4V0VA

The crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-660)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
295
structure length
295
Chain Sequence
MLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase regulator
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
publication title G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
pubmed doi rcsb
source organism Mus musculus
total genus 110
structure length 295
sequence length 295
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4v0vA00
4O43A 3K7VC 4JA9A 4XPNA 2P6BA 3H67A 3AV0A 3THNA 4ZX2A 1SU1A 1OIDA 3PSOA 3V4YA 3RL4A 3CK2A 1QHWA 1S3NA 2WDEA 4ORBA 3EGHA 5DNYA 1IT6A 2IE3C 1XZWA 4UT3A 3ICFA 5JPEA 3KBPA 2O8AA 1V73A 4WWLA 3GVEA 4ORAA 1W24A 3N5UA 4LU9A 2JOGA 2R17A 4O24A 4UT2A 3QFMA 1MF8A 3H68A 2Z06A 2Z72A 4O4KA 1UTEA 2NYLC 2USHA 2CV9A 4TUIA 4IYPC 1WARA 3IB8A 3K7WC 5EQVA 1OIEA 5JJTA 3DW8C 5IOHA 3DSDA 4I5NC 4H2FA 3IB7A 4V0WA 3H60A 4UWQA 1S70A 5J28A 2NYMC 4ZVZA 3THOB 3QFNA 4MOYA 5C1VA 4JA7A 1USHA 3RL5A 4FBQA 2QJCA 1HO5A 1Z2XA 4TUGA 4KKZA 4H2GA 1NNWA 3H62B 3RQZA 4DHLA 4O5GA 3JYFA 3DSCA 2DFJA 1TCOA 4V0VA 4I5LC 3TGHA 2A22A 1HPUA 1KBPA 1S95A 3C5WC 3H63A 2WDDA 2BCDA 4NZVA 3E7BA 4H2IA 2KKNA 4DSYA 3H64A 4LACC 1AUIA 2HY1A 4YKEA 3HVQA 2NXFA 1T70A 2QFRA 3PSNA 3RL3A 2XMOA 4Q7FA 4H1YP 2BDXA 1WAO1 4HD0A 3H61A 4MP0A 3IVEA 4FBWA 4MOVA 2IAEC 4UT3B 5HPEA 2HYPA 3H66A 3QFOA 4F0ZA 4B2OA 4FBKA 1OI8A 1II7A 2O8GA 3LL8A 1M63A 3H69A 1T71A 3ZTVA 1JK7A 2NPPC 2Z1AA 1HP1A 2ZBMA 4LTYA 1FJMA 3T1IA 1S8EA 3ZU0A 4ORCA 1QFCA 4H2BA 2Q8UA 4KBPA 2AHDA 3FGAC 4M0VA 4OR9A 2WDFA 4FCXA 1XM7A 3QG5C 5F3WA 4V0XA 3P71C 2GJUA 2WDCA 4J6OA 1Z2WA 3EGGA 3AUZA 3IVDA 5INBA 1U32A 2QFPA 2YVTA 1UF3A 5B8IA 5GTUA 1S3MA 2IE4C 4DT2A 3C9FA 3E7AA 3QFKA 2BQ8X 1G5BA 4G9JA 1S3LA 4IL1A 2HYOA 4H1SA 5JPFA
chains in the Genus database with same CATH superfamily
4O43A 3K7VC 4JA9A 4XPNA 2P6BA 3H67A 3AV0A 3THNA 4ZX2A 1SU1A 1OIDA 2DXLA 3PSOA 3V4YA 3RL4A 3CK2A 1QHWA 1S3NA 2WDEA 4ORBA 3EGHA 5DNYA 1IT6A 2IE3C 1XZWA 4UT3A 3ICFA 5JPEA 3KBPA 2O8AA 1V73A 4WWLA 3GVEA 4ORAA 1W24A 3N5UA 4LU9A 2JOGA 2R17A 4O24A 4UT2A 3QFMA 1MF8A 3H68A 2Z06A 2Z72A 4O4KA 1UTEA 2NYLC 2USHA 2CV9A 4TUIA 4IYPC 1WARA 3IB8A 3K7WC 5EQVA 1OIEA 5JJTA 3DW8C 5IOHA 3DSDA 4I5NC 4H2FA 3IB7A 4V0WA 3H60A 4UWQA 1S70A 5J28A 2NYMC 4ZVZA 3THOB 3QFNA 2DXNA 4MOYA 5C1VA 4JA7A 1USHA 3RL5A 4FBQA 2QJCA 1HO5A 1Z2XA 4TUGA 4KKZA 4H2GA 1NNWA 3H62B 3RQZA 4DHLA 4O5GA 3JYFA 3DSCA 2DFJA 1TCOA 4V0VA 4I5LC 3TGHA 2A22A 1HPUA 1KBPA 1S95A 2ZOAA 3C5WC 3H63A 2WDDA 3E0JA 2BCDA 4NZVA 3E7BA 4H2IA 2KKNA 4DSYA 3H64A 4LACC 1AUIA 2HY1A 4YKEA 3HVQA 2NXFA 1T70A 2QFRA 3PSNA 3RL3A 2XMOA 4Q7FA 4H1YP 2BDXA 1WAO1 4HD0A 3H61A 4MP0A 3IVEA 4FBWA 4MOVA 2IAEC 4UT3B 5HPEA 2HYPA 3H66A 3QFOA 4F0ZA 4B2OA 4FBKA 1OI8A 1II7A 2O8GA 3FLOA 3LL8A 1M63A 3H69A 1T71A 3ZTVA 1JK7A 2NPPC 1HP1A 2Z1AA 2ZBMA 4LTYA 1FJMA 3T1IA 1S8EA 3ZU0A 4ORCA 1QFCA 4H2BA 2Q8UA 4KBPA 2AHDA 3FGAC 4M0VA 4OR9A 2WDFA 4FCXA 1XM7A 3QG5C 5F3WA 4V0XA 2ZO9B 3P71C 2GJUA 2WDCA 4J6OA 1Z2WA 3EGGA 3AUZA 3IVDA 5INBA 1U32A 2QFPA 2YVTA 1UF3A 5B8IA 5GTUA 1S3MA 2IE4C 3D03A 4DT2A 3C9FA 3E7AA 3QFKA 2BQ8X 2YEQA 1G5BA 4G9JA 1S3LA 4IL1A 2HYOA 4H1SA 5JPFA
chains in the Genus database with same CATH topology
4O43A 3K7VC 4JA9A 4XPNA 2P6BA 3H67A 3AV0A 3THNA 4ZX2A 1SU1A 1OIDA 2DXLA 3PSOA 3V4YA 3RL4A 3CK2A 1QHWA 1S3NA 2WDEA 4ORBA 3EGHA 5DNYA 1IT6A 2IE3C 1XZWA 4UT3A 3ICFA 5JPEA 3KBPA 2O8AA 1V73A 4WWLA 3GVEA 4ORAA 1W24A 3N5UA 4LU9A 2JOGA 2R17A 4O24A 4UT2A 3QFMA 1MF8A 3H68A 2Z06A 2Z72A 4O4KA 1UTEA 2NYLC 2USHA 2CV9A 4TUIA 4IYPC 1WARA 3IB8A 3K7WC 5EQVA 1OIEA 5JJTA 3DW8C 5IOHA 3DSDA 4I5NC 4H2FA 3IB7A 4V0WA 3H60A 4UWQA 1S70A 5J28A 2NYMC 4ZVZA 3THOB 3QFNA 2DXNA 4MOYA 5C1VA 4JA7A 1USHA 3RL5A 4FBQA 2QJCA 1HO5A 1Z2XA 4TUGA 4KKZA 4H2GA 1NNWA 3H62B 3RQZA 4DHLA 4O5GA 3JYFA 3DSCA 2DFJA 1TCOA 4V0VA 4I5LC 3TGHA 2A22A 1HPUA 1KBPA 1S95A 2ZOAA 3C5WC 3H63A 2WDDA 3E0JA 2BCDA 4NZVA 3E7BA 4H2IA 2KKNA 4DSYA 3H64A 4LACC 1AUIA 2HY1A 4YKEA 3HVQA 2NXFA 1T70A 2QFRA 3PSNA 3RL3A 2XMOA 4Q7FA 4H1YP 2BDXA 1WAO1 4HD0A 3H61A 4MP0A 3IVEA 4FBWA 4MOVA 2IAEC 4UT3B 5HPEA 2HYPA 3H66A 3QFOA 4F0ZA 4B2OA 4FBKA 1OI8A 1II7A 2O8GA 3FLOA 3LL8A 1M63A 3H69A 1T71A 3ZTVA 1JK7A 2NPPC 1HP1A 2Z1AA 2ZBMA 4LTYA 1FJMA 3T1IA 1S8EA 3ZU0A 4ORCA 1QFCA 4H2BA 2Q8UA 4KBPA 2AHDA 3FGAC 4M0VA 4OR9A 2WDFA 4FCXA 1XM7A 3QG5C 5F3WA 4V0XA 2ZO9B 3P71C 2GJUA 2WDCA 4J6OA 1Z2WA 3EGGA 3AUZA 3IVDA 5INBA 1U32A 2QFPA 2YVTA 1UF3A 5B8IA 5GTUA 1S3MA 2IE4C 3D03A 4DT2A 3C9FA 3E7AA 3QFKA 2BQ8X 2YEQA 1G5BA 4G9JA 1S3LA 4IL1A 2HYOA 4H1SA 5JPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O43 A;  3K7V C;  4JA9 A;  4XPN A;  2P6B A;  3H67 A;  3AV0 A;  3THN A;  4ZX2 A;  1SU1 A;  1OID A;  3PSO A;  3V4Y A;  3RL4 A;  3CK2 A;  1QHW A;  1S3N A;  2WDE A;  4ORB A;  3EGH A;  5DNY A;  1IT6 A;  2IE3 C;  1XZW A;  4UT3 A;  3ICF A;  5JPE A;  3KBP A;  2O8A A;  1V73 A;  4WWL A;  3GVE A;  4ORA A;  1W24 A;  3N5U A;  4LU9 A;  2JOG A;  2R17 A;  4O24 A;  4UT2 A;  3QFM A;  1MF8 A;  3H68 A;  2Z06 A;  2Z72 A;  4O4K A;  1UTE A;  2NYL C;  2USH A;  2CV9 A;  4TUI A;  4IYP C;  1WAR A;  3IB8 A;  3K7W C;  5EQV A;  1OIE A;  5JJT A;  3DW8 C;  5IOH A;  3DSD A;  4I5N C;  4H2F A;  3IB7 A;  4V0W A;  3H60 A;  4UWQ A;  1S70 A;  5J28 A;  2NYM C;  4ZVZ A;  3THO B;  3QFN A;  4MOY A;  5C1V A;  4JA7 A;  1USH A;  3RL5 A;  4FBQ A;  2QJC A;  1HO5 A;  1Z2X A;  4TUG A;  4KKZ A;  4H2G A;  1NNW A;  3H62 B;  3RQZ A;  4DHL A;  4O5G A;  3JYF A;  3DSC A;  2DFJ A;  1TCO A;  4V0V A;  4I5L C;  3TGH A;  2A22 A;  1HPU A;  1KBP A;  1S95 A;  3C5W C;  3H63 A;  2WDD A;  2BCD A;  4NZV A;  3E7B A;  4H2I A;  2KKN A;  4DSY A;  3H64 A;  4LAC C;  1AUI A;  2HY1 A;  4YKE A;  3HVQ A;  2NXF A;  1T70 A;  2QFR A;  3PSN A;  3RL3 A;  2XMO A;  4Q7F A;  4H1Y P;  2BDX A;  1WAO 1;  4HD0 A;  3H61 A;  4MP0 A;  3IVE A;  4FBW A;  4MOV A;  2IAE C;  4UT3 B;  5HPE A;  2HYP A;  3H66 A;  3QFO A;  4F0Z A;  4B2O A;  4FBK A;  1OI8 A;  1II7 A;  2O8G A;  3LL8 A;  1M63 A;  3H69 A;  1T71 A;  3ZTV A;  1JK7 A;  2NPP C;  2Z1A A;  1HP1 A;  2ZBM A;  4LTY A;  1FJM A;  3T1I A;  1S8E A;  3ZU0 A;  4ORC A;  1QFC A;  4H2B A;  2Q8U A;  4KBP A;  2AHD A;  3FGA C;  4M0V A;  4OR9 A;  2WDF A;  4FCX A;  1XM7 A;  3QG5 C;  5F3W A;  4V0X A;  3P71 C;  2GJU A;  2WDC A;  4J6O A;  1Z2W A;  3EGG A;  3AUZ A;  3IVD A;  5INB A;  1U32 A;  2QFP A;  2YVT A;  1UF3 A;  5B8I A;  5GTU A;  1S3M A;  2IE4 C;  4DT2 A;  3C9F A;  3E7A A;  3QFK A;  2BQ8 X;  1G5B A;  4G9J A;  1S3L A;  4IL1 A;  2HYO A;  4H1S A;  5JPF A; 
#chains in the Genus database with same CATH topology
 4O43 A;  3K7V C;  4JA9 A;  4XPN A;  2P6B A;  3H67 A;  3AV0 A;  3THN A;  4ZX2 A;  1SU1 A;  1OID A;  2DXL A;  3PSO A;  3V4Y A;  3RL4 A;  3CK2 A;  1QHW A;  1S3N A;  2WDE A;  4ORB A;  3EGH A;  5DNY A;  1IT6 A;  2IE3 C;  1XZW A;  4UT3 A;  3ICF A;  5JPE A;  3KBP A;  2O8A A;  1V73 A;  4WWL A;  3GVE A;  4ORA A;  1W24 A;  3N5U A;  4LU9 A;  2JOG A;  2R17 A;  4O24 A;  4UT2 A;  3QFM A;  1MF8 A;  3H68 A;  2Z06 A;  2Z72 A;  4O4K A;  1UTE A;  2NYL C;  2USH A;  2CV9 A;  4TUI A;  4IYP C;  1WAR A;  3IB8 A;  3K7W C;  5EQV A;  1OIE A;  5JJT A;  3DW8 C;  5IOH A;  3DSD A;  4I5N C;  4H2F A;  3IB7 A;  4V0W A;  3H60 A;  4UWQ A;  1S70 A;  5J28 A;  2NYM C;  4ZVZ A;  3THO B;  3QFN A;  2DXN A;  4MOY A;  5C1V A;  4JA7 A;  1USH A;  3RL5 A;  4FBQ A;  2QJC A;  1HO5 A;  1Z2X A;  4TUG A;  4KKZ A;  4H2G A;  1NNW A;  3H62 B;  3RQZ A;  4DHL A;  4O5G A;  3JYF A;  3DSC A;  2DFJ A;  1TCO A;  4V0V A;  4I5L C;  3TGH A;  2A22 A;  1HPU A;  1KBP A;  1S95 A;  2ZOA A;  3C5W C;  3H63 A;  2WDD A;  3E0J A;  2BCD A;  4NZV A;  3E7B A;  4H2I A;  2KKN A;  4DSY A;  3H64 A;  4LAC C;  1AUI A;  2HY1 A;  4YKE A;  3HVQ A;  2NXF A;  1T70 A;  2QFR A;  3PSN A;  3RL3 A;  2XMO A;  4Q7F A;  4H1Y P;  2BDX A;  1WAO 1;  4HD0 A;  3H61 A;  4MP0 A;  3IVE A;  4FBW A;  4MOV A;  2IAE C;  4UT3 B;  5HPE A;  2HYP A;  3H66 A;  3QFO A;  4F0Z A;  4B2O A;  4FBK A;  1OI8 A;  1II7 A;  2O8G A;  3FLO A;  3LL8 A;  1M63 A;  3H69 A;  1T71 A;  3ZTV A;  1JK7 A;  2NPP C;  1HP1 A;  2Z1A A;  2ZBM A;  4LTY A;  1FJM A;  3T1I A;  1S8E A;  3ZU0 A;  4ORC A;  1QFC A;  4H2B A;  2Q8U A;  4KBP A;  2AHD A;  3FGA C;  4M0V A;  4OR9 A;  2WDF A;  4FCX A;  1XM7 A;  3QG5 C;  5F3W A;  4V0X A;  2ZO9 B;  3P71 C;  2GJU A;  2WDC A;  4J6O A;  1Z2W A;  3EGG A;  3AUZ A;  3IVD A;  5INB A;  1U32 A;  2QFP A;  2YVT A;  1UF3 A;  5B8I A;  5GTU A;  1S3M A;  2IE4 C;  3D03 A;  4DT2 A;  3C9F A;  3E7A A;  3QFK A;  2BQ8 X;  2YEQ A;  1G5B A;  4G9J A;  1S3L A;  4IL1 A;  2HYO A;  4H1S A;  5JPF A; 
#chains in the Genus database with same CATH homology
 4O43 A;  3K7V C;  4JA9 A;  4XPN A;  2P6B A;  3H67 A;  3AV0 A;  3THN A;  4ZX2 A;  1SU1 A;  1OID A;  2DXL A;  3PSO A;  3V4Y A;  3RL4 A;  3CK2 A;  1QHW A;  1S3N A;  2WDE A;  4ORB A;  3EGH A;  5DNY A;  1IT6 A;  2IE3 C;  1XZW A;  4UT3 A;  3ICF A;  5JPE A;  3KBP A;  2O8A A;  1V73 A;  4WWL A;  3GVE A;  4ORA A;  1W24 A;  3N5U A;  4LU9 A;  2JOG A;  2R17 A;  4O24 A;  4UT2 A;  3QFM A;  1MF8 A;  3H68 A;  2Z06 A;  2Z72 A;  4O4K A;  1UTE A;  2NYL C;  2USH A;  2CV9 A;  4TUI A;  4IYP C;  1WAR A;  3IB8 A;  3K7W C;  5EQV A;  1OIE A;  5JJT A;  3DW8 C;  5IOH A;  3DSD A;  4I5N C;  4H2F A;  3IB7 A;  4V0W A;  3H60 A;  4UWQ A;  1S70 A;  5J28 A;  2NYM C;  4ZVZ A;  3THO B;  3QFN A;  2DXN A;  4MOY A;  5C1V A;  4JA7 A;  1USH A;  3RL5 A;  4FBQ A;  2QJC A;  1HO5 A;  1Z2X A;  4TUG A;  4KKZ A;  4H2G A;  1NNW A;  3H62 B;  3RQZ A;  4DHL A;  4O5G A;  3JYF A;  3DSC A;  2DFJ A;  1TCO A;  4V0V A;  4I5L C;  3TGH A;  2A22 A;  1HPU A;  1KBP A;  1S95 A;  2ZOA A;  3C5W C;  3H63 A;  2WDD A;  3E0J A;  2BCD A;  4NZV A;  3E7B A;  4H2I A;  2KKN A;  4DSY A;  3H64 A;  4LAC C;  1AUI A;  2HY1 A;  4YKE A;  3HVQ A;  2NXF A;  1T70 A;  2QFR A;  3PSN A;  3RL3 A;  2XMO A;  4Q7F A;  4H1Y P;  2BDX A;  1WAO 1;  4HD0 A;  3H61 A;  4MP0 A;  3IVE A;  4FBW A;  4MOV A;  2IAE C;  4UT3 B;  5HPE A;  2HYP A;  3H66 A;  3QFO A;  4F0Z A;  4B2O A;  4FBK A;  1OI8 A;  1II7 A;  2O8G A;  3FLO A;  3LL8 A;  1M63 A;  3H69 A;  1T71 A;  3ZTV A;  1JK7 A;  2NPP C;  1HP1 A;  2Z1A A;  2ZBM A;  4LTY A;  1FJM A;  3T1I A;  1S8E A;  3ZU0 A;  4ORC A;  1QFC A;  4H2B A;  2Q8U A;  4KBP A;  2AHD A;  3FGA C;  4M0V A;  4OR9 A;  2WDF A;  4FCX A;  1XM7 A;  3QG5 C;  5F3W A;  4V0X A;  2ZO9 B;  3P71 C;  2GJU A;  2WDC A;  4J6O A;  1Z2W A;  3EGG A;  3AUZ A;  3IVD A;  5INB A;  1U32 A;  2QFP A;  2YVT A;  1UF3 A;  5B8I A;  5GTU A;  1S3M A;  2IE4 C;  3D03 A;  4DT2 A;  3C9F A;  3E7A A;  3QFK A;  2BQ8 X;  2YEQ A;  1G5B A;  4G9J A;  1S3L A;  4IL1 A;  2HYO A;  4H1S A;  5JPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...