3C9FA

Crystal structure of 5'-nucleotidase from candida albicans sc5314
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
546
structure length
531
Chain Sequence
SFPHRNLTWNDINFVHTTDTHGWYSGHINQPLYHANWGDFISFTTHMRRIAHSRNQDLLLIDSGDRHDGNGLSDITSPNGLKSTPIFIKQDYDLLTIGNHELYLWENSKQEYETVVNHFQDKYVCSNVDIRLDNGLFVPLGLKYKYFTTPIRGIRVMAFGFLFDFKRFNSGTRVTPMAETIHEPWFQEALKHEVDLIIIVGHTPISHNWGEFYQVHQYLRQFFPDTIIQYFGGHSHIRDFTVFDSLSTGLQSGRYCETVGWTSVNLDKADLNLPVRQRFSRSYIDFNTDSFKYHTNLDKEFDTAKGKLVSKLIRETRKELKLDTLIGYVKTNYYVDYVPIDHPKSIFNLLALKILKTLPKSKHEERITIINTGSIRYDLYKGPYTIDSKFIVSPFENIWVNITVPKSVATKVAAKLNDYISASRLKPPHQYDLQVQQEKLPKGYVTHDDFGADGDDTLHRAVVNFPVPNVIQSVEINDEVDSPVNLVFYSFITPNIIWALKELNFSTEQVPTPYSDIYLGTLLNEFVANNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 5'-nucleotidase
publication title Crystal structure of 5'-nucleotidase from Candida albicans.
rcsb
source organism Candida albicans
total genus 185
structure length 531
sequence length 546
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3c9fA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 3c9fA02
2USHA 3QFKA 4HD0A 2HYOA 2NYMC 4O4KA 4ORBA 1S3NA 1AUIA 3H60A 1WARA 1IT6A 2KKNA 4OR9A 3T1IA 4UT2A 3RQZA 1S3LA 4TUGA 2HY1A 1HPUA 3P71C 5EQVA 3RL5A 4I5NC 3E7BA 2QFPA 1U32A 4H2FA 4DHLA 2P6BA 3JYFA 5IOHA 1USHA 1W24A 3K7WC 2XMOA 2DFJA 1Z2WA 3H68A 3ICFA 2Q8UA 3GVEA 2Z1AA 4FBQA 1HP1A 2BDXA 2QFRA 2WDEA 3PSNA 3PSOA 3QFMA 2JOGA 3HVQA 4JA7A 2O8GA 1UF3A 3QFOA 5F3WA 3QG5C 4V0XA 4O43A 4LU9A 1TCOA 3THOB 2Z72A 4B2OA 4YKEA 1KBPA 4LACC 2IE4C 1SU1A 3RL3A 4ZX2A 4KKZA 4I5LC 4V0VA 1NNWA 2WDDA 4MP0A 2YVTA 4V0WA 4ORAA 2WDFA 4H2BA 1V73A 2Z06A 4IL1A 1QFCA 3TGHA 2ZBMA 1UTEA 4UT3A 2WDCA 4FBKA 4DT2A 3AUZA 4DSYA 2BQ8X 3CK2A 1XM7A 4FBWA 3H69A 2HYPA 4ZVZA 1OIEA 4FCXA 1S3MA 2R17A 3N5UA 3H63A 2CV9A 1G5BA 2IE3C 2GJUA 4ORCA 2O8AA 4TUIA 3DSDA 3AV0A 5J28A 4UT3B 3KBPA 1T71A 3IVEA 3IB8A 3H62B 4UWQA 2BCDA 4O24A 3IVDA 3K7VC 5JPFA 1S95A 4H2GA 3H64A 1WAO1 3C9FA 1Z2XA 4M0VA 5HPEA 4H1YP 2A22A 1QHWA 3EGHA 3EGGA 2AHDA 4KBPA 1OIDA 3FGAC 1S8EA 1MF8A 1OI8A 5INBA 5JPEA 4JA9A 5DNYA 1M63A 2QJCA 3RL4A 4XPNA 3H67A 4G9JA 4NZVA 1II7A 3THNA 4MOYA 3E7AA 4MOVA 3DSCA 3ZTVA 5C1VA 3C5WC 3H61A 3IB7A 3QFNA 3H66A 4F0ZA 1HO5A 4LTYA 4IYPC 4O5GA 2NYLC 2NXFA 5JJTA 1T70A 5GTUA 1XZWA 3V4YA 3ZU0A 1FJMA 4WWLA 1S70A 1JK7A 3DW8C 3LL8A 4H1SA 4H2IA 4Q7FA 5B8IA 2NPPC 2IAEC 4J6OA
chains in the Genus database with same CATH superfamily
2DXLA 2USHA 3QFKA 4HD0A 2ZOAA 2HYOA 2NYMC 4O4KA 4ORBA 1S3NA 1AUIA 3H60A 1WARA 1IT6A 2KKNA 4OR9A 3T1IA 4UT2A 3RQZA 1S3LA 4TUGA 2HY1A 1HPUA 3P71C 2DXNA 5EQVA 3RL5A 4I5NC 3E7BA 2QFPA 1U32A 4H2FA 4DHLA 2P6BA 3JYFA 5IOHA 1USHA 1W24A 3K7WC 2XMOA 2DFJA 1Z2WA 3H68A 3ICFA 2Q8UA 3GVEA 2Z1AA 4FBQA 1HP1A 2BDXA 2QFRA 2WDEA 3PSNA 3PSOA 3QFMA 2JOGA 3HVQA 4JA7A 2O8GA 1UF3A 3D03A 3QFOA 5F3WA 3QG5C 4V0XA 4O43A 4LU9A 1TCOA 3THOB 2Z72A 2ZO9B 4B2OA 4YKEA 1KBPA 4LACC 2IE4C 1SU1A 3RL3A 4ZX2A 4KKZA 4I5LC 4V0VA 1NNWA 2WDDA 4MP0A 2YVTA 4V0WA 4ORAA 2WDFA 4H2BA 1V73A 2Z06A 4IL1A 1QFCA 3TGHA 2ZBMA 1UTEA 4UT3A 2WDCA 4FBKA 4DT2A 3AUZA 4DSYA 2BQ8X 3CK2A 1XM7A 4FBWA 3H69A 2HYPA 4ZVZA 1OIEA 4FCXA 1S3MA 2R17A 3N5UA 3H63A 2CV9A 2YEQA 1G5BA 2IE3C 2GJUA 4ORCA 2O8AA 4TUIA 3DSDA 3AV0A 5J28A 4UT3B 3KBPA 1T71A 3IVEA 3IB8A 3H62B 4UWQA 2BCDA 4O24A 3IVDA 3K7VC 5JPFA 1S95A 4H2GA 3H64A 1WAO1 3C9FA 3FLOA 1Z2XA 4M0VA 5HPEA 4H1YP 2A22A 1QHWA 3EGHA 3E0JA 2AHDA 3EGGA 4KBPA 1OIDA 3FGAC 1S8EA 1MF8A 1OI8A 5INBA 5JPEA 4JA9A 5DNYA 1M63A 2QJCA 3RL4A 4XPNA 3H67A 4G9JA 4NZVA 1II7A 3THNA 4MOYA 3E7AA 4MOVA 3DSCA 3ZTVA 5C1VA 3C5WC 3H61A 3IB7A 3QFNA 3H66A 4F0ZA 1HO5A 4LTYA 4IYPC 4O5GA 2NYLC 2NXFA 5JJTA 1T70A 5GTUA 1XZWA 3V4YA 3ZU0A 1FJMA 4WWLA 1S70A 1JK7A 3DW8C 3LL8A 4H1SA 4H2IA 4Q7FA 5B8IA 2NPPC 2IAEC 4J6OA
chains in the Genus database with same CATH topology
2DXLA 2USHA 3QFKA 4HD0A 2ZOAA 2HYOA 2NYMC 4O4KA 4ORBA 1S3NA 1AUIA 3H60A 1WARA 1IT6A 2KKNA 4OR9A 3T1IA 4UT2A 3RQZA 1S3LA 4TUGA 2HY1A 1HPUA 3P71C 2DXNA 5EQVA 3RL5A 4I5NC 3E7BA 2QFPA 1U32A 4H2FA 4DHLA 2P6BA 3JYFA 5IOHA 1USHA 1W24A 3K7WC 2XMOA 2DFJA 1Z2WA 3H68A 3ICFA 2Q8UA 3GVEA 2Z1AA 4FBQA 1HP1A 2BDXA 2QFRA 2WDEA 3PSNA 3PSOA 3QFMA 2JOGA 3HVQA 4JA7A 2O8GA 1UF3A 3D03A 3QFOA 5F3WA 3QG5C 4V0XA 4O43A 4LU9A 1TCOA 3THOB 2Z72A 2ZO9B 4B2OA 4YKEA 1KBPA 4LACC 2IE4C 1SU1A 3RL3A 4ZX2A 4KKZA 4I5LC 4V0VA 1NNWA 2WDDA 4MP0A 2YVTA 4V0WA 4ORAA 2WDFA 4H2BA 1V73A 2Z06A 4IL1A 1QFCA 3TGHA 2ZBMA 1UTEA 4UT3A 2WDCA 4FBKA 4DT2A 3AUZA 4DSYA 2BQ8X 3CK2A 1XM7A 4FBWA 3H69A 2HYPA 4ZVZA 1OIEA 4FCXA 1S3MA 2R17A 3N5UA 3H63A 2CV9A 2YEQA 1G5BA 2IE3C 2GJUA 4ORCA 2O8AA 4TUIA 3DSDA 3AV0A 5J28A 4UT3B 3KBPA 1T71A 3IVEA 3IB8A 3H62B 4UWQA 2BCDA 4O24A 3IVDA 3K7VC 5JPFA 1S95A 4H2GA 3H64A 1WAO1 3C9FA 3FLOA 1Z2XA 4M0VA 5HPEA 4H1YP 2A22A 1QHWA 3EGHA 3E0JA 2AHDA 3EGGA 4KBPA 1OIDA 3FGAC 1S8EA 1MF8A 1OI8A 5INBA 5JPEA 4JA9A 5DNYA 1M63A 2QJCA 3RL4A 4XPNA 3H67A 4G9JA 4NZVA 1II7A 3THNA 4MOYA 3E7AA 4MOVA 3DSCA 3ZTVA 5C1VA 3C5WC 3H61A 3IB7A 3QFNA 3H66A 4F0ZA 1HO5A 4LTYA 4IYPC 4O5GA 2NYLC 2NXFA 5JJTA 1T70A 5GTUA 1XZWA 3V4YA 3ZU0A 1FJMA 4WWLA 1S70A 1JK7A 3DW8C 3LL8A 4H1SA 4H2IA 4Q7FA 5B8IA 2NPPC 2IAEC 4J6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2USH A;  3QFK A;  4HD0 A;  2HYO A;  2NYM C;  4O4K A;  4ORB A;  1S3N A;  1AUI A;  3H60 A;  1WAR A;  1IT6 A;  2KKN A;  4OR9 A;  3T1I A;  4UT2 A;  3RQZ A;  1S3L A;  4TUG A;  2HY1 A;  1HPU A;  3P71 C;  5EQV A;  3RL5 A;  4I5N C;  3E7B A;  2QFP A;  1U32 A;  4H2F A;  4DHL A;  2P6B A;  3JYF A;  5IOH A;  1USH A;  1W24 A;  3K7W C;  2XMO A;  2DFJ A;  1Z2W A;  3H68 A;  3ICF A;  2Q8U A;  3GVE A;  2Z1A A;  4FBQ A;  1HP1 A;  2BDX A;  2QFR A;  2WDE A;  3PSN A;  3PSO A;  3QFM A;  2JOG A;  3HVQ A;  4JA7 A;  2O8G A;  1UF3 A;  3QFO A;  5F3W A;  3QG5 C;  4V0X A;  4O43 A;  4LU9 A;  1TCO A;  3THO B;  2Z72 A;  4B2O A;  4YKE A;  1KBP A;  4LAC C;  2IE4 C;  1SU1 A;  3RL3 A;  4ZX2 A;  4KKZ A;  4I5L C;  4V0V A;  1NNW A;  2WDD A;  4MP0 A;  2YVT A;  4V0W A;  4ORA A;  2WDF A;  4H2B A;  1V73 A;  2Z06 A;  4IL1 A;  1QFC A;  3TGH A;  2ZBM A;  1UTE A;  4UT3 A;  2WDC A;  4FBK A;  4DT2 A;  3AUZ A;  4DSY A;  2BQ8 X;  3CK2 A;  1XM7 A;  4FBW A;  3H69 A;  2HYP A;  4ZVZ A;  1OIE A;  4FCX A;  1S3M A;  2R17 A;  3N5U A;  3H63 A;  2CV9 A;  1G5B A;  2IE3 C;  2GJU A;  4ORC A;  2O8A A;  4TUI A;  3DSD A;  3AV0 A;  5J28 A;  4UT3 B;  3KBP A;  1T71 A;  3IVE A;  3IB8 A;  3H62 B;  4UWQ A;  2BCD A;  4O24 A;  3IVD A;  3K7V C;  5JPF A;  1S95 A;  4H2G A;  3H64 A;  1WAO 1;  3C9F A;  1Z2X A;  4M0V A;  5HPE A;  4H1Y P;  2A22 A;  1QHW A;  3EGH A;  3EGG A;  2AHD A;  4KBP A;  1OID A;  3FGA C;  1S8E A;  1MF8 A;  1OI8 A;  5INB A;  5JPE A;  4JA9 A;  5DNY A;  1M63 A;  2QJC A;  3RL4 A;  4XPN A;  3H67 A;  4G9J A;  4NZV A;  1II7 A;  3THN A;  4MOY A;  3E7A A;  4MOV A;  3DSC A;  3ZTV A;  5C1V A;  3C5W C;  3H61 A;  3IB7 A;  3QFN A;  3H66 A;  4F0Z A;  1HO5 A;  4LTY A;  4IYP C;  4O5G A;  2NYL C;  2NXF A;  5JJT A;  1T70 A;  5GTU A;  1XZW A;  3V4Y A;  3ZU0 A;  1FJM A;  4WWL A;  1S70 A;  1JK7 A;  3DW8 C;  3LL8 A;  4H1S A;  4H2I A;  4Q7F A;  5B8I A;  2NPP C;  2IAE C;  4J6O A; 
#chains in the Genus database with same CATH topology
 2DXL A;  2USH A;  3QFK A;  4HD0 A;  2ZOA A;  2HYO A;  2NYM C;  4O4K A;  4ORB A;  1S3N A;  1AUI A;  3H60 A;  1WAR A;  1IT6 A;  2KKN A;  4OR9 A;  3T1I A;  4UT2 A;  3RQZ A;  1S3L A;  4TUG A;  2HY1 A;  1HPU A;  3P71 C;  2DXN A;  5EQV A;  3RL5 A;  4I5N C;  3E7B A;  2QFP A;  1U32 A;  4H2F A;  4DHL A;  2P6B A;  3JYF A;  5IOH A;  1USH A;  1W24 A;  3K7W C;  2XMO A;  2DFJ A;  1Z2W A;  3H68 A;  3ICF A;  2Q8U A;  3GVE A;  2Z1A A;  4FBQ A;  1HP1 A;  2BDX A;  2QFR A;  2WDE A;  3PSN A;  3PSO A;  3QFM A;  2JOG A;  3HVQ A;  4JA7 A;  2O8G A;  1UF3 A;  3D03 A;  3QFO A;  5F3W A;  3QG5 C;  4V0X A;  4O43 A;  4LU9 A;  1TCO A;  3THO B;  2Z72 A;  2ZO9 B;  4B2O A;  4YKE A;  1KBP A;  4LAC C;  2IE4 C;  1SU1 A;  3RL3 A;  4ZX2 A;  4KKZ A;  4I5L C;  4V0V A;  1NNW A;  2WDD A;  4MP0 A;  2YVT A;  4V0W A;  4ORA A;  2WDF A;  4H2B A;  1V73 A;  2Z06 A;  4IL1 A;  1QFC A;  3TGH A;  2ZBM A;  1UTE A;  4UT3 A;  2WDC A;  4FBK A;  4DT2 A;  3AUZ A;  4DSY A;  2BQ8 X;  3CK2 A;  1XM7 A;  4FBW A;  3H69 A;  2HYP A;  4ZVZ A;  1OIE A;  4FCX A;  1S3M A;  2R17 A;  3N5U A;  3H63 A;  2CV9 A;  2YEQ A;  1G5B A;  2IE3 C;  2GJU A;  4ORC A;  2O8A A;  4TUI A;  3DSD A;  3AV0 A;  5J28 A;  4UT3 B;  3KBP A;  1T71 A;  3IVE A;  3IB8 A;  3H62 B;  4UWQ A;  2BCD A;  4O24 A;  3IVD A;  3K7V C;  5JPF A;  1S95 A;  4H2G A;  3H64 A;  1WAO 1;  3C9F A;  3FLO A;  1Z2X A;  4M0V A;  5HPE A;  4H1Y P;  2A22 A;  1QHW A;  3EGH A;  3E0J A;  2AHD A;  3EGG A;  4KBP A;  1OID A;  3FGA C;  1S8E A;  1MF8 A;  1OI8 A;  5INB A;  5JPE A;  4JA9 A;  5DNY A;  1M63 A;  2QJC A;  3RL4 A;  4XPN A;  3H67 A;  4G9J A;  4NZV A;  1II7 A;  3THN A;  4MOY A;  3E7A A;  4MOV A;  3DSC A;  3ZTV A;  5C1V A;  3C5W C;  3H61 A;  3IB7 A;  3QFN A;  3H66 A;  4F0Z A;  1HO5 A;  4LTY A;  4IYP C;  4O5G A;  2NYL C;  2NXF A;  5JJT A;  1T70 A;  5GTU A;  1XZW A;  3V4Y A;  3ZU0 A;  1FJM A;  4WWL A;  1S70 A;  1JK7 A;  3DW8 C;  3LL8 A;  4H1S A;  4H2I A;  4Q7F A;  5B8I A;  2NPP C;  2IAE C;  4J6O A; 
#chains in the Genus database with same CATH homology
 2DXL A;  2USH A;  3QFK A;  4HD0 A;  2ZOA A;  2HYO A;  2NYM C;  4O4K A;  4ORB A;  1S3N A;  1AUI A;  3H60 A;  1WAR A;  1IT6 A;  2KKN A;  4OR9 A;  3T1I A;  4UT2 A;  3RQZ A;  1S3L A;  4TUG A;  2HY1 A;  1HPU A;  3P71 C;  2DXN A;  5EQV A;  3RL5 A;  4I5N C;  3E7B A;  2QFP A;  1U32 A;  4H2F A;  4DHL A;  2P6B A;  3JYF A;  5IOH A;  1USH A;  1W24 A;  3K7W C;  2XMO A;  2DFJ A;  1Z2W A;  3H68 A;  3ICF A;  2Q8U A;  3GVE A;  2Z1A A;  4FBQ A;  1HP1 A;  2BDX A;  2QFR A;  2WDE A;  3PSN A;  3PSO A;  3QFM A;  2JOG A;  3HVQ A;  4JA7 A;  2O8G A;  1UF3 A;  3D03 A;  3QFO A;  5F3W A;  3QG5 C;  4V0X A;  4O43 A;  4LU9 A;  1TCO A;  3THO B;  2Z72 A;  2ZO9 B;  4B2O A;  4YKE A;  1KBP A;  4LAC C;  2IE4 C;  1SU1 A;  3RL3 A;  4ZX2 A;  4KKZ A;  4I5L C;  4V0V A;  1NNW A;  2WDD A;  4MP0 A;  2YVT A;  4V0W A;  4ORA A;  2WDF A;  4H2B A;  1V73 A;  2Z06 A;  4IL1 A;  1QFC A;  3TGH A;  2ZBM A;  1UTE A;  4UT3 A;  2WDC A;  4FBK A;  4DT2 A;  3AUZ A;  4DSY A;  2BQ8 X;  3CK2 A;  1XM7 A;  4FBW A;  3H69 A;  2HYP A;  4ZVZ A;  1OIE A;  4FCX A;  1S3M A;  2R17 A;  3N5U A;  3H63 A;  2CV9 A;  2YEQ A;  1G5B A;  2IE3 C;  2GJU A;  4ORC A;  2O8A A;  4TUI A;  3DSD A;  3AV0 A;  5J28 A;  4UT3 B;  3KBP A;  1T71 A;  3IVE A;  3IB8 A;  3H62 B;  4UWQ A;  2BCD A;  4O24 A;  3IVD A;  3K7V C;  5JPF A;  1S95 A;  4H2G A;  3H64 A;  1WAO 1;  3C9F A;  3FLO A;  1Z2X A;  4M0V A;  5HPE A;  4H1Y P;  2A22 A;  1QHW A;  3EGH A;  3E0J A;  2AHD A;  3EGG A;  4KBP A;  1OID A;  3FGA C;  1S8E A;  1MF8 A;  1OI8 A;  5INB A;  5JPE A;  4JA9 A;  5DNY A;  1M63 A;  2QJC A;  3RL4 A;  4XPN A;  3H67 A;  4G9J A;  4NZV A;  1II7 A;  3THN A;  4MOY A;  3E7A A;  4MOV A;  3DSC A;  3ZTV A;  5C1V A;  3C5W C;  3H61 A;  3IB7 A;  3QFN A;  3H66 A;  4F0Z A;  1HO5 A;  4LTY A;  4IYP C;  4O5G A;  2NYL C;  2NXF A;  5JJT A;  1T70 A;  5GTU A;  1XZW A;  3V4Y A;  3ZU0 A;  1FJM A;  4WWL A;  1S70 A;  1JK7 A;  3DW8 C;  3LL8 A;  4H1S A;  4H2I A;  4Q7F A;  5B8I A;  2NPP C;  2IAE C;  4J6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...