4MP0A

Structure of a second nuclear pp1 holoenzyme, crystal form 2
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
295
structure length
295
Chain Sequence
SLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Understanding the antagonism of retinoblastoma protein dephosphorylation by PNUTS provides insights into the PP1 regulatory code.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 295
sequence length 295
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4mp0A00
3GVEA 5IOHA 2QFRA 3RL4A 4TUIA 4DHLA 1JK7A 3H60A 3QFOA 3RL3A 1WARA 1M63A 2NYLC 2HYPA 5EQVA 2QFPA 3AUZA 4I5LC 3RQZA 2Z1AA 2DFJA 1KBPA 1FJMA 4O24A 2JOGA 4IYPC 1QFCA 3P71C 3T1IA 1T71A 1S8EA 3DW8C 4H2FA 1S3MA 5C1VA 1Z2WA 4MP0A 1XZWA 4LACC 4FBKA 4J6OA 2NXFA 1XM7A 2O8GA 4FCXA 3K7WC 3QFNA 5DNYA 3H66A 3TGHA 1HP1A 1OIEA 4UT2A 2WDDA 3DSDA 4LTYA 3PSNA 4ZVZA 1WAO1 4O4KA 1USHA 3HVQA 4NZVA 5JPFA 2KKNA 3RL5A 2IAEC 4V0XA 4YKEA 4UT3B 4DSYA 4ZX2A 3QFMA 2A22A 1UTEA 2AHDA 4FBWA 4FBQA 1S95A 3H69A 3AV0A 2YVTA 3E7BA 1TCOA 3IB7A 2R17A 2QJCA 1S3LA 4H1SA 1QHWA 1U32A 4UWQA 3DSCA 4OR9A 1AUIA 5HPEA 3H64A 4I5NC 3QFKA 4LU9A 1OI8A 2NYMC 1V73A 3IVDA 2WDCA 2XMOA 4KBPA 3ZU0A 3E7AA 4ORBA 2ZBMA 3EGGA 4O5GA 4DT2A 1OIDA 3THOB 1UF3A 4H2BA 4H2IA 4F0ZA 4JA9A 3EGHA 1S70A 2GJUA 5INBA 2WDFA 1NNWA 3IVEA 1T70A 3V4YA 5JJTA 3QG5C 3H68A 4MOVA 4M0VA 2Q8UA 4B2OA 2IE4C 4UT3A 4JA7A 2NPPC 4G9JA 3H61A 1SU1A 4XPNA 1HPUA 3PSOA 2BDXA 4Q7FA 1G5BA 2BQ8X 4ORAA 1II7A 5J28A 3KBPA 3IB8A 5JPEA 4MOYA 3FGAC 2O8AA 3H63A 4ORCA 4V0WA 2Z72A 3LL8A 2HY1A 3THNA 5GTUA 3JYFA 2USHA 2WDEA 3C9FA 5F3WA 2CV9A 3H67A 4HD0A 2P6BA 1MF8A 4H1YP 2IE3C 2BCDA 3ZTVA 1HO5A 4V0VA 1Z2XA 5B8IA 1W24A 4H2GA 4IL1A 4TUGA 3N5UA 3CK2A 1IT6A 3K7VC 3ICFA 3C5WC 2HYOA 1S3NA 2Z06A 4O43A 3H62B 4KKZA 4WWLA
chains in the Genus database with same CATH superfamily
3GVEA 5IOHA 2QFRA 3RL4A 4TUIA 4DHLA 1JK7A 3H60A 3QFOA 3RL3A 1WARA 1M63A 2NYLC 2HYPA 5EQVA 2QFPA 3AUZA 4I5LC 3RQZA 2Z1AA 2DFJA 1KBPA 1FJMA 4O24A 2DXNA 2JOGA 4IYPC 1QFCA 3P71C 3T1IA 1T71A 1S8EA 3DW8C 4H2FA 1S3MA 5C1VA 1Z2WA 4MP0A 1XZWA 4LACC 4FBKA 4J6OA 2NXFA 1XM7A 2O8GA 4FCXA 3K7WC 3QFNA 5DNYA 3H66A 3TGHA 1HP1A 1OIEA 4UT2A 2WDDA 3DSDA 4LTYA 3E0JA 3PSNA 4ZVZA 1WAO1 3D03A 4O4KA 1USHA 3HVQA 4NZVA 5JPFA 2KKNA 3RL5A 2IAEC 4V0XA 4YKEA 4UT3B 4DSYA 4ZX2A 3QFMA 2A22A 1UTEA 2AHDA 4FBWA 4FBQA 1S95A 3H69A 3AV0A 2YVTA 3E7BA 1TCOA 3IB7A 2R17A 2QJCA 1S3LA 4H1SA 1QHWA 1U32A 4UWQA 3DSCA 4OR9A 1AUIA 5HPEA 3H64A 4I5NC 3QFKA 4LU9A 1OI8A 2NYMC 1V73A 3IVDA 2WDCA 2XMOA 4KBPA 3ZU0A 3E7AA 4ORBA 2ZBMA 3EGGA 4O5GA 4DT2A 1OIDA 3THOB 1UF3A 4H2BA 4H2IA 4F0ZA 4JA9A 3EGHA 1S70A 2GJUA 5INBA 2WDFA 1NNWA 2YEQA 3IVEA 1T70A 3V4YA 5JJTA 3QG5C 3H68A 4MOVA 4M0VA 2Q8UA 4B2OA 2IE4C 4UT3A 4JA7A 2NPPC 4G9JA 3H61A 1SU1A 4XPNA 1HPUA 3PSOA 2BDXA 4Q7FA 1G5BA 2BQ8X 4ORAA 3FLOA 1II7A 5J28A 3KBPA 3IB8A 5JPEA 4MOYA 3FGAC 2O8AA 3H63A 4ORCA 4V0WA 2Z72A 3LL8A 2HY1A 3THNA 5GTUA 3JYFA 2USHA 2WDEA 3C9FA 5F3WA 2CV9A 3H67A 4HD0A 2P6BA 2ZOAA 1MF8A 4H1YP 2IE3C 2BCDA 3ZTVA 1HO5A 2DXLA 1Z2XA 4V0VA 5B8IA 1W24A 4H2GA 4IL1A 4TUGA 3N5UA 3CK2A 2ZO9B 1IT6A 3K7VC 3ICFA 3C5WC 2HYOA 1S3NA 2Z06A 4O43A 3H62B 4KKZA 4WWLA
chains in the Genus database with same CATH topology
3GVEA 5IOHA 2QFRA 3RL4A 4TUIA 4DHLA 1JK7A 3H60A 3QFOA 3RL3A 1WARA 1M63A 2NYLC 2HYPA 5EQVA 2QFPA 3AUZA 4I5LC 3RQZA 2Z1AA 2DFJA 1KBPA 1FJMA 4O24A 2DXNA 2JOGA 4IYPC 1QFCA 3P71C 3T1IA 1T71A 1S8EA 3DW8C 4H2FA 1S3MA 5C1VA 1Z2WA 4MP0A 1XZWA 4LACC 4FBKA 4J6OA 2NXFA 1XM7A 2O8GA 4FCXA 3K7WC 3QFNA 5DNYA 3H66A 3TGHA 1HP1A 1OIEA 4UT2A 2WDDA 3DSDA 4LTYA 3E0JA 3PSNA 4ZVZA 1WAO1 3D03A 4O4KA 1USHA 3HVQA 4NZVA 5JPFA 2KKNA 3RL5A 2IAEC 4V0XA 4YKEA 4UT3B 4DSYA 4ZX2A 3QFMA 2A22A 1UTEA 2AHDA 4FBWA 4FBQA 1S95A 3H69A 3AV0A 2YVTA 3E7BA 1TCOA 3IB7A 2R17A 2QJCA 1S3LA 4H1SA 1QHWA 1U32A 4UWQA 3DSCA 4OR9A 1AUIA 5HPEA 3H64A 4I5NC 3QFKA 4LU9A 1OI8A 2NYMC 1V73A 3IVDA 2WDCA 2XMOA 4KBPA 3ZU0A 3E7AA 4ORBA 2ZBMA 3EGGA 4O5GA 4DT2A 1OIDA 3THOB 1UF3A 4H2BA 4H2IA 4F0ZA 4JA9A 3EGHA 1S70A 2GJUA 5INBA 2WDFA 1NNWA 2YEQA 3IVEA 1T70A 3V4YA 5JJTA 3QG5C 3H68A 4MOVA 4M0VA 2Q8UA 4B2OA 2IE4C 4UT3A 4JA7A 2NPPC 4G9JA 3H61A 1SU1A 4XPNA 1HPUA 3PSOA 2BDXA 4Q7FA 1G5BA 2BQ8X 4ORAA 3FLOA 1II7A 5J28A 3KBPA 3IB8A 5JPEA 4MOYA 3FGAC 2O8AA 3H63A 4ORCA 4V0WA 2Z72A 3LL8A 2HY1A 3THNA 5GTUA 3JYFA 2USHA 2WDEA 3C9FA 5F3WA 2CV9A 3H67A 4HD0A 2P6BA 2ZOAA 1MF8A 4H1YP 2IE3C 2BCDA 3ZTVA 1HO5A 2DXLA 1Z2XA 4V0VA 5B8IA 1W24A 4H2GA 4IL1A 4TUGA 3N5UA 3CK2A 2ZO9B 1IT6A 3K7VC 3ICFA 3C5WC 2HYOA 1S3NA 2Z06A 4O43A 3H62B 4KKZA 4WWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVE A;  5IOH A;  2QFR A;  3RL4 A;  4TUI A;  4DHL A;  1JK7 A;  3H60 A;  3QFO A;  3RL3 A;  1WAR A;  1M63 A;  2NYL C;  2HYP A;  5EQV A;  2QFP A;  3AUZ A;  4I5L C;  3RQZ A;  2Z1A A;  2DFJ A;  1KBP A;  1FJM A;  4O24 A;  2JOG A;  4IYP C;  1QFC A;  3P71 C;  3T1I A;  1T71 A;  1S8E A;  3DW8 C;  4H2F A;  1S3M A;  5C1V A;  1Z2W A;  4MP0 A;  1XZW A;  4LAC C;  4FBK A;  4J6O A;  2NXF A;  1XM7 A;  2O8G A;  4FCX A;  3K7W C;  3QFN A;  5DNY A;  3H66 A;  3TGH A;  1HP1 A;  1OIE A;  4UT2 A;  2WDD A;  3DSD A;  4LTY A;  3PSN A;  4ZVZ A;  1WAO 1;  4O4K A;  1USH A;  3HVQ A;  4NZV A;  5JPF A;  2KKN A;  3RL5 A;  2IAE C;  4V0X A;  4YKE A;  4UT3 B;  4DSY A;  4ZX2 A;  3QFM A;  2A22 A;  1UTE A;  2AHD A;  4FBW A;  4FBQ A;  1S95 A;  3H69 A;  3AV0 A;  2YVT A;  3E7B A;  1TCO A;  3IB7 A;  2R17 A;  2QJC A;  1S3L A;  4H1S A;  1QHW A;  1U32 A;  4UWQ A;  3DSC A;  4OR9 A;  1AUI A;  5HPE A;  3H64 A;  4I5N C;  3QFK A;  4LU9 A;  1OI8 A;  2NYM C;  1V73 A;  3IVD A;  2WDC A;  2XMO A;  4KBP A;  3ZU0 A;  3E7A A;  4ORB A;  2ZBM A;  3EGG A;  4O5G A;  4DT2 A;  1OID A;  3THO B;  1UF3 A;  4H2B A;  4H2I A;  4F0Z A;  4JA9 A;  3EGH A;  1S70 A;  2GJU A;  5INB A;  2WDF A;  1NNW A;  3IVE A;  1T70 A;  3V4Y A;  5JJT A;  3QG5 C;  3H68 A;  4MOV A;  4M0V A;  2Q8U A;  4B2O A;  2IE4 C;  4UT3 A;  4JA7 A;  2NPP C;  4G9J A;  3H61 A;  1SU1 A;  4XPN A;  1HPU A;  3PSO A;  2BDX A;  4Q7F A;  1G5B A;  2BQ8 X;  4ORA A;  1II7 A;  5J28 A;  3KBP A;  3IB8 A;  5JPE A;  4MOY A;  3FGA C;  2O8A A;  3H63 A;  4ORC A;  4V0W A;  2Z72 A;  3LL8 A;  2HY1 A;  3THN A;  5GTU A;  3JYF A;  2USH A;  2WDE A;  3C9F A;  5F3W A;  2CV9 A;  3H67 A;  4HD0 A;  2P6B A;  1MF8 A;  4H1Y P;  2IE3 C;  2BCD A;  3ZTV A;  1HO5 A;  4V0V A;  1Z2X A;  5B8I A;  1W24 A;  4H2G A;  4IL1 A;  4TUG A;  3N5U A;  3CK2 A;  1IT6 A;  3K7V C;  3ICF A;  3C5W C;  2HYO A;  1S3N A;  2Z06 A;  4O43 A;  3H62 B;  4KKZ A;  4WWL A; 
#chains in the Genus database with same CATH topology
 3GVE A;  5IOH A;  2QFR A;  3RL4 A;  4TUI A;  4DHL A;  1JK7 A;  3H60 A;  3QFO A;  3RL3 A;  1WAR A;  1M63 A;  2NYL C;  2HYP A;  5EQV A;  2QFP A;  3AUZ A;  4I5L C;  3RQZ A;  2Z1A A;  2DFJ A;  1KBP A;  1FJM A;  4O24 A;  2DXN A;  2JOG A;  4IYP C;  1QFC A;  3P71 C;  3T1I A;  1T71 A;  1S8E A;  3DW8 C;  4H2F A;  1S3M A;  5C1V A;  1Z2W A;  4MP0 A;  1XZW A;  4LAC C;  4FBK A;  4J6O A;  2NXF A;  1XM7 A;  2O8G A;  4FCX A;  3K7W C;  3QFN A;  5DNY A;  3H66 A;  3TGH A;  1HP1 A;  1OIE A;  4UT2 A;  2WDD A;  3DSD A;  4LTY A;  3E0J A;  3PSN A;  4ZVZ A;  1WAO 1;  3D03 A;  4O4K A;  1USH A;  3HVQ A;  4NZV A;  5JPF A;  2KKN A;  3RL5 A;  2IAE C;  4V0X A;  4YKE A;  4UT3 B;  4DSY A;  4ZX2 A;  3QFM A;  2A22 A;  1UTE A;  2AHD A;  4FBW A;  4FBQ A;  1S95 A;  3H69 A;  3AV0 A;  2YVT A;  3E7B A;  1TCO A;  3IB7 A;  2R17 A;  2QJC A;  1S3L A;  4H1S A;  1QHW A;  1U32 A;  4UWQ A;  3DSC A;  4OR9 A;  1AUI A;  5HPE A;  3H64 A;  4I5N C;  3QFK A;  4LU9 A;  1OI8 A;  2NYM C;  1V73 A;  3IVD A;  2WDC A;  2XMO A;  4KBP A;  3ZU0 A;  3E7A A;  4ORB A;  2ZBM A;  3EGG A;  4O5G A;  4DT2 A;  1OID A;  3THO B;  1UF3 A;  4H2B A;  4H2I A;  4F0Z A;  4JA9 A;  3EGH A;  1S70 A;  2GJU A;  5INB A;  2WDF A;  1NNW A;  2YEQ A;  3IVE A;  1T70 A;  3V4Y A;  5JJT A;  3QG5 C;  3H68 A;  4MOV A;  4M0V A;  2Q8U A;  4B2O A;  2IE4 C;  4UT3 A;  4JA7 A;  2NPP C;  4G9J A;  3H61 A;  1SU1 A;  4XPN A;  1HPU A;  3PSO A;  2BDX A;  4Q7F A;  1G5B A;  2BQ8 X;  4ORA A;  3FLO A;  1II7 A;  5J28 A;  3KBP A;  3IB8 A;  5JPE A;  4MOY A;  3FGA C;  2O8A A;  3H63 A;  4ORC A;  4V0W A;  2Z72 A;  3LL8 A;  2HY1 A;  3THN A;  5GTU A;  3JYF A;  2USH A;  2WDE A;  3C9F A;  5F3W A;  2CV9 A;  3H67 A;  4HD0 A;  2P6B A;  2ZOA A;  1MF8 A;  4H1Y P;  2IE3 C;  2BCD A;  3ZTV A;  1HO5 A;  2DXL A;  1Z2X A;  4V0V A;  5B8I A;  1W24 A;  4H2G A;  4IL1 A;  4TUG A;  3N5U A;  3CK2 A;  2ZO9 B;  1IT6 A;  3K7V C;  3ICF A;  3C5W C;  2HYO A;  1S3N A;  2Z06 A;  4O43 A;  3H62 B;  4KKZ A;  4WWL A; 
#chains in the Genus database with same CATH homology
 3GVE A;  5IOH A;  2QFR A;  3RL4 A;  4TUI A;  4DHL A;  1JK7 A;  3H60 A;  3QFO A;  3RL3 A;  1WAR A;  1M63 A;  2NYL C;  2HYP A;  5EQV A;  2QFP A;  3AUZ A;  4I5L C;  3RQZ A;  2Z1A A;  2DFJ A;  1KBP A;  1FJM A;  4O24 A;  2DXN A;  2JOG A;  4IYP C;  1QFC A;  3P71 C;  3T1I A;  1T71 A;  1S8E A;  3DW8 C;  4H2F A;  1S3M A;  5C1V A;  1Z2W A;  4MP0 A;  1XZW A;  4LAC C;  4FBK A;  4J6O A;  2NXF A;  1XM7 A;  2O8G A;  4FCX A;  3K7W C;  3QFN A;  5DNY A;  3H66 A;  3TGH A;  1HP1 A;  1OIE A;  4UT2 A;  2WDD A;  3DSD A;  4LTY A;  3E0J A;  3PSN A;  4ZVZ A;  1WAO 1;  3D03 A;  4O4K A;  1USH A;  3HVQ A;  4NZV A;  5JPF A;  2KKN A;  3RL5 A;  2IAE C;  4V0X A;  4YKE A;  4UT3 B;  4DSY A;  4ZX2 A;  3QFM A;  2A22 A;  1UTE A;  2AHD A;  4FBW A;  4FBQ A;  1S95 A;  3H69 A;  3AV0 A;  2YVT A;  3E7B A;  1TCO A;  3IB7 A;  2R17 A;  2QJC A;  1S3L A;  4H1S A;  1QHW A;  1U32 A;  4UWQ A;  3DSC A;  4OR9 A;  1AUI A;  5HPE A;  3H64 A;  4I5N C;  3QFK A;  4LU9 A;  1OI8 A;  2NYM C;  1V73 A;  3IVD A;  2WDC A;  2XMO A;  4KBP A;  3ZU0 A;  3E7A A;  4ORB A;  2ZBM A;  3EGG A;  4O5G A;  4DT2 A;  1OID A;  3THO B;  1UF3 A;  4H2B A;  4H2I A;  4F0Z A;  4JA9 A;  3EGH A;  1S70 A;  2GJU A;  5INB A;  2WDF A;  1NNW A;  2YEQ A;  3IVE A;  1T70 A;  3V4Y A;  5JJT A;  3QG5 C;  3H68 A;  4MOV A;  4M0V A;  2Q8U A;  4B2O A;  2IE4 C;  4UT3 A;  4JA7 A;  2NPP C;  4G9J A;  3H61 A;  1SU1 A;  4XPN A;  1HPU A;  3PSO A;  2BDX A;  4Q7F A;  1G5B A;  2BQ8 X;  4ORA A;  3FLO A;  1II7 A;  5J28 A;  3KBP A;  3IB8 A;  5JPE A;  4MOY A;  3FGA C;  2O8A A;  3H63 A;  4ORC A;  4V0W A;  2Z72 A;  3LL8 A;  2HY1 A;  3THN A;  5GTU A;  3JYF A;  2USH A;  2WDE A;  3C9F A;  5F3W A;  2CV9 A;  3H67 A;  4HD0 A;  2P6B A;  2ZOA A;  1MF8 A;  4H1Y P;  2IE3 C;  2BCD A;  3ZTV A;  1HO5 A;  2DXL A;  1Z2X A;  4V0V A;  5B8I A;  1W24 A;  4H2G A;  4IL1 A;  4TUG A;  3N5U A;  3CK2 A;  2ZO9 B;  1IT6 A;  3K7V C;  3ICF A;  3C5W C;  2HYO A;  1S3N A;  2Z06 A;  4O43 A;  3H62 B;  4KKZ A;  4WWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...