3C9FA

Crystal structure of 5'-nucleotidase from candida albicans sc5314
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
546
structure length
531
Chain Sequence
SFPHRNLTWNDINFVHTTDTHGWYSGHINQPLYHANWGDFISFTTHMRRIAHSRNQDLLLIDSGDRHDGNGLSDITSPNGLKSTPIFIKQDYDLLTIGNHELYLWENSKQEYETVVNHFQDKYVCSNVDIRLDNGLFVPLGLKYKYFTTPIRGIRVMAFGFLFDFKRFNSGTRVTPMAETIHEPWFQEALKHEVDLIIIVGHTPISHNWGEFYQVHQYLRQFFPDTIIQYFGGHSHIRDFTVFDSLSTGLQSGRYCETVGWTSVNLDKADLNLPVRQRFSRSYIDFNTDSFKYHTNLDKEFDTAKGKLVSKLIRETRKELKLDTLIGYVKTNYYVDYVPIDHPKSIFNLLALKILKTLPKSKHEERITIINTGSIRYDLYKGPYTIDSKFIVSPFENIWVNITVPKSVATKVAAKLNDYISASRLKPPHQYDLQVQQEKLPKGYVTHDDFGADGDDTLHRAVVNFPVPNVIQSVEINDEVDSPVNLVFYSFITPNIIWALKELNFSTEQVPTPYSDIYLGTLLNEFVANNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of 5'-nucleotidase from Candida albicans.
rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords 5'-nucleotidase
total genus 185
structure length 531
sequence length 546
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3c9fA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 3c9fA02
1S70A 4DHLA 3CK2A 4G9JA 3TGHA 1UTEA 1T71A 1WARA 4UT2A 1S95A 4WWLA 4OR9A 2QFPA 4ORCA 3IVEA 4UWQA 3ZTVA 2YVTA 4XPNA 5IOHA 3PSNA 3PSOA 4J6OA 4ORAA 3JYFA 2USHA 1Z2WA 3DSCA 1T70A 1S3MA 3H68A 3H69A 3P71C 4HD0A 3HVQA 2DFJA 1USHA 2NPPC 3H64A 4V0XA 3H61A 2O8AA 3RL5A 3RQZA 1S3LA 4H1YP 4I5LC 4NZVA 1M63A 1QFCA 2Q8UA 2KKNA 2HY1A 2XMOA 4IL1A 3THNA 3K7VC 5JPEA 1MF8A 1KBPA 4UT3B 2IE4C 3EGGA 4V0WA 2QJCA 3QG5C 1U32A 1SU1A 1S3NA 3IB7A 1TCOA 3H63A 5JJTA 5GTUA 1G5BA 4ORBA 2BCDA 3DSDA 2WDFA 4ZVZA 3AUZA 2Z06A 2AHDA 2QFRA 3QFOA 1XZWA 4TUIA 2NYLC 2WDDA 4KBPA 4O4KA 3C9FA 1V73A 3ZU0A 3ICFA 4UT3A 4I5NC 2WDEA 3IVDA 1HO5A 4IYPC 3V4YA 3GVEA 2P6BA 5INBA 4LTYA 1HPUA 2A22A 2NXFA 4H2IA 3H60A 1FJMA 3IB8A 3RL3A 1NNWA 3QFNA 1WAO1 2GJUA 3E7BA 4FCXA 1W24A 5J28A 4DSYA 1OIDA 4O5GA 3RL4A 4V0VA 1II7A 2Z1AA 4B2OA 4JA9A 4LACC 1IT6A 3LL8A 4FBQA 4ZX2A 5HPEA 4H2GA 3K7WC 2IE3C 4MOYA 3QFMA 1UF3A 5F3WA 4YKEA 3N5UA 5JPFA 4H1SA 4DT2A 4FBWA 3FGAC 1JK7A 2Z72A 2CV9A 2WDCA 3C5WC 1S8EA 5C1VA 4JA7A 3H67A 2BQ8X 1QHWA 3E7AA 3H66A 1Z2XA 2HYPA 4F0ZA 4KKZA 3QFKA 4MP0A 2HYOA 3DW8C 3T1IA 2IAEC 4O43A 5DNYA 1XM7A 3THOB 5B8IA 2R17A 4Q7FA 1OIEA 4LU9A 2JOGA 4O24A 4MOVA 2ZBMA 1HP1A 2BDXA 3AV0A 4H2FA 2NYMC 3KBPA 4H2BA 3H62B 2O8GA 4M0VA 1AUIA 3EGHA 5EQVA 4TUGA 1OI8A 4FBKA
chains in the Genus database with same CATH superfamily
1S70A 4DHLA 3CK2A 4G9JA 3TGHA 1UTEA 1T71A 1WARA 4UT2A 1S95A 4WWLA 4OR9A 2QFPA 4ORCA 3IVEA 4UWQA 3ZTVA 2YVTA 4XPNA 5IOHA 3PSNA 3PSOA 4J6OA 4ORAA 3JYFA 2USHA 1Z2WA 3DSCA 1T70A 1S3MA 3H68A 3H69A 3P71C 4HD0A 3HVQA 2DFJA 1USHA 2NPPC 3E0JA 3H64A 4V0XA 3H61A 2O8AA 3RL5A 3RQZA 1S3LA 4H1YP 4I5LC 4NZVA 1M63A 1QFCA 2Q8UA 2KKNA 2HY1A 2XMOA 4IL1A 3THNA 3K7VC 5JPEA 1MF8A 1KBPA 4UT3B 2IE4C 3EGGA 4V0WA 2QJCA 3QG5C 1U32A 1SU1A 1S3NA 3D03A 3IB7A 1TCOA 3H63A 5JJTA 5GTUA 1G5BA 4ORBA 2BCDA 3DSDA 2WDFA 4ZVZA 3AUZA 2Z06A 2AHDA 2QFRA 3QFOA 1XZWA 4TUIA 2NYLC 2DXNA 2WDDA 4KBPA 4O4KA 3C9FA 1V73A 3ZU0A 3ICFA 2YEQA 4UT3A 4I5NC 2WDEA 2ZOAA 3IVDA 1HO5A 4IYPC 3V4YA 3GVEA 2P6BA 5INBA 3FLOA 4LTYA 1HPUA 2A22A 2NXFA 4H2IA 3H60A 1FJMA 3IB8A 3RL3A 1NNWA 3QFNA 1WAO1 2GJUA 3E7BA 4FCXA 1W24A 5J28A 4DSYA 2ZO9B 1OIDA 4O5GA 3RL4A 4V0VA 1II7A 2Z1AA 4B2OA 4JA9A 4LACC 1IT6A 3LL8A 4FBQA 4ZX2A 5HPEA 4H2GA 3K7WC 2IE3C 4MOYA 3QFMA 1UF3A 5F3WA 4YKEA 3N5UA 5JPFA 4H1SA 4DT2A 4FBWA 3FGAC 1JK7A 2Z72A 2CV9A 2WDCA 3C5WC 1S8EA 5C1VA 4JA7A 3H67A 2BQ8X 1QHWA 3E7AA 3H66A 1Z2XA 2HYPA 4F0ZA 4KKZA 3QFKA 4MP0A 2HYOA 3DW8C 3T1IA 2IAEC 4O43A 5DNYA 2DXLA 1XM7A 3THOB 5B8IA 2R17A 4Q7FA 1OIEA 4LU9A 2JOGA 4O24A 4MOVA 2ZBMA 1HP1A 2BDXA 3AV0A 4H2FA 2NYMC 3KBPA 4H2BA 3H62B 2O8GA 4M0VA 1AUIA 3EGHA 5EQVA 4TUGA 1OI8A 4FBKA
chains in the Genus database with same CATH topology
1S70A 4DHLA 3CK2A 4G9JA 3TGHA 1UTEA 1T71A 1WARA 4UT2A 1S95A 4WWLA 4OR9A 2QFPA 4ORCA 3IVEA 4UWQA 3ZTVA 2YVTA 4XPNA 5IOHA 3PSNA 3PSOA 4J6OA 4ORAA 3JYFA 2USHA 1Z2WA 3DSCA 1T70A 1S3MA 3H68A 3H69A 3P71C 4HD0A 3HVQA 2DFJA 1USHA 2NPPC 3E0JA 3H64A 4V0XA 3H61A 2O8AA 3RL5A 3RQZA 1S3LA 4H1YP 4I5LC 4NZVA 1M63A 1QFCA 2Q8UA 2KKNA 2HY1A 2XMOA 4IL1A 3THNA 3K7VC 5JPEA 1MF8A 1KBPA 4UT3B 2IE4C 3EGGA 4V0WA 2QJCA 3QG5C 1U32A 1SU1A 1S3NA 3D03A 3IB7A 1TCOA 3H63A 5JJTA 5GTUA 1G5BA 4ORBA 2BCDA 3DSDA 2WDFA 4ZVZA 3AUZA 2Z06A 2AHDA 2QFRA 3QFOA 1XZWA 4TUIA 2NYLC 2DXNA 2WDDA 4KBPA 4O4KA 3C9FA 1V73A 3ZU0A 3ICFA 2YEQA 4UT3A 4I5NC 2WDEA 2ZOAA 3IVDA 1HO5A 4IYPC 3V4YA 3GVEA 2P6BA 5INBA 3FLOA 4LTYA 1HPUA 2A22A 2NXFA 4H2IA 3H60A 1FJMA 3IB8A 3RL3A 1NNWA 3QFNA 1WAO1 2GJUA 3E7BA 4FCXA 1W24A 5J28A 4DSYA 2ZO9B 1OIDA 4O5GA 3RL4A 4V0VA 1II7A 2Z1AA 4B2OA 4JA9A 4LACC 1IT6A 3LL8A 4FBQA 4ZX2A 5HPEA 4H2GA 3K7WC 2IE3C 4MOYA 3QFMA 1UF3A 5F3WA 4YKEA 3N5UA 5JPFA 4H1SA 4DT2A 4FBWA 3FGAC 1JK7A 2Z72A 2CV9A 2WDCA 3C5WC 1S8EA 5C1VA 4JA7A 3H67A 2BQ8X 1QHWA 3E7AA 3H66A 1Z2XA 2HYPA 4F0ZA 4KKZA 3QFKA 4MP0A 2HYOA 3DW8C 3T1IA 2IAEC 4O43A 5DNYA 2DXLA 1XM7A 3THOB 5B8IA 2R17A 4Q7FA 1OIEA 4LU9A 2JOGA 4O24A 4MOVA 2ZBMA 1HP1A 2BDXA 3AV0A 4H2FA 2NYMC 3KBPA 4H2BA 3H62B 2O8GA 4M0VA 1AUIA 3EGHA 5EQVA 4TUGA 1OI8A 4FBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S70 A;  4DHL A;  3CK2 A;  4G9J A;  3TGH A;  1UTE A;  1T71 A;  1WAR A;  4UT2 A;  1S95 A;  4WWL A;  4OR9 A;  2QFP A;  4ORC A;  3IVE A;  4UWQ A;  3ZTV A;  2YVT A;  4XPN A;  5IOH A;  3PSN A;  3PSO A;  4J6O A;  4ORA A;  3JYF A;  2USH A;  1Z2W A;  3DSC A;  1T70 A;  1S3M A;  3H68 A;  3H69 A;  3P71 C;  4HD0 A;  3HVQ A;  2DFJ A;  1USH A;  2NPP C;  3H64 A;  4V0X A;  3H61 A;  2O8A A;  3RL5 A;  3RQZ A;  1S3L A;  4H1Y P;  4I5L C;  4NZV A;  1M63 A;  1QFC A;  2Q8U A;  2KKN A;  2HY1 A;  2XMO A;  4IL1 A;  3THN A;  3K7V C;  5JPE A;  1MF8 A;  1KBP A;  4UT3 B;  2IE4 C;  3EGG A;  4V0W A;  2QJC A;  3QG5 C;  1U32 A;  1SU1 A;  1S3N A;  3IB7 A;  1TCO A;  3H63 A;  5JJT A;  5GTU A;  1G5B A;  4ORB A;  2BCD A;  3DSD A;  2WDF A;  4ZVZ A;  3AUZ A;  2Z06 A;  2AHD A;  2QFR A;  3QFO A;  1XZW A;  4TUI A;  2NYL C;  2WDD A;  4KBP A;  4O4K A;  3C9F A;  1V73 A;  3ZU0 A;  3ICF A;  4UT3 A;  4I5N C;  2WDE A;  3IVD A;  1HO5 A;  4IYP C;  3V4Y A;  3GVE A;  2P6B A;  5INB A;  4LTY A;  1HPU A;  2A22 A;  2NXF A;  4H2I A;  3H60 A;  1FJM A;  3IB8 A;  3RL3 A;  1NNW A;  3QFN A;  1WAO 1;  2GJU A;  3E7B A;  4FCX A;  1W24 A;  5J28 A;  4DSY A;  1OID A;  4O5G A;  3RL4 A;  4V0V A;  1II7 A;  2Z1A A;  4B2O A;  4JA9 A;  4LAC C;  1IT6 A;  3LL8 A;  4FBQ A;  4ZX2 A;  5HPE A;  4H2G A;  3K7W C;  2IE3 C;  4MOY A;  3QFM A;  1UF3 A;  5F3W A;  4YKE A;  3N5U A;  5JPF A;  4H1S A;  4DT2 A;  4FBW A;  3FGA C;  1JK7 A;  2Z72 A;  2CV9 A;  2WDC A;  3C5W C;  1S8E A;  5C1V A;  4JA7 A;  3H67 A;  2BQ8 X;  1QHW A;  3E7A A;  3H66 A;  1Z2X A;  2HYP A;  4F0Z A;  4KKZ A;  3QFK A;  4MP0 A;  2HYO A;  3DW8 C;  3T1I A;  2IAE C;  4O43 A;  5DNY A;  1XM7 A;  3THO B;  5B8I A;  2R17 A;  4Q7F A;  1OIE A;  4LU9 A;  2JOG A;  4O24 A;  4MOV A;  2ZBM A;  1HP1 A;  2BDX A;  3AV0 A;  4H2F A;  2NYM C;  3KBP A;  4H2B A;  3H62 B;  2O8G A;  4M0V A;  1AUI A;  3EGH A;  5EQV A;  4TUG A;  1OI8 A;  4FBK A; 
#chains in the Genus database with same CATH topology
 1S70 A;  4DHL A;  3CK2 A;  4G9J A;  3TGH A;  1UTE A;  1T71 A;  1WAR A;  4UT2 A;  1S95 A;  4WWL A;  4OR9 A;  2QFP A;  4ORC A;  3IVE A;  4UWQ A;  3ZTV A;  2YVT A;  4XPN A;  5IOH A;  3PSN A;  3PSO A;  4J6O A;  4ORA A;  3JYF A;  2USH A;  1Z2W A;  3DSC A;  1T70 A;  1S3M A;  3H68 A;  3H69 A;  3P71 C;  4HD0 A;  3HVQ A;  2DFJ A;  1USH A;  2NPP C;  3E0J A;  3H64 A;  4V0X A;  3H61 A;  2O8A A;  3RL5 A;  3RQZ A;  1S3L A;  4H1Y P;  4I5L C;  4NZV A;  1M63 A;  1QFC A;  2Q8U A;  2KKN A;  2HY1 A;  2XMO A;  4IL1 A;  3THN A;  3K7V C;  5JPE A;  1MF8 A;  1KBP A;  4UT3 B;  2IE4 C;  3EGG A;  4V0W A;  2QJC A;  3QG5 C;  1U32 A;  1SU1 A;  1S3N A;  3D03 A;  3IB7 A;  1TCO A;  3H63 A;  5JJT A;  5GTU A;  1G5B A;  4ORB A;  2BCD A;  3DSD A;  2WDF A;  4ZVZ A;  3AUZ A;  2Z06 A;  2AHD A;  2QFR A;  3QFO A;  1XZW A;  4TUI A;  2NYL C;  2DXN A;  2WDD A;  4KBP A;  4O4K A;  3C9F A;  1V73 A;  3ZU0 A;  3ICF A;  2YEQ A;  4UT3 A;  4I5N C;  2WDE A;  2ZOA A;  3IVD A;  1HO5 A;  4IYP C;  3V4Y A;  3GVE A;  2P6B A;  5INB A;  3FLO A;  4LTY A;  1HPU A;  2A22 A;  2NXF A;  4H2I A;  3H60 A;  1FJM A;  3IB8 A;  3RL3 A;  1NNW A;  3QFN A;  1WAO 1;  2GJU A;  3E7B A;  4FCX A;  1W24 A;  5J28 A;  4DSY A;  2ZO9 B;  1OID A;  4O5G A;  3RL4 A;  4V0V A;  1II7 A;  2Z1A A;  4B2O A;  4JA9 A;  4LAC C;  1IT6 A;  3LL8 A;  4FBQ A;  4ZX2 A;  5HPE A;  4H2G A;  3K7W C;  2IE3 C;  4MOY A;  3QFM A;  1UF3 A;  5F3W A;  4YKE A;  3N5U A;  5JPF A;  4H1S A;  4DT2 A;  4FBW A;  3FGA C;  1JK7 A;  2Z72 A;  2CV9 A;  2WDC A;  3C5W C;  1S8E A;  5C1V A;  4JA7 A;  3H67 A;  2BQ8 X;  1QHW A;  3E7A A;  3H66 A;  1Z2X A;  2HYP A;  4F0Z A;  4KKZ A;  3QFK A;  4MP0 A;  2HYO A;  3DW8 C;  3T1I A;  2IAE C;  4O43 A;  5DNY A;  2DXL A;  1XM7 A;  3THO B;  5B8I A;  2R17 A;  4Q7F A;  1OIE A;  4LU9 A;  2JOG A;  4O24 A;  4MOV A;  2ZBM A;  1HP1 A;  2BDX A;  3AV0 A;  4H2F A;  2NYM C;  3KBP A;  4H2B A;  3H62 B;  2O8G A;  4M0V A;  1AUI A;  3EGH A;  5EQV A;  4TUG A;  1OI8 A;  4FBK A; 
#chains in the Genus database with same CATH homology
 1S70 A;  4DHL A;  3CK2 A;  4G9J A;  3TGH A;  1UTE A;  1T71 A;  1WAR A;  4UT2 A;  1S95 A;  4WWL A;  4OR9 A;  2QFP A;  4ORC A;  3IVE A;  4UWQ A;  3ZTV A;  2YVT A;  4XPN A;  5IOH A;  3PSN A;  3PSO A;  4J6O A;  4ORA A;  3JYF A;  2USH A;  1Z2W A;  3DSC A;  1T70 A;  1S3M A;  3H68 A;  3H69 A;  3P71 C;  4HD0 A;  3HVQ A;  2DFJ A;  1USH A;  2NPP C;  3E0J A;  3H64 A;  4V0X A;  3H61 A;  2O8A A;  3RL5 A;  3RQZ A;  1S3L A;  4H1Y P;  4I5L C;  4NZV A;  1M63 A;  1QFC A;  2Q8U A;  2KKN A;  2HY1 A;  2XMO A;  4IL1 A;  3THN A;  3K7V C;  5JPE A;  1MF8 A;  1KBP A;  4UT3 B;  2IE4 C;  3EGG A;  4V0W A;  2QJC A;  3QG5 C;  1U32 A;  1SU1 A;  1S3N A;  3D03 A;  3IB7 A;  1TCO A;  3H63 A;  5JJT A;  5GTU A;  1G5B A;  4ORB A;  2BCD A;  3DSD A;  2WDF A;  4ZVZ A;  3AUZ A;  2Z06 A;  2AHD A;  2QFR A;  3QFO A;  1XZW A;  4TUI A;  2NYL C;  2DXN A;  2WDD A;  4KBP A;  4O4K A;  3C9F A;  1V73 A;  3ZU0 A;  3ICF A;  2YEQ A;  4UT3 A;  4I5N C;  2WDE A;  2ZOA A;  3IVD A;  1HO5 A;  4IYP C;  3V4Y A;  3GVE A;  2P6B A;  5INB A;  3FLO A;  4LTY A;  1HPU A;  2A22 A;  2NXF A;  4H2I A;  3H60 A;  1FJM A;  3IB8 A;  3RL3 A;  1NNW A;  3QFN A;  1WAO 1;  2GJU A;  3E7B A;  4FCX A;  1W24 A;  5J28 A;  4DSY A;  2ZO9 B;  1OID A;  4O5G A;  3RL4 A;  4V0V A;  1II7 A;  2Z1A A;  4B2O A;  4JA9 A;  4LAC C;  1IT6 A;  3LL8 A;  4FBQ A;  4ZX2 A;  5HPE A;  4H2G A;  3K7W C;  2IE3 C;  4MOY A;  3QFM A;  1UF3 A;  5F3W A;  4YKE A;  3N5U A;  5JPF A;  4H1S A;  4DT2 A;  4FBW A;  3FGA C;  1JK7 A;  2Z72 A;  2CV9 A;  2WDC A;  3C5W C;  1S8E A;  5C1V A;  4JA7 A;  3H67 A;  2BQ8 X;  1QHW A;  3E7A A;  3H66 A;  1Z2X A;  2HYP A;  4F0Z A;  4KKZ A;  3QFK A;  4MP0 A;  2HYO A;  3DW8 C;  3T1I A;  2IAE C;  4O43 A;  5DNY A;  2DXL A;  1XM7 A;  3THO B;  5B8I A;  2R17 A;  4Q7F A;  1OIE A;  4LU9 A;  2JOG A;  4O24 A;  4MOV A;  2ZBM A;  1HP1 A;  2BDX A;  3AV0 A;  4H2F A;  2NYM C;  3KBP A;  4H2B A;  3H62 B;  2O8G A;  4M0V A;  1AUI A;  3EGH A;  5EQV A;  4TUG A;  1OI8 A;  4FBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...