3H67A

Catalytic domain of human serine/threonine phosphatase 5 (pp5c)with two zn2+ atoms complexed with cantharidic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
315
structure length
315
Chain Sequence
YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase 5
total genus 113
structure length 315
sequence length 315
chains with identical sequence D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3h67A00
4H2GA 1W24A 1II7A 1XM7A 4JA7A 4H2BA 3H66A 3IVDA 1WAO1 4XPNA 4HD0A 2QFRA 3H60A 4FBWA 4F0ZA 2BQ8X 2IAEC 3V4YA 3HVQA 3PSOA 4KKZA 4UT3B 3EGHA 1IT6A 1U32A 4V0XA 2CV9A 2P6BA 3QG5C 3QFOA 1MF8A 3E7AA 4Q7FA 2JOGA 4MOYA 3QFMA 1OI8A 1USHA 2ZBMA 3T1IA 5JPFA 4V0VA 2NPPC 4TUIA 2Q8UA 1UF3A 4J6OA 4ZVZA 1UTEA 2O8AA 4FCXA 4MOVA 4IYPC 3IB7A 1WARA 2NYLC 4DT2A 1V73A 2KKNA 5INBA 3DSCA 4IL1A 3KBPA 4NZVA 3C9FA 3ICFA 2Z06A 2DFJA 3K7VC 4H1SA 4V0WA 2YVTA 2R17A 3C5WC 3IB8A 4H2IA 2GJUA 1OIEA 1S95A 3H64A 4I5NC 4O4KA 2QJCA 3JYFA 1Z2XA 2Z1AA 1S70A 2QFPA 3IVEA 3H67A 1TCOA 3P71C 1M63A 5IOHA 1OIDA 4LTYA 4M0VA 5B8IA 2A22A 3N5UA 4O5GA 5C1VA 2HYOA 3RL3A 3H62B 3ZU0A 5F3WA 2HY1A 1S8EA 3AV0A 5JJTA 3H69A 3RL4A 5GTUA 3LL8A 2O8GA 4B2OA 2IE3C 1KBPA 4ORBA 3TGHA 4DHLA 3FGAC 1XZWA 1AUIA 3H63A 4ORCA 4JA9A 3DSDA 1SU1A 3QFNA 2IE4C 4UWQA 3RL5A 2XMOA 4WWLA 4OR9A 3DW8C 2Z72A 4O43A 1T70A 4H2FA 5EQVA 1QFCA 1T71A 4O24A 4DSYA 4ZX2A 1HP1A 1S3NA 4LU9A 4LACC 1Z2WA 2NXFA 2NYMC 1HO5A 2WDCA 3THOB 4G9JA 4FBQA 3GVEA 3QFKA 2WDEA 4YKEA 4ORAA 3RQZA 3E7BA 3AUZA 1NNWA 1S3MA 1G5BA 3ZTVA 4H1YP 5JPEA 3H61A 4KBPA 4FBKA 5HPEA 2BCDA 4UT3A 4MP0A 4UT2A 3THNA 5DNYA 2BDXA 2WDDA 1FJMA 2WDFA 1QHWA 1JK7A 5J28A 1S3LA 3CK2A 3EGGA 4TUGA 3PSNA 3H68A 3K7WC 2AHDA 1HPUA 2HYPA 4I5LC 2USHA
chains in the Genus database with same CATH superfamily
4H2GA 1W24A 1II7A 1XM7A 4JA7A 4H2BA 3H66A 3IVDA 1WAO1 4XPNA 4HD0A 2QFRA 3H60A 4FBWA 4F0ZA 2BQ8X 2IAEC 3V4YA 3HVQA 3PSOA 4KKZA 4UT3B 3EGHA 1IT6A 1U32A 4V0XA 2CV9A 2P6BA 3QG5C 3QFOA 1MF8A 3E7AA 4Q7FA 2JOGA 4MOYA 3QFMA 1OI8A 1USHA 2ZBMA 3T1IA 5JPFA 4V0VA 2NPPC 4TUIA 2Q8UA 2YEQA 1UF3A 4J6OA 1UTEA 4ZVZA 2O8AA 4FCXA 2ZOAA 4MOVA 4IYPC 3IB7A 1WARA 2NYLC 4DT2A 1V73A 2KKNA 5INBA 3DSCA 4IL1A 3KBPA 4NZVA 3C9FA 3ICFA 2Z06A 2DFJA 3K7VC 4H1SA 4V0WA 2YVTA 2DXLA 2R17A 3C5WC 3IB8A 4H2IA 2GJUA 1OIEA 1S95A 3H64A 4I5NC 4O4KA 2QJCA 3JYFA 1Z2XA 2Z1AA 1S70A 2QFPA 3IVEA 3H67A 1TCOA 3P71C 1M63A 5IOHA 1OIDA 4LTYA 4M0VA 5B8IA 2A22A 3N5UA 4O5GA 5C1VA 2HYOA 3RL3A 3H62B 3ZU0A 5F3WA 2HY1A 1S8EA 3AV0A 5JJTA 3H69A 3RL4A 5GTUA 3LL8A 2O8GA 4B2OA 2IE3C 1KBPA 4ORBA 3TGHA 3E0JA 4DHLA 3FGAC 1XZWA 1AUIA 3H63A 4ORCA 4JA9A 3DSDA 1SU1A 3QFNA 2DXNA 2IE4C 4UWQA 3RL5A 2XMOA 4WWLA 4OR9A 3DW8C 2Z72A 4O43A 1T70A 4H2FA 5EQVA 1QFCA 1T71A 4O24A 4DSYA 4ZX2A 1HP1A 1S3NA 4LU9A 3D03A 4LACC 1Z2WA 2NXFA 2NYMC 1HO5A 2WDCA 3THOB 4G9JA 4FBQA 3GVEA 3FLOA 2WDEA 3QFKA 4ORAA 4YKEA 3RQZA 3E7BA 3AUZA 1NNWA 1S3MA 1G5BA 3ZTVA 4H1YP 5JPEA 3H61A 4KBPA 4FBKA 5HPEA 2BCDA 4UT3A 4MP0A 4UT2A 3THNA 5DNYA 2BDXA 2WDDA 1FJMA 2WDFA 1QHWA 1JK7A 5J28A 1S3LA 3CK2A 3EGGA 4TUGA 3PSNA 3H68A 3K7WC 2AHDA 1HPUA 2HYPA 4I5LC 2ZO9B 2USHA
chains in the Genus database with same CATH topology
4H2GA 1W24A 1II7A 1XM7A 4JA7A 4H2BA 3H66A 3IVDA 1WAO1 4XPNA 4HD0A 2QFRA 3H60A 4FBWA 4F0ZA 2BQ8X 2IAEC 3V4YA 3HVQA 3PSOA 4KKZA 4UT3B 3EGHA 1IT6A 1U32A 4V0XA 2CV9A 2P6BA 3QG5C 3QFOA 1MF8A 3E7AA 4Q7FA 2JOGA 4MOYA 3QFMA 1OI8A 1USHA 2ZBMA 3T1IA 5JPFA 4V0VA 2NPPC 4TUIA 2Q8UA 2YEQA 1UF3A 4J6OA 1UTEA 4ZVZA 2O8AA 4FCXA 2ZOAA 4MOVA 4IYPC 3IB7A 1WARA 2NYLC 4DT2A 1V73A 2KKNA 5INBA 3DSCA 4IL1A 3KBPA 4NZVA 3C9FA 3ICFA 2Z06A 2DFJA 3K7VC 4H1SA 4V0WA 2YVTA 2DXLA 2R17A 3C5WC 3IB8A 4H2IA 2GJUA 1OIEA 1S95A 3H64A 4I5NC 4O4KA 2QJCA 3JYFA 1Z2XA 2Z1AA 1S70A 2QFPA 3IVEA 3H67A 1TCOA 3P71C 1M63A 5IOHA 1OIDA 4LTYA 4M0VA 5B8IA 2A22A 3N5UA 4O5GA 5C1VA 2HYOA 3RL3A 3H62B 3ZU0A 5F3WA 2HY1A 1S8EA 3AV0A 5JJTA 3H69A 3RL4A 5GTUA 3LL8A 2O8GA 4B2OA 2IE3C 1KBPA 4ORBA 3TGHA 3E0JA 4DHLA 3FGAC 1XZWA 1AUIA 3H63A 4ORCA 4JA9A 3DSDA 1SU1A 3QFNA 2DXNA 2IE4C 4UWQA 3RL5A 2XMOA 4WWLA 4OR9A 3DW8C 2Z72A 4O43A 1T70A 4H2FA 5EQVA 1QFCA 1T71A 4O24A 4DSYA 4ZX2A 1HP1A 1S3NA 4LU9A 3D03A 4LACC 1Z2WA 2NXFA 2NYMC 1HO5A 2WDCA 3THOB 4G9JA 4FBQA 3GVEA 3FLOA 2WDEA 3QFKA 4ORAA 4YKEA 3RQZA 3E7BA 3AUZA 1NNWA 1S3MA 1G5BA 3ZTVA 4H1YP 5JPEA 3H61A 4KBPA 4FBKA 5HPEA 2BCDA 4UT3A 4MP0A 4UT2A 3THNA 5DNYA 2BDXA 2WDDA 1FJMA 2WDFA 1QHWA 1JK7A 5J28A 1S3LA 3CK2A 3EGGA 4TUGA 3PSNA 3H68A 3K7WC 2AHDA 1HPUA 2HYPA 4I5LC 2ZO9B 2USHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2G A;  1W24 A;  1II7 A;  1XM7 A;  4JA7 A;  4H2B A;  3H66 A;  3IVD A;  1WAO 1;  4XPN A;  4HD0 A;  2QFR A;  3H60 A;  4FBW A;  4F0Z A;  2BQ8 X;  2IAE C;  3V4Y A;  3HVQ A;  3PSO A;  4KKZ A;  4UT3 B;  3EGH A;  1IT6 A;  1U32 A;  4V0X A;  2CV9 A;  2P6B A;  3QG5 C;  3QFO A;  1MF8 A;  3E7A A;  4Q7F A;  2JOG A;  4MOY A;  3QFM A;  1OI8 A;  1USH A;  2ZBM A;  3T1I A;  5JPF A;  4V0V A;  2NPP C;  4TUI A;  2Q8U A;  1UF3 A;  4J6O A;  4ZVZ A;  1UTE A;  2O8A A;  4FCX A;  4MOV A;  4IYP C;  3IB7 A;  1WAR A;  2NYL C;  4DT2 A;  1V73 A;  2KKN A;  5INB A;  3DSC A;  4IL1 A;  3KBP A;  4NZV A;  3C9F A;  3ICF A;  2Z06 A;  2DFJ A;  3K7V C;  4H1S A;  4V0W A;  2YVT A;  2R17 A;  3C5W C;  3IB8 A;  4H2I A;  2GJU A;  1OIE A;  1S95 A;  3H64 A;  4I5N C;  4O4K A;  2QJC A;  3JYF A;  1Z2X A;  2Z1A A;  1S70 A;  2QFP A;  3IVE A;  3H67 A;  1TCO A;  3P71 C;  1M63 A;  5IOH A;  1OID A;  4LTY A;  4M0V A;  5B8I A;  2A22 A;  3N5U A;  4O5G A;  5C1V A;  2HYO A;  3RL3 A;  3H62 B;  3ZU0 A;  5F3W A;  2HY1 A;  1S8E A;  3AV0 A;  5JJT A;  3H69 A;  3RL4 A;  5GTU A;  3LL8 A;  2O8G A;  4B2O A;  2IE3 C;  1KBP A;  4ORB A;  3TGH A;  4DHL A;  3FGA C;  1XZW A;  1AUI A;  3H63 A;  4ORC A;  4JA9 A;  3DSD A;  1SU1 A;  3QFN A;  2IE4 C;  4UWQ A;  3RL5 A;  2XMO A;  4WWL A;  4OR9 A;  3DW8 C;  2Z72 A;  4O43 A;  1T70 A;  4H2F A;  5EQV A;  1QFC A;  1T71 A;  4O24 A;  4DSY A;  4ZX2 A;  1HP1 A;  1S3N A;  4LU9 A;  4LAC C;  1Z2W A;  2NXF A;  2NYM C;  1HO5 A;  2WDC A;  3THO B;  4G9J A;  4FBQ A;  3GVE A;  3QFK A;  2WDE A;  4YKE A;  4ORA A;  3RQZ A;  3E7B A;  3AUZ A;  1NNW A;  1S3M A;  1G5B A;  3ZTV A;  4H1Y P;  5JPE A;  3H61 A;  4KBP A;  4FBK A;  5HPE A;  2BCD A;  4UT3 A;  4MP0 A;  4UT2 A;  3THN A;  5DNY A;  2BDX A;  2WDD A;  1FJM A;  2WDF A;  1QHW A;  1JK7 A;  5J28 A;  1S3L A;  3CK2 A;  3EGG A;  4TUG A;  3PSN A;  3H68 A;  3K7W C;  2AHD A;  1HPU A;  2HYP A;  4I5L C;  2USH A; 
#chains in the Genus database with same CATH topology
 4H2G A;  1W24 A;  1II7 A;  1XM7 A;  4JA7 A;  4H2B A;  3H66 A;  3IVD A;  1WAO 1;  4XPN A;  4HD0 A;  2QFR A;  3H60 A;  4FBW A;  4F0Z A;  2BQ8 X;  2IAE C;  3V4Y A;  3HVQ A;  3PSO A;  4KKZ A;  4UT3 B;  3EGH A;  1IT6 A;  1U32 A;  4V0X A;  2CV9 A;  2P6B A;  3QG5 C;  3QFO A;  1MF8 A;  3E7A A;  4Q7F A;  2JOG A;  4MOY A;  3QFM A;  1OI8 A;  1USH A;  2ZBM A;  3T1I A;  5JPF A;  4V0V A;  2NPP C;  4TUI A;  2Q8U A;  2YEQ A;  1UF3 A;  4J6O A;  1UTE A;  4ZVZ A;  2O8A A;  4FCX A;  2ZOA A;  4MOV A;  4IYP C;  3IB7 A;  1WAR A;  2NYL C;  4DT2 A;  1V73 A;  2KKN A;  5INB A;  3DSC A;  4IL1 A;  3KBP A;  4NZV A;  3C9F A;  3ICF A;  2Z06 A;  2DFJ A;  3K7V C;  4H1S A;  4V0W A;  2YVT A;  2DXL A;  2R17 A;  3C5W C;  3IB8 A;  4H2I A;  2GJU A;  1OIE A;  1S95 A;  3H64 A;  4I5N C;  4O4K A;  2QJC A;  3JYF A;  1Z2X A;  2Z1A A;  1S70 A;  2QFP A;  3IVE A;  3H67 A;  1TCO A;  3P71 C;  1M63 A;  5IOH A;  1OID A;  4LTY A;  4M0V A;  5B8I A;  2A22 A;  3N5U A;  4O5G A;  5C1V A;  2HYO A;  3RL3 A;  3H62 B;  3ZU0 A;  5F3W A;  2HY1 A;  1S8E A;  3AV0 A;  5JJT A;  3H69 A;  3RL4 A;  5GTU A;  3LL8 A;  2O8G A;  4B2O A;  2IE3 C;  1KBP A;  4ORB A;  3TGH A;  3E0J A;  4DHL A;  3FGA C;  1XZW A;  1AUI A;  3H63 A;  4ORC A;  4JA9 A;  3DSD A;  1SU1 A;  3QFN A;  2DXN A;  2IE4 C;  4UWQ A;  3RL5 A;  2XMO A;  4WWL A;  4OR9 A;  3DW8 C;  2Z72 A;  4O43 A;  1T70 A;  4H2F A;  5EQV A;  1QFC A;  1T71 A;  4O24 A;  4DSY A;  4ZX2 A;  1HP1 A;  1S3N A;  4LU9 A;  3D03 A;  4LAC C;  1Z2W A;  2NXF A;  2NYM C;  1HO5 A;  2WDC A;  3THO B;  4G9J A;  4FBQ A;  3GVE A;  3FLO A;  2WDE A;  3QFK A;  4ORA A;  4YKE A;  3RQZ A;  3E7B A;  3AUZ A;  1NNW A;  1S3M A;  1G5B A;  3ZTV A;  4H1Y P;  5JPE A;  3H61 A;  4KBP A;  4FBK A;  5HPE A;  2BCD A;  4UT3 A;  4MP0 A;  4UT2 A;  3THN A;  5DNY A;  2BDX A;  2WDD A;  1FJM A;  2WDF A;  1QHW A;  1JK7 A;  5J28 A;  1S3L A;  3CK2 A;  3EGG A;  4TUG A;  3PSN A;  3H68 A;  3K7W C;  2AHD A;  1HPU A;  2HYP A;  4I5L C;  2ZO9 B;  2USH A; 
#chains in the Genus database with same CATH homology
 4H2G A;  1W24 A;  1II7 A;  1XM7 A;  4JA7 A;  4H2B A;  3H66 A;  3IVD A;  1WAO 1;  4XPN A;  4HD0 A;  2QFR A;  3H60 A;  4FBW A;  4F0Z A;  2BQ8 X;  2IAE C;  3V4Y A;  3HVQ A;  3PSO A;  4KKZ A;  4UT3 B;  3EGH A;  1IT6 A;  1U32 A;  4V0X A;  2CV9 A;  2P6B A;  3QG5 C;  3QFO A;  1MF8 A;  3E7A A;  4Q7F A;  2JOG A;  4MOY A;  3QFM A;  1OI8 A;  1USH A;  2ZBM A;  3T1I A;  5JPF A;  4V0V A;  2NPP C;  4TUI A;  2Q8U A;  2YEQ A;  1UF3 A;  4J6O A;  1UTE A;  4ZVZ A;  2O8A A;  4FCX A;  2ZOA A;  4MOV A;  4IYP C;  3IB7 A;  1WAR A;  2NYL C;  4DT2 A;  1V73 A;  2KKN A;  5INB A;  3DSC A;  4IL1 A;  3KBP A;  4NZV A;  3C9F A;  3ICF A;  2Z06 A;  2DFJ A;  3K7V C;  4H1S A;  4V0W A;  2YVT A;  2DXL A;  2R17 A;  3C5W C;  3IB8 A;  4H2I A;  2GJU A;  1OIE A;  1S95 A;  3H64 A;  4I5N C;  4O4K A;  2QJC A;  3JYF A;  1Z2X A;  2Z1A A;  1S70 A;  2QFP A;  3IVE A;  3H67 A;  1TCO A;  3P71 C;  1M63 A;  5IOH A;  1OID A;  4LTY A;  4M0V A;  5B8I A;  2A22 A;  3N5U A;  4O5G A;  5C1V A;  2HYO A;  3RL3 A;  3H62 B;  3ZU0 A;  5F3W A;  2HY1 A;  1S8E A;  3AV0 A;  5JJT A;  3H69 A;  3RL4 A;  5GTU A;  3LL8 A;  2O8G A;  4B2O A;  2IE3 C;  1KBP A;  4ORB A;  3TGH A;  3E0J A;  4DHL A;  3FGA C;  1XZW A;  1AUI A;  3H63 A;  4ORC A;  4JA9 A;  3DSD A;  1SU1 A;  3QFN A;  2DXN A;  2IE4 C;  4UWQ A;  3RL5 A;  2XMO A;  4WWL A;  4OR9 A;  3DW8 C;  2Z72 A;  4O43 A;  1T70 A;  4H2F A;  5EQV A;  1QFC A;  1T71 A;  4O24 A;  4DSY A;  4ZX2 A;  1HP1 A;  1S3N A;  4LU9 A;  3D03 A;  4LAC C;  1Z2W A;  2NXF A;  2NYM C;  1HO5 A;  2WDC A;  3THO B;  4G9J A;  4FBQ A;  3GVE A;  3FLO A;  2WDE A;  3QFK A;  4ORA A;  4YKE A;  3RQZ A;  3E7B A;  3AUZ A;  1NNW A;  1S3M A;  1G5B A;  3ZTV A;  4H1Y P;  5JPE A;  3H61 A;  4KBP A;  4FBK A;  5HPE A;  2BCD A;  4UT3 A;  4MP0 A;  4UT2 A;  3THN A;  5DNY A;  2BDX A;  2WDD A;  1FJM A;  2WDF A;  1QHW A;  1JK7 A;  5J28 A;  1S3L A;  3CK2 A;  3EGG A;  4TUG A;  3PSN A;  3H68 A;  3K7W C;  2AHD A;  1HPU A;  2HYP A;  4I5L C;  2ZO9 B;  2USH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...