4TUIA

Crystal structure of mjmre11-dna1 complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA double-strand break repair protein Mre11
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 94
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tuiA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tuiA01
3EGHA 3RL3A 3ZTVA 4KBPA 2Z72A 2IE4C 5J28A 2P6BA 3H63A 1KBPA 3H66A 4NZVA 3C5WC 4KKZA 1OIDA 3H62B 1T71A 4IL1A 4DHLA 3IB8A 3EGGA 4ZVZA 5EQVA 5JPFA 4O43A 2QFPA 2WDFA 1OI8A 1QHWA 1HPUA 2NPPC 3DW8C 3E7AA 4ZX2A 3IVEA 3N5UA 1FJMA 4MOVA 3ICFA 4H2IA 4TUIA 3THOB 4ORAA 3ZU0A 1UF3A 4FBWA 4HD0A 4J6OA 3V4YA 4DT2A 5HPEA 1S8EA 1T70A 3K7WC 1OIEA 4H2BA 2R17A 3K7VC 2YVTA 4H1YP 4IYPC 2KKNA 1NNWA 2USHA 4H1SA 1S95A 4I5NC 4H2FA 3PSOA 5DNYA 4O24A 4LACC 4UT3B 3AUZA 1M63A 2NYLC 4LU9A 4YKEA 5GTUA 3AV0A 3THNA 2A22A 4FBQA 3FGAC 3H67A 1QFCA 3QFOA 1JK7A 4H2GA 2NXFA 4FBKA 4ORBA 4OR9A 5C1VA 1TCOA 3PSNA 2ZBMA 3QFKA 2WDEA 1UTEA 3C9FA 1S3NA 1USHA 1S3MA 2IAEC 1S3LA 2WDCA 2Z06A 1W24A 4JA9A 4I5LC 3QFNA 4O5GA 3E7BA 1AUIA 3KBPA 3IVDA 4LTYA 4V0WA 4UWQA 2IE3C 2WDDA 2QFRA 2Z1AA 2HY1A 3TGHA 1Z2XA 3DSDA 3RQZA 5INBA 1II7A 1IT6A 2Q8UA 4DSYA 2CV9A 4FCXA 3JYFA 3RL4A 4B2OA 2XMOA 3QFMA 1XZWA 1XM7A 3HVQA 4M0VA 4ORCA 5B8IA 2BDXA 5JJTA 1G5BA 2BQ8X 2HYOA 2O8GA 3IB7A 4UT3A 4F0ZA 3H64A 1Z2WA 2BCDA 4MOYA 3RL5A 2GJUA 3P71C 4V0XA 1HO5A 1WAO1 1WARA 5F3WA 3LL8A 4TUGA 5IOHA 2AHDA 4UT2A 4JA7A 3DSCA 1SU1A 2HYPA 4MP0A 3QG5C 3H69A 2QJCA 3CK2A 3GVEA 1S70A 4XPNA 4O4KA 1HP1A 2NYMC 3H61A 4Q7FA 3T1IA 5JPEA 3H68A 4V0VA 3H60A 1U32A 4G9JA 1V73A 2JOGA 4WWLA 2DFJA 1MF8A 2O8AA
chains in the Genus database with same CATH superfamily
2VF1A 4B3RE 4BHBA 4KBPA 4BS9A 2YTIA 2N8XA 4NZVA 3C6KA 3H63A 4R2SA 3C5WC 3H62B 5FLXC 5A6KA 2EOHA 4LFBE 4AQYE 1ZBQA 2MDGA 3IWBA 4O43A 1N32E 3ADGA 2ENHA 1A1LA 3DW8C 4NHRA 1MGTA 1XMOE 3N5UA 2DMYA 3J81C 2YEQA 2DLKA 5KL6A 4TUIA 2UXBE 3J80C 3UK3C 1FKAE 1EH8A 1GQEA 2YTFA 1UF3A 2EOQA 4DV6E 2EM7A 4J6OA 4HTGA 2EMXA 2EMWA 4JI6E 4K0KE 1YUJA 2NA2A 4H2BA 2KOUA 2EPPA 2YT4A 2UUAE 2ZM6E 2E1MA 3K7VC 4F9CB 1A1HA 4IYPC 2EMCA 2JXPA 1N34E 4NXNE 1XMQE 2YU5A 4MLVA 2EMBA 3JAMC 3IWDA 2L3CA 1STUA 2M7QA 4L5NC 3C4BA 5A69A 5DNYA 2EOIA 2MKDA 4LU9A 2LE2A 3HTXA 2UXCE 5KL5A 2NYLC 4KZSA 1G2DC 2EMYA 2L3JA 4X64E 3H67A 4BCAA 3FLOA 1TF3A 1JK7A 2GHFA 2EM3A 3L00A 5ADZA 4OR9A 1IBME 2M1SA 1YZ9A 5C1VA 1YUIA 3TQMA 4JV5E 5LMNE 2FGGA 2GPIA 3QFKA 3F6HA 5KL4A 1S3MA 5LMUE 2IAEC 2WDCA 3F6GA 4KWYA 1W24A 4I5LC 3QFNA 3E7BA 3BF2A 3M99B 4Q28A 2B9DA 2YU8A 4GZNC 2QFRA 3TGHA 1Z2XA 2L92A 2YTGA 4M30A 4DR3E 2GLIA 1LLMC 4LF6E 2EM8A 1NCSA 2RQLA 4DUYE 2Q8UA 2EORA 2CT1A 3JYFA 2L2MA 3RL4A 2XMOA 1XZWA 3HVQA 2EOXA 1X49A 3JU0A 2EZ6A 2BDXA 3T1YE 4Q35B 2EN1A 1AAYA 3IB7A 1N36E 1RC7A 3H64A 2BCDA 3BBGA 4P78A 3EPKA 3H09A 1WAO1 2DMIA 4M9VC 2ZOAA 4WX9A 2JVAA 2WZOA 1X6FA 3LL8A 2VRDA 3C6MA 2E5LE 4WYQB 2AHDA 2YPNA 2JY9A 5AASA 3DSCA 2HYPA 2ODRC 4JYAE 3OMLA 2QJCA 3HXLA 2J7JA 1I94E 2M9AA 2YSPA 2YWQA 3T1IA 5KL2A 1X48A 2NYMC 1GZ6A 5JPEA 1GTKA 2EMZA 2ENCA 1U32A 4DV3E 4R2CA 2HHHE 2RPCA 2JOGA 2CPNA 2UU9E 1UN6B 5AE2A 2L2NA 2ADRA 2HJJA 3ZTVA 2Z72A 2UUCE 2P6BA 2NUGA 2A25A 4KKZA 2V88A 3KZZA 2UUBE 3EGGA 2MC6A 4ZVZA 5IWAE 2LTRA 2QFPA 4R2AA 2EM5A 3HPZA 1L4SA 1HPUA 3E7AA 2K7IA 1G2FC 4R2PA 3ICFA 3THOB 2JR1A 2YTDA 3ADJA 5LL6R 4F54A 2FTXB 4FBWA 2K4VA 2F8BA 5HPEA 3V4YA 2EOJA 4X65E 4JI3E 3EPHA 2VE7C 1O0WA 2LMZA 3VHTB 2CSHA 2R17A 2RSMA 2LUPB 2KKNA 2USHA 4I5NC 3MSWA 4DR7E 2L8TA 5AE1A 3C4TA 3AUZA 3THNA 1XNQE 1M63A 3AV0A 4WXDA 2EPCA 3QFOA 1X6HA 4BMJA 4F9AB 4F2JC 4H2GA 2B7VA 1T38A 2EPRA 1SR9A 4B3TE 1WRJA 1XNRE 3T1HE 2FV4B 2LBSB 2ZBMA 1WHQA 2L2KB 5T6JA 4DV4E 2EOYA 4ZYDA 2Z06A 5AC4A 4DV7E 4JA9A 4DV5E 4WSGA 2NABA 4DR1E 1QNTA 4M2ZA 4O5GA 2VQFE 3IWCA 2BBGA 2EPOA 4X66E 2G7HA 1IBLE 4JI4E 4UWQA 2WDDA 3EPJA 2Z1AA 1DGCA 1IMUA 4FCXA 4DV2E 1RMDA 1EH7A 2EPUA 4M0VA 1XM7A 1ZAAC 4X62E 4JI5E 2EPNA 4JI7E 1G5BA 2BQ8X 4OOGC 2HYOA 4UT3A 2EN4A 2EN6A 2LVHA 5KL3A 2WBSA 4IJDA 2CTDA 2IHR1 3MHSC 3ZOQB 2EP3A 4LF4E 4DKKA 4UT2A 4R2EA 4JA7A 4NXME 4DUZE 2EPAA 1PJQA 3P1XA 4F6MA 3CK2A 3GVEA 1KYQA 1S70A 4XPNA 4O4KA 5LLQA 5A6JA 1HP1A 4R8OA 2ELYA 4G9JA 4WWLA 2JWOA 2LJUA 2ODRD 5A6BD 3ADLA 1T4LB 2DFJA 5CFFE 2EMAA 2EL6A 4LFAE 2O8AA 4F9BB 2EJ4A 4B3SE 3RL3A 1A1JA 5J28A 4P7DA 2YRHA 3H66A 4DV0E 4LF8E 1T71A 4IL1A 4DHLA 2BB8A 1BBGA 5JPFA 2WDFA 2JPAA 1QU6A 1OI8A 1YYOA 4LFCE 4DMIA 3IVEA 1WJPA 2LJHA 4WPYA 4MOVA 3LLHA 2HGHA 4I8OA 1PJTA 2EMLA 4ORAA 1A1FA 4HD0A 5AC5A 1IBKE 1T70A 3K7WC 1OIEA 1JK1A 5IV8B 1IQOA 4JI1E 2EMKA 4F6NA 1HNXE 1NNWA 4H1SA 2EM9A 1S95A 3DJWA 2B7TA 3OTOE 2R76A 4DR6E 3E0JA 1P47A 4LACC 4UT3B 5GTUA 2EM4A 2LTSA 2F4VE 2A22A 2MC5A 4R03A 4FBQA 1EKZA 5TSEA 1DQ3A 1PKPA 1QFCA 4YY3E 2NXFA 1ZU1A 5BR8E 1TF6A 3FIGA 2RSIA 2DIXA 2DLQA 1SFEA 1TCOA 3PSNA 2JP9A 2RTXA 3C9FA 1ZBTA 2N3HA 2V8QB 3DF6A 1S3LA 3EPLA 3HPSA 2YZTA 2MDRA 2EE8A 4X8WA 1HNWE 1AUIA 3KBPA 2EOMA 2HC5A 3BGHA 1UILA 4LTYA 4BC7A 2NUFA 2EOZA 3DSDA 4MLQA 2HY1A 2EOOA 1X6EA 5INBA 4B3ME 2I9IA 2ENAA 2N3GA 2YTOA 4FK5C 1II7A 4DSYA 4R2DA 2CV9A 4RH8A 3QFMA 2YTJA 1UBDC 5B8IA 1PJSA 2R1FA 2EPXA 5IXMB 3RL5A 4MOYA 1A1IA 4V0XA 3JTZA 2EM6A 1HO5A 1WARA 1YYKA 2EMGA 5F3WA 4WFTA 4ZYHA 3BIDA 2YTQA 2EL4A 2YTNA 3QG5C 2YTPA 3H69A 3ADIA 2EQ1A 4ZYEA 2H36X 1N33E 4IS1C 4LF7E 4L8NA 4HEIA 3H61A 1B69A 3H68A 1IQSA 4Q7FA 3RMPA 2LT7A 4V0VA 3LMLA 2D9HA 1FJGE 1UHZA 1MF8A 2EMHA 5AE3A 2EM2A 3EGHA 2L33A 1J26A 1T4NA 2EM0A 2IE4C 2LV2A 4DR5E 4DR4E 1OIDA 2EN8A 4R2QA 2EQ3A 2RS7A 2WCC3 3IB8A 2WBUA 1T39A 5EQVA 2I13A 1AH5A 5A6BA 2DXNA 1YPNA 4N4RB 4BBYA 1HNZE 2V86A 2DB2A 2EMFA 1QHWA 2NPPC 4ZX2A 4JI2E 1YYWA 1FJMA 4H2IA 2YTEA 4BHCA 1HR0E 2L6MA 3EQ1A 3ZU0A 2EOEA 2PRTA 2E72A 4DT2A 2YRMA 3KWRA 2LO3A 1S8EA 2MKNA 1EH6A 2KHXA 5IT9C 2YVTA 4H1YP 4JI0E 2EPZA 2V85A 2EOFA 2LCEA 4LF9E 4H2FA 3PSOA 2ELZA 1WHNA 4O24A 1N3GA 5KL7A 2EN3A 4LF5E 4YKEA 1RQ0A 1A1GA 1WXRA 3FGAC 1NEIA 2YRKA 4DR2E 1JK2A 3VK6A 4FBKA 4ORBA 2EN7A 4ZYGA 2JOXA 4BC9A 2B3TB 4OX9E 2WDEA 3K6QA 2EPLX 1UTEA 1X47A 2EPMX 1S3NA 4J8ZA 1USHA 2LUQA 1BB8A 1DI2A 3D03A 1X5WA 2DSYA 1Z1BA 1PDAA 2EL5A 2JOBA 3IVDA 4GEQB 1YFHA 2EPKX 4JI8E 2V83A 2DRPA 4V0WA 2YSOA 4X9JA 2IE3C 2M4IA 1MEYC 3RQZA 3VYXA 2KONA 4RHBB 3J7Yp 2EOSA 3MHHC 1TN9A 2LRSA 2JYAA 3HQ1A 1T4OA 1IT6A 2UXDE 4GKKE 4B2OA 4ORCA 2EWLA 4KHPE 3J7AG 2DGCA 2EMIA 5JJTA 1F2IG 2WBTA 2NUEA 2O8GA 2EN2A 1YSAC 4F0ZA 1KJKA 1Z2WA 1ZR9A 2GJUA 3P71C 2V87A 3KZYA 1X3CA 4TUGA 1A1KA 5IOHA 1J5EE 3VYYA 1SU1A 4R2RA 4MP0A 2RS6A 5A2QC 4WSPA 5A6AA 4WXCA 4DV1E 3ECRA 2DXLA 2ZO9B 3H60A 2VQEE 2V89A 1V73A 1KBPA 4GKJE 2EQ0A 1BBOA 4YHHE
chains in the Genus database with same CATH topology
2VF1A 4B3RE 4KBPA 4BS9A 3H63A 4NZVA 3C5WC 3H62B 5FLXC 4LFBE 4AQYE 1ZBQA 3IWBA 1N32E 4O43A 3ADGA 3DW8C 1XMOE 3N5UA 2DMYA 3J81C 2YEQA 4TUIA 2UXBE 3J80C 1FKAE 1GQEA 1UF3A 4DV6E 4J6OA 4JI6E 4K0KE 2NA2A 4H2BA 2KOUA 2YT4A 2UUAE 2ZM6E 2E1MA 3K7VC 4F9CB 4IYPC 1N34E 4NXNE 1XMQE 3JAMC 3IWDA 2L3CA 1STUA 2M7QA 4L5NC 3C4BA 5DNYA 4LU9A 3HTXA 2LE2A 2UXCE 2NYLC 4KZSA 2L3JA 4X64E 3H67A 4BCAA 3FLOA 1JK7A 5ADZA 4OR9A 1IBME 2M1SA 1YZ9A 5C1VA 4JV5E 5LMNE 2FGGA 3QFKA 3F6HA 1S3MA 5LMUE 2IAEC 2WDCA 3F6GA 1W24A 4I5LC 3QFNA 3E7BA 4Q28A 3TGHA 2B9DA 2QFRA 1Z2XA 2L92A 4M30A 4DR3E 4LF6E 4DUYE 2Q8UA 3JYFA 3RL4A 2L2MA 2XMOA 1XZWA 3HVQA 3JU0A 1X49A 2EZ6A 2BDXA 3T1YE 3IB7A 1N36E 1RC7A 3H64A 2BCDA 4P78A 3H09A 1WAO1 2ZOAA 2JVAA 2WZOA 3LL8A 2E5LE 4WYQB 2AHDA 2JY9A 5AASA 3DSCA 2HYPA 2ODRC 4JYAE 3OMLA 2QJCA 3HXLA 1I94E 3T1IA 1X48A 2NYMC 1GZ6A 5JPEA 1U32A 4DV3E 2HHHE 2JOGA 2CPNA 2UU9E 5AE2A 2L2NA 3ZTVA 2Z72A 2UUCE 2P6BA 2NUGA 4KKZA 2V88A 2UUBE 3EGGA 2MC6A 4ZVZA 5IWAE 2LTRA 2QFPA 3HPZA 1HPUA 3E7AA 3ICFA 3THOB 2JR1A 4F54A 3ADJA 5LL6R 2FTXB 4FBWA 2K4VA 2F8BA 5HPEA 3V4YA 4X65E 4JI3E 2VE7C 1O0WA 2LMZA 2R17A 2RSMA 2LUPB 2KKNA 2USHA 4I5NC 3MSWA 4DR7E 2L8TA 5AE1A 3C4TA 1M63A 3AUZA 1XNQE 3THNA 3AV0A 3QFOA 4BMJA 4F9AB 4H2GA 2B7VA 1SR9A 4B3TE 1XNRE 3T1HE 2FV4B 2LBSB 2ZBMA 1WHQA 2L2KB 5T6JA 4DV4E 2Z06A 4DV7E 4JA9A 4DV5E 4DR1E 4M2ZA 4O5GA 2VQFE 3IWCA 4X66E 2G7HA 1IBLE 4JI4E 4UWQA 2WDDA 2Z1AA 4FCXA 4DV2E 4M0VA 1XM7A 4X62E 4JI5E 4JI7E 1G5BA 2BQ8X 4OOGC 2HYOA 4UT3A 2IHR1 3ZOQB 4LF4E 4DKKA 4UT2A 4JA7A 4NXME 4DUZE 3P1XA 3CK2A 3GVEA 1S70A 4XPNA 4O4KA 1HP1A 4R8OA 4G9JA 4WWLA 2JWOA 2ODRD 3ADLA 2DFJA 1T4LB 5CFFE 4LFAE 2O8AA 4F9BB 3RL3A 4B3SE 5J28A 4P7DA 3H66A 4DV0E 4LF8E 1T71A 4IL1A 4DHLA 5JPFA 2WDFA 1QU6A 1OI8A 1YYOA 4LFCE 4DMIA 3IVEA 2LJHA 4WPYA 4MOVA 3LLHA 4I8OA 4ORAA 4HD0A 1IBKE 1T70A 3K7WC 1OIEA 4JI1E 1HNXE 1NNWA 4H1SA 1S95A 3DJWA 2B7TA 3OTOE 4DR6E 3E0JA 4LACC 4UT3B 5GTUA 2F4VE 2LTSA 2A22A 2MC5A 4R03A 4FBQA 1EKZA 1QFCA 1PKPA 1DQ3A 4YY3E 2NXFA 5BR8E 3FIGA 2DIXA 1TCOA 3PSNA 2RTXA 3C9FA 1ZBTA 2N3HA 2V8QB 3DF6A 1S3LA 3HPSA 2YZTA 2MDRA 4X8WA 1HNWE 1AUIA 3KBPA 1UILA 4LTYA 4BC7A 2NUFA 3DSDA 2HY1A 5INBA 4B3ME 2N3GA 1II7A 4DSYA 2CV9A 3QFMA 5B8IA 3RL5A 4MOYA 4V0XA 3JTZA 1HO5A 1WARA 1YYKA 5F3WA 4WFTA 3QG5C 3H69A 3ADIA 2H36X 1N33E 3H61A 4LF7E 4L8NA 4Q7FA 3H68A 4V0VA 3RMPA 3LMLA 1FJGE 1UHZA 1MF8A 5AE3A 3EGHA 2L33A 1J26A 1T4NA 2IE4C 4DR5E 4DR4E 1OIDA 2RS7A 3IB8A 5EQVA 2DXNA 4BBYA 1HNZE 2V86A 2DB2A 2NPPC 1QHWA 4ZX2A 4JI2E 1YYWA 1FJMA 4H2IA 1HR0E 2L6MA 3ZU0A 4DT2A 3KWRA 1S8EA 2KHXA 5IT9C 2YVTA 4H1YP 4JI0E 2V85A 4LF9E 4H2FA 3PSOA 1WHNA 4O24A 4LF5E 4YKEA 1RQ0A 1WXRA 3FGAC 4DR2E 3VK6A 4FBKA 4ORBA 2JOXA 4BC9A 2B3TB 4OX9E 2WDEA 3K6QA 1UTEA 1X47A 1S3NA 1USHA 4J8ZA 2LUQA 1DI2A 3D03A 2DSYA 2JOBA 3IVDA 4GEQB 4JI8E 2V83A 4V0WA 2IE3C 2M4IA 3RQZA 3VYXA 2KONA 3J7Yp 2LRSA 3HQ1A 1T4OA 1IT6A 2UXDE 4GKKE 4B2OA 4ORCA 2EWLA 4KHPE 3J7AG 5JJTA 2NUEA 2O8GA 4F0ZA 1Z2WA 2GJUA 3P71C 2V87A 4TUGA 5IOHA 1J5EE 3VYYA 1SU1A 4MP0A 2RS6A 5A2QC 4WSPA 4DV1E 2DXLA 2ZO9B 3H60A 2VQEE 2V89A 1V73A 1KBPA 4GKJE 4YHHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGH A;  3RL3 A;  3ZTV A;  4KBP A;  2Z72 A;  2IE4 C;  5J28 A;  2P6B A;  3H63 A;  1KBP A;  3H66 A;  4NZV A;  3C5W C;  4KKZ A;  1OID A;  3H62 B;  1T71 A;  4IL1 A;  4DHL A;  3IB8 A;  3EGG A;  4ZVZ A;  5EQV A;  5JPF A;  4O43 A;  2QFP A;  2WDF A;  1OI8 A;  1QHW A;  1HPU A;  2NPP C;  3DW8 C;  3E7A A;  4ZX2 A;  3IVE A;  3N5U A;  1FJM A;  4MOV A;  3ICF A;  4H2I A;  4TUI A;  3THO B;  4ORA A;  3ZU0 A;  1UF3 A;  4FBW A;  4HD0 A;  4J6O A;  3V4Y A;  4DT2 A;  5HPE A;  1S8E A;  1T70 A;  3K7W C;  1OIE A;  4H2B A;  2R17 A;  3K7V C;  2YVT A;  4H1Y P;  4IYP C;  2KKN A;  1NNW A;  2USH A;  4H1S A;  1S95 A;  4I5N C;  4H2F A;  3PSO A;  5DNY A;  4O24 A;  4LAC C;  4UT3 B;  3AUZ A;  1M63 A;  2NYL C;  4LU9 A;  4YKE A;  5GTU A;  3AV0 A;  3THN A;  2A22 A;  4FBQ A;  3FGA C;  3H67 A;  1QFC A;  3QFO A;  1JK7 A;  4H2G A;  2NXF A;  4FBK A;  4ORB A;  4OR9 A;  5C1V A;  1TCO A;  3PSN A;  2ZBM A;  3QFK A;  2WDE A;  1UTE A;  3C9F A;  1S3N A;  1USH A;  1S3M A;  2IAE C;  1S3L A;  2WDC A;  2Z06 A;  1W24 A;  4JA9 A;  4I5L C;  3QFN A;  4O5G A;  3E7B A;  1AUI A;  3KBP A;  3IVD A;  4LTY A;  4V0W A;  4UWQ A;  2IE3 C;  2WDD A;  2QFR A;  2Z1A A;  2HY1 A;  3TGH A;  1Z2X A;  3DSD A;  3RQZ A;  5INB A;  1II7 A;  1IT6 A;  2Q8U A;  4DSY A;  2CV9 A;  4FCX A;  3JYF A;  3RL4 A;  4B2O A;  2XMO A;  3QFM A;  1XZW A;  1XM7 A;  3HVQ A;  4M0V A;  4ORC A;  5B8I A;  2BDX A;  5JJT A;  1G5B A;  2BQ8 X;  2HYO A;  2O8G A;  3IB7 A;  4UT3 A;  4F0Z A;  3H64 A;  1Z2W A;  2BCD A;  4MOY A;  3RL5 A;  2GJU A;  3P71 C;  4V0X A;  1HO5 A;  1WAO 1;  1WAR A;  5F3W A;  3LL8 A;  4TUG A;  5IOH A;  2AHD A;  4UT2 A;  4JA7 A;  3DSC A;  1SU1 A;  2HYP A;  4MP0 A;  3QG5 C;  3H69 A;  2QJC A;  3CK2 A;  3GVE A;  1S70 A;  4XPN A;  4O4K A;  1HP1 A;  2NYM C;  3H61 A;  4Q7F A;  3T1I A;  5JPE A;  3H68 A;  4V0V A;  3H60 A;  1U32 A;  4G9J A;  1V73 A;  2JOG A;  4WWL A;  2DFJ A;  1MF8 A;  2O8A A; 
#chains in the Genus database with same CATH topology
 2VF1 A;  4B3R E;  4BHB A;  4KBP A;  4BS9 A;  2YTI A;  2N8X A;  4NZV A;  3C6K A;  3H63 A;  4R2S A;  3C5W C;  3H62 B;  5FLX C;  5A6K A;  2EOH A;  4LFB E;  4AQY E;  1ZBQ A;  2MDG A;  3IWB A;  4O43 A;  1N32 E;  3ADG A;  2ENH A;  1A1L A;  3DW8 C;  4NHR A;  1MGT A;  1XMO E;  3N5U A;  2DMY A;  3J81 C;  2YEQ A;  2DLK A;  5KL6 A;  4TUI A;  2UXB E;  3J80 C;  3UK3 C;  1FKA E;  1EH8 A;  1GQE A;  2YTF A;  1UF3 A;  2EOQ A;  4DV6 E;  2EM7 A;  4J6O A;  4HTG A;  2EMX A;  2EMW A;  4JI6 E;  4K0K E;  1YUJ A;  2NA2 A;  4H2B A;  2KOU A;  2EPP A;  2YT4 A;  2UUA E;  2ZM6 E;  2E1M A;  3K7V C;  4F9C B;  1A1H A;  4IYP C;  2EMC A;  2JXP A;  1N34 E;  4NXN E;  1XMQ E;  2YU5 A;  4MLV A;  2EMB A;  3JAM C;  3IWD A;  2L3C A;  1STU A;  2M7Q A;  4L5N C;  3C4B A;  5A69 A;  5DNY A;  2EOI A;  2MKD A;  4LU9 A;  2LE2 A;  3HTX A;  2UXC E;  5KL5 A;  2NYL C;  4KZS A;  1G2D C;  2EMY A;  2L3J A;  4X64 E;  3H67 A;  4BCA A;  3FLO A;  1TF3 A;  1JK7 A;  2GHF A;  2EM3 A;  3L00 A;  5ADZ A;  4OR9 A;  1IBM E;  2M1S A;  1YZ9 A;  5C1V A;  1YUI A;  3TQM A;  4JV5 E;  5LMN E;  2FGG A;  2GPI A;  3QFK A;  3F6H A;  5KL4 A;  1S3M A;  5LMU E;  2IAE C;  2WDC A;  3F6G A;  4KWY A;  1W24 A;  4I5L C;  3QFN A;  3E7B A;  3BF2 A;  3M99 B;  4Q28 A;  2B9D A;  2YU8 A;  4GZN C;  2QFR A;  3TGH A;  1Z2X A;  2L92 A;  2YTG A;  4M30 A;  4DR3 E;  2GLI A;  1LLM C;  4LF6 E;  2EM8 A;  1NCS A;  2RQL A;  4DUY E;  2Q8U A;  2EOR A;  2CT1 A;  3JYF A;  2L2M A;  3RL4 A;  2XMO A;  1XZW A;  3HVQ A;  2EOX A;  1X49 A;  3JU0 A;  2EZ6 A;  2BDX A;  3T1Y E;  4Q35 B;  2EN1 A;  1AAY A;  3IB7 A;  1N36 E;  1RC7 A;  3H64 A;  2BCD A;  3BBG A;  4P78 A;  3EPK A;  3H09 A;  1WAO 1;  2DMI A;  4M9V C;  2ZOA A;  4WX9 A;  2JVA A;  2WZO A;  1X6F A;  3LL8 A;  2VRD A;  3C6M A;  2E5L E;  4WYQ B;  2AHD A;  2YPN A;  2JY9 A;  5AAS A;  3DSC A;  2HYP A;  2ODR C;  4JYA E;  3OML A;  2QJC A;  3HXL A;  2J7J A;  1I94 E;  2M9A A;  2YSP A;  2YWQ A;  3T1I A;  5KL2 A;  1X48 A;  2NYM C;  1GZ6 A;  5JPE A;  1GTK A;  2EMZ A;  2ENC A;  1U32 A;  4DV3 E;  4R2C A;  2HHH E;  2RPC A;  2JOG A;  2CPN A;  2UU9 E;  1UN6 B;  5AE2 A;  2L2N A;  2ADR A;  2HJJ A;  3ZTV A;  2Z72 A;  2UUC E;  2P6B A;  2NUG A;  2A25 A;  4KKZ A;  2V88 A;  3KZZ A;  2UUB E;  3EGG A;  2MC6 A;  4ZVZ A;  5IWA E;  2LTR A;  2QFP A;  4R2A A;  2EM5 A;  3HPZ A;  1L4S A;  1HPU A;  3E7A A;  2K7I A;  1G2F C;  4R2P A;  3ICF A;  3THO B;  2JR1 A;  2YTD A;  3ADJ A;  5LL6 R;  4F54 A;  2FTX B;  4FBW A;  2K4V A;  2F8B A;  5HPE A;  3V4Y A;  2EOJ A;  4X65 E;  4JI3 E;  3EPH A;  2VE7 C;  1O0W A;  2LMZ A;  3VHT B;  2CSH A;  2R17 A;  2RSM A;  2LUP B;  2KKN A;  2USH A;  4I5N C;  3MSW A;  4DR7 E;  2L8T A;  5AE1 A;  3C4T A;  3AUZ A;  3THN A;  1XNQ E;  1M63 A;  3AV0 A;  4WXD A;  2EPC A;  3QFO A;  1X6H A;  4BMJ A;  4F9A B;  4F2J C;  4H2G A;  2B7V A;  1T38 A;  2EPR A;  1SR9 A;  4B3T E;  1WRJ A;  1XNR E;  3T1H E;  2FV4 B;  2LBS B;  2ZBM A;  1WHQ A;  2L2K B;  5T6J A;  4DV4 E;  2EOY A;  4ZYD A;  2Z06 A;  5AC4 A;  4DV7 E;  4JA9 A;  4DV5 E;  4WSG A;  2NAB A;  4DR1 E;  1QNT A;  4M2Z A;  4O5G A;  2VQF E;  3IWC A;  2BBG A;  2EPO A;  4X66 E;  2G7H A;  1IBL E;  4JI4 E;  4UWQ A;  2WDD A;  3EPJ A;  2Z1A A;  1DGC A;  1IMU A;  4FCX A;  4DV2 E;  1RMD A;  1EH7 A;  2EPU A;  4M0V A;  1XM7 A;  1ZAA C;  4X62 E;  4JI5 E;  2EPN A;  4JI7 E;  1G5B A;  2BQ8 X;  4OOG C;  2HYO A;  4UT3 A;  2EN4 A;  2EN6 A;  2LVH A;  5KL3 A;  2WBS A;  4IJD A;  2CTD A;  2IHR 1;  3MHS C;  3ZOQ B;  2EP3 A;  4LF4 E;  4DKK A;  4UT2 A;  4R2E A;  4JA7 A;  4NXM E;  4DUZ E;  2EPA A;  1PJQ A;  3P1X A;  4F6M A;  3CK2 A;  3GVE A;  1KYQ A;  1S70 A;  4XPN A;  4O4K A;  5LLQ A;  5A6J A;  1HP1 A;  4R8O A;  2ELY A;  4G9J A;  4WWL A;  2JWO A;  2LJU A;  2ODR D;  5A6B D;  3ADL A;  1T4L B;  2DFJ A;  5CFF E;  2EMA A;  2EL6 A;  4LFA E;  2O8A A;  4F9B B;  2EJ4 A;  4B3S E;  3RL3 A;  1A1J A;  5J28 A;  4P7D A;  2YRH A;  3H66 A;  4DV0 E;  4LF8 E;  1T71 A;  4IL1 A;  4DHL A;  2BB8 A;  1BBG A;  5JPF A;  2WDF A;  2JPA A;  1QU6 A;  1OI8 A;  1YYO A;  4LFC E;  4DMI A;  3IVE A;  1WJP A;  2LJH A;  4WPY A;  4MOV A;  3LLH A;  2HGH A;  4I8O A;  1PJT A;  2EML A;  4ORA A;  1A1F A;  4HD0 A;  5AC5 A;  1IBK E;  1T70 A;  3K7W C;  1OIE A;  1JK1 A;  5IV8 B;  1IQO A;  4JI1 E;  2EMK A;  4F6N A;  1HNX E;  1NNW A;  4H1S A;  2EM9 A;  1S95 A;  3DJW A;  2B7T A;  3OTO E;  2R76 A;  4DR6 E;  3E0J A;  1P47 A;  4LAC C;  4UT3 B;  5GTU A;  2EM4 A;  2LTS A;  2F4V E;  2A22 A;  2MC5 A;  4R03 A;  4FBQ A;  1EKZ A;  5TSE A;  1DQ3 A;  1PKP A;  1QFC A;  4YY3 E;  2NXF A;  1ZU1 A;  5BR8 E;  1TF6 A;  3FIG A;  2RSI A;  2DIX A;  2DLQ A;  1SFE A;  1TCO A;  3PSN A;  2JP9 A;  2RTX A;  3C9F A;  1ZBT A;  2N3H A;  2V8Q B;  3DF6 A;  1S3L A;  3EPL A;  3HPS A;  2YZT A;  2MDR A;  2EE8 A;  4X8W A;  1HNW E;  1AUI A;  3KBP A;  2EOM A;  2HC5 A;  3BGH A;  1UIL A;  4LTY A;  4BC7 A;  2NUF A;  2EOZ A;  3DSD A;  4MLQ A;  2HY1 A;  2EOO A;  1X6E A;  5INB A;  4B3M E;  2I9I A;  2ENA A;  2N3G A;  2YTO A;  4FK5 C;  1II7 A;  4DSY A;  4R2D A;  2CV9 A;  4RH8 A;  3QFM A;  2YTJ A;  1UBD C;  5B8I A;  1PJS A;  2R1F A;  2EPX A;  5IXM B;  3RL5 A;  4MOY A;  1A1I A;  4V0X A;  3JTZ A;  2EM6 A;  1HO5 A;  1WAR A;  1YYK A;  2EMG A;  5F3W A;  4WFT A;  4ZYH A;  3BID A;  2YTQ A;  2EL4 A;  2YTN A;  3QG5 C;  2YTP A;  3H69 A;  3ADI A;  2EQ1 A;  4ZYE A;  2H36 X;  1N33 E;  4IS1 C;  4LF7 E;  4L8N A;  4HEI A;  3H61 A;  1B69 A;  3H68 A;  1IQS A;  4Q7F A;  3RMP A;  2LT7 A;  4V0V A;  3LML A;  2D9H A;  1FJG E;  1UHZ A;  1MF8 A;  2EMH A;  5AE3 A;  2EM2 A;  3EGH A;  2L33 A;  1J26 A;  1T4N A;  2EM0 A;  2IE4 C;  2LV2 A;  4DR5 E;  4DR4 E;  1OID A;  2EN8 A;  4R2Q A;  2EQ3 A;  2RS7 A;  2WCC 3;  3IB8 A;  2WBU A;  1T39 A;  5EQV A;  2I13 A;  1AH5 A;  5A6B A;  2DXN A;  1YPN A;  4N4R B;  4BBY A;  1HNZ E;  2V86 A;  2DB2 A;  2EMF A;  1QHW A;  2NPP C;  4ZX2 A;  4JI2 E;  1YYW A;  1FJM A;  4H2I A;  2YTE A;  4BHC A;  1HR0 E;  2L6M A;  3EQ1 A;  3ZU0 A;  2EOE A;  2PRT A;  2E72 A;  4DT2 A;  2YRM A;  3KWR A;  2LO3 A;  1S8E A;  2MKN A;  1EH6 A;  2KHX A;  5IT9 C;  2YVT A;  4H1Y P;  4JI0 E;  2EPZ A;  2V85 A;  2EOF A;  2LCE A;  4LF9 E;  4H2F A;  3PSO A;  2ELZ A;  1WHN A;  4O24 A;  1N3G A;  5KL7 A;  2EN3 A;  4LF5 E;  4YKE A;  1RQ0 A;  1A1G A;  1WXR A;  3FGA C;  1NEI A;  2YRK A;  4DR2 E;  1JK2 A;  3VK6 A;  4FBK A;  4ORB A;  2EN7 A;  4ZYG A;  2JOX A;  4BC9 A;  2B3T B;  4OX9 E;  2WDE A;  3K6Q A;  2EPL X;  1UTE A;  1X47 A;  2EPM X;  1S3N A;  4J8Z A;  1USH A;  2LUQ A;  1BB8 A;  1DI2 A;  3D03 A;  1X5W A;  2DSY A;  1Z1B A;  1PDA A;  2EL5 A;  2JOB A;  3IVD A;  4GEQ B;  1YFH A;  2EPK X;  4JI8 E;  2V83 A;  2DRP A;  4V0W A;  2YSO A;  4X9J A;  2IE3 C;  2M4I A;  1MEY C;  3RQZ A;  3VYX A;  2KON A;  4RHB B;  3J7Y p;  2EOS A;  3MHH C;  1TN9 A;  2LRS A;  2JYA A;  3HQ1 A;  1T4O A;  1IT6 A;  2UXD E;  4GKK E;  4B2O A;  4ORC A;  2EWL A;  4KHP E;  3J7A G;  2DGC A;  2EMI A;  5JJT A;  1F2I G;  2WBT A;  2NUE A;  2O8G A;  2EN2 A;  1YSA C;  4F0Z A;  1KJK A;  1Z2W A;  1ZR9 A;  2GJU A;  3P71 C;  2V87 A;  3KZY A;  1X3C A;  4TUG A;  1A1K A;  5IOH A;  1J5E E;  3VYY A;  1SU1 A;  4R2R A;  4MP0 A;  2RS6 A;  5A2Q C;  4WSP A;  5A6A A;  4WXC A;  4DV1 E;  3ECR A;  2DXL A;  2ZO9 B;  3H60 A;  2VQE E;  2V89 A;  1V73 A;  1KBP A;  4GKJ E;  2EQ0 A;  1BBO A;  4YHH E; 
#chains in the Genus database with same CATH homology
 2VF1 A;  4B3R E;  4KBP A;  4BS9 A;  3H63 A;  4NZV A;  3C5W C;  3H62 B;  5FLX C;  4LFB E;  4AQY E;  1ZBQ A;  3IWB A;  1N32 E;  4O43 A;  3ADG A;  3DW8 C;  1XMO E;  3N5U A;  2DMY A;  3J81 C;  2YEQ A;  4TUI A;  2UXB E;  3J80 C;  1FKA E;  1GQE A;  1UF3 A;  4DV6 E;  4J6O A;  4JI6 E;  4K0K E;  2NA2 A;  4H2B A;  2KOU A;  2YT4 A;  2UUA E;  2ZM6 E;  2E1M A;  3K7V C;  4F9C B;  4IYP C;  1N34 E;  4NXN E;  1XMQ E;  3JAM C;  3IWD A;  2L3C A;  1STU A;  2M7Q A;  4L5N C;  3C4B A;  5DNY A;  4LU9 A;  3HTX A;  2LE2 A;  2UXC E;  2NYL C;  4KZS A;  2L3J A;  4X64 E;  3H67 A;  4BCA A;  3FLO A;  1JK7 A;  5ADZ A;  4OR9 A;  1IBM E;  2M1S A;  1YZ9 A;  5C1V A;  4JV5 E;  5LMN E;  2FGG A;  3QFK A;  3F6H A;  1S3M A;  5LMU E;  2IAE C;  2WDC A;  3F6G A;  1W24 A;  4I5L C;  3QFN A;  3E7B A;  4Q28 A;  3TGH A;  2B9D A;  2QFR A;  1Z2X A;  2L92 A;  4M30 A;  4DR3 E;  4LF6 E;  4DUY E;  2Q8U A;  3JYF A;  3RL4 A;  2L2M A;  2XMO A;  1XZW A;  3HVQ A;  3JU0 A;  1X49 A;  2EZ6 A;  2BDX A;  3T1Y E;  3IB7 A;  1N36 E;  1RC7 A;  3H64 A;  2BCD A;  4P78 A;  3H09 A;  1WAO 1;  2ZOA A;  2JVA A;  2WZO A;  3LL8 A;  2E5L E;  4WYQ B;  2AHD A;  2JY9 A;  5AAS A;  3DSC A;  2HYP A;  2ODR C;  4JYA E;  3OML A;  2QJC A;  3HXL A;  1I94 E;  3T1I A;  1X48 A;  2NYM C;  1GZ6 A;  5JPE A;  1U32 A;  4DV3 E;  2HHH E;  2JOG A;  2CPN A;  2UU9 E;  5AE2 A;  2L2N A;  3ZTV A;  2Z72 A;  2UUC E;  2P6B A;  2NUG A;  4KKZ A;  2V88 A;  2UUB E;  3EGG A;  2MC6 A;  4ZVZ A;  5IWA E;  2LTR A;  2QFP A;  3HPZ A;  1HPU A;  3E7A A;  3ICF A;  3THO B;  2JR1 A;  4F54 A;  3ADJ A;  5LL6 R;  2FTX B;  4FBW A;  2K4V A;  2F8B A;  5HPE A;  3V4Y A;  4X65 E;  4JI3 E;  2VE7 C;  1O0W A;  2LMZ A;  2R17 A;  2RSM A;  2LUP B;  2KKN A;  2USH A;  4I5N C;  3MSW A;  4DR7 E;  2L8T A;  5AE1 A;  3C4T A;  1M63 A;  3AUZ A;  1XNQ E;  3THN A;  3AV0 A;  3QFO A;  4BMJ A;  4F9A B;  4H2G A;  2B7V A;  1SR9 A;  4B3T E;  1XNR E;  3T1H E;  2FV4 B;  2LBS B;  2ZBM A;  1WHQ A;  2L2K B;  5T6J A;  4DV4 E;  2Z06 A;  4DV7 E;  4JA9 A;  4DV5 E;  4DR1 E;  4M2Z A;  4O5G A;  2VQF E;  3IWC A;  4X66 E;  2G7H A;  1IBL E;  4JI4 E;  4UWQ A;  2WDD A;  2Z1A A;  4FCX A;  4DV2 E;  4M0V A;  1XM7 A;  4X62 E;  4JI5 E;  4JI7 E;  1G5B A;  2BQ8 X;  4OOG C;  2HYO A;  4UT3 A;  2IHR 1;  3ZOQ B;  4LF4 E;  4DKK A;  4UT2 A;  4JA7 A;  4NXM E;  4DUZ E;  3P1X A;  3CK2 A;  3GVE A;  1S70 A;  4XPN A;  4O4K A;  1HP1 A;  4R8O A;  4G9J A;  4WWL A;  2JWO A;  2ODR D;  3ADL A;  2DFJ A;  1T4L B;  5CFF E;  4LFA E;  2O8A A;  4F9B B;  3RL3 A;  4B3S E;  5J28 A;  4P7D A;  3H66 A;  4DV0 E;  4LF8 E;  1T71 A;  4IL1 A;  4DHL A;  5JPF A;  2WDF A;  1QU6 A;  1OI8 A;  1YYO A;  4LFC E;  4DMI A;  3IVE A;  2LJH A;  4WPY A;  4MOV A;  3LLH A;  4I8O A;  4ORA A;  4HD0 A;  1IBK E;  1T70 A;  3K7W C;  1OIE A;  4JI1 E;  1HNX E;  1NNW A;  4H1S A;  1S95 A;  3DJW A;  2B7T A;  3OTO E;  4DR6 E;  3E0J A;  4LAC C;  4UT3 B;  5GTU A;  2F4V E;  2LTS A;  2A22 A;  2MC5 A;  4R03 A;  4FBQ A;  1EKZ A;  1QFC A;  1PKP A;  1DQ3 A;  4YY3 E;  2NXF A;  5BR8 E;  3FIG A;  2DIX A;  1TCO A;  3PSN A;  2RTX A;  3C9F A;  1ZBT A;  2N3H A;  2V8Q B;  3DF6 A;  1S3L A;  3HPS A;  2YZT A;  2MDR A;  4X8W A;  1HNW E;  1AUI A;  3KBP A;  1UIL A;  4LTY A;  4BC7 A;  2NUF A;  3DSD A;  2HY1 A;  5INB A;  4B3M E;  2N3G A;  1II7 A;  4DSY A;  2CV9 A;  3QFM A;  5B8I A;  3RL5 A;  4MOY A;  4V0X A;  3JTZ A;  1HO5 A;  1WAR A;  1YYK A;  5F3W A;  4WFT A;  3QG5 C;  3H69 A;  3ADI A;  2H36 X;  1N33 E;  3H61 A;  4LF7 E;  4L8N A;  4Q7F A;  3H68 A;  4V0V A;  3RMP A;  3LML A;  1FJG E;  1UHZ A;  1MF8 A;  5AE3 A;  3EGH A;  2L33 A;  1J26 A;  1T4N A;  2IE4 C;  4DR5 E;  4DR4 E;  1OID A;  2RS7 A;  3IB8 A;  5EQV A;  2DXN A;  4BBY A;  1HNZ E;  2V86 A;  2DB2 A;  2NPP C;  1QHW A;  4ZX2 A;  4JI2 E;  1YYW A;  1FJM A;  4H2I A;  1HR0 E;  2L6M A;  3ZU0 A;  4DT2 A;  3KWR A;  1S8E A;  2KHX A;  5IT9 C;  2YVT A;  4H1Y P;  4JI0 E;  2V85 A;  4LF9 E;  4H2F A;  3PSO A;  1WHN A;  4O24 A;  4LF5 E;  4YKE A;  1RQ0 A;  1WXR A;  3FGA C;  4DR2 E;  3VK6 A;  4FBK A;  4ORB A;  2JOX A;  4BC9 A;  2B3T B;  4OX9 E;  2WDE A;  3K6Q A;  1UTE A;  1X47 A;  1S3N A;  1USH A;  4J8Z A;  2LUQ A;  1DI2 A;  3D03 A;  2DSY A;  2JOB A;  3IVD A;  4GEQ B;  4JI8 E;  2V83 A;  4V0W A;  2IE3 C;  2M4I A;  3RQZ A;  3VYX A;  2KON A;  3J7Y p;  2LRS A;  3HQ1 A;  1T4O A;  1IT6 A;  2UXD E;  4GKK E;  4B2O A;  4ORC A;  2EWL A;  4KHP E;  3J7A G;  5JJT A;  2NUE A;  2O8G A;  4F0Z A;  1Z2W A;  2GJU A;  3P71 C;  2V87 A;  4TUG A;  5IOH A;  1J5E E;  3VYY A;  1SU1 A;  4MP0 A;  2RS6 A;  5A2Q C;  4WSP A;  4DV1 E;  2DXL A;  2ZO9 B;  3H60 A;  2VQE E;  2V89 A;  1V73 A;  1KBP A;  4GKJ E;  4YHH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...