4TUIA

Crystal structure of mjmre11-dna1 complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
molecule keywords DNA double-strand break repair protein Mre11
total genus 94
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tuiA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tuiA01
1HP1A 1S70A 2NPPC 2BDXA 4ZX2A 4HD0A 3DW8C 4LACC 4MP0A 4H2BA 3QFMA 3E7BA 5JPFA 5JJTA 2BCDA 4NZVA 2O8GA 4Q7FA 5B8IA 2QJCA 3H69A 4WWLA 3H62B 1T71A 2AHDA 4FBQA 1OIEA 1OIDA 2CV9A 4TUGA 1FJMA 2ZBMA 5INBA 1S3LA 3FGAC 3EGHA 4MOVA 3CK2A 1S3MA 3K7WC 4DSYA 4FBKA 5J28A 1OI8A 2O8AA 1M63A 4JA7A 5EQVA 2HYPA 1AUIA 4O24A 4ORBA 3DSDA 2IAEC 2R17A 3H66A 2QFRA 4KKZA 1UTEA 1XZWA 5DNYA 3PSNA 1S3NA 1IT6A 3C5WC 4UWQA 1TCOA 3QFNA 3QFOA 2IE3C 4V0WA 3HVQA 4YKEA 2NYMC 4I5NC 3T1IA 4LTYA 3AUZA 3RL5A 2DFJA 1Z2WA 1SU1A 4XPNA 2HYOA 3RQZA 1Z2XA 3N5UA 3PSOA 1WARA 3JYFA 1MF8A 1QHWA 2QFPA 2Z06A 3THOB 2USHA 4UT3A 2HY1A 3IB8A 3IVEA 3P71C 4O5GA 5GTUA 5IOHA 3GVEA 2BQ8X 4IYPC 3H64A 3AV0A 3E7AA 4TUIA 2P6BA 3IB7A 4O4KA 4MOYA 4B2OA 4H2FA 2KKNA 1W24A 2NXFA 4M0VA 3H63A 4ORAA 1USHA 2YVTA 4I5LC 1T70A 4V0XA 5JPEA 3RL3A 2WDCA 1HPUA 2WDFA 3H61A 2WDDA 5C1VA 4ZVZA 2Z72A 2JOGA 3C9FA 1U32A 1WAO1 3IVDA 1II7A 4J6OA 4O43A 4H2GA 1NNWA 3TGHA 5F3WA 4OR9A 3ICFA 4FCXA 1JK7A 1V73A 4H1YP 4H1SA 3RL4A 2XMOA 3QG5C 4JA9A 2GJUA 3ZU0A 4ORCA 1HO5A 4H2IA 4KBPA 2WDEA 3H67A 4F0ZA 2A22A 2IE4C 4FBWA 1UF3A 3V4YA 3DSCA 4G9JA 1XM7A 1S95A 2NYLC 2Z1AA 3K7VC 3KBPA 3THNA 4DHLA 3H60A 1QFCA 4LU9A 1G5BA 1KBPA 3EGGA 3QFKA 4UT3B 4V0VA 3H68A 3ZTVA 1S8EA 4IL1A 5HPEA 2Q8UA 4DT2A 4UT2A 3LL8A
chains in the Genus database with same CATH superfamily
2UUBE 1HNZE 5KL2A 3ADJA 2L2KB 1HP1A 2VQEE 2BDXA 4F9AB 4HD0A 3BBGA 2K4VA 4LACC 2UU9E 5JJTA 5ADZA 1MEYC 4R2RA 2QJCA 1J26A 1GQEA 5T6JA 5LMUE 4X8WA 2EN8A 1PJQA 3H62B 3OTOE 2YRKA 1X3CA 4F9BB 1OIEA 1OIDA 2EPUA 2LUPB 1G2FC 2EL5A 4X62E 5IV8B 2LMZA 3HQ1A 1S3MA 2VF1A 3K7WC 1O0WA 2LRSA 1I94E 2EOYA 2EOMA 3DF6A 5J28A 2L33A 1HNWE 1BBOA 1M63A 2M4IA 1X47A 4I8OA 4LFCE 3EPLA 3ADIA 2DXLA 3VHTB 1UTEA 2WCC3 5AE1A 2HC5A 3C6KA 1WJPA 2IE3C 3HVQA 2E72A 2EOXA 1ZBTA 2EOIA 1X6HA 4NHRA 2ELYA 2EM3A 2YTQA 3RQZA 2EQ3A 1Z2XA 3PSOA 1FKAE 4GKKE 2USHA 2B9DA 1QU6A 3IB8A 4O5GA 2CT1A 1YYWA 4ZYDA 2BQ8X 3MHSC 4IYPC 1RQ0A 2EE8A 3E7AA 2YU5A 2YSPA 4LFAE 1ZR9A 2ENAA 1N32E 2ENCA 4B2OA 2LCEA 2KKNA 1W24A 2N3GA 1HR0E 3IWDA 2YTGA 1PKPA 3ADLA 1L4SA 3K6QA 2FTXB 3ECRA 4BBYA 4DR2E 4BC7A 2M7QA 4GZNC 4NXME 2WDDA 5A69A 1X48A 2EOHA 3C9FA 2ELZA 2M1SA 2EPRA 1NEIA 5KL3A 4HEIA 3IVDA 2DMIA 2YTNA 3C6MA 4H2GA 4KWYA 4DV3E 2EMCA 2DGCA 2EPCA 1X49A 1DQ3A 4M2ZA 2ODRD 4DR1E 4F2JC 4LF8E 3JAMC 3RL4A 4WXCA 2DMYA 4JI0E 4JA9A 2EQ0A 2EM6A 2YTFA 3H67A 1T4NA 2A25A 4WSGA 2V87A 3MSWA 2WBUA 5A6AA 1XM7A 1S95A 2Z1AA 3THNA 3D03A 3KBPA 2F8BA 1QFCA 5AC4A 1JK1A 2FV4B 1KBPA 1N3GA 3QFKA 4V0VA 2LVHA 4YY3E 2E5LE 4LF7E 2NPPC 1XMOE 4ZX2A 3F6HA 4GKJE 4M30A 3DW8C 4K0KE 2EM7A 3J80C 2KHXA 4OX9E 2BCDA 4R2QA 4LFBE 2O8GA 5B8IA 2EOSA 4WX9A 4GEQB 1XMQE 4BC9A 1B69A 2M9AA 3J7AG 4F54A 2FGGA 2YTEA 2ZBMA 2J7JA 4BHBA 2ZO9B 4DSYA 4DUYE 2EMKA 2E1MA 2L6MA 2JWOA 1OI8A 2EN2A 5EQVA 5AC5A 2UUAE 1X6EA 2EQ1A 2JXPA 2LTSA 2DB2A 2BB8A 1PDAA 2EMFA 2H36X 3VYYA 1XZWA 5DNYA 3T1HE 1BB8A 1X6FA 5AASA 3PSNA 2L3CA 1IT6A 3MHHC 4DMIA 4KHPE 2EPAA 2EOFA 1NCSA 2YPNA 2EP3A 2DSYA 3ADGA 4R2AA 4BS9A 1J5EE 2NUGA 4V0WA 2DIXA 2EWLA 1ZBQA 4FK5C 1A1LA 4YKEA 3T1IA 4LTYA 3AUZA 1F2IG 2DFJA 2HYOA 1DI2A 3HXLA 3JYFA 2R76A 1QHWA 2Z06A 2HY1A 3IVEA 5A6BA 3L00A 2EPPA 5A6KA 3IWCA 2EPLX 3H64A 2K7IA 3AV0A 5LMNE 1A1GA 3RMPA 2EMBA 2P6BA 1EH8A 4NXNE 2LJUA 4JI6E 2B7VA 2NUFA 4X9JA 1UBDC 4DV1E 1USHA 4B3ME 4OOGC 5AE2A 3RL3A 2YRHA 4DR6E 4N4RB 1N34E 2UXCE 2WDFA 3H61A 1KJKA 1A1FA 4ZVZA 2JOGA 2EOOA 1A1JA 4DR7E 2EPKX 1RC7A 2ODRC 1G2DC 1UHZA 4L8NA 2G7HA 4OR9A 1WXRA 2WZOA 4Q28A 1LLMC 1V73A 4H1SA 4JI3E 2LJHA 4B3TE 4JI5E 4JYAE 2WBSA 3ZU0A 4ORCA 2L2MA 4H2IA 4KBPA 2WDEA 2YSOA 5KL7A 5CFFE 2EL6A 2V88A 2MDRA 1UF3A 3V4YA 1QNTA 1IMUA 2NYLC 2HJJA 3H60A 2EM2A 3DJWA 2NA2A 3EPHA 1IBME 1MGTA 3H68A 2L92A 4JI8E 1WHQA 3ZTVA 4IL1A 2JYAA 4UT2A 3LL8A 2EMGA 4YHHE 2EPNA 4WXDA 5A2QC 2JP9A 3JTZA 2ENHA 4MP0A 4H2BA 3QFMA 3E7BA 5JPFA 3E0JA 2EPZA 5AE3A 1XNQE 4DR5E 1DGCA 3H69A 2N3HA 2B3TB 1T39A 4WWLA 2YTIA 4R8OA 1T71A 2AHDA 3FLOA 2EMHA 4BCAA 2RTXA 4FBQA 2CV9A 2EN7A 1FJMA 5INBA 3FGAC 1BBGA 3BGHA 2MC6A 3CK2A 2YTPA 2JY9A 4P78A 4DV5E 2O8AA 2EL4A 4JA7A 2LT7A 2HYPA 1AUIA 4O24A 4ORBA 5KL4A 3LMLA 4DUZE 4LF6E 4KKZA 4KZSA 4DV0E 4WPYA 4Q35B 2EN1A 4B3SE 3VYXA 2B7TA 1S3NA 1A1HA 3C5WC 4UWQA 4RHBB 1TCOA 4ZYEA 3C4TA 2YT4A 1PJTA 1N33E 2V89A 1AAYA 3BIDA 2NYMC 4I5NC 1TF3A 3RL5A 4IS1C 1IQOA 3KZYA 3N5UA 1WARA 5IWAE 3THOB 2CSHA 4UT3A 5A6JA 2JOXA 3KWRA 1P47A 5TSEA 3GVEA 2MDGA 1N36E 2DRPA 2V85A 3KZZA 2F4VE 4JV5E 4HTGA 1EH7A 4TUIA 1YYOA 2LBSB 3IB7A 3JU0A 3VK6A 4O4KA 2CTDA 1YZ9A 3TQMA 3H09A 2EMIA 2DLKA 2EOQA 2YZTA 4H2FA 1PJSA 2EOJA 2NXFA 2CPNA 4M0VA 2GHFA 4ORAA 5JPEA 4ZYGA 1T70A 1EKZA 1STUA 2ZOAA 1HPUA 2YTDA 2RS7A 5KL6A 2UXBE 5C1VA 3EPKA 2RS6A 4X65E 1WAO1 1II7A 4J6OA 4BHCA 3TGHA 4JI4E 2EMLA 2HHHE 2GLIA 2EZ6A 1YFHA 3QG5C 2JR1A 2VRDA 1ZAAC 4X66E 1HO5A 4IJDA 1SFEA 2EMYA 2VQFE 4DR4E 1XNRE 2EOEA 2EPOA 2RSIA 1T4LB 2YEQA 3DSCA 4ZYHA 4WYQB 4DHLA 2YTOA 2L3JA 1G5BA 5KL5A 3EPJA 4F9CB 2ZM6E 2YRMA 1S8EA 2EN6A 5HPEA 2Q8UA 5A6BD 3OMLA 1GZ6A 2MKNA 2V83A 2LO3A 1S70A 3HPZA 4JI1E 4R2DA 2YWQA 2RSMA 2EM8A 3EQ1A 1YSAC 2MC5A 4NZVA 3J81C 1A1KA 4Q7FA 2EORA 4L5NC 1RMDA 3M99B 4R2EA 1YYKA 3P1XA 1WRJA 4TUGA 1S3LA 4DR3E 1X5WA 3EGHA 4LF4E 1FJGE 4MOVA 2EPXA 4P7DA 4R2PA 3T1YE 1T38A 2EMAA 2JPAA 4FBKA 5FLXC 3HTXA 4F6NA 3DSDA 2L2NA 2IAEC 1YPNA 2V86A 2KONA 2R17A 2EJ4A 3H66A 2QFRA 2V8QB 4AQYE 3HPSA 2NUEA 2EMXA 1A1IA 3QFNA 3QFOA 1T4OA 4R2SA 2EPMX 3F6GA 1Z2WA 2DXNA 1SU1A 4XPNA 2I9IA 3IWBA 1YUIA 4DV6E 4MLVA 4LF9E 2MKDA 2EMZA 2NABA 1MF8A 2QFPA 2LV2A 3P71C 5GTUA 5IOHA 2YU8A 1IQSA 2DLQA 2WBTA 2YTJA 4MOYA 4RH8A 4JI7E 4MLQA 2EOZA 2N8XA 2GPIA 2VE7C 1IBLE 3UK3C 3H63A 2LTRA 4J8ZA 2YVTA 4I5LC 4V0XA 2EN4A 2WDCA 2HGHA 2RQLA 1AH5A 2JVAA 3FIGA 3ZOQB 3BF2A 4B3RE 4M9VC 2UXDE 2Z72A 1SR9A 5BR8E 2I13A 5LL6R 1U32A 3J7Yp 2KOUA 2LE2A 2EM0A 4O43A 2EN3A 2LUQA 4F6MA 1Z1BA 1NNWA 2EM5A 4R2CA 2ADRA 4DKKA 2EM4A 5F3WA 1GTKA 3ICFA 1JK2A 5LLQA 1UILA 1TF6A 4FCXA 1JK7A 4H1YP 2IHR1 4DV2E 2L8TA 1HNXE 1KYQA 2XMOA 1ZU1A 4X64E 1TN9A 4BMJA 2GJUA 4WSPA 4DV7E 2JOBA 4DV4E 4F0ZA 1WHNA 2R1FA 2A22A 2IE4C 4FBWA 4G9JA 3K7VC 2PRTA 4JI2E 4LU9A 3LLHA 5IXMB 1EH6A 2EMWA 3EGGA 1YUJA 3C4BA 1UN6B 4UT3B 2BBGA 4WFTA 2RPCA 2UUCE 4R03A 5IT9C 4LF5E 4DT2A 1IBKE 2EM9A 2D9HA
chains in the Genus database with same CATH topology
2UUBE 1HNZE 1HP1A 3ADJA 2L2KB 2BDXA 2VQEE 4F9AB 4HD0A 4LACC 2K4VA 2UU9E 5JJTA 5ADZA 2QJCA 1J26A 1GQEA 5T6JA 5LMUE 4X8WA 3H62B 3OTOE 4F9BB 1OIEA 1OIDA 2LUPB 4X62E 2LMZA 3HQ1A 1S3MA 2VF1A 3K7WC 1O0WA 2LRSA 1I94E 3DF6A 5J28A 2L33A 1HNWE 1M63A 2M4IA 1X47A 4I8OA 4LFCE 3ADIA 2DXLA 1UTEA 5AE1A 2IE3C 3HVQA 1ZBTA 3RQZA 1Z2XA 3PSOA 1FKAE 4GKKE 2USHA 2B9DA 1QU6A 3IB8A 4O5GA 1YYWA 2BQ8X 4IYPC 1RQ0A 3E7AA 4LFAE 1N32E 4B2OA 2KKNA 1W24A 2N3GA 1HR0E 3ADLA 3IWDA 1PKPA 3K6QA 2FTXB 4BBYA 4DR2E 4BC7A 2M7QA 2WDDA 4NXME 1X48A 3C9FA 2M1SA 3IVDA 4H2GA 4DV3E 1X49A 1DQ3A 4M2ZA 2ODRD 4DR1E 4LF8E 3JAMC 3RL4A 2DMYA 4JI0E 4JA9A 3H67A 1T4NA 2V87A 3MSWA 3DSCA 1XM7A 1S95A 2Z1AA 3D03A 3KBPA 3THNA 2F8BA 1QFCA 2FV4B 1KBPA 3QFKA 4V0VA 2E5LE 4YY3E 4LF7E 2NPPC 1XMOE 4ZX2A 3F6HA 4GKJE 4M30A 3DW8C 4K0KE 3J80C 2KHXA 4OX9E 2BCDA 4LFBE 2O8GA 5B8IA 4GEQB 1XMQE 4BC9A 3J7AG 4F54A 2FGGA 2ZBMA 2ZO9B 4DSYA 4DUYE 2E1MA 2L6MA 2JWOA 1OI8A 5EQVA 2UUAE 2LTSA 2DB2A 2H36X 1XZWA 3VYYA 5DNYA 3T1HE 5AASA 3PSNA 2L3CA 1IT6A 4DMIA 4KHPE 2DSYA 3ADGA 4BS9A 1J5EE 2NUGA 4V0WA 2DIXA 2EWLA 1ZBQA 4YKEA 3T1IA 4LTYA 3AUZA 2DFJA 2HYOA 1DI2A 3HXLA 3JYFA 1QHWA 2Z06A 2HY1A 3IVEA 3IWCA 3H64A 3AV0A 5LMNE 3RMPA 2P6BA 4NXNE 4JI6E 2B7VA 2NUFA 4DV1E 1USHA 4B3ME 4OOGC 5AE2A 3RL3A 4DR6E 1N34E 2UXCE 2WDFA 3H61A 4ZVZA 2JOGA 4DR7E 1RC7A 2ODRC 1UHZA 4L8NA 2G7HA 4OR9A 1WXRA 2WZOA 4Q28A 1V73A 4H1SA 4JI3E 2LJHA 4B3TE 4JI5E 4JYAE 3ZU0A 4ORCA 2L2MA 4H2IA 4KBPA 2WDEA 5CFFE 2V88A 2MDRA 1UF3A 3V4YA 2NYLC 3H60A 3DJWA 2NA2A 1IBME 3ZTVA 3H68A 2L92A 4JI8E 1WHQA 4IL1A 4UT2A 3LL8A 4YHHE 5A2QC 3JTZA 4MP0A 4H2BA 3QFMA 3E7BA 5JPFA 3E0JA 5AE3A 1XNQE 4DR5E 3H69A 2N3HA 2B3TB 4WWLA 1T71A 4R8OA 2AHDA 3FLOA 4BCAA 2RTXA 4FBQA 2CV9A 1FJMA 5INBA 3FGAC 2MC6A 3CK2A 2JY9A 4P78A 4DV5E 2O8AA 4JA7A 2HYPA 1AUIA 4O24A 4ORBA 3LMLA 4DUZE 4LF6E 4KKZA 4KZSA 4DV0E 4WPYA 4B3SE 1S3NA 3VYXA 3C5WC 2B7TA 4UWQA 1TCOA 3C4TA 2YT4A 1N33E 2V89A 2NYMC 4I5NC 3RL5A 3N5UA 1WARA 5IWAE 3THOB 4UT3A 2JOXA 3KWRA 3GVEA 1N36E 2V85A 2F4VE 4JV5E 4TUIA 1YYOA 2LBSB 3IB7A 3JU0A 3VK6A 4O4KA 1YZ9A 3H09A 2YZTA 4H2FA 2NXFA 2CPNA 4M0VA 4ORAA 5JPEA 1T70A 1EKZA 1STUA 2ZOAA 1HPUA 2RS7A 2UXBE 5C1VA 2RS6A 4X65E 1WAO1 1II7A 4J6OA 3TGHA 4JI4E 2HHHE 2EZ6A 3QG5C 2JR1A 4X66E 1HO5A 2VQFE 4DR4E 1XNRE 1T4LB 2YEQA 4WYQB 4DHLA 2L3JA 1G5BA 4F9CB 2ZM6E 1S8EA 5HPEA 2Q8UA 3OMLA 1GZ6A 2V83A 1S70A 3HPZA 4JI1E 2RSMA 2MC5A 3J81C 4NZVA 4Q7FA 4L5NC 1YYKA 3P1XA 4TUGA 1S3LA 4DR3E 3EGHA 4LF4E 1FJGE 4MOVA 3T1YE 4P7DA 4FBKA 5FLXC 3HTXA 3DSDA 2L2NA 2IAEC 2V86A 2KONA 2R17A 3H66A 2QFRA 2V8QB 4AQYE 3HPSA 2NUEA 3QFNA 3QFOA 1T4OA 3F6GA 1Z2WA 2DXNA 1SU1A 4XPNA 3IWBA 4DV6E 4LF9E 1MF8A 2QFPA 3P71C 5GTUA 5IOHA 4MOYA 4JI7E 2VE7C 1IBLE 3H63A 2LTRA 4J8ZA 2YVTA 4I5LC 4V0XA 2WDCA 2JVAA 3FIGA 3ZOQB 4B3RE 2UXDE 2Z72A 1SR9A 5BR8E 5LL6R 1U32A 3J7Yp 2LE2A 2KOUA 4O43A 2LUQA 1NNWA 4DKKA 5F3WA 3ICFA 1UILA 4FCXA 1JK7A 4H1YP 2IHR1 4DV2E 2L8TA 1HNXE 2XMOA 4X64E 2GJUA 4BMJA 4WSPA 4DV7E 2JOBA 4DV4E 4F0ZA 1WHNA 2A22A 2IE4C 4FBWA 4G9JA 3K7VC 4JI2E 4LU9A 3LLHA 4UT3B 3EGGA 3C4BA 4WFTA 2UUCE 4R03A 5IT9C 4LF5E 4DT2A 1IBKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP1 A;  1S70 A;  2NPP C;  2BDX A;  4ZX2 A;  4HD0 A;  3DW8 C;  4LAC C;  4MP0 A;  4H2B A;  3QFM A;  3E7B A;  5JPF A;  5JJT A;  2BCD A;  4NZV A;  2O8G A;  4Q7F A;  5B8I A;  2QJC A;  3H69 A;  4WWL A;  3H62 B;  1T71 A;  2AHD A;  4FBQ A;  1OIE A;  1OID A;  2CV9 A;  4TUG A;  1FJM A;  2ZBM A;  5INB A;  1S3L A;  3FGA C;  3EGH A;  4MOV A;  3CK2 A;  1S3M A;  3K7W C;  4DSY A;  4FBK A;  5J28 A;  1OI8 A;  2O8A A;  1M63 A;  4JA7 A;  5EQV A;  2HYP A;  1AUI A;  4O24 A;  4ORB A;  3DSD A;  2IAE C;  2R17 A;  3H66 A;  2QFR A;  4KKZ A;  1UTE A;  1XZW A;  5DNY A;  3PSN A;  1S3N A;  1IT6 A;  3C5W C;  4UWQ A;  1TCO A;  3QFN A;  3QFO A;  2IE3 C;  4V0W A;  3HVQ A;  4YKE A;  2NYM C;  4I5N C;  3T1I A;  4LTY A;  3AUZ A;  3RL5 A;  2DFJ A;  1Z2W A;  1SU1 A;  4XPN A;  2HYO A;  3RQZ A;  1Z2X A;  3N5U A;  3PSO A;  1WAR A;  3JYF A;  1MF8 A;  1QHW A;  2QFP A;  2Z06 A;  3THO B;  2USH A;  4UT3 A;  2HY1 A;  3IB8 A;  3IVE A;  3P71 C;  4O5G A;  5GTU A;  5IOH A;  3GVE A;  2BQ8 X;  4IYP C;  3H64 A;  3AV0 A;  3E7A A;  4TUI A;  2P6B A;  3IB7 A;  4O4K A;  4MOY A;  4B2O A;  4H2F A;  2KKN A;  1W24 A;  2NXF A;  4M0V A;  3H63 A;  4ORA A;  1USH A;  2YVT A;  4I5L C;  1T70 A;  4V0X A;  5JPE A;  3RL3 A;  2WDC A;  1HPU A;  2WDF A;  3H61 A;  2WDD A;  5C1V A;  4ZVZ A;  2Z72 A;  2JOG A;  3C9F A;  1U32 A;  1WAO 1;  3IVD A;  1II7 A;  4J6O A;  4O43 A;  4H2G A;  1NNW A;  3TGH A;  5F3W A;  4OR9 A;  3ICF A;  4FCX A;  1JK7 A;  1V73 A;  4H1Y P;  4H1S A;  3RL4 A;  2XMO A;  3QG5 C;  4JA9 A;  2GJU A;  3ZU0 A;  4ORC A;  1HO5 A;  4H2I A;  4KBP A;  2WDE A;  3H67 A;  4F0Z A;  2A22 A;  2IE4 C;  4FBW A;  1UF3 A;  3V4Y A;  3DSC A;  4G9J A;  1XM7 A;  1S95 A;  2NYL C;  2Z1A A;  3K7V C;  3KBP A;  3THN A;  4DHL A;  3H60 A;  1QFC A;  4LU9 A;  1G5B A;  1KBP A;  3EGG A;  3QFK A;  4UT3 B;  4V0V A;  3H68 A;  3ZTV A;  1S8E A;  4IL1 A;  5HPE A;  2Q8U A;  4DT2 A;  4UT2 A;  3LL8 A; 
#chains in the Genus database with same CATH topology
 2UUB E;  1HNZ E;  5KL2 A;  3ADJ A;  2L2K B;  1HP1 A;  2VQE E;  2BDX A;  4F9A B;  4HD0 A;  3BBG A;  2K4V A;  4LAC C;  2UU9 E;  5JJT A;  5ADZ A;  1MEY C;  4R2R A;  2QJC A;  1J26 A;  1GQE A;  5T6J A;  5LMU E;  4X8W A;  2EN8 A;  1PJQ A;  3H62 B;  3OTO E;  2YRK A;  1X3C A;  4F9B B;  1OIE A;  1OID A;  2EPU A;  2LUP B;  1G2F C;  2EL5 A;  4X62 E;  5IV8 B;  2LMZ A;  3HQ1 A;  1S3M A;  2VF1 A;  3K7W C;  1O0W A;  2LRS A;  1I94 E;  2EOY A;  2EOM A;  3DF6 A;  5J28 A;  2L33 A;  1HNW E;  1BBO A;  1M63 A;  2M4I A;  1X47 A;  4I8O A;  4LFC E;  3EPL A;  3ADI A;  2DXL A;  3VHT B;  1UTE A;  2WCC 3;  5AE1 A;  2HC5 A;  3C6K A;  1WJP A;  2IE3 C;  3HVQ A;  2E72 A;  2EOX A;  1ZBT A;  2EOI A;  1X6H A;  4NHR A;  2ELY A;  2EM3 A;  2YTQ A;  3RQZ A;  2EQ3 A;  1Z2X A;  3PSO A;  1FKA E;  4GKK E;  2USH A;  2B9D A;  1QU6 A;  3IB8 A;  4O5G A;  2CT1 A;  1YYW A;  4ZYD A;  2BQ8 X;  3MHS C;  4IYP C;  1RQ0 A;  2EE8 A;  3E7A A;  2YU5 A;  2YSP A;  4LFA E;  1ZR9 A;  2ENA A;  1N32 E;  2ENC A;  4B2O A;  2LCE A;  2KKN A;  1W24 A;  2N3G A;  1HR0 E;  3IWD A;  2YTG A;  1PKP A;  3ADL A;  1L4S A;  3K6Q A;  2FTX B;  3ECR A;  4BBY A;  4DR2 E;  4BC7 A;  2M7Q A;  4GZN C;  4NXM E;  2WDD A;  5A69 A;  1X48 A;  2EOH A;  3C9F A;  2ELZ A;  2M1S A;  2EPR A;  1NEI A;  5KL3 A;  4HEI A;  3IVD A;  2DMI A;  2YTN A;  3C6M A;  4H2G A;  4KWY A;  4DV3 E;  2EMC A;  2DGC A;  2EPC A;  1X49 A;  1DQ3 A;  4M2Z A;  2ODR D;  4DR1 E;  4F2J C;  4LF8 E;  3JAM C;  3RL4 A;  4WXC A;  2DMY A;  4JI0 E;  4JA9 A;  2EQ0 A;  2EM6 A;  2YTF A;  3H67 A;  1T4N A;  2A25 A;  4WSG A;  2V87 A;  3MSW A;  2WBU A;  5A6A A;  1XM7 A;  1S95 A;  2Z1A A;  3THN A;  3D03 A;  3KBP A;  2F8B A;  1QFC A;  5AC4 A;  1JK1 A;  2FV4 B;  1KBP A;  1N3G A;  3QFK A;  4V0V A;  2LVH A;  4YY3 E;  2E5L E;  4LF7 E;  2NPP C;  1XMO E;  4ZX2 A;  3F6H A;  4GKJ E;  4M30 A;  3DW8 C;  4K0K E;  2EM7 A;  3J80 C;  2KHX A;  4OX9 E;  2BCD A;  4R2Q A;  4LFB E;  2O8G A;  5B8I A;  2EOS A;  4WX9 A;  4GEQ B;  1XMQ E;  4BC9 A;  1B69 A;  2M9A A;  3J7A G;  4F54 A;  2FGG A;  2YTE A;  2ZBM A;  2J7J A;  4BHB A;  2ZO9 B;  4DSY A;  4DUY E;  2EMK A;  2E1M A;  2L6M A;  2JWO A;  1OI8 A;  2EN2 A;  5EQV A;  5AC5 A;  2UUA E;  1X6E A;  2EQ1 A;  2JXP A;  2LTS A;  2DB2 A;  2BB8 A;  1PDA A;  2EMF A;  2H36 X;  3VYY A;  1XZW A;  5DNY A;  3T1H E;  1BB8 A;  1X6F A;  5AAS A;  3PSN A;  2L3C A;  1IT6 A;  3MHH C;  4DMI A;  4KHP E;  2EPA A;  2EOF A;  1NCS A;  2YPN A;  2EP3 A;  2DSY A;  3ADG A;  4R2A A;  4BS9 A;  1J5E E;  2NUG A;  4V0W A;  2DIX A;  2EWL A;  1ZBQ A;  4FK5 C;  1A1L A;  4YKE A;  3T1I A;  4LTY A;  3AUZ A;  1F2I G;  2DFJ A;  2HYO A;  1DI2 A;  3HXL A;  3JYF A;  2R76 A;  1QHW A;  2Z06 A;  2HY1 A;  3IVE A;  5A6B A;  3L00 A;  2EPP A;  5A6K A;  3IWC A;  2EPL X;  3H64 A;  2K7I A;  3AV0 A;  5LMN E;  1A1G A;  3RMP A;  2EMB A;  2P6B A;  1EH8 A;  4NXN E;  2LJU A;  4JI6 E;  2B7V A;  2NUF A;  4X9J A;  1UBD C;  4DV1 E;  1USH A;  4B3M E;  4OOG C;  5AE2 A;  3RL3 A;  2YRH A;  4DR6 E;  4N4R B;  1N34 E;  2UXC E;  2WDF A;  3H61 A;  1KJK A;  1A1F A;  4ZVZ A;  2JOG A;  2EOO A;  1A1J A;  4DR7 E;  2EPK X;  1RC7 A;  2ODR C;  1G2D C;  1UHZ A;  4L8N A;  2G7H A;  4OR9 A;  1WXR A;  2WZO A;  4Q28 A;  1LLM C;  1V73 A;  4H1S A;  4JI3 E;  2LJH A;  4B3T E;  4JI5 E;  4JYA E;  2WBS A;  3ZU0 A;  4ORC A;  2L2M A;  4H2I A;  4KBP A;  2WDE A;  2YSO A;  5KL7 A;  5CFF E;  2EL6 A;  2V88 A;  2MDR A;  1UF3 A;  3V4Y A;  1QNT A;  1IMU A;  2NYL C;  2HJJ A;  3H60 A;  2EM2 A;  3DJW A;  2NA2 A;  3EPH A;  1IBM E;  1MGT A;  3H68 A;  2L92 A;  4JI8 E;  1WHQ A;  3ZTV A;  4IL1 A;  2JYA A;  4UT2 A;  3LL8 A;  2EMG A;  4YHH E;  2EPN A;  4WXD A;  5A2Q C;  2JP9 A;  3JTZ A;  2ENH A;  4MP0 A;  4H2B A;  3QFM A;  3E7B A;  5JPF A;  3E0J A;  2EPZ A;  5AE3 A;  1XNQ E;  4DR5 E;  1DGC A;  3H69 A;  2N3H A;  2B3T B;  1T39 A;  4WWL A;  2YTI A;  4R8O A;  1T71 A;  2AHD A;  3FLO A;  2EMH A;  4BCA A;  2RTX A;  4FBQ A;  2CV9 A;  2EN7 A;  1FJM A;  5INB A;  3FGA C;  1BBG A;  3BGH A;  2MC6 A;  3CK2 A;  2YTP A;  2JY9 A;  4P78 A;  4DV5 E;  2O8A A;  2EL4 A;  4JA7 A;  2LT7 A;  2HYP A;  1AUI A;  4O24 A;  4ORB A;  5KL4 A;  3LML A;  4DUZ E;  4LF6 E;  4KKZ A;  4KZS A;  4DV0 E;  4WPY A;  4Q35 B;  2EN1 A;  4B3S E;  3VYX A;  2B7T A;  1S3N A;  1A1H A;  3C5W C;  4UWQ A;  4RHB B;  1TCO A;  4ZYE A;  3C4T A;  2YT4 A;  1PJT A;  1N33 E;  2V89 A;  1AAY A;  3BID A;  2NYM C;  4I5N C;  1TF3 A;  3RL5 A;  4IS1 C;  1IQO A;  3KZY A;  3N5U A;  1WAR A;  5IWA E;  3THO B;  2CSH A;  4UT3 A;  5A6J A;  2JOX A;  3KWR A;  1P47 A;  5TSE A;  3GVE A;  2MDG A;  1N36 E;  2DRP A;  2V85 A;  3KZZ A;  2F4V E;  4JV5 E;  4HTG A;  1EH7 A;  4TUI A;  1YYO A;  2LBS B;  3IB7 A;  3JU0 A;  3VK6 A;  4O4K A;  2CTD A;  1YZ9 A;  3TQM A;  3H09 A;  2EMI A;  2DLK A;  2EOQ A;  2YZT A;  4H2F A;  1PJS A;  2EOJ A;  2NXF A;  2CPN A;  4M0V A;  2GHF A;  4ORA A;  5JPE A;  4ZYG A;  1T70 A;  1EKZ A;  1STU A;  2ZOA A;  1HPU A;  2YTD A;  2RS7 A;  5KL6 A;  2UXB E;  5C1V A;  3EPK A;  2RS6 A;  4X65 E;  1WAO 1;  1II7 A;  4J6O A;  4BHC A;  3TGH A;  4JI4 E;  2EML A;  2HHH E;  2GLI A;  2EZ6 A;  1YFH A;  3QG5 C;  2JR1 A;  2VRD A;  1ZAA C;  4X66 E;  1HO5 A;  4IJD A;  1SFE A;  2EMY A;  2VQF E;  4DR4 E;  1XNR E;  2EOE A;  2EPO A;  2RSI A;  1T4L B;  2YEQ A;  3DSC A;  4ZYH A;  4WYQ B;  4DHL A;  2YTO A;  2L3J A;  1G5B A;  5KL5 A;  3EPJ A;  4F9C B;  2ZM6 E;  2YRM A;  1S8E A;  2EN6 A;  5HPE A;  2Q8U A;  5A6B D;  3OML A;  1GZ6 A;  2MKN A;  2V83 A;  2LO3 A;  1S70 A;  3HPZ A;  4JI1 E;  4R2D A;  2YWQ A;  2RSM A;  2EM8 A;  3EQ1 A;  1YSA C;  2MC5 A;  4NZV A;  3J81 C;  1A1K A;  4Q7F A;  2EOR A;  4L5N C;  1RMD A;  3M99 B;  4R2E A;  1YYK A;  3P1X A;  1WRJ A;  4TUG A;  1S3L A;  4DR3 E;  1X5W A;  3EGH A;  4LF4 E;  1FJG E;  4MOV A;  2EPX A;  4P7D A;  4R2P A;  3T1Y E;  1T38 A;  2EMA A;  2JPA A;  4FBK A;  5FLX C;  3HTX A;  4F6N A;  3DSD A;  2L2N A;  2IAE C;  1YPN A;  2V86 A;  2KON A;  2R17 A;  2EJ4 A;  3H66 A;  2QFR A;  2V8Q B;  4AQY E;  3HPS A;  2NUE A;  2EMX A;  1A1I A;  3QFN A;  3QFO A;  1T4O A;  4R2S A;  2EPM X;  3F6G A;  1Z2W A;  2DXN A;  1SU1 A;  4XPN A;  2I9I A;  3IWB A;  1YUI A;  4DV6 E;  4MLV A;  4LF9 E;  2MKD A;  2EMZ A;  2NAB A;  1MF8 A;  2QFP A;  2LV2 A;  3P71 C;  5GTU A;  5IOH A;  2YU8 A;  1IQS A;  2DLQ A;  2WBT A;  2YTJ A;  4MOY A;  4RH8 A;  4JI7 E;  4MLQ A;  2EOZ A;  2N8X A;  2GPI A;  2VE7 C;  1IBL E;  3UK3 C;  3H63 A;  2LTR A;  4J8Z A;  2YVT A;  4I5L C;  4V0X A;  2EN4 A;  2WDC A;  2HGH A;  2RQL A;  1AH5 A;  2JVA A;  3FIG A;  3ZOQ B;  3BF2 A;  4B3R E;  4M9V C;  2UXD E;  2Z72 A;  1SR9 A;  5BR8 E;  2I13 A;  5LL6 R;  1U32 A;  3J7Y p;  2KOU A;  2LE2 A;  2EM0 A;  4O43 A;  2EN3 A;  2LUQ A;  4F6M A;  1Z1B A;  1NNW A;  2EM5 A;  4R2C A;  2ADR A;  4DKK A;  2EM4 A;  5F3W A;  1GTK A;  3ICF A;  1JK2 A;  5LLQ A;  1UIL A;  1TF6 A;  4FCX A;  1JK7 A;  4H1Y P;  2IHR 1;  4DV2 E;  2L8T A;  1HNX E;  1KYQ A;  2XMO A;  1ZU1 A;  4X64 E;  1TN9 A;  4BMJ A;  2GJU A;  4WSP A;  4DV7 E;  2JOB A;  4DV4 E;  4F0Z A;  1WHN A;  2R1F A;  2A22 A;  2IE4 C;  4FBW A;  4G9J A;  3K7V C;  2PRT A;  4JI2 E;  4LU9 A;  3LLH A;  5IXM B;  1EH6 A;  2EMW A;  3EGG A;  1YUJ A;  3C4B A;  1UN6 B;  4UT3 B;  2BBG A;  4WFT A;  2RPC A;  2UUC E;  4R03 A;  5IT9 C;  4LF5 E;  4DT2 A;  1IBK E;  2EM9 A;  2D9H A; 
#chains in the Genus database with same CATH homology
 2UUB E;  1HNZ E;  1HP1 A;  3ADJ A;  2L2K B;  2BDX A;  2VQE E;  4F9A B;  4HD0 A;  4LAC C;  2K4V A;  2UU9 E;  5JJT A;  5ADZ A;  2QJC A;  1J26 A;  1GQE A;  5T6J A;  5LMU E;  4X8W A;  3H62 B;  3OTO E;  4F9B B;  1OIE A;  1OID A;  2LUP B;  4X62 E;  2LMZ A;  3HQ1 A;  1S3M A;  2VF1 A;  3K7W C;  1O0W A;  2LRS A;  1I94 E;  3DF6 A;  5J28 A;  2L33 A;  1HNW E;  1M63 A;  2M4I A;  1X47 A;  4I8O A;  4LFC E;  3ADI A;  2DXL A;  1UTE A;  5AE1 A;  2IE3 C;  3HVQ A;  1ZBT A;  3RQZ A;  1Z2X A;  3PSO A;  1FKA E;  4GKK E;  2USH A;  2B9D A;  1QU6 A;  3IB8 A;  4O5G A;  1YYW A;  2BQ8 X;  4IYP C;  1RQ0 A;  3E7A A;  4LFA E;  1N32 E;  4B2O A;  2KKN A;  1W24 A;  2N3G A;  1HR0 E;  3ADL A;  3IWD A;  1PKP A;  3K6Q A;  2FTX B;  4BBY A;  4DR2 E;  4BC7 A;  2M7Q A;  2WDD A;  4NXM E;  1X48 A;  3C9F A;  2M1S A;  3IVD A;  4H2G A;  4DV3 E;  1X49 A;  1DQ3 A;  4M2Z A;  2ODR D;  4DR1 E;  4LF8 E;  3JAM C;  3RL4 A;  2DMY A;  4JI0 E;  4JA9 A;  3H67 A;  1T4N A;  2V87 A;  3MSW A;  3DSC A;  1XM7 A;  1S95 A;  2Z1A A;  3D03 A;  3KBP A;  3THN A;  2F8B A;  1QFC A;  2FV4 B;  1KBP A;  3QFK A;  4V0V A;  2E5L E;  4YY3 E;  4LF7 E;  2NPP C;  1XMO E;  4ZX2 A;  3F6H A;  4GKJ E;  4M30 A;  3DW8 C;  4K0K E;  3J80 C;  2KHX A;  4OX9 E;  2BCD A;  4LFB E;  2O8G A;  5B8I A;  4GEQ B;  1XMQ E;  4BC9 A;  3J7A G;  4F54 A;  2FGG A;  2ZBM A;  2ZO9 B;  4DSY A;  4DUY E;  2E1M A;  2L6M A;  2JWO A;  1OI8 A;  5EQV A;  2UUA E;  2LTS A;  2DB2 A;  2H36 X;  1XZW A;  3VYY A;  5DNY A;  3T1H E;  5AAS A;  3PSN A;  2L3C A;  1IT6 A;  4DMI A;  4KHP E;  2DSY A;  3ADG A;  4BS9 A;  1J5E E;  2NUG A;  4V0W A;  2DIX A;  2EWL A;  1ZBQ A;  4YKE A;  3T1I A;  4LTY A;  3AUZ A;  2DFJ A;  2HYO A;  1DI2 A;  3HXL A;  3JYF A;  1QHW A;  2Z06 A;  2HY1 A;  3IVE A;  3IWC A;  3H64 A;  3AV0 A;  5LMN E;  3RMP A;  2P6B A;  4NXN E;  4JI6 E;  2B7V A;  2NUF A;  4DV1 E;  1USH A;  4B3M E;  4OOG C;  5AE2 A;  3RL3 A;  4DR6 E;  1N34 E;  2UXC E;  2WDF A;  3H61 A;  4ZVZ A;  2JOG A;  4DR7 E;  1RC7 A;  2ODR C;  1UHZ A;  4L8N A;  2G7H A;  4OR9 A;  1WXR A;  2WZO A;  4Q28 A;  1V73 A;  4H1S A;  4JI3 E;  2LJH A;  4B3T E;  4JI5 E;  4JYA E;  3ZU0 A;  4ORC A;  2L2M A;  4H2I A;  4KBP A;  2WDE A;  5CFF E;  2V88 A;  2MDR A;  1UF3 A;  3V4Y A;  2NYL C;  3H60 A;  3DJW A;  2NA2 A;  1IBM E;  3ZTV A;  3H68 A;  2L92 A;  4JI8 E;  1WHQ A;  4IL1 A;  4UT2 A;  3LL8 A;  4YHH E;  5A2Q C;  3JTZ A;  4MP0 A;  4H2B A;  3QFM A;  3E7B A;  5JPF A;  3E0J A;  5AE3 A;  1XNQ E;  4DR5 E;  3H69 A;  2N3H A;  2B3T B;  4WWL A;  1T71 A;  4R8O A;  2AHD A;  3FLO A;  4BCA A;  2RTX A;  4FBQ A;  2CV9 A;  1FJM A;  5INB A;  3FGA C;  2MC6 A;  3CK2 A;  2JY9 A;  4P78 A;  4DV5 E;  2O8A A;  4JA7 A;  2HYP A;  1AUI A;  4O24 A;  4ORB A;  3LML A;  4DUZ E;  4LF6 E;  4KKZ A;  4KZS A;  4DV0 E;  4WPY A;  4B3S E;  1S3N A;  3VYX A;  3C5W C;  2B7T A;  4UWQ A;  1TCO A;  3C4T A;  2YT4 A;  1N33 E;  2V89 A;  2NYM C;  4I5N C;  3RL5 A;  3N5U A;  1WAR A;  5IWA E;  3THO B;  4UT3 A;  2JOX A;  3KWR A;  3GVE A;  1N36 E;  2V85 A;  2F4V E;  4JV5 E;  4TUI A;  1YYO A;  2LBS B;  3IB7 A;  3JU0 A;  3VK6 A;  4O4K A;  1YZ9 A;  3H09 A;  2YZT A;  4H2F A;  2NXF A;  2CPN A;  4M0V A;  4ORA A;  5JPE A;  1T70 A;  1EKZ A;  1STU A;  2ZOA A;  1HPU A;  2RS7 A;  2UXB E;  5C1V A;  2RS6 A;  4X65 E;  1WAO 1;  1II7 A;  4J6O A;  3TGH A;  4JI4 E;  2HHH E;  2EZ6 A;  3QG5 C;  2JR1 A;  4X66 E;  1HO5 A;  2VQF E;  4DR4 E;  1XNR E;  1T4L B;  2YEQ A;  4WYQ B;  4DHL A;  2L3J A;  1G5B A;  4F9C B;  2ZM6 E;  1S8E A;  5HPE A;  2Q8U A;  3OML A;  1GZ6 A;  2V83 A;  1S70 A;  3HPZ A;  4JI1 E;  2RSM A;  2MC5 A;  3J81 C;  4NZV A;  4Q7F A;  4L5N C;  1YYK A;  3P1X A;  4TUG A;  1S3L A;  4DR3 E;  3EGH A;  4LF4 E;  1FJG E;  4MOV A;  3T1Y E;  4P7D A;  4FBK A;  5FLX C;  3HTX A;  3DSD A;  2L2N A;  2IAE C;  2V86 A;  2KON A;  2R17 A;  3H66 A;  2QFR A;  2V8Q B;  4AQY E;  3HPS A;  2NUE A;  3QFN A;  3QFO A;  1T4O A;  3F6G A;  1Z2W A;  2DXN A;  1SU1 A;  4XPN A;  3IWB A;  4DV6 E;  4LF9 E;  1MF8 A;  2QFP A;  3P71 C;  5GTU A;  5IOH A;  4MOY A;  4JI7 E;  2VE7 C;  1IBL E;  3H63 A;  2LTR A;  4J8Z A;  2YVT A;  4I5L C;  4V0X A;  2WDC A;  2JVA A;  3FIG A;  3ZOQ B;  4B3R E;  2UXD E;  2Z72 A;  1SR9 A;  5BR8 E;  5LL6 R;  1U32 A;  3J7Y p;  2LE2 A;  2KOU A;  4O43 A;  2LUQ A;  1NNW A;  4DKK A;  5F3W A;  3ICF A;  1UIL A;  4FCX A;  1JK7 A;  4H1Y P;  2IHR 1;  4DV2 E;  2L8T A;  1HNX E;  2XMO A;  4X64 E;  2GJU A;  4BMJ A;  4WSP A;  4DV7 E;  2JOB A;  4DV4 E;  4F0Z A;  1WHN A;  2A22 A;  2IE4 C;  4FBW A;  4G9J A;  3K7V C;  4JI2 E;  4LU9 A;  3LLH A;  4UT3 B;  3EGG A;  3C4B A;  4WFT A;  2UUC E;  4R03 A;  5IT9 C;  4LF5 E;  4DT2 A;  1IBK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...