4V0VA

The crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-660)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
295
structure length
295
Chain Sequence
MLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase regulator
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
total genus 110
structure length 295
sequence length 295
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4v0vA00
3FGAC 3H67A 2XMOA 4I5LC 4V0VA 4H1YP 4YKEA 3DW8C 1UTEA 3EGGA 4H2GA 1S95A 3ZU0A 5J28A 1II7A 5JJTA 4ZVZA 3IB7A 1NNWA 3CK2A 4UWQA 4FCXA 2AHDA 3IVEA 1SU1A 4IL1A 4LU9A 4DT2A 3HVQA 3QFMA 1Z2WA 3QG5C 2NYLC 4TUIA 5JPEA 3QFOA 2USHA 3TGHA 2BCDA 4O4KA 4V0XA 5DNYA 2NXFA 1M63A 1OI8A 1JK7A 1AUIA 4HD0A 4KKZA 5B8IA 1V73A 3H63A 4UT2A 1XZWA 2P6BA 3T1IA 5IOHA 4V0WA 3E7AA 4O5GA 1WAO1 4MOVA 2HYOA 4JA7A 3H60A 3H69A 4XPNA 3RL5A 2IE4C 3DSDA 4H1SA 3H64A 2DFJA 2O8AA 3THOB 4JA9A 1QFCA 2QFPA 2HYPA 1KBPA 2IAEC 3H66A 2Z72A 3P71C 1IT6A 2NYMC 1HO5A 1G5BA 2WDFA 4FBQA 1XM7A 5C1VA 1USHA 2HY1A 3C9FA 2WDCA 3AV0A 3ZTVA 3H61A 2BDXA 3GVEA 4WWLA 1S3NA 3V4YA 3RQZA 1QHWA 4UT3A 1U32A 2GJUA 4B2OA 2Z1AA 3E7BA 4Q7FA 2Q8UA 4LACC 4DSYA 4IYPC 3THNA 2O8GA 1S70A 3RL4A 4ZX2A 2YVTA 1MF8A 2JOGA 2KKNA 3H68A 4I5NC 3QFKA 4MP0A 3IB8A 2QJCA 5HPEA 1S3MA 3ICFA 3QFNA 1HPUA 2IE3C 1Z2XA 3K7VC 3IVDA 4G9JA 4UT3B 3LL8A 4H2IA 4TUGA 1FJMA 2NPPC 4DHLA 2WDEA 4ORBA 5EQVA 3EGHA 5F3WA 4ORCA 3PSNA 3H62B 4KBPA 3PSOA 4LTYA 4ORAA 3JYFA 2CV9A 4J6OA 5GTUA 2R17A 1OIEA 2WDDA 1OIDA 1T71A 2A22A 4MOYA 4O43A 1UF3A 2QFRA 3C5WC 3AUZA 3N5UA 3RL3A 2Z06A 1WARA 4FBKA 1W24A 3DSCA 5INBA 3K7WC 4OR9A 1T70A 4FBWA 5JPFA 4NZVA 4F0ZA 4H2BA 1S3LA 4M0VA 4H2FA 2ZBMA 4O24A 2BQ8X 3KBPA 1TCOA 1HP1A 1S8EA
chains in the Genus database with same CATH superfamily
3FGAC 3H67A 2XMOA 4I5LC 4V0VA 4H1YP 4YKEA 3DW8C 1UTEA 3EGGA 4H2GA 2YEQA 1S95A 3FLOA 3ZU0A 5J28A 1II7A 5JJTA 4ZVZA 3IB7A 1NNWA 3CK2A 4UWQA 4FCXA 2AHDA 3IVEA 1SU1A 4IL1A 4LU9A 4DT2A 3HVQA 3QFMA 1Z2WA 3QG5C 2NYLC 4TUIA 5JPEA 3QFOA 2DXNA 2USHA 3TGHA 2BCDA 4O4KA 4V0XA 5DNYA 2NXFA 1M63A 1OI8A 1JK7A 1AUIA 4HD0A 4KKZA 5B8IA 1V73A 3H63A 4UT2A 1XZWA 2P6BA 3T1IA 5IOHA 4V0WA 3E7AA 4O5GA 1WAO1 4MOVA 2HYOA 4JA7A 3H60A 3H69A 4XPNA 3RL5A 2IE4C 3DSDA 4H1SA 3H64A 2DFJA 2O8AA 3THOB 4JA9A 1QFCA 2QFPA 2HYPA 1KBPA 2IAEC 3H66A 2Z72A 3P71C 1IT6A 2NYMC 1HO5A 1G5BA 2WDFA 4FBQA 1XM7A 5C1VA 1USHA 2HY1A 3C9FA 3E0JA 2WDCA 3AV0A 3ZTVA 3H61A 2BDXA 3GVEA 4WWLA 2ZOAA 1S3NA 3V4YA 3RQZA 1QHWA 4UT3A 1U32A 2GJUA 4B2OA 2Z1AA 3E7BA 4Q7FA 2Q8UA 4LACC 4DSYA 4IYPC 3THNA 2O8GA 1S70A 3RL4A 4ZX2A 2YVTA 1MF8A 2JOGA 2KKNA 3H68A 4I5NC 3QFKA 4MP0A 3IB8A 2QJCA 5HPEA 1S3MA 3ICFA 3QFNA 2IE3C 1HPUA 1Z2XA 3K7VC 3IVDA 4G9JA 4UT3B 3LL8A 4H2IA 4TUGA 1FJMA 2NPPC 4DHLA 2WDEA 4ORBA 5EQVA 2ZO9B 3EGHA 5F3WA 4ORCA 3PSNA 3H62B 4KBPA 3PSOA 4LTYA 4ORAA 3JYFA 2CV9A 4J6OA 5GTUA 2R17A 1OIEA 2WDDA 3D03A 1OIDA 1T71A 2A22A 4MOYA 4O43A 1UF3A 2QFRA 3AUZA 3C5WC 3N5UA 3RL3A 2DXLA 2Z06A 1WARA 4FBKA 1W24A 3DSCA 5INBA 3K7WC 4OR9A 1T70A 4FBWA 5JPFA 4NZVA 4F0ZA 4H2BA 1S3LA 4M0VA 4H2FA 2ZBMA 4O24A 2BQ8X 3KBPA 1TCOA 1HP1A 1S8EA
chains in the Genus database with same CATH topology
3FGAC 3H67A 2XMOA 4I5LC 4V0VA 4H1YP 4YKEA 3DW8C 1UTEA 3EGGA 4H2GA 2YEQA 1S95A 3FLOA 3ZU0A 5J28A 1II7A 5JJTA 4ZVZA 3IB7A 1NNWA 3CK2A 4UWQA 4FCXA 2AHDA 3IVEA 1SU1A 4IL1A 4LU9A 4DT2A 3HVQA 3QFMA 1Z2WA 3QG5C 2NYLC 4TUIA 5JPEA 3QFOA 2DXNA 2USHA 3TGHA 2BCDA 4O4KA 4V0XA 5DNYA 2NXFA 1M63A 1OI8A 1JK7A 1AUIA 4HD0A 4KKZA 5B8IA 1V73A 3H63A 4UT2A 1XZWA 2P6BA 3T1IA 5IOHA 4V0WA 3E7AA 4O5GA 1WAO1 4MOVA 2HYOA 4JA7A 3H60A 3H69A 4XPNA 3RL5A 2IE4C 3DSDA 4H1SA 3H64A 2DFJA 2O8AA 3THOB 4JA9A 1QFCA 2QFPA 2HYPA 1KBPA 2IAEC 3H66A 2Z72A 3P71C 1IT6A 2NYMC 1HO5A 1G5BA 2WDFA 4FBQA 1XM7A 5C1VA 1USHA 2HY1A 3C9FA 3E0JA 2WDCA 3AV0A 3ZTVA 3H61A 2BDXA 3GVEA 4WWLA 2ZOAA 1S3NA 3V4YA 3RQZA 1QHWA 4UT3A 1U32A 2GJUA 4B2OA 2Z1AA 3E7BA 4Q7FA 2Q8UA 4LACC 4DSYA 4IYPC 3THNA 2O8GA 1S70A 3RL4A 4ZX2A 2YVTA 1MF8A 2JOGA 2KKNA 3H68A 4I5NC 3QFKA 4MP0A 3IB8A 2QJCA 5HPEA 1S3MA 3ICFA 3QFNA 2IE3C 1HPUA 1Z2XA 3K7VC 3IVDA 4G9JA 4UT3B 3LL8A 4H2IA 4TUGA 1FJMA 2NPPC 4DHLA 2WDEA 4ORBA 5EQVA 2ZO9B 3EGHA 5F3WA 4ORCA 3PSNA 3H62B 4KBPA 3PSOA 4LTYA 4ORAA 3JYFA 2CV9A 4J6OA 5GTUA 2R17A 1OIEA 2WDDA 3D03A 1OIDA 1T71A 2A22A 4MOYA 4O43A 1UF3A 2QFRA 3AUZA 3C5WC 3N5UA 3RL3A 2DXLA 2Z06A 1WARA 4FBKA 1W24A 3DSCA 5INBA 3K7WC 4OR9A 1T70A 4FBWA 5JPFA 4NZVA 4F0ZA 4H2BA 1S3LA 4M0VA 4H2FA 2ZBMA 4O24A 2BQ8X 3KBPA 1TCOA 1HP1A 1S8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGA C;  3H67 A;  2XMO A;  4I5L C;  4V0V A;  4H1Y P;  4YKE A;  3DW8 C;  1UTE A;  3EGG A;  4H2G A;  1S95 A;  3ZU0 A;  5J28 A;  1II7 A;  5JJT A;  4ZVZ A;  3IB7 A;  1NNW A;  3CK2 A;  4UWQ A;  4FCX A;  2AHD A;  3IVE A;  1SU1 A;  4IL1 A;  4LU9 A;  4DT2 A;  3HVQ A;  3QFM A;  1Z2W A;  3QG5 C;  2NYL C;  4TUI A;  5JPE A;  3QFO A;  2USH A;  3TGH A;  2BCD A;  4O4K A;  4V0X A;  5DNY A;  2NXF A;  1M63 A;  1OI8 A;  1JK7 A;  1AUI A;  4HD0 A;  4KKZ A;  5B8I A;  1V73 A;  3H63 A;  4UT2 A;  1XZW A;  2P6B A;  3T1I A;  5IOH A;  4V0W A;  3E7A A;  4O5G A;  1WAO 1;  4MOV A;  2HYO A;  4JA7 A;  3H60 A;  3H69 A;  4XPN A;  3RL5 A;  2IE4 C;  3DSD A;  4H1S A;  3H64 A;  2DFJ A;  2O8A A;  3THO B;  4JA9 A;  1QFC A;  2QFP A;  2HYP A;  1KBP A;  2IAE C;  3H66 A;  2Z72 A;  3P71 C;  1IT6 A;  2NYM C;  1HO5 A;  1G5B A;  2WDF A;  4FBQ A;  1XM7 A;  5C1V A;  1USH A;  2HY1 A;  3C9F A;  2WDC A;  3AV0 A;  3ZTV A;  3H61 A;  2BDX A;  3GVE A;  4WWL A;  1S3N A;  3V4Y A;  3RQZ A;  1QHW A;  4UT3 A;  1U32 A;  2GJU A;  4B2O A;  2Z1A A;  3E7B A;  4Q7F A;  2Q8U A;  4LAC C;  4DSY A;  4IYP C;  3THN A;  2O8G A;  1S70 A;  3RL4 A;  4ZX2 A;  2YVT A;  1MF8 A;  2JOG A;  2KKN A;  3H68 A;  4I5N C;  3QFK A;  4MP0 A;  3IB8 A;  2QJC A;  5HPE A;  1S3M A;  3ICF A;  3QFN A;  1HPU A;  2IE3 C;  1Z2X A;  3K7V C;  3IVD A;  4G9J A;  4UT3 B;  3LL8 A;  4H2I A;  4TUG A;  1FJM A;  2NPP C;  4DHL A;  2WDE A;  4ORB A;  5EQV A;  3EGH A;  5F3W A;  4ORC A;  3PSN A;  3H62 B;  4KBP A;  3PSO A;  4LTY A;  4ORA A;  3JYF A;  2CV9 A;  4J6O A;  5GTU A;  2R17 A;  1OIE A;  2WDD A;  1OID A;  1T71 A;  2A22 A;  4MOY A;  4O43 A;  1UF3 A;  2QFR A;  3C5W C;  3AUZ A;  3N5U A;  3RL3 A;  2Z06 A;  1WAR A;  4FBK A;  1W24 A;  3DSC A;  5INB A;  3K7W C;  4OR9 A;  1T70 A;  4FBW A;  5JPF A;  4NZV A;  4F0Z A;  4H2B A;  1S3L A;  4M0V A;  4H2F A;  2ZBM A;  4O24 A;  2BQ8 X;  3KBP A;  1TCO A;  1HP1 A;  1S8E A; 
#chains in the Genus database with same CATH topology
 3FGA C;  3H67 A;  2XMO A;  4I5L C;  4V0V A;  4H1Y P;  4YKE A;  3DW8 C;  1UTE A;  3EGG A;  4H2G A;  2YEQ A;  1S95 A;  3FLO A;  3ZU0 A;  5J28 A;  1II7 A;  5JJT A;  4ZVZ A;  3IB7 A;  1NNW A;  3CK2 A;  4UWQ A;  4FCX A;  2AHD A;  3IVE A;  1SU1 A;  4IL1 A;  4LU9 A;  4DT2 A;  3HVQ A;  3QFM A;  1Z2W A;  3QG5 C;  2NYL C;  4TUI A;  5JPE A;  3QFO A;  2DXN A;  2USH A;  3TGH A;  2BCD A;  4O4K A;  4V0X A;  5DNY A;  2NXF A;  1M63 A;  1OI8 A;  1JK7 A;  1AUI A;  4HD0 A;  4KKZ A;  5B8I A;  1V73 A;  3H63 A;  4UT2 A;  1XZW A;  2P6B A;  3T1I A;  5IOH A;  4V0W A;  3E7A A;  4O5G A;  1WAO 1;  4MOV A;  2HYO A;  4JA7 A;  3H60 A;  3H69 A;  4XPN A;  3RL5 A;  2IE4 C;  3DSD A;  4H1S A;  3H64 A;  2DFJ A;  2O8A A;  3THO B;  4JA9 A;  1QFC A;  2QFP A;  2HYP A;  1KBP A;  2IAE C;  3H66 A;  2Z72 A;  3P71 C;  1IT6 A;  2NYM C;  1HO5 A;  1G5B A;  2WDF A;  4FBQ A;  1XM7 A;  5C1V A;  1USH A;  2HY1 A;  3C9F A;  3E0J A;  2WDC A;  3AV0 A;  3ZTV A;  3H61 A;  2BDX A;  3GVE A;  4WWL A;  2ZOA A;  1S3N A;  3V4Y A;  3RQZ A;  1QHW A;  4UT3 A;  1U32 A;  2GJU A;  4B2O A;  2Z1A A;  3E7B A;  4Q7F A;  2Q8U A;  4LAC C;  4DSY A;  4IYP C;  3THN A;  2O8G A;  1S70 A;  3RL4 A;  4ZX2 A;  2YVT A;  1MF8 A;  2JOG A;  2KKN A;  3H68 A;  4I5N C;  3QFK A;  4MP0 A;  3IB8 A;  2QJC A;  5HPE A;  1S3M A;  3ICF A;  3QFN A;  2IE3 C;  1HPU A;  1Z2X A;  3K7V C;  3IVD A;  4G9J A;  4UT3 B;  3LL8 A;  4H2I A;  4TUG A;  1FJM A;  2NPP C;  4DHL A;  2WDE A;  4ORB A;  5EQV A;  2ZO9 B;  3EGH A;  5F3W A;  4ORC A;  3PSN A;  3H62 B;  4KBP A;  3PSO A;  4LTY A;  4ORA A;  3JYF A;  2CV9 A;  4J6O A;  5GTU A;  2R17 A;  1OIE A;  2WDD A;  3D03 A;  1OID A;  1T71 A;  2A22 A;  4MOY A;  4O43 A;  1UF3 A;  2QFR A;  3AUZ A;  3C5W C;  3N5U A;  3RL3 A;  2DXL A;  2Z06 A;  1WAR A;  4FBK A;  1W24 A;  3DSC A;  5INB A;  3K7W C;  4OR9 A;  1T70 A;  4FBW A;  5JPF A;  4NZV A;  4F0Z A;  4H2B A;  1S3L A;  4M0V A;  4H2F A;  2ZBM A;  4O24 A;  2BQ8 X;  3KBP A;  1TCO A;  1HP1 A;  1S8E A; 
#chains in the Genus database with same CATH homology
 3FGA C;  3H67 A;  2XMO A;  4I5L C;  4V0V A;  4H1Y P;  4YKE A;  3DW8 C;  1UTE A;  3EGG A;  4H2G A;  2YEQ A;  1S95 A;  3FLO A;  3ZU0 A;  5J28 A;  1II7 A;  5JJT A;  4ZVZ A;  3IB7 A;  1NNW A;  3CK2 A;  4UWQ A;  4FCX A;  2AHD A;  3IVE A;  1SU1 A;  4IL1 A;  4LU9 A;  4DT2 A;  3HVQ A;  3QFM A;  1Z2W A;  3QG5 C;  2NYL C;  4TUI A;  5JPE A;  3QFO A;  2DXN A;  2USH A;  3TGH A;  2BCD A;  4O4K A;  4V0X A;  5DNY A;  2NXF A;  1M63 A;  1OI8 A;  1JK7 A;  1AUI A;  4HD0 A;  4KKZ A;  5B8I A;  1V73 A;  3H63 A;  4UT2 A;  1XZW A;  2P6B A;  3T1I A;  5IOH A;  4V0W A;  3E7A A;  4O5G A;  1WAO 1;  4MOV A;  2HYO A;  4JA7 A;  3H60 A;  3H69 A;  4XPN A;  3RL5 A;  2IE4 C;  3DSD A;  4H1S A;  3H64 A;  2DFJ A;  2O8A A;  3THO B;  4JA9 A;  1QFC A;  2QFP A;  2HYP A;  1KBP A;  2IAE C;  3H66 A;  2Z72 A;  3P71 C;  1IT6 A;  2NYM C;  1HO5 A;  1G5B A;  2WDF A;  4FBQ A;  1XM7 A;  5C1V A;  1USH A;  2HY1 A;  3C9F A;  3E0J A;  2WDC A;  3AV0 A;  3ZTV A;  3H61 A;  2BDX A;  3GVE A;  4WWL A;  2ZOA A;  1S3N A;  3V4Y A;  3RQZ A;  1QHW A;  4UT3 A;  1U32 A;  2GJU A;  4B2O A;  2Z1A A;  3E7B A;  4Q7F A;  2Q8U A;  4LAC C;  4DSY A;  4IYP C;  3THN A;  2O8G A;  1S70 A;  3RL4 A;  4ZX2 A;  2YVT A;  1MF8 A;  2JOG A;  2KKN A;  3H68 A;  4I5N C;  3QFK A;  4MP0 A;  3IB8 A;  2QJC A;  5HPE A;  1S3M A;  3ICF A;  3QFN A;  2IE3 C;  1HPU A;  1Z2X A;  3K7V C;  3IVD A;  4G9J A;  4UT3 B;  3LL8 A;  4H2I A;  4TUG A;  1FJM A;  2NPP C;  4DHL A;  2WDE A;  4ORB A;  5EQV A;  2ZO9 B;  3EGH A;  5F3W A;  4ORC A;  3PSN A;  3H62 B;  4KBP A;  3PSO A;  4LTY A;  4ORA A;  3JYF A;  2CV9 A;  4J6O A;  5GTU A;  2R17 A;  1OIE A;  2WDD A;  3D03 A;  1OID A;  1T71 A;  2A22 A;  4MOY A;  4O43 A;  1UF3 A;  2QFR A;  3AUZ A;  3C5W C;  3N5U A;  3RL3 A;  2DXL A;  2Z06 A;  1WAR A;  4FBK A;  1W24 A;  3DSC A;  5INB A;  3K7W C;  4OR9 A;  1T70 A;  4FBW A;  5JPF A;  4NZV A;  4F0Z A;  4H2B A;  1S3L A;  4M0V A;  4H2F A;  2ZBM A;  4O24 A;  2BQ8 X;  3KBP A;  1TCO A;  1HP1 A;  1S8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...