3H67A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c)with two zn2+ atoms complexed with cantharidic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
315
structure length
315
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h67A00
2QFPA 1OI8A 2NYMC 4V0XA 5B8IA 4LU9A 3V4YA 2JOGA 1S3LA 4UT3B 1G5BA 2Q8UA 4LTYA 4DT2A 4KKZA 1M63A 4O4KA 3H62B 4F0ZA 3RL3A 2WDDA 1S3MA 5INBA 3QFNA 1T70A 1HPUA 2XMOA 1W24A 3AV0A 1UTEA 5C1VA 2HYOA 1UF3A 3H68A 4IYPC 3QFMA 4WWLA 4ZX2A 3THOB 2R17A 2WDCA 3K7VC 1TCOA 3HVQA 4H2BA 5EQVA 4ZVZA 4H2IA 5J28A 3IVEA 2IE4C 1HP1A 2BCDA 2NXFA 4O24A 2Z72A 1JK7A 3LL8A 1QFCA 1NNWA 1IT6A 5GTUA 3DW8C 5DNYA 1SU1A 4UWQA 5F3WA 4MOYA 4V0VA 4JA7A 4DSYA 1Z2XA 4MOVA 1T71A 4V0WA 2O8AA 4TUIA 3H67A 4UT2A 3RL5A 3T1IA 4KBPA 4NZVA 1S70A 1U32A 2Z06A 3AUZA 2BQ8X 4I5NC 2BDXA 4B2OA 2KKNA 3H63A 4UT3A 5IOHA 1V73A 3C5WC 4MP0A 4XPNA 1HO5A 4J6OA 4H2FA 2HYPA 3RQZA 4O5GA 3GVEA 4Q7FA 1WARA 3PSNA 3H60A 1XZWA 3DSDA 2AHDA 3CK2A 3ICFA 3E7AA 2USHA 4JA9A 3K7WC 3EGHA 2WDFA 4ORAA 2NYLC 3H66A 2HY1A 3TGHA 5JPEA 2P6BA 1Z2WA 4OR9A 3EGGA 3C9FA 3DSCA 2YVTA 3ZTVA 1II7A 3ZU0A 1FJMA 4FCXA 3N5UA 2IAEC 3QG5C 4G9JA 3H64A 2IE3C 4ORBA 3H69A 2QJCA 4IL1A 4O43A 4H1SA 1QHWA 3QFOA 2A22A 3E7BA 2DFJA 1S8EA 2O8GA 2ZBMA 1WAO1 3H61A 1S95A 3IB7A 5JJTA 4FBWA 1AUIA 1KBPA 4H2GA 1XM7A 1OIEA 4DHLA 4HD0A 3IVDA 2QFRA 1S3NA 5JPFA 3IB8A 4TUGA 1OIDA 4H1YP 1MF8A 4LACC 2CV9A 2GJUA 2WDEA 4M0VA 3JYFA 3THNA 3QFKA 2Z1AA 4YKEA 2NPPC 1USHA 3FGAC 4FBKA 4I5LC 3PSOA 4ORCA 4FBQA 3RL4A 3P71C 5HPEA 3KBPA
chains in the Genus database with same CATH superfamily
2QFPA 1OI8A 2NYMC 4V0XA 5B8IA 4LU9A 3V4YA 2JOGA 1S3LA 4UT3B 1G5BA 2Q8UA 4LTYA 4DT2A 4KKZA 1M63A 4O4KA 3H62B 4F0ZA 2DXLA 3RL3A 2WDDA 1S3MA 5INBA 3QFNA 1T70A 1HPUA 2XMOA 1W24A 3AV0A 1UTEA 5C1VA 2HYOA 1UF3A 3H68A 4IYPC 3QFMA 4WWLA 4ZX2A 3THOB 2R17A 2WDCA 3K7VC 1TCOA 3HVQA 4H2BA 5EQVA 4ZVZA 4H2IA 5J28A 3IVEA 2IE4C 1HP1A 2BCDA 2NXFA 4O24A 2Z72A 1JK7A 3LL8A 1QFCA 1NNWA 1IT6A 5GTUA 3DW8C 5DNYA 1SU1A 4UWQA 5F3WA 4MOYA 4V0VA 4JA7A 4DSYA 1Z2XA 4MOVA 1T71A 4V0WA 2O8AA 4TUIA 3H67A 4UT2A 3RL5A 3T1IA 4KBPA 4NZVA 1S70A 1U32A 2Z06A 3AUZA 2BQ8X 3D03A 4I5NC 2BDXA 4B2OA 2KKNA 3H63A 4UT3A 5IOHA 1V73A 3C5WC 4MP0A 4XPNA 1HO5A 4J6OA 4H2FA 2HYPA 3RQZA 4O5GA 3GVEA 4Q7FA 1WARA 3PSNA 3H60A 1XZWA 3DSDA 2DXNA 2AHDA 3CK2A 3ICFA 3E7AA 2USHA 4JA9A 3K7WC 3EGHA 2WDFA 4ORAA 2NYLC 3H66A 2HY1A 3TGHA 5JPEA 2P6BA 2YEQA 1Z2WA 4OR9A 3EGGA 3C9FA 3DSCA 2YVTA 3ZTVA 1II7A 3ZU0A 1FJMA 4FCXA 3E0JA 2IAEC 3N5UA 3QG5C 3H64A 4G9JA 2IE3C 4ORBA 3H69A 3FLOA 2QJCA 4IL1A 4O43A 4H1SA 1QHWA 3QFOA 2A22A 3E7BA 2DFJA 1S8EA 2O8GA 2ZBMA 1WAO1 3H61A 1S95A 3IB7A 5JJTA 4FBWA 1AUIA 1KBPA 2ZOAA 2ZO9B 4H2GA 1XM7A 1OIEA 4DHLA 4HD0A 3IVDA 2QFRA 1S3NA 5JPFA 3IB8A 4TUGA 1OIDA 4H1YP 1MF8A 4LACC 2CV9A 2GJUA 2WDEA 4M0VA 3JYFA 3THNA 3QFKA 2Z1AA 4YKEA 2NPPC 1USHA 3FGAC 4FBKA 4I5LC 3PSOA 4ORCA 4FBQA 3RL4A 3P71C 5HPEA 3KBPA
chains in the Genus database with same CATH topology
2QFPA 1OI8A 2NYMC 4V0XA 5B8IA 4LU9A 3V4YA 2JOGA 1S3LA 4UT3B 1G5BA 2Q8UA 4LTYA 4DT2A 4KKZA 1M63A 4O4KA 3H62B 4F0ZA 2DXLA 3RL3A 2WDDA 1S3MA 5INBA 3QFNA 1T70A 1HPUA 2XMOA 1W24A 3AV0A 1UTEA 5C1VA 2HYOA 1UF3A 3H68A 4IYPC 3QFMA 4WWLA 4ZX2A 3THOB 2R17A 2WDCA 3K7VC 1TCOA 3HVQA 4H2BA 5EQVA 4ZVZA 4H2IA 5J28A 3IVEA 2IE4C 1HP1A 2BCDA 2NXFA 4O24A 2Z72A 1JK7A 3LL8A 1QFCA 1NNWA 1IT6A 5GTUA 3DW8C 5DNYA 1SU1A 4UWQA 5F3WA 4MOYA 4V0VA 4JA7A 4DSYA 1Z2XA 4MOVA 1T71A 4V0WA 2O8AA 4TUIA 3H67A 4UT2A 3RL5A 3T1IA 4KBPA 4NZVA 1S70A 1U32A 2Z06A 3AUZA 2BQ8X 3D03A 4I5NC 2BDXA 4B2OA 2KKNA 3H63A 4UT3A 5IOHA 1V73A 3C5WC 4MP0A 4XPNA 1HO5A 4J6OA 4H2FA 2HYPA 3RQZA 4O5GA 3GVEA 4Q7FA 1WARA 3PSNA 3H60A 1XZWA 3DSDA 2DXNA 2AHDA 3CK2A 3ICFA 3E7AA 2USHA 4JA9A 3K7WC 3EGHA 2WDFA 4ORAA 2NYLC 3H66A 2HY1A 3TGHA 5JPEA 2P6BA 2YEQA 1Z2WA 4OR9A 3EGGA 3C9FA 3DSCA 2YVTA 3ZTVA 1II7A 3ZU0A 1FJMA 4FCXA 3E0JA 2IAEC 3N5UA 3QG5C 3H64A 4G9JA 2IE3C 4ORBA 3H69A 3FLOA 2QJCA 4IL1A 4O43A 4H1SA 1QHWA 3QFOA 2A22A 3E7BA 2DFJA 1S8EA 2O8GA 2ZBMA 1WAO1 3H61A 1S95A 3IB7A 5JJTA 4FBWA 1AUIA 1KBPA 2ZOAA 2ZO9B 4H2GA 1XM7A 1OIEA 4DHLA 4HD0A 3IVDA 2QFRA 1S3NA 5JPFA 3IB8A 4TUGA 1OIDA 4H1YP 1MF8A 4LACC 2CV9A 2GJUA 2WDEA 4M0VA 3JYFA 3THNA 3QFKA 2Z1AA 4YKEA 2NPPC 1USHA 3FGAC 4FBKA 4I5LC 3PSOA 4ORCA 4FBQA 3RL4A 3P71C 5HPEA 3KBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFP A;  1OI8 A;  2NYM C;  4V0X A;  5B8I A;  4LU9 A;  3V4Y A;  2JOG A;  1S3L A;  4UT3 B;  1G5B A;  2Q8U A;  4LTY A;  4DT2 A;  4KKZ A;  1M63 A;  4O4K A;  3H62 B;  4F0Z A;  3RL3 A;  2WDD A;  1S3M A;  5INB A;  3QFN A;  1T70 A;  1HPU A;  2XMO A;  1W24 A;  3AV0 A;  1UTE A;  5C1V A;  2HYO A;  1UF3 A;  3H68 A;  4IYP C;  3QFM A;  4WWL A;  4ZX2 A;  3THO B;  2R17 A;  2WDC A;  3K7V C;  1TCO A;  3HVQ A;  4H2B A;  5EQV A;  4ZVZ A;  4H2I A;  5J28 A;  3IVE A;  2IE4 C;  1HP1 A;  2BCD A;  2NXF A;  4O24 A;  2Z72 A;  1JK7 A;  3LL8 A;  1QFC A;  1NNW A;  1IT6 A;  5GTU A;  3DW8 C;  5DNY A;  1SU1 A;  4UWQ A;  5F3W A;  4MOY A;  4V0V A;  4JA7 A;  4DSY A;  1Z2X A;  4MOV A;  1T71 A;  4V0W A;  2O8A A;  4TUI A;  3H67 A;  4UT2 A;  3RL5 A;  3T1I A;  4KBP A;  4NZV A;  1S70 A;  1U32 A;  2Z06 A;  3AUZ A;  2BQ8 X;  4I5N C;  2BDX A;  4B2O A;  2KKN A;  3H63 A;  4UT3 A;  5IOH A;  1V73 A;  3C5W C;  4MP0 A;  4XPN A;  1HO5 A;  4J6O A;  4H2F A;  2HYP A;  3RQZ A;  4O5G A;  3GVE A;  4Q7F A;  1WAR A;  3PSN A;  3H60 A;  1XZW A;  3DSD A;  2AHD A;  3CK2 A;  3ICF A;  3E7A A;  2USH A;  4JA9 A;  3K7W C;  3EGH A;  2WDF A;  4ORA A;  2NYL C;  3H66 A;  2HY1 A;  3TGH A;  5JPE A;  2P6B A;  1Z2W A;  4OR9 A;  3EGG A;  3C9F A;  3DSC A;  2YVT A;  3ZTV A;  1II7 A;  3ZU0 A;  1FJM A;  4FCX A;  3N5U A;  2IAE C;  3QG5 C;  4G9J A;  3H64 A;  2IE3 C;  4ORB A;  3H69 A;  2QJC A;  4IL1 A;  4O43 A;  4H1S A;  1QHW A;  3QFO A;  2A22 A;  3E7B A;  2DFJ A;  1S8E A;  2O8G A;  2ZBM A;  1WAO 1;  3H61 A;  1S95 A;  3IB7 A;  5JJT A;  4FBW A;  1AUI A;  1KBP A;  4H2G A;  1XM7 A;  1OIE A;  4DHL A;  4HD0 A;  3IVD A;  2QFR A;  1S3N A;  5JPF A;  3IB8 A;  4TUG A;  1OID A;  4H1Y P;  1MF8 A;  4LAC C;  2CV9 A;  2GJU A;  2WDE A;  4M0V A;  3JYF A;  3THN A;  3QFK A;  2Z1A A;  4YKE A;  2NPP C;  1USH A;  3FGA C;  4FBK A;  4I5L C;  3PSO A;  4ORC A;  4FBQ A;  3RL4 A;  3P71 C;  5HPE A;  3KBP A; 
#chains in the Genus database with same CATH topology
 2QFP A;  1OI8 A;  2NYM C;  4V0X A;  5B8I A;  4LU9 A;  3V4Y A;  2JOG A;  1S3L A;  4UT3 B;  1G5B A;  2Q8U A;  4LTY A;  4DT2 A;  4KKZ A;  1M63 A;  4O4K A;  3H62 B;  4F0Z A;  2DXL A;  3RL3 A;  2WDD A;  1S3M A;  5INB A;  3QFN A;  1T70 A;  1HPU A;  2XMO A;  1W24 A;  3AV0 A;  1UTE A;  5C1V A;  2HYO A;  1UF3 A;  3H68 A;  4IYP C;  3QFM A;  4WWL A;  4ZX2 A;  3THO B;  2R17 A;  2WDC A;  3K7V C;  1TCO A;  3HVQ A;  4H2B A;  5EQV A;  4ZVZ A;  4H2I A;  5J28 A;  3IVE A;  2IE4 C;  1HP1 A;  2BCD A;  2NXF A;  4O24 A;  2Z72 A;  1JK7 A;  3LL8 A;  1QFC A;  1NNW A;  1IT6 A;  5GTU A;  3DW8 C;  5DNY A;  1SU1 A;  4UWQ A;  5F3W A;  4MOY A;  4V0V A;  4JA7 A;  4DSY A;  1Z2X A;  4MOV A;  1T71 A;  4V0W A;  2O8A A;  4TUI A;  3H67 A;  4UT2 A;  3RL5 A;  3T1I A;  4KBP A;  4NZV A;  1S70 A;  1U32 A;  2Z06 A;  3AUZ A;  2BQ8 X;  3D03 A;  4I5N C;  2BDX A;  4B2O A;  2KKN A;  3H63 A;  4UT3 A;  5IOH A;  1V73 A;  3C5W C;  4MP0 A;  4XPN A;  1HO5 A;  4J6O A;  4H2F A;  2HYP A;  3RQZ A;  4O5G A;  3GVE A;  4Q7F A;  1WAR A;  3PSN A;  3H60 A;  1XZW A;  3DSD A;  2DXN A;  2AHD A;  3CK2 A;  3ICF A;  3E7A A;  2USH A;  4JA9 A;  3K7W C;  3EGH A;  2WDF A;  4ORA A;  2NYL C;  3H66 A;  2HY1 A;  3TGH A;  5JPE A;  2P6B A;  2YEQ A;  1Z2W A;  4OR9 A;  3EGG A;  3C9F A;  3DSC A;  2YVT A;  3ZTV A;  1II7 A;  3ZU0 A;  1FJM A;  4FCX A;  3E0J A;  2IAE C;  3N5U A;  3QG5 C;  3H64 A;  4G9J A;  2IE3 C;  4ORB A;  3H69 A;  3FLO A;  2QJC A;  4IL1 A;  4O43 A;  4H1S A;  1QHW A;  3QFO A;  2A22 A;  3E7B A;  2DFJ A;  1S8E A;  2O8G A;  2ZBM A;  1WAO 1;  3H61 A;  1S95 A;  3IB7 A;  5JJT A;  4FBW A;  1AUI A;  1KBP A;  2ZOA A;  2ZO9 B;  4H2G A;  1XM7 A;  1OIE A;  4DHL A;  4HD0 A;  3IVD A;  2QFR A;  1S3N A;  5JPF A;  3IB8 A;  4TUG A;  1OID A;  4H1Y P;  1MF8 A;  4LAC C;  2CV9 A;  2GJU A;  2WDE A;  4M0V A;  3JYF A;  3THN A;  3QFK A;  2Z1A A;  4YKE A;  2NPP C;  1USH A;  3FGA C;  4FBK A;  4I5L C;  3PSO A;  4ORC A;  4FBQ A;  3RL4 A;  3P71 C;  5HPE A;  3KBP A; 
#chains in the Genus database with same CATH homology
 2QFP A;  1OI8 A;  2NYM C;  4V0X A;  5B8I A;  4LU9 A;  3V4Y A;  2JOG A;  1S3L A;  4UT3 B;  1G5B A;  2Q8U A;  4LTY A;  4DT2 A;  4KKZ A;  1M63 A;  4O4K A;  3H62 B;  4F0Z A;  2DXL A;  3RL3 A;  2WDD A;  1S3M A;  5INB A;  3QFN A;  1T70 A;  1HPU A;  2XMO A;  1W24 A;  3AV0 A;  1UTE A;  5C1V A;  2HYO A;  1UF3 A;  3H68 A;  4IYP C;  3QFM A;  4WWL A;  4ZX2 A;  3THO B;  2R17 A;  2WDC A;  3K7V C;  1TCO A;  3HVQ A;  4H2B A;  5EQV A;  4ZVZ A;  4H2I A;  5J28 A;  3IVE A;  2IE4 C;  1HP1 A;  2BCD A;  2NXF A;  4O24 A;  2Z72 A;  1JK7 A;  3LL8 A;  1QFC A;  1NNW A;  1IT6 A;  5GTU A;  3DW8 C;  5DNY A;  1SU1 A;  4UWQ A;  5F3W A;  4MOY A;  4V0V A;  4JA7 A;  4DSY A;  1Z2X A;  4MOV A;  1T71 A;  4V0W A;  2O8A A;  4TUI A;  3H67 A;  4UT2 A;  3RL5 A;  3T1I A;  4KBP A;  4NZV A;  1S70 A;  1U32 A;  2Z06 A;  3AUZ A;  2BQ8 X;  3D03 A;  4I5N C;  2BDX A;  4B2O A;  2KKN A;  3H63 A;  4UT3 A;  5IOH A;  1V73 A;  3C5W C;  4MP0 A;  4XPN A;  1HO5 A;  4J6O A;  4H2F A;  2HYP A;  3RQZ A;  4O5G A;  3GVE A;  4Q7F A;  1WAR A;  3PSN A;  3H60 A;  1XZW A;  3DSD A;  2DXN A;  2AHD A;  3CK2 A;  3ICF A;  3E7A A;  2USH A;  4JA9 A;  3K7W C;  3EGH A;  2WDF A;  4ORA A;  2NYL C;  3H66 A;  2HY1 A;  3TGH A;  5JPE A;  2P6B A;  2YEQ A;  1Z2W A;  4OR9 A;  3EGG A;  3C9F A;  3DSC A;  2YVT A;  3ZTV A;  1II7 A;  3ZU0 A;  1FJM A;  4FCX A;  3E0J A;  2IAE C;  3N5U A;  3QG5 C;  3H64 A;  4G9J A;  2IE3 C;  4ORB A;  3H69 A;  3FLO A;  2QJC A;  4IL1 A;  4O43 A;  4H1S A;  1QHW A;  3QFO A;  2A22 A;  3E7B A;  2DFJ A;  1S8E A;  2O8G A;  2ZBM A;  1WAO 1;  3H61 A;  1S95 A;  3IB7 A;  5JJT A;  4FBW A;  1AUI A;  1KBP A;  2ZOA A;  2ZO9 B;  4H2G A;  1XM7 A;  1OIE A;  4DHL A;  4HD0 A;  3IVD A;  2QFR A;  1S3N A;  5JPF A;  3IB8 A;  4TUG A;  1OID A;  4H1Y P;  1MF8 A;  4LAC C;  2CV9 A;  2GJU A;  2WDE A;  4M0V A;  3JYF A;  3THN A;  3QFK A;  2Z1A A;  4YKE A;  2NPP C;  1USH A;  3FGA C;  4FBK A;  4I5L C;  3PSO A;  4ORC A;  4FBQ A;  3RL4 A;  3P71 C;  5HPE A;  3KBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...