3C9FA

Crystal structure of 5'-nucleotidase from candida albicans sc5314
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
546
structure length
531
Chain Sequence
SFPHRNLTWNDINFVHTTDTHGWYSGHINQPLYHANWGDFISFTTHMRRIAHSRNQDLLLIDSGDRHDGNGLSDITSPNGLKSTPIFIKQDYDLLTIGNHELYLWENSKQEYETVVNHFQDKYVCSNVDIRLDNGLFVPLGLKYKYFTTPIRGIRVMAFGFLFDFKRFNSGTRVTPMAETIHEPWFQEALKHEVDLIIIVGHTPISHNWGEFYQVHQYLRQFFPDTIIQYFGGHSHIRDFTVFDSLSTGLQSGRYCETVGWTSVNLDKADLNLPVRQRFSRSYIDFNTDSFKYHTNLDKEFDTAKGKLVSKLIRETRKELKLDTLIGYVKTNYYVDYVPIDHPKSIFNLLALKILKTLPKSKHEERITIINTGSIRYDLYKGPYTIDSKFIVSPFENIWVNITVPKSVATKVAAKLNDYISASRLKPPHQYDLQVQQEKLPKGYVTHDDFGADGDDTLHRAVVNFPVPNVIQSVEINDEVDSPVNLVFYSFITPNIIWALKELNFSTEQVPTPYSDIYLGTLLNEFVANNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of 5'-nucleotidase from Candida albicans.
rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords 5'-nucleotidase
total genus 185
structure length 531
sequence length 546
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3c9fA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 3c9fA02
1S3NA 3RL5A 1NNWA 3RL3A 4MP0A 2WDEA 4UT2A 1AUIA 2QJCA 1QFCA 3H63A 3IVEA 1T70A 5JJTA 4ORCA 4Q7FA 2NPPC 4V0XA 3E7BA 4F0ZA 2NYMC 3AV0A 1FJMA 1HP1A 1G5BA 3HVQA 3DW8C 4G9JA 4FBKA 4H2IA 4LTYA 3QFKA 3PSOA 3QFNA 4NZVA 1HO5A 4H2FA 4H2BA 2KKNA 1OI8A 3ZTVA 1UTEA 3DSCA 1T71A 1S3LA 4H1SA 1KBPA 2Q8UA 4IL1A 4KBPA 5F3WA 1QHWA 3CK2A 3EGHA 3IB8A 4DSYA 2O8AA 3E7AA 4V0WA 4O43A 2Z72A 2DFJA 3N5UA 4FBQA 4FBWA 4MOYA 4O5GA 5J28A 4ZVZA 4HD0A 2HYOA 5EQVA 4DT2A 5HPEA 2YVTA 3TGHA 3H64A 3GVEA 3QFMA 1S8EA 2XMOA 4OR9A 4I5LC 4V0VA 2IAEC 3H68A 2CV9A 3H62B 4LACC 1SU1A 2HY1A 4JA9A 2GJUA 4H2GA 4YKEA 1OIEA 3KBPA 3THNA 3IVDA 1U32A 2JOGA 4UT3A 5INBA 2AHDA 3C9FA 3QG5C 4H1YP 3H66A 2USHA 2NXFA 3H67A 1XM7A 5B8IA 3JYFA 4ORBA 3RQZA 3ZU0A 2BQ8X 2NYLC 3H61A 4ZX2A 2BCDA 2P6BA 4TUIA 1II7A 1WARA 2A22A 2IE4C 3K7WC 2HYPA 2IE3C 4IYPC 5DNYA 4M0VA 4B2OA 4KKZA 3K7VC 4UT3B 2BDXA 4FCXA 3EGGA 3DSDA 3IB7A 1HPUA 3QFOA 3AUZA 3RL4A 1M63A 1TCOA 2O8GA 4LU9A 4O4KA 4J6OA 1UF3A 1W24A 3PSNA 5C1VA 3V4YA 4XPNA 3LL8A 1XZWA 5GTUA 1JK7A 1MF8A 1USHA 3H69A 2Z1AA 3P71C 3T1IA 5JPFA 2ZBMA 2QFRA 1S95A 1Z2XA 1V73A 2Z06A 3FGAC 1IT6A 4I5NC 4O24A 2WDDA 4DHLA 4UWQA 2QFPA 2WDFA 4ORAA 4TUGA 2WDCA 2R17A 1Z2WA 1WAO1 3ICFA 5IOHA 3THOB 5JPEA 1OIDA 4JA7A 1S3MA 1S70A 4WWLA 3C5WC 4MOVA 3H60A
chains in the Genus database with same CATH superfamily
1S3NA 3RL5A 1NNWA 3RL3A 4MP0A 2WDEA 4UT2A 1AUIA 2QJCA 1QFCA 3H63A 3IVEA 1T70A 5JJTA 4ORCA 3E0JA 4Q7FA 2NPPC 4V0XA 3E7BA 4F0ZA 2NYMC 3AV0A 1FJMA 1HP1A 1G5BA 3HVQA 3DW8C 4G9JA 4FBKA 4H2IA 4LTYA 3QFKA 3PSOA 3QFNA 3D03A 4NZVA 1HO5A 4H2FA 4H2BA 2KKNA 1OI8A 2YEQA 3ZTVA 1UTEA 3DSCA 1T71A 1S3LA 4H1SA 1KBPA 2Q8UA 4IL1A 4KBPA 5F3WA 1QHWA 3CK2A 3EGHA 3IB8A 4DSYA 2O8AA 3E7AA 4V0WA 4O43A 2Z72A 2DFJA 3N5UA 4FBQA 4FBWA 4MOYA 4O5GA 5J28A 4ZVZA 4HD0A 2HYOA 5EQVA 4DT2A 5HPEA 2YVTA 3TGHA 3H64A 3GVEA 3QFMA 2DXLA 1S8EA 2XMOA 2ZO9B 4OR9A 4I5LC 4V0VA 2IAEC 3H68A 2CV9A 3H62B 4LACC 1SU1A 2HY1A 4JA9A 2GJUA 4H2GA 4YKEA 1OIEA 3KBPA 3THNA 3IVDA 1U32A 2JOGA 4UT3A 5INBA 2AHDA 3C9FA 3QG5C 4H1YP 3H66A 2USHA 2NXFA 3H67A 1XM7A 5B8IA 3JYFA 4ORBA 3RQZA 3ZU0A 2BQ8X 2NYLC 3C5WC 3H61A 4ZX2A 2BCDA 2P6BA 4TUIA 1II7A 1WARA 2IE4C 3K7WC 2HYPA 2IE3C 4IYPC 5DNYA 4M0VA 4B2OA 4KKZA 3K7VC 4UT3B 2BDXA 4FCXA 3EGGA 3DSDA 3IB7A 1HPUA 3QFOA 3AUZA 3FLOA 3RL4A 1M63A 1TCOA 2O8GA 4LU9A 4O4KA 4J6OA 1UF3A 1W24A 3PSNA 5C1VA 3V4YA 4XPNA 3LL8A 1XZWA 5GTUA 2DXNA 1JK7A 1MF8A 1USHA 3H69A 2Z1AA 3P71C 3T1IA 5JPFA 2ZBMA 2QFRA 1S95A 1Z2XA 1V73A 2Z06A 3FGAC 1IT6A 4I5NC 4O24A 2WDDA 4DHLA 4UWQA 2QFPA 2WDFA 4ORAA 4TUGA 2WDCA 2R17A 1Z2WA 1WAO1 3ICFA 5IOHA 3THOB 5JPEA 1OIDA 4JA7A 1S3MA 1S70A 2ZOAA 4WWLA 2A22A 4MOVA 3H60A
chains in the Genus database with same CATH topology
1S3NA 3RL5A 1NNWA 3RL3A 4MP0A 2WDEA 4UT2A 1AUIA 2QJCA 1QFCA 3H63A 3IVEA 1T70A 5JJTA 4ORCA 3E0JA 4Q7FA 2NPPC 4V0XA 3E7BA 4F0ZA 2NYMC 3AV0A 1FJMA 1HP1A 1G5BA 3HVQA 3DW8C 4G9JA 4FBKA 4H2IA 4LTYA 3QFKA 3PSOA 3QFNA 3D03A 4NZVA 1HO5A 4H2FA 4H2BA 2KKNA 1OI8A 2YEQA 3ZTVA 1UTEA 3DSCA 1T71A 1S3LA 4H1SA 1KBPA 2Q8UA 4IL1A 4KBPA 5F3WA 1QHWA 3CK2A 3EGHA 3IB8A 4DSYA 2O8AA 3E7AA 4V0WA 4O43A 2Z72A 2DFJA 3N5UA 4FBQA 4FBWA 4MOYA 4O5GA 5J28A 4ZVZA 4HD0A 2HYOA 5EQVA 4DT2A 5HPEA 2YVTA 3TGHA 3H64A 3GVEA 3QFMA 2DXLA 1S8EA 2XMOA 2ZO9B 4OR9A 4I5LC 4V0VA 2IAEC 3H68A 2CV9A 3H62B 4LACC 1SU1A 2HY1A 4JA9A 2GJUA 4H2GA 4YKEA 1OIEA 3KBPA 3THNA 3IVDA 1U32A 2JOGA 4UT3A 5INBA 2AHDA 3C9FA 3QG5C 4H1YP 3H66A 2USHA 2NXFA 3H67A 1XM7A 5B8IA 3JYFA 4ORBA 3RQZA 3ZU0A 2BQ8X 2NYLC 3C5WC 3H61A 4ZX2A 2BCDA 2P6BA 4TUIA 1II7A 1WARA 2IE4C 3K7WC 2HYPA 2IE3C 4IYPC 5DNYA 4M0VA 4B2OA 4KKZA 3K7VC 4UT3B 2BDXA 4FCXA 3EGGA 3DSDA 3IB7A 1HPUA 3QFOA 3AUZA 3FLOA 3RL4A 1M63A 1TCOA 2O8GA 4LU9A 4O4KA 4J6OA 1UF3A 1W24A 3PSNA 5C1VA 3V4YA 4XPNA 3LL8A 1XZWA 5GTUA 2DXNA 1JK7A 1MF8A 1USHA 3H69A 2Z1AA 3P71C 3T1IA 5JPFA 2ZBMA 2QFRA 1S95A 1Z2XA 1V73A 2Z06A 3FGAC 1IT6A 4I5NC 4O24A 2WDDA 4DHLA 4UWQA 2QFPA 2WDFA 4ORAA 4TUGA 2WDCA 2R17A 1Z2WA 1WAO1 3ICFA 5IOHA 3THOB 5JPEA 1OIDA 4JA7A 1S3MA 1S70A 2ZOAA 4WWLA 2A22A 4MOVA 3H60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3N A;  3RL5 A;  1NNW A;  3RL3 A;  4MP0 A;  2WDE A;  4UT2 A;  1AUI A;  2QJC A;  1QFC A;  3H63 A;  3IVE A;  1T70 A;  5JJT A;  4ORC A;  4Q7F A;  2NPP C;  4V0X A;  3E7B A;  4F0Z A;  2NYM C;  3AV0 A;  1FJM A;  1HP1 A;  1G5B A;  3HVQ A;  3DW8 C;  4G9J A;  4FBK A;  4H2I A;  4LTY A;  3QFK A;  3PSO A;  3QFN A;  4NZV A;  1HO5 A;  4H2F A;  4H2B A;  2KKN A;  1OI8 A;  3ZTV A;  1UTE A;  3DSC A;  1T71 A;  1S3L A;  4H1S A;  1KBP A;  2Q8U A;  4IL1 A;  4KBP A;  5F3W A;  1QHW A;  3CK2 A;  3EGH A;  3IB8 A;  4DSY A;  2O8A A;  3E7A A;  4V0W A;  4O43 A;  2Z72 A;  2DFJ A;  3N5U A;  4FBQ A;  4FBW A;  4MOY A;  4O5G A;  5J28 A;  4ZVZ A;  4HD0 A;  2HYO A;  5EQV A;  4DT2 A;  5HPE A;  2YVT A;  3TGH A;  3H64 A;  3GVE A;  3QFM A;  1S8E A;  2XMO A;  4OR9 A;  4I5L C;  4V0V A;  2IAE C;  3H68 A;  2CV9 A;  3H62 B;  4LAC C;  1SU1 A;  2HY1 A;  4JA9 A;  2GJU A;  4H2G A;  4YKE A;  1OIE A;  3KBP A;  3THN A;  3IVD A;  1U32 A;  2JOG A;  4UT3 A;  5INB A;  2AHD A;  3C9F A;  3QG5 C;  4H1Y P;  3H66 A;  2USH A;  2NXF A;  3H67 A;  1XM7 A;  5B8I A;  3JYF A;  4ORB A;  3RQZ A;  3ZU0 A;  2BQ8 X;  2NYL C;  3H61 A;  4ZX2 A;  2BCD A;  2P6B A;  4TUI A;  1II7 A;  1WAR A;  2A22 A;  2IE4 C;  3K7W C;  2HYP A;  2IE3 C;  4IYP C;  5DNY A;  4M0V A;  4B2O A;  4KKZ A;  3K7V C;  4UT3 B;  2BDX A;  4FCX A;  3EGG A;  3DSD A;  3IB7 A;  1HPU A;  3QFO A;  3AUZ A;  3RL4 A;  1M63 A;  1TCO A;  2O8G A;  4LU9 A;  4O4K A;  4J6O A;  1UF3 A;  1W24 A;  3PSN A;  5C1V A;  3V4Y A;  4XPN A;  3LL8 A;  1XZW A;  5GTU A;  1JK7 A;  1MF8 A;  1USH A;  3H69 A;  2Z1A A;  3P71 C;  3T1I A;  5JPF A;  2ZBM A;  2QFR A;  1S95 A;  1Z2X A;  1V73 A;  2Z06 A;  3FGA C;  1IT6 A;  4I5N C;  4O24 A;  2WDD A;  4DHL A;  4UWQ A;  2QFP A;  2WDF A;  4ORA A;  4TUG A;  2WDC A;  2R17 A;  1Z2W A;  1WAO 1;  3ICF A;  5IOH A;  3THO B;  5JPE A;  1OID A;  4JA7 A;  1S3M A;  1S70 A;  4WWL A;  3C5W C;  4MOV A;  3H60 A; 
#chains in the Genus database with same CATH topology
 1S3N A;  3RL5 A;  1NNW A;  3RL3 A;  4MP0 A;  2WDE A;  4UT2 A;  1AUI A;  2QJC A;  1QFC A;  3H63 A;  3IVE A;  1T70 A;  5JJT A;  4ORC A;  3E0J A;  4Q7F A;  2NPP C;  4V0X A;  3E7B A;  4F0Z A;  2NYM C;  3AV0 A;  1FJM A;  1HP1 A;  1G5B A;  3HVQ A;  3DW8 C;  4G9J A;  4FBK A;  4H2I A;  4LTY A;  3QFK A;  3PSO A;  3QFN A;  3D03 A;  4NZV A;  1HO5 A;  4H2F A;  4H2B A;  2KKN A;  1OI8 A;  2YEQ A;  3ZTV A;  1UTE A;  3DSC A;  1T71 A;  1S3L A;  4H1S A;  1KBP A;  2Q8U A;  4IL1 A;  4KBP A;  5F3W A;  1QHW A;  3CK2 A;  3EGH A;  3IB8 A;  4DSY A;  2O8A A;  3E7A A;  4V0W A;  4O43 A;  2Z72 A;  2DFJ A;  3N5U A;  4FBQ A;  4FBW A;  4MOY A;  4O5G A;  5J28 A;  4ZVZ A;  4HD0 A;  2HYO A;  5EQV A;  4DT2 A;  5HPE A;  2YVT A;  3TGH A;  3H64 A;  3GVE A;  3QFM A;  2DXL A;  1S8E A;  2XMO A;  2ZO9 B;  4OR9 A;  4I5L C;  4V0V A;  2IAE C;  3H68 A;  2CV9 A;  3H62 B;  4LAC C;  1SU1 A;  2HY1 A;  4JA9 A;  2GJU A;  4H2G A;  4YKE A;  1OIE A;  3KBP A;  3THN A;  3IVD A;  1U32 A;  2JOG A;  4UT3 A;  5INB A;  2AHD A;  3C9F A;  3QG5 C;  4H1Y P;  3H66 A;  2USH A;  2NXF A;  3H67 A;  1XM7 A;  5B8I A;  3JYF A;  4ORB A;  3RQZ A;  3ZU0 A;  2BQ8 X;  2NYL C;  3C5W C;  3H61 A;  4ZX2 A;  2BCD A;  2P6B A;  4TUI A;  1II7 A;  1WAR A;  2IE4 C;  3K7W C;  2HYP A;  2IE3 C;  4IYP C;  5DNY A;  4M0V A;  4B2O A;  4KKZ A;  3K7V C;  4UT3 B;  2BDX A;  4FCX A;  3EGG A;  3DSD A;  3IB7 A;  1HPU A;  3QFO A;  3AUZ A;  3FLO A;  3RL4 A;  1M63 A;  1TCO A;  2O8G A;  4LU9 A;  4O4K A;  4J6O A;  1UF3 A;  1W24 A;  3PSN A;  5C1V A;  3V4Y A;  4XPN A;  3LL8 A;  1XZW A;  5GTU A;  2DXN A;  1JK7 A;  1MF8 A;  1USH A;  3H69 A;  2Z1A A;  3P71 C;  3T1I A;  5JPF A;  2ZBM A;  2QFR A;  1S95 A;  1Z2X A;  1V73 A;  2Z06 A;  3FGA C;  1IT6 A;  4I5N C;  4O24 A;  2WDD A;  4DHL A;  4UWQ A;  2QFP A;  2WDF A;  4ORA A;  4TUG A;  2WDC A;  2R17 A;  1Z2W A;  1WAO 1;  3ICF A;  5IOH A;  3THO B;  5JPE A;  1OID A;  4JA7 A;  1S3M A;  1S70 A;  2ZOA A;  4WWL A;  2A22 A;  4MOV A;  3H60 A; 
#chains in the Genus database with same CATH homology
 1S3N A;  3RL5 A;  1NNW A;  3RL3 A;  4MP0 A;  2WDE A;  4UT2 A;  1AUI A;  2QJC A;  1QFC A;  3H63 A;  3IVE A;  1T70 A;  5JJT A;  4ORC A;  3E0J A;  4Q7F A;  2NPP C;  4V0X A;  3E7B A;  4F0Z A;  2NYM C;  3AV0 A;  1FJM A;  1HP1 A;  1G5B A;  3HVQ A;  3DW8 C;  4G9J A;  4FBK A;  4H2I A;  4LTY A;  3QFK A;  3PSO A;  3QFN A;  3D03 A;  4NZV A;  1HO5 A;  4H2F A;  4H2B A;  2KKN A;  1OI8 A;  2YEQ A;  3ZTV A;  1UTE A;  3DSC A;  1T71 A;  1S3L A;  4H1S A;  1KBP A;  2Q8U A;  4IL1 A;  4KBP A;  5F3W A;  1QHW A;  3CK2 A;  3EGH A;  3IB8 A;  4DSY A;  2O8A A;  3E7A A;  4V0W A;  4O43 A;  2Z72 A;  2DFJ A;  3N5U A;  4FBQ A;  4FBW A;  4MOY A;  4O5G A;  5J28 A;  4ZVZ A;  4HD0 A;  2HYO A;  5EQV A;  4DT2 A;  5HPE A;  2YVT A;  3TGH A;  3H64 A;  3GVE A;  3QFM A;  2DXL A;  1S8E A;  2XMO A;  2ZO9 B;  4OR9 A;  4I5L C;  4V0V A;  2IAE C;  3H68 A;  2CV9 A;  3H62 B;  4LAC C;  1SU1 A;  2HY1 A;  4JA9 A;  2GJU A;  4H2G A;  4YKE A;  1OIE A;  3KBP A;  3THN A;  3IVD A;  1U32 A;  2JOG A;  4UT3 A;  5INB A;  2AHD A;  3C9F A;  3QG5 C;  4H1Y P;  3H66 A;  2USH A;  2NXF A;  3H67 A;  1XM7 A;  5B8I A;  3JYF A;  4ORB A;  3RQZ A;  3ZU0 A;  2BQ8 X;  2NYL C;  3C5W C;  3H61 A;  4ZX2 A;  2BCD A;  2P6B A;  4TUI A;  1II7 A;  1WAR A;  2IE4 C;  3K7W C;  2HYP A;  2IE3 C;  4IYP C;  5DNY A;  4M0V A;  4B2O A;  4KKZ A;  3K7V C;  4UT3 B;  2BDX A;  4FCX A;  3EGG A;  3DSD A;  3IB7 A;  1HPU A;  3QFO A;  3AUZ A;  3FLO A;  3RL4 A;  1M63 A;  1TCO A;  2O8G A;  4LU9 A;  4O4K A;  4J6O A;  1UF3 A;  1W24 A;  3PSN A;  5C1V A;  3V4Y A;  4XPN A;  3LL8 A;  1XZW A;  5GTU A;  2DXN A;  1JK7 A;  1MF8 A;  1USH A;  3H69 A;  2Z1A A;  3P71 C;  3T1I A;  5JPF A;  2ZBM A;  2QFR A;  1S95 A;  1Z2X A;  1V73 A;  2Z06 A;  3FGA C;  1IT6 A;  4I5N C;  4O24 A;  2WDD A;  4DHL A;  4UWQ A;  2QFP A;  2WDF A;  4ORA A;  4TUG A;  2WDC A;  2R17 A;  1Z2W A;  1WAO 1;  3ICF A;  5IOH A;  3THO B;  5JPE A;  1OID A;  4JA7 A;  1S3M A;  1S70 A;  2ZOA A;  4WWL A;  2A22 A;  4MOV A;  3H60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...