUGA 4FCXA 3C9FA 2IE4C 2WDCA 2L8TA 3IB8A 2UUAE 1N33E 4F54A 4JI6E 1STUA 2KOUA 1XM7A 4DV1E 4F9AB 5IWAE 5AASA 3JTZA 2LUPB 2UUBE 1S3MA 1N34E 3C4BA 2LTRA 2ODRD 4BS9A 4LU9A 4V0WA 4DV6E 1XMOE 3LMLA 5LL6R 2B7TA 1YYOA 2P6BA 2VE7C 3D03A 1UTEA 3QFKA 1UHZA 4BCAA 1FKAE 3MSWA 1WXRA 2RS7A 3FIGA 4DR4E 3VYXA 5IOHA 1GZ6A 4X64E 4DV7E 4V0VA 3HVQA 2NYMC 4F9CB 4DV0E 2XMOA 4I8OA 5FLXC 2F4VE 4J8ZA 4UT3A 4LACC 1HR0E 1XNRE 2JOBA 1JK7A 3H61A 3ICFA 2Z72A 2K4VA 5AE1A 2HHHE 4DR7E 1PKPA 4JI0E 2BCDA 5LMNE 3DSCA 1W24A 2L2NA 4DR5E 1RQ0A 2FGGA 2LBSB 4WWLA 4ZVZA 4DT2A 4O43A 5JJTA 1WARA 3OTOE 3H09A 4B3ME 2WDFA 4I5LC 3ADIA 2VQEE 3QFMA 3FLOA 4MP0A 2YVTA 1Z2WA 5LMUE 2Z06A 4O24A 5INBA 2LJHA 2DFJA 1EKZA 5F3WA 4WSPA 4F0ZA 4JI3E 2F8BA 4X66E 3KWRA 2IAEC 5GTUA 2LMZA 2MC6A 3H69A 3P1XA 1N36E 1OIEA 4JV5E 4JI1E 4DV3E 1J5EE 4LF6E 3PSNA 2IE3C 3K7WC 2M1SA 4L8NA 2O8AA 2QFPA 3T1YE 3ADGA 4M2ZA 1G5BA 4DHLA 2RTXA 3QFNA 3IVEA 1HNXE 4WFTA 1OI8A 3H66A 1T4LB 2N3GA 2GJUA 1IBKE 4K0KE 3RL3A 3JYFA 1WHNA 3FGAC 3KBPA 4WPYA 3P71C 4Q7FA 4OR9A 2V87A 4FBQA 1WAO1 3CK2A 3T1HE 2HYOA 3N5UA 1UILA 4UT2A 4JI8E 3AV0A 2FV4B 4BC9A 4M0VA 4NXME 4JI5E 3EGGA 3QG5C 2DB2A 2UUCE 4HD0A 2DSYA 2MC5A 4MOVA 1YYKA 2UU9E 1QU6A 1M63A 2YT4A 1IBLE 1S3NA 2V88A 2V89A 5DNYA 1HO5A 4LF4E 3ZU0A 2Q8UA 1X47A 4LF5E 3DJWA 2FTXB 3IB7A 4DR2E 4J6OA 4Q28A 3H64A 4OX9E 4H2GA 4V0XA 3JAMC 2LUQA 3LL8A 1T4NA 4DUZE 2L2MA 3VK6A 4X62E 4JYAE 2CPNA 3AUZA 2V8QB 4YKEA 2HY1A 3H68A 2JVAA 4H1YP 4R03A 5ADZA 2ZOAA 2L3CA 1FJMA 2Z1AA 4JA9A 5C1VA 1Z2XA 2M7QA 5J28A 4ORAA 5B8IA 2H36X 1SU1A 1YZ9A 2DXLA 1IBME 3DF6A 4B3RE 4DV5E 2JOGA 5BR8E 4KZSA 4JI2E 4GEQB 4GKKE 1YYWA 2DMYA 5JPEA 4DMIA 3GVEA 3H60A 2M4IA 2UXBE 1WHQA 4DR1E 4B2OA 2E1MA 2VQFE 1XMQE 5JPFA 4DKKA 4WYQB 3E7AA 4IYPC 1ZBTA 4H2BA 1AUIA 2WDDA 4KBPA 1IT6A 4JA7A 4O5GA 2KKNA 4P7DA 1QFCA 3EGHA 4ORCA 1TCOA 2L3JA 5AE2A 4LFCE 1X49A 2ODRC 4G9JA 3ADLA 2JOXA 2E5LE 4LF7E 3RL4A 2KONA 5HPEA 2DIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYO A;  3RQZ A;  3N5U A;  3C5W C;  4H2I A;  4UT2 A;  2P6B A;  3AV0 A;  4UWQ A;  4XPN A;  1UTE A;  4M0V A;  3QFK A;  1NNW A;  3H67 A;  1KBP A;  2CV9 A;  3EGG A;  3QG5 C;  2ZBM A;  1U32 A;  3K7V C;  4HD0 A;  3THN A;  2USH A;  4MOV A;  4LTY A;  1MF8 A;  5IOH A;  1M63 A;  5EQV A;  3TGH A;  2NYL C;  3DSD A;  1S3N A;  4V0V A;  3HVQ A;  5DNY A;  2NYM C;  3E7B A;  3H62 B;  3RL5 A;  2XMO A;  1HO5 A;  2AHD A;  3ZU0 A;  4UT3 A;  4LAC C;  2Q8U A;  2NPP C;  1QHW A;  4DSY A;  1JK7 A;  3H61 A;  3ICF A;  2Z72 A;  3QFO A;  4UT3 B;  3IB7 A;  1T71 A;  4J6O A;  3H64 A;  3PSO A;  2BCD A;  3H63 A;  4H2G A;  4V0X A;  3DSC A;  1W24 A;  2BDX A;  3LL8 A;  1S8E A;  1V73 A;  2R17 A;  4WWL A;  4ZVZ A;  4MOY A;  4DT2 A;  4O43 A;  3V4Y A;  1II7 A;  5JJT A;  1WAR A;  3AUZ A;  4YKE A;  2A22 A;  2HY1 A;  3H68 A;  3ZTV A;  4H1Y P;  2WDF A;  2QFR A;  4I5L C;  3THO B;  3QFM A;  4MP0 A;  1FJM A;  4ORB A;  4FBW A;  2Z1A A;  2YVT A;  4TUI A;  1Z2W A;  4JA9 A;  5C1V A;  1Z2X A;  2Z06 A;  4O24 A;  4I5N C;  5INB A;  2DFJ A;  5F3W A;  5J28 A;  4ORA A;  4F0Z A;  5B8I A;  3IVD A;  2HYP A;  1SU1 A;  1XZW A;  2QJC A;  1S70 A;  2IAE C;  5GTU A;  1HPU A;  4IL1 A;  2JOG A;  4NZV A;  4FBK A;  4ZX2 A;  2WDE A;  3H69 A;  3T1I A;  1USH A;  5JPE A;  3GVE A;  1OIE A;  3H60 A;  3PSN A;  1HP1 A;  2IE3 C;  3K7W C;  1S95 A;  2O8A A;  4B2O A;  1UF3 A;  2QFP A;  4TUG A;  4FCX A;  1G5B A;  1OID A;  3C9F A;  2IE4 C;  4DHL A;  2WDC A;  3QFN A;  5JPF A;  3IVE A;  3IB8 A;  3DW8 C;  1S3L A;  3E7A A;  4IYP C;  4H2B A;  1AUI A;  1OI8 A;  1XM7 A;  2WDD A;  1IT6 A;  3H66 A;  4JA7 A;  2KKN A;  4KBP A;  1S3M A;  4O5G A;  2O8G A;  2GJU A;  1QFC A;  3EGH A;  3RL3 A;  2BQ8 X;  4O4K A;  3JYF A;  4ORC A;  1TCO A;  3FGA C;  4KKZ A;  2NXF A;  3KBP A;  1T70 A;  3P71 C;  4LU9 A;  4Q7F A;  4V0W A;  4OR9 A;  4G9J A;  4H2F A;  4H1S A;  3RL4 A;  4FBQ A;  1WAO 1;  5HPE A;  3CK2 A; 
#chains in the Genus database with same CATH topology
 5T6J A;  2EMZ A;  2EMI A;  2EWL A;  3KZZ A;  2EM8 A;  3C5W C;  3F6G A;  2UXD E;  4YHH E;  4YY3 E;  4UWQ A;  4XPN A;  1BBG A;  4BC7 A;  1X48 A;  1NNW A;  3H67 A;  1KBP A;  2NA2 A;  3HTX A;  3THN A;  3OML A;  3K7V C;  2USH A;  4FK5 C;  2YWQ A;  5A6J A;  3BID A;  5A2Q C;  2L2K B;  4LF8 E;  4ZYH A;  3TGH A;  2EPA A;  2NYL C;  3DSD A;  2EM2 A;  1L4S A;  4WSG A;  1O0W A;  2JY9 A;  3E0J A;  3E7B A;  3H62 B;  2YSP A;  4P78 A;  1N32 E;  3RL5 A;  2LRS A;  2YTP A;  1JK2 A;  1EH8 A;  2L6M A;  2NPP C;  2RS6 A;  3IWC A;  1YSA C;  2V83 A;  3VYY A;  2EOM A;  2EZ6 A;  2EL6 A;  4DV2 E;  2N8X A;  1YFH A;  1T71 A;  2EN2 A;  3PSO A;  4R2C A;  1PJS A;  2LV2 A;  3EPL A;  1RC7 A;  1ZR9 A;  2EMB A;  4B3T E;  3V4Y A;  2JWO A;  1II7 A;  4BMJ A;  1EH6 A;  1AH5 A;  4F9B B;  2A22 A;  3ECR A;  1FJG E;  2MDR A;  3ZTV A;  2I9I A;  3THO B;  3KZY A;  2B3T B;  5AC4 A;  4F6N A;  1G2F C;  4TUI A;  2EPM X;  2VF1 A;  2DMI A;  3K6Q A;  4R2A A;  1A1I A;  2LJU A;  4ZYD A;  1I94 E;  2HYP A;  2EOR A;  2GPI A;  1XZW A;  2QJC A;  2YTO A;  4IL1 A;  2EQ0 A;  2DLQ A;  3T1I A;  2EMX A;  2RSM A;  2EMA A;  2EL4 A;  1HP1 A;  4MLV A;  2EL5 A;  1S95 A;  2UXC E;  4R8O A;  2EMF A;  2EM9 A;  1UN6 B;  1OID A;  3LLH A;  2EPO A;  1A1J A;  1J26 A;  1XNQ E;  4GKJ E;  2WZO A;  1B69 A;  1A1K A;  2B7V A;  2LVH A;  2YZT A;  5KL7 A;  3DW8 C;  2D9H A;  4LFA E;  1S3L A;  1PJQ A;  5A6A A;  2YRK A;  1SR9 A;  2YTD A;  2ZO9 B;  2O8G A;  2EMG A;  2JR1 A;  4O4K A;  2BQ8 X;  2YTF A;  1KJK A;  4KKZ A;  2NXF A;  4JI4 E;  1T70 A;  4LFB E;  1NEI A;  2JYA A;  4H2F A;  4H1S A;  2EN8 A;  3HPZ A;  2EPP A;  5A6K A;  1ZBQ A;  4NXN E;  4NHR A;  4X65 E;  2NUF A;  3RQZ A;  1X3C A;  3RMP A;  2EMC A;  4OOG C;  3J80 C;  2I13 A;  2NUG A;  1IQO A;  4H2I A;  5LLQ A;  5CFF E;  4N4R B;  5KL4 A;  3BGH A;  1YPN A;  4AQY E;  4DR3 E;  2CV9 A;  2ZBM A;  2RSI A;  1KYQ A;  1U32 A;  1PJT A;  4BHB A;  3HXL A;  1T4O A;  4L5N C;  2V85 A;  4LTY A;  1IQS A;  3J81 C;  1MF8 A;  5EQV A;  3MHS C;  4LF9 E;  2YEQ A;  3ZOQ B;  3ADJ A;  2AHD A;  3BF2 A;  4GZN C;  2YTG A;  3F6H A;  1QHW A;  2NUE A;  2DLK A;  4DSY A;  2YTQ A;  2EM3 A;  3QFO A;  3C4T A;  4UT3 B;  3IWB A;  2GHF A;  5IT9 C;  1ZU1 A;  2RPC A;  1HNZ E;  1DI2 A;  2KHX A;  1WJP A;  3H63 A;  2HGH A;  3JU0 A;  2EN4 A;  2EPN A;  4X8W A;  3J7A G;  1S8E A;  1GQE A;  1V73 A;  2BDX A;  2R17 A;  4HTG A;  2EM5 A;  4MOY A;  4B3S E;  2EOI A;  2LT7 A;  2WBS A;  5A69 A;  4F2J C;  3HPS A;  2EPR A;  2QFR A;  4DR6 E;  2EM0 A;  2LO3 A;  2ZM6 E;  2MKD A;  2EN7 A;  3L00 A;  4ORB A;  4KHP E;  2B9D A;  4FBW A;  4DV4 E;  4DUY E;  2JP9 A;  2ENC A;  1DQ3 A;  4I5N C;  2JPA A;  2IHR 1;  1TF3 A;  2N3H A;  1Z1B A;  1HNW E;  3IVD A;  2VRD A;  5KL3 A;  1S70 A;  1HPU A;  4BHC A;  2V86 A;  2DXN A;  3IWD A;  4NZV A;  1JK1 A;  4FBK A;  4ZX2 A;  4M30 A;  4ZYE A;  1F2I G;  2WDE A;  3J7Y p;  1USH A;  2L33 A;  2G7H A;  4JI7 E;  2L92 A;  5AE3 A;  4BBY A;  2LTS A;  1AAY A;  2ELZ A;  2EPX A;  1UF3 A;  2LE2 A;  3HQ1 A;  4TUG A;  1G2D C;  5AC5 A;  4FCX A;  1YUI A;  3C9F A;  2IE4 C;  2WDC A;  2L8T A;  3IB8 A;  4RHB B;  2UUA E;  1N33 E;  4F54 A;  2CT1 A;  4JI6 E;  1BB8 A;  2EE8 A;  1STU A;  2KOU A;  1XM7 A;  2EQ1 A;  4F9A B;  4DV1 E;  5IWA E;  5AAS A;  3JTZ A;  2LUP B;  4KWY A;  2UUB E;  1N34 E;  1S3M A;  5KL2 A;  3C4B A;  2LTR A;  2ODR D;  4BS9 A;  2R76 A;  1T39 A;  4LU9 A;  4V0W A;  4DV6 E;  1A1F A;  4RH8 A;  1XMO E;  1P47 A;  2YU8 A;  2EM4 A;  3LML A;  1A1H A;  2EN1 A;  5LL6 R;  2B7T A;  1YYO A;  2P6B A;  2VE7 C;  3D03 A;  1UTE A;  3QFK A;  1UHZ A;  2YSO A;  5IV8 B;  4BCA A;  2EQ3 A;  1FKA E;  2EPK X;  4ZYG A;  3EPK A;  3MSW A;  1WXR A;  2WCC 3;  2RS7 A;  2R1F A;  3EQ1 A;  3FIG A;  4DR4 E;  3VYX A;  5IOH A;  4WX9 A;  2LCE A;  4R2D A;  1GZ6 A;  4X64 E;  4DV7 E;  4WXD A;  4V0V A;  3HVQ A;  2NYM C;  4F9C B;  4DV0 E;  2XMO A;  4I8O A;  5FLX C;  2ADR A;  2F4V E;  4J8Z A;  2EOE A;  4UT3 A;  4LAC C;  1HR0 E;  1XNR E;  2JOB A;  2HC5 A;  3M99 B;  5KL6 A;  1JK7 A;  3H61 A;  3C6K A;  3ICF A;  2Z72 A;  2K4V A;  5AE1 A;  2HHH E;  4DR7 E;  2BBG A;  4F6M A;  1A1L A;  1PKP A;  4JI0 E;  2BCD A;  2EPU A;  2YRM A;  2K7I A;  1X6H A;  5LMN E;  1W24 A;  2ELY A;  3DSC A;  4IJD A;  2HJJ A;  2L2N A;  4DR5 E;  1RQ0 A;  2FGG A;  2LBS B;  4WWL A;  4ZVZ A;  4DT2 A;  4O43 A;  5JJT A;  1WAR A;  3OTO E;  3H09 A;  1X5W A;  3MHH C;  2EML A;  2EOY A;  4B3M E;  2WDF A;  4I5L C;  3ADI A;  2VQE E;  3QFM A;  3FLO A;  4MP0 A;  3EPJ A;  2YRH A;  2YVT A;  1Z2W A;  2YTI A;  5LMU E;  4O24 A;  2Z06 A;  5INB A;  2LJH A;  2DFJ A;  1EKZ A;  5F3W A;  4WSP A;  4R2S A;  4F0Z A;  4JI3 E;  2F8B A;  4X66 E;  3KWR A;  1DGC A;  2IAE C;  5GTU A;  2LMZ A;  2MDG A;  1GTK A;  2MC6 A;  4R2R A;  2EOO A;  3H69 A;  3VHT B;  4Q35 B;  3P1X A;  1N36 E;  1OIE A;  4JI1 E;  4LF6 E;  4DV3 E;  1J5E E;  4JV5 E;  3PSN A;  2IE3 C;  2DGC A;  3K7W C;  2M1S A;  4L8N A;  2O8A A;  2YPN A;  1EH7 A;  2QFP A;  3T1Y E;  3BBG A;  3ADG A;  4M2Z A;  1G5B A;  1NCS A;  2EMW A;  4DHL A;  2RTX A;  3QFN A;  5A6B A;  1ZAA C;  3IVE A;  1HNX E;  4WFT A;  4M9V C;  2RQL A;  5KL5 A;  2EN6 A;  4X9J A;  1OI8 A;  3H66 A;  1T4L B;  2N3G A;  2GJU A;  1IBK E;  4K0K E;  3RL3 A;  3JYF A;  1WHN A;  3FGA C;  2JXP A;  3KBP A;  4WPY A;  3P71 C;  4Q7F A;  4OR9 A;  1BBO A;  2WBU A;  2V87 A;  4FBQ A;  4R2Q A;  1WAO 1;  2EOX A;  3CK2 A;  3T1H E;  2NAB A;  2HYO A;  2CSH A;  2J7J A;  3N5U A;  1UIL A;  4UT2 A;  4JI8 E;  3AV0 A;  1SFE A;  2FV4 B;  4BC9 A;  4M0V A;  2EM6 A;  4NXM E;  4JI5 E;  1LLM C;  5A6B D;  2EOQ A;  3QG5 C;  4R2P A;  3EGG A;  2DB2 A;  2UUC E;  2YTN A;  4HD0 A;  2DSY A;  2MC5 A;  4MOV A;  1YYK A;  2UU9 E;  1QU6 A;  2ENH A;  1M63 A;  2EMH A;  2M9A A;  1QNT A;  2YT4 A;  1IBL E;  1S3N A;  2V88 A;  2V89 A;  1TF6 A;  5DNY A;  4HEI A;  1HO5 A;  2EM7 A;  4LF4 E;  3ZU0 A;  2Q8U A;  1IMU A;  1X47 A;  4LF5 E;  3DJW A;  2BB8 A;  2FTX B;  1MEY C;  3IB7 A;  2EOS A;  4DR2 E;  4J6O A;  4Q28 A;  3H64 A;  4OX9 E;  4H2G A;  4V0X A;  3JAM C;  2LUQ A;  3LL8 A;  1WRJ A;  4IS1 C;  1T4N A;  1UBD C;  4DUZ E;  2L2M A;  3VK6 A;  4X62 E;  1RMD A;  4JYA E;  2CPN A;  3AUZ A;  2V8Q B;  4YKE A;  2HY1 A;  3H68 A;  1A1G A;  2JVA A;  3UK3 C;  4MLQ A;  4H1Y P;  2EJ4 A;  4R03 A;  5ADZ A;  2EMK A;  2ZOA A;  2L3C A;  1FJM A;  2Z1A A;  2DRP A;  3EPH A;  4JA9 A;  5C1V A;  1Z2X A;  2M7Q A;  5IXM B;  1N3G A;  5J28 A;  4ORA A;  5B8I A;  2EPZ A;  2YTE A;  2H36 X;  1SU1 A;  1YZ9 A;  2DXL A;  1IBM E;  3DF6 A;  2EMY A;  4B3R E;  4DV5 E;  2ENA A;  2EP3 A;  5BR8 E;  4KZS A;  4JI2 E;  2JOG A;  1X6E A;  4GEQ B;  1MGT A;  4R2E A;  2WBT A;  1YYW A;  2DMY A;  4GKK E;  2EOF A;  4DMI A;  3GVE A;  5JPE A;  3H60 A;  2M4I A;  2UXB E;  1WHQ A;  4DR1 E;  4B2O A;  1TN9 A;  2EN3 A;  2E1M A;  2EOZ A;  4WXC A;  2VQF E;  1XMQ E;  5JPF A;  4DKK A;  3TQM A;  4WYQ B;  1T38 A;  2E72 A;  2YU5 A;  2CTD A;  3E7A A;  4IYP C;  1ZBT A;  1YUJ A;  1AUI A;  1PDA A;  2WDD A;  4H2B A;  1IT6 A;  4O5G A;  4JA7 A;  2KKN A;  2EPL X;  4P7D A;  4KBP A;  2EOH A;  5TSE A;  1QFC A;  2GLI A;  3EGH A;  2EOJ A;  2A25 A;  4ORC A;  3C6M A;  1TCO A;  1X6F A;  2PRT A;  2YTJ A;  2EPC A;  2MKN A;  2L3J A;  5AE2 A;  4LFC E;  1X49 A;  2ODR C;  4G9J A;  3ADL A;  2JOX A;  2E5L E;  4LF7 E;  3RL4 A;  2KON A;  5HPE A;  2DIX A; 
#chains in the Genus database with same CATH homology
 5T6J A;  2EWL A;  3C5W C;  3F6G A;  2UXD E;  4YHH E;  4YY3 E;  4UWQ A;  4XPN A;  4BC7 A;  1X48 A;  1NNW A;  3H67 A;  1KBP A;  2NA2 A;  3HTX A;  3K7V C;  3OML A;  3THN A;  2USH A;  5A2Q C;  2L2K B;  4LF8 E;  3TGH A;  2NYL C;  3DSD A;  1O0W A;  2JY9 A;  3E0J A;  3E7B A;  3H62 B;  4P78 A;  1N32 E;  3RL5 A;  2LRS A;  2L6M A;  2NPP C;  2RS6 A;  3IWC A;  2V83 A;  3VYY A;  2EZ6 A;  4DV2 E;  1T71 A;  3PSO A;  1RC7 A;  4B3T E;  3V4Y A;  2JWO A;  1II7 A;  4BMJ A;  4F9B B;  2A22 A;  1FJG E;  2MDR A;  3ZTV A;  3THO B;  2B3T B;  4TUI A;  2VF1 A;  3K6Q A;  1I94 E;  2HYP A;  1XZW A;  2QJC A;  4IL1 A;  3T1I A;  2RSM A;  1HP1 A;  1S95 A;  2UXC E;  4R8O A;  1OID A;  3LLH A;  1J26 A;  1XNQ E;  4GKJ E;  2WZO A;  2B7V A;  2YZT A;  3DW8 C;  4LFA E;  1S3L A;  1SR9 A;  2ZO9 B;  2O8G A;  2JR1 A;  2BQ8 X;  4O4K A;  4KKZ A;  2NXF A;  4JI4 E;  1T70 A;  4LFB E;  4H2F A;  4H1S A;  3HPZ A;  1ZBQ A;  4NXN E;  2NUF A;  4X65 E;  3RQZ A;  3RMP A;  4OOG C;  3J80 C;  2NUG A;  4H2I A;  5CFF E;  4AQY E;  4DR3 E;  2CV9 A;  2ZBM A;  1U32 A;  3HXL A;  1T4O A;  4L5N C;  2V85 A;  4LTY A;  3J81 C;  1MF8 A;  5EQV A;  4LF9 E;  2YEQ A;  3ZOQ B;  3ADJ A;  2AHD A;  3F6H A;  1QHW A;  2NUE A;  4DSY A;  3QFO A;  3C4T A;  4UT3 B;  3IWB A;  5IT9 C;  1HNZ E;  1DI2 A;  2KHX A;  3H63 A;  3JU0 A;  4X8W A;  2BDX A;  3J7A G;  1S8E A;  1GQE A;  1V73 A;  2R17 A;  4MOY A;  4B3S E;  3HPS A;  2QFR A;  4DR6 E;  2ZM6 E;  4ORB A;  4KHP E;  2B9D A;  4FBW A;  4DV4 E;  4DUY E;  1DQ3 A;  4I5N C;  2IHR 1;  2N3H A;  1HNW E;  3IVD A;  1S70 A;  1HPU A;  2V86 A;  2DXN A;  3IWD A;  4FBK A;  4NZV A;  4ZX2 A;  4M30 A;  2WDE A;  3J7Y p;  1USH A;  2L33 A;  2G7H A;  4JI7 E;  2L92 A;  5AE3 A;  4BBY A;  2LTS A;  1UF3 A;  2LE2 A;  3HQ1 A;  4TUG A;  4FCX A;  3C9F A;  2IE4 C;  2WDC A;  2L8T A;  3IB8 A;  2UUA E;  1N33 E;  4F54 A;  4JI6 E;  1STU A;  2KOU A;  1XM7 A;  4DV1 E;  4F9A B;  5IWA E;  5AAS A;  3JTZ A;  2LUP B;  2UUB E;  1S3M A;  1N34 E;  3C4B A;  2LTR A;  2ODR D;  4BS9 A;  4LU9 A;  4V0W A;  4DV6 E;  1XMO E;  3LML A;  5LL6 R;  2B7T A;  1YYO A;  2P6B A;  2VE7 C;  3D03 A;  1UTE A;  3QFK A;  1UHZ A;  4BCA A;  1FKA E;  3MSW A;  1WXR A;  2RS7 A;  3FIG A;  4DR4 E;  3VYX A;  5IOH A;  1GZ6 A;  4X64 E;  4DV7 E;  4V0V A;  3HVQ A;  2NYM C;  4F9C B;  4DV0 E;  2XMO A;  4I8O A;  5FLX C;  2F4V E;  4J8Z A;  4UT3 A;  4LAC C;  1HR0 E;  1XNR E;  2JOB A;  1JK7 A;  3H61 A;  3ICF A;  2Z72 A;  2K4V A;  5AE1 A;  2HHH E;  4DR7 E;  1PKP A;  4JI0 E;  2BCD A;  5LMN E;  3DSC A;  1W24 A;  2L2N A;  4DR5 E;  1RQ0 A;  2FGG A;  2LBS B;  4WWL A;  4ZVZ A;  4DT2 A;  4O43 A;  5JJT A;  1WAR A;  3OTO E;  3H09 A;  4B3M E;  2WDF A;  4I5L C;  3ADI A;  2VQE E;  3QFM A;  3FLO A;  4MP0 A;  2YVT A;  1Z2W A;  5LMU E;  2Z06 A;  4O24 A;  5INB A;  2LJH A;  2DFJ A;  1EKZ A;  5F3W A;  4WSP A;  4F0Z A;  4JI3 E;  2F8B A;  4X66 E;  3KWR A;  2IAE C;  5GTU A;  2LMZ A;  2MC6 A;  3H69 A;  3P1X A;  1N36 E;  1OIE A;  4JV5 E;  4JI1 E;  4DV3 E;  1J5E E;  4LF6 E;  3PSN A;  2IE3 C;  3K7W C;  2M1S A;  4L8N A;  2O8A A;  2QFP A;  3T1Y E;  3ADG A;  4M2Z A;  1G5B A;  4DHL A;  2RTX A;  3QFN A;  3IVE A;  1HNX E;  4WFT A;  1OI8 A;  3H66 A;  1T4L B;  2N3G A;  2GJU A;  1IBK E;  4K0K E;  3RL3 A;  3JYF A;  1WHN A;  3FGA C;  3KBP A;  4WPY A;  3P71 C;  4Q7F A;  4OR9 A;  2V87 A;  4FBQ A;  1WAO 1;  3CK2 A;  3T1H E;  2HYO A;  3N5U A;  1UIL A;  4UT2 A;  4JI8 E;  3AV0 A;  2FV4 B;  4BC9 A;  4M0V A;  4NXM E;  4JI5 E;  3EGG A;  3QG5 C;  2DB2 A;  2UUC E;  4HD0 A;  2DSY A;  2MC5 A;  4MOV A;  1YYK A;  2UU9 E;  1QU6 A;  1M63 A;  2YT4 A;  1IBL E;  1S3N A;  2V88 A;  2V89 A;  5DNY A;  1HO5 A;  4LF4 E;  3ZU0 A;  2Q8U A;  1X47 A;  4LF5 E;  3DJW A;  2FTX B;  3IB7 A;  4DR2 E;  4J6O A;  4Q28 A;  3H64 A;  4OX9 E;  4H2G A;  4V0X A;  3JAM C;  2LUQ A;  3LL8 A;  1T4N A;  4DUZ E;  2L2M A;  3VK6 A;  4X62 E;  4JYA E;  2CPN A;  3AUZ A;  2V8Q B;  4YKE A;  2HY1 A;  3H68 A;  2JVA A;  4H1Y P;  4R03 A;  5ADZ A;  2ZOA A;  2L3C A;  1FJM A;  2Z1A A;  4JA9 A;  5C1V A;  1Z2X A;  2M7Q A;  5J28 A;  4ORA A;  5B8I A;  2H36 X;  1SU1 A;  1YZ9 A;  2DXL A;  1IBM E;  3DF6 A;  4B3R E;  4DV5 E;  2JOG A;  5BR8 E;  4KZS A;  4JI2 E;  4GEQ B;  4GKK E;  1YYW A;  2DMY A;  5JPE A;  4DMI A;  3GVE A;  3H60 A;  2M4I A;  2UXB E;  1WHQ A;  4DR1 E;  4B2O A;  2E1M A;  2VQF E;  1XMQ E;  5JPF A;  4DKK A;  4WYQ B;  3E7A A;  4IYP C;  1ZBT A;  4H2B A;  1AUI A;  2WDD A;  4KBP A;  1IT6 A;  4JA7 A;  4O5G A;  2KKN A;  4P7D A;  1QFC A;  3EGH A;  4ORC A;  1TCO A;  2L3J A;  5AE2 A;  4LFC E;  1X49 A;  2ODR C;  4G9J A;  3ADL A;  2JOX A;  2E5L E;  4LF7 E;  3RL4 A;  2KON A;  5HPE A;  2DIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...