4V0VA

The crystal structure of mouse pp1g in complex with truncated human ppp1r15b (631-660)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
295
structure length
295
Chain Sequence
MLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G-actin provides substrate-specificity to eukaryotic initiation factor 2 alpha holophosphatases.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase/hydrolase regulator
molecule keywords SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
total genus 110
structure length 295
sequence length 295
chains with identical sequence C
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2014-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4v0vA00
1S3MA 3E7AA 5HPEA 3THOB 4O5GA 3DW8C 3T1IA 5C1VA 3IVEA 3ICFA 3H61A 4FCXA 4KBPA 2WDFA 3THNA 4TUIA 4B2OA 2BDXA 5GTUA 3AUZA 5INBA 1UTEA 2Z72A 4F0ZA 4DT2A 1OIDA 1S95A 2DFJA 1IT6A 4LTYA 4JA7A 4HD0A 3EGHA 3GVEA 4I5LC 4JA9A 3QFKA 1JK7A 2USHA 2XMOA 3ZU0A 3K7WC 3E7BA 4KKZA 1AUIA 1V73A 4ORCA 4Q7FA 3AV0A 1OI8A 2CV9A 2R17A 3H68A 3QFOA 3RL4A 4UT2A 4ORAA 4OR9A 1T70A 3RQZA 1OIEA 4H1YP 3CK2A 5EQVA 3C9FA 1HP1A 2HY1A 1QHWA 1HO5A 3HVQA 5JPFA 1M63A 3P71C 3C5WC 3K7VC 1W24A 3FGAC 2BQ8X 5J28A 2NPPC 2KKNA 4M0VA 3H62B 2IE4C 4J6OA 3QFMA 3H60A 4UT3A 3EGGA 2P6BA 2ZBMA 1WARA 1S3NA 1HPUA 1KBPA 2Z1AA 3RL3A 4DSYA 2QFRA 2HYOA 3V4YA 4H2IA 4O4KA 4ZVZA 5B8IA 4UWQA 2GJUA 3TGHA 3JYFA 2HYPA 1TCOA 1MF8A 2NYLC 5DNYA 3H66A 1G5BA 1XZWA 2YVTA 4IYPC 2O8GA 3QG5C 4WWLA 1II7A 3IB8A 5IOHA 4DHLA 3DSCA 4FBWA 4ORBA 1S3LA 4MP0A 3H64A 2IAEC 1UF3A 4V0WA 4UT3B 2NXFA 2BCDA 1NNWA 3PSOA 1U32A 4V0XA 1USHA 4XPNA 2A22A 4YKEA 1S8EA 2JOGA 1XM7A 1T71A 3H67A 3RL5A 1QFCA 2Z06A 4FBKA 2WDCA 3QFNA 1Z2WA 4ZX2A 3IVDA 2QJCA 4H2FA 5JPEA 4IL1A 4H2BA 3H69A 4MOVA 2WDEA 4H2GA 1SU1A 4O43A 1FJMA 1S70A 3KBPA 4TUGA 4NZVA 1WAO1 1Z2XA 2QFPA 5F3WA 4LACC 3N5UA 3ZTVA 3H63A 4FBQA 4V0VA 2Q8UA 4MOYA 2IE3C 4LU9A 2NYMC 2O8AA 2AHDA 3IB7A 2WDDA 4I5NC 3PSNA 5JJTA 3DSDA 4G9JA 4O24A 4H1SA 3LL8A
chains in the Genus database with same CATH superfamily
1S3MA 3E7AA 5HPEA 3THOB 4O5GA 3DW8C 3T1IA 5C1VA 3IVEA 3ICFA 3H61A 4FCXA 4KBPA 2WDFA 3THNA 4TUIA 4B2OA 2BDXA 5GTUA 3AUZA 5INBA 1UTEA 2Z72A 4F0ZA 4DT2A 1OIDA 1S95A 2DFJA 2ZOAA 1IT6A 4LTYA 4JA7A 4HD0A 3EGHA 3GVEA 4I5LC 4JA9A 3QFKA 2DXLA 1JK7A 2USHA 2XMOA 3ZU0A 3K7WC 3E7BA 2YEQA 4KKZA 1AUIA 1V73A 4ORCA 4Q7FA 3AV0A 1OI8A 2CV9A 2DXNA 2R17A 3H68A 3QFOA 3RL4A 4UT2A 4ORAA 4OR9A 1T70A 3RQZA 1OIEA 4H1YP 3CK2A 5EQVA 3C9FA 1HP1A 2HY1A 1QHWA 1HO5A 3HVQA 5JPFA 1M63A 3P71C 3C5WC 3K7VC 1W24A 3FGAC 2BQ8X 5J28A 2NPPC 2KKNA 4M0VA 3H62B 2IE4C 4J6OA 3QFMA 2ZO9B 3H60A 4UT3A 3EGGA 2P6BA 2ZBMA 1WARA 1S3NA 1HPUA 1KBPA 2Z1AA 3E0JA 3RL3A 4DSYA 2QFRA 3D03A 2HYOA 3V4YA 4H2IA 4O4KA 4ZVZA 5B8IA 4UWQA 2GJUA 3TGHA 3JYFA 2HYPA 1TCOA 1MF8A 2NYLC 5DNYA 3H66A 1G5BA 1XZWA 3FLOA 2YVTA 4IYPC 2O8GA 3QG5C 4WWLA 1II7A 3IB8A 5IOHA 4DHLA 3DSCA 4FBWA 4ORBA 1S3LA 4MP0A 3H64A 2IAEC 1UF3A 4V0WA 4UT3B 2NXFA 2BCDA 1NNWA 3PSOA 1U32A 4V0XA 1USHA 4XPNA 2A22A 4YKEA 1S8EA 2JOGA 1XM7A 1T71A 3H67A 3RL5A 1QFCA 2Z06A 4FBKA 2WDCA 3QFNA 1Z2WA 4ZX2A 3IVDA 2QJCA 4H2FA 5JPEA 4IL1A 4H2BA 3H69A 4MOVA 2WDEA 4H2GA 1SU1A 4O43A 1FJMA 1S70A 3KBPA 4TUGA 4NZVA 1WAO1 1Z2XA 2QFPA 5F3WA 4LACC 3N5UA 3ZTVA 3H63A 4FBQA 4V0VA 2Q8UA 4MOYA 2IE3C 4LU9A 2NYMC 2O8AA 2AHDA 3IB7A 2WDDA 4I5NC 3PSNA 5JJTA 3DSDA 4G9JA 4O24A 4H1SA 3LL8A
chains in the Genus database with same CATH topology
1S3MA 3E7AA 5HPEA 3THOB 4O5GA 3DW8C 3T1IA 5C1VA 3IVEA 3ICFA 3H61A 4FCXA 4KBPA 2WDFA 3THNA 4TUIA 4B2OA 2BDXA 5GTUA 3AUZA 5INBA 1UTEA 2Z72A 4F0ZA 4DT2A 1OIDA 1S95A 2DFJA 2ZOAA 1IT6A 4LTYA 4JA7A 4HD0A 3EGHA 3GVEA 4I5LC 4JA9A 3QFKA 2DXLA 1JK7A 2USHA 2XMOA 3ZU0A 3K7WC 3E7BA 2YEQA 4KKZA 1AUIA 1V73A 4ORCA 4Q7FA 3AV0A 1OI8A 2CV9A 2DXNA 2R17A 3H68A 3QFOA 3RL4A 4UT2A 4ORAA 4OR9A 1T70A 3RQZA 1OIEA 4H1YP 3CK2A 5EQVA 3C9FA 1HP1A 2HY1A 1QHWA 1HO5A 3HVQA 5JPFA 1M63A 3P71C 3C5WC 3K7VC 1W24A 3FGAC 2BQ8X 5J28A 2NPPC 2KKNA 4M0VA 3H62B 2IE4C 4J6OA 3QFMA 2ZO9B 3H60A 4UT3A 3EGGA 2P6BA 2ZBMA 1WARA 1S3NA 1HPUA 1KBPA 2Z1AA 3E0JA 3RL3A 4DSYA 2QFRA 3D03A 2HYOA 3V4YA 4H2IA 4O4KA 4ZVZA 5B8IA 4UWQA 2GJUA 3TGHA 3JYFA 2HYPA 1TCOA 1MF8A 2NYLC 5DNYA 3H66A 1G5BA 1XZWA 3FLOA 2YVTA 4IYPC 2O8GA 3QG5C 4WWLA 1II7A 3IB8A 5IOHA 4DHLA 3DSCA 4FBWA 4ORBA 1S3LA 4MP0A 3H64A 2IAEC 1UF3A 4V0WA 4UT3B 2NXFA 2BCDA 1NNWA 3PSOA 1U32A 4V0XA 1USHA 4XPNA 2A22A 4YKEA 1S8EA 2JOGA 1XM7A 1T71A 3H67A 3RL5A 1QFCA 2Z06A 4FBKA 2WDCA 3QFNA 1Z2WA 4ZX2A 3IVDA 2QJCA 4H2FA 5JPEA 4IL1A 4H2BA 3H69A 4MOVA 2WDEA 4H2GA 1SU1A 4O43A 1FJMA 1S70A 3KBPA 4TUGA 4NZVA 1WAO1 1Z2XA 2QFPA 5F3WA 4LACC 3N5UA 3ZTVA 3H63A 4FBQA 4V0VA 2Q8UA 4MOYA 2IE3C 4LU9A 2NYMC 2O8AA 2AHDA 3IB7A 2WDDA 4I5NC 3PSNA 5JJTA 3DSDA 4G9JA 4O24A 4H1SA 3LL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3M A;  3E7A A;  5HPE A;  3THO B;  4O5G A;  3DW8 C;  3T1I A;  5C1V A;  3IVE A;  3ICF A;  3H61 A;  4FCX A;  4KBP A;  2WDF A;  3THN A;  4TUI A;  4B2O A;  2BDX A;  5GTU A;  3AUZ A;  5INB A;  1UTE A;  2Z72 A;  4F0Z A;  4DT2 A;  1OID A;  1S95 A;  2DFJ A;  1IT6 A;  4LTY A;  4JA7 A;  4HD0 A;  3EGH A;  3GVE A;  4I5L C;  4JA9 A;  3QFK A;  1JK7 A;  2USH A;  2XMO A;  3ZU0 A;  3K7W C;  3E7B A;  4KKZ A;  1AUI A;  1V73 A;  4ORC A;  4Q7F A;  3AV0 A;  1OI8 A;  2CV9 A;  2R17 A;  3H68 A;  3QFO A;  3RL4 A;  4UT2 A;  4ORA A;  4OR9 A;  1T70 A;  3RQZ A;  1OIE A;  4H1Y P;  3CK2 A;  5EQV A;  3C9F A;  1HP1 A;  2HY1 A;  1QHW A;  1HO5 A;  3HVQ A;  5JPF A;  1M63 A;  3P71 C;  3C5W C;  3K7V C;  1W24 A;  3FGA C;  2BQ8 X;  5J28 A;  2NPP C;  2KKN A;  4M0V A;  3H62 B;  2IE4 C;  4J6O A;  3QFM A;  3H60 A;  4UT3 A;  3EGG A;  2P6B A;  2ZBM A;  1WAR A;  1S3N A;  1HPU A;  1KBP A;  2Z1A A;  3RL3 A;  4DSY A;  2QFR A;  2HYO A;  3V4Y A;  4H2I A;  4O4K A;  4ZVZ A;  5B8I A;  4UWQ A;  2GJU A;  3TGH A;  3JYF A;  2HYP A;  1TCO A;  1MF8 A;  2NYL C;  5DNY A;  3H66 A;  1G5B A;  1XZW A;  2YVT A;  4IYP C;  2O8G A;  3QG5 C;  4WWL A;  1II7 A;  3IB8 A;  5IOH A;  4DHL A;  3DSC A;  4FBW A;  4ORB A;  1S3L A;  4MP0 A;  3H64 A;  2IAE C;  1UF3 A;  4V0W A;  4UT3 B;  2NXF A;  2BCD A;  1NNW A;  3PSO A;  1U32 A;  4V0X A;  1USH A;  4XPN A;  2A22 A;  4YKE A;  1S8E A;  2JOG A;  1XM7 A;  1T71 A;  3H67 A;  3RL5 A;  1QFC A;  2Z06 A;  4FBK A;  2WDC A;  3QFN A;  1Z2W A;  4ZX2 A;  3IVD A;  2QJC A;  4H2F A;  5JPE A;  4IL1 A;  4H2B A;  3H69 A;  4MOV A;  2WDE A;  4H2G A;  1SU1 A;  4O43 A;  1FJM A;  1S70 A;  3KBP A;  4TUG A;  4NZV A;  1WAO 1;  1Z2X A;  2QFP A;  5F3W A;  4LAC C;  3N5U A;  3ZTV A;  3H63 A;  4FBQ A;  4V0V A;  2Q8U A;  4MOY A;  2IE3 C;  4LU9 A;  2NYM C;  2O8A A;  2AHD A;  3IB7 A;  2WDD A;  4I5N C;  3PSN A;  5JJT A;  3DSD A;  4G9J A;  4O24 A;  4H1S A;  3LL8 A; 
#chains in the Genus database with same CATH topology
 1S3M A;  3E7A A;  5HPE A;  3THO B;  4O5G A;  3DW8 C;  3T1I A;  5C1V A;  3IVE A;  3ICF A;  3H61 A;  4FCX A;  4KBP A;  2WDF A;  3THN A;  4TUI A;  4B2O A;  2BDX A;  5GTU A;  3AUZ A;  5INB A;  1UTE A;  2Z72 A;  4F0Z A;  4DT2 A;  1OID A;  1S95 A;  2DFJ A;  2ZOA A;  1IT6 A;  4LTY A;  4JA7 A;  4HD0 A;  3EGH A;  3GVE A;  4I5L C;  4JA9 A;  3QFK A;  2DXL A;  1JK7 A;  2USH A;  2XMO A;  3ZU0 A;  3K7W C;  3E7B A;  2YEQ A;  4KKZ A;  1AUI A;  1V73 A;  4ORC A;  4Q7F A;  3AV0 A;  1OI8 A;  2CV9 A;  2DXN A;  2R17 A;  3H68 A;  3QFO A;  3RL4 A;  4UT2 A;  4ORA A;  4OR9 A;  1T70 A;  3RQZ A;  1OIE A;  4H1Y P;  3CK2 A;  5EQV A;  3C9F A;  1HP1 A;  2HY1 A;  1QHW A;  1HO5 A;  3HVQ A;  5JPF A;  1M63 A;  3P71 C;  3C5W C;  3K7V C;  1W24 A;  3FGA C;  2BQ8 X;  5J28 A;  2NPP C;  2KKN A;  4M0V A;  3H62 B;  2IE4 C;  4J6O A;  3QFM A;  2ZO9 B;  3H60 A;  4UT3 A;  3EGG A;  2P6B A;  2ZBM A;  1WAR A;  1S3N A;  1HPU A;  1KBP A;  2Z1A A;  3E0J A;  3RL3 A;  4DSY A;  2QFR A;  3D03 A;  2HYO A;  3V4Y A;  4H2I A;  4O4K A;  4ZVZ A;  5B8I A;  4UWQ A;  2GJU A;  3TGH A;  3JYF A;  2HYP A;  1TCO A;  1MF8 A;  2NYL C;  5DNY A;  3H66 A;  1G5B A;  1XZW A;  3FLO A;  2YVT A;  4IYP C;  2O8G A;  3QG5 C;  4WWL A;  1II7 A;  3IB8 A;  5IOH A;  4DHL A;  3DSC A;  4FBW A;  4ORB A;  1S3L A;  4MP0 A;  3H64 A;  2IAE C;  1UF3 A;  4V0W A;  4UT3 B;  2NXF A;  2BCD A;  1NNW A;  3PSO A;  1U32 A;  4V0X A;  1USH A;  4XPN A;  2A22 A;  4YKE A;  1S8E A;  2JOG A;  1XM7 A;  1T71 A;  3H67 A;  3RL5 A;  1QFC A;  2Z06 A;  4FBK A;  2WDC A;  3QFN A;  1Z2W A;  4ZX2 A;  3IVD A;  2QJC A;  4H2F A;  5JPE A;  4IL1 A;  4H2B A;  3H69 A;  4MOV A;  2WDE A;  4H2G A;  1SU1 A;  4O43 A;  1FJM A;  1S70 A;  3KBP A;  4TUG A;  4NZV A;  1WAO 1;  1Z2X A;  2QFP A;  5F3W A;  4LAC C;  3N5U A;  3ZTV A;  3H63 A;  4FBQ A;  4V0V A;  2Q8U A;  4MOY A;  2IE3 C;  4LU9 A;  2NYM C;  2O8A A;  2AHD A;  3IB7 A;  2WDD A;  4I5N C;  3PSN A;  5JJT A;  3DSD A;  4G9J A;  4O24 A;  4H1S A;  3LL8 A; 
#chains in the Genus database with same CATH homology
 1S3M A;  3E7A A;  5HPE A;  3THO B;  4O5G A;  3DW8 C;  3T1I A;  5C1V A;  3IVE A;  3ICF A;  3H61 A;  4FCX A;  4KBP A;  2WDF A;  3THN A;  4TUI A;  4B2O A;  2BDX A;  5GTU A;  3AUZ A;  5INB A;  1UTE A;  2Z72 A;  4F0Z A;  4DT2 A;  1OID A;  1S95 A;  2DFJ A;  2ZOA A;  1IT6 A;  4LTY A;  4JA7 A;  4HD0 A;  3EGH A;  3GVE A;  4I5L C;  4JA9 A;  3QFK A;  2DXL A;  1JK7 A;  2USH A;  2XMO A;  3ZU0 A;  3K7W C;  3E7B A;  2YEQ A;  4KKZ A;  1AUI A;  1V73 A;  4ORC A;  4Q7F A;  3AV0 A;  1OI8 A;  2CV9 A;  2DXN A;  2R17 A;  3H68 A;  3QFO A;  3RL4 A;  4UT2 A;  4ORA A;  4OR9 A;  1T70 A;  3RQZ A;  1OIE A;  4H1Y P;  3CK2 A;  5EQV A;  3C9F A;  1HP1 A;  2HY1 A;  1QHW A;  1HO5 A;  3HVQ A;  5JPF A;  1M63 A;  3P71 C;  3C5W C;  3K7V C;  1W24 A;  3FGA C;  2BQ8 X;  5J28 A;  2NPP C;  2KKN A;  4M0V A;  3H62 B;  2IE4 C;  4J6O A;  3QFM A;  2ZO9 B;  3H60 A;  4UT3 A;  3EGG A;  2P6B A;  2ZBM A;  1WAR A;  1S3N A;  1HPU A;  1KBP A;  2Z1A A;  3E0J A;  3RL3 A;  4DSY A;  2QFR A;  3D03 A;  2HYO A;  3V4Y A;  4H2I A;  4O4K A;  4ZVZ A;  5B8I A;  4UWQ A;  2GJU A;  3TGH A;  3JYF A;  2HYP A;  1TCO A;  1MF8 A;  2NYL C;  5DNY A;  3H66 A;  1G5B A;  1XZW A;  3FLO A;  2YVT A;  4IYP C;  2O8G A;  3QG5 C;  4WWL A;  1II7 A;  3IB8 A;  5IOH A;  4DHL A;  3DSC A;  4FBW A;  4ORB A;  1S3L A;  4MP0 A;  3H64 A;  2IAE C;  1UF3 A;  4V0W A;  4UT3 B;  2NXF A;  2BCD A;  1NNW A;  3PSO A;  1U32 A;  4V0X A;  1USH A;  4XPN A;  2A22 A;  4YKE A;  1S8E A;  2JOG A;  1XM7 A;  1T71 A;  3H67 A;  3RL5 A;  1QFC A;  2Z06 A;  4FBK A;  2WDC A;  3QFN A;  1Z2W A;  4ZX2 A;  3IVD A;  2QJC A;  4H2F A;  5JPE A;  4IL1 A;  4H2B A;  3H69 A;  4MOV A;  2WDE A;  4H2G A;  1SU1 A;  4O43 A;  1FJM A;  1S70 A;  3KBP A;  4TUG A;  4NZV A;  1WAO 1;  1Z2X A;  2QFP A;  5F3W A;  4LAC C;  3N5U A;  3ZTV A;  3H63 A;  4FBQ A;  4V0V A;  2Q8U A;  4MOY A;  2IE3 C;  4LU9 A;  2NYM C;  2O8A A;  2AHD A;  3IB7 A;  2WDD A;  4I5N C;  3PSN A;  5JJT A;  3DSD A;  4G9J A;  4O24 A;  4H1S A;  3LL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...