4IL1A

Crystal structure of the rat calcineurin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
647
structure length
529
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICFEEAKGLDRINERMPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calmodulin, Calcineurin subunit B type 1, Serine/threonine-p
publication title Structural basis of calcineurin activation by calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 174
structure length 529
sequence length 647
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4il1A01
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4il1A02
5DKNA 1CB1A 4JPZB 1DF0A 1B47A 3O4YA 3WXAA 1OE9B 5I2OA 4ORCA 2ZRTA 1UWOA 1OOJA 2KAXA 2R2IA 3OB1B 3H61A 3IVEA 1YX8A 2JNXA 1M46A 1QATA 2LP2A 2H61C 2QACA 1SPYA 2CCMA 3AV0A 4QJ5B 4H2FA 4H2BA 1GJYA 2HQWA 1NIWA 2F33A 2LNKA 2NCPA 1B8LA 5GTUA 2BL0C 2D8NA 5J3XA 1FF1A 4UT2A 1YUTA 4I5NC 3D0YB 1OMDA 1IKUA 2AHDA 1M39A 3I5IB 2Y1NA 1LVCD 1W7JB 1B4CA 1QTXA 1SW8A 2K7CA 3EKHA 2IE3C 2Z06A 2NZ0A 2YVTA 4GAOA 1YRUB 1A29A 1CM4A 3SG6A 1V73A 4DCKA 1HQVA 4PE4A 1MF8A 1F8HA 1RROA 2F2PA 2K2AA 2P6BB 4JWQA 5EQVA 1N0YA 4C0LA 1QFCA 4HRGA 1ZUZA 2IE4C 2LVVA 4XPNA 2V53A 2L98A 3N5UA 2M7NA 1NX2A 1QV0A 2HETA 3H60A 3V4YA 1J1DA 4GBAA 5DNYA 2AAOA 3LK0A 2PMYA 2NXFA 1L2OB 2F3YA 1OIEA 1QLSA 1D1OA 3PSRA 3DVEA 4DSYA 2KAVA 2EC6C 1J7OA 5HKWA 2KKNA 4BY4A 3QFMA 2L2EA 1CKKA 2KSPA 1QIVA 1KK7Y 2WOSA 3KF9A 1OIDA 2F8PA 2LANA 3BUMB 4YGDB 2CV9A 1F4OA 1EXRA 1UP5A 1B9AA 3PFVA 1KCYA 1KK8B 1MUXA 2M8UA 2JC2A 3ZNIA 3TUYC 4I5LC 5I8NA 3TGHA 1S36A 4L9MA 1QVIZ 2BCXA 2BKIB 2L4HA 2KI6D 2KNEA 4DIRA 2MJWB 4TUIA 2MLEC 3I5HC 1SCMB 3PATA 3IQQA 2LVIA 3BOWB 2WDCA 2OTGC 1E8AA 2E6WA 5AFPA 2CNPA 4DRWA 2DFJA 2LVKA 1RECA 4V0WA 3PLFB 1BG1A 1WDCC 1A03A 3VRPA 4FBWA 3RL5A 4A4BA 4ZCUA 3LCPC 4GNKB 4WQ3A 2PASA 5JOLA 1SY9A 4F0ZA 2LVJA 3GK1A 1CFFA 2DOQA 1IQ3A 1JFJA 1FW4A 3BUOB 4MLWA 1TRFA 4MZLA 3E3RA 1IRJA 5BPJA 1F55A 1K95A 1SRAA 3FIAA 1ZFSA 3LL8B 2NPPC 3RL3A 4MVFA 2L4IA 2NCOA 4I5KA 4WRIA 1BJFA 3FGAC 1IJ6A 4XJKB 1JSAA 3EGHA 1FI6A 3CK2A 2KI4B 5HLVA 3ICFA 1U5IA 4ORAB 3SG5A 1KSMA 1G33A 1XFZO 3TDUA 4E68A 1BU3A 1C07A 1AUIA 1NCYA 4QJ4B 5C1VA 1K9PA 4AQIA 1QV1A 3ZTVA 3LK1A 1ZOTB 1YURA 4B2OA 3JVTB 3HX4A 2Q91A 1MQ1A 4LACC 1F71A 4O24A 4MZKA 1J55A 5ER4X 5CSIA 4O5GA 3RL4A 2LUXA 4OCIA 3CS1A 1MHOA 4FQOA 5KTYA 4AOMA 1CMGA 4JQ0D 3EGGA 3RQZA 1DJHA 2CXJA 4ICBA 3CR2A 1DJYA 3AUZA 1S26D 1BMOA 2HYOA 1K9KA 1IG5A 3IQOA 2Z72A 1X02A 4GUKA 2LV7A 3NSLA 1Z2WA 1QXPA 1WY9A 1KWOC 2HF5A 2R17A 1UHJA 2PVBA 1XFXO 1CLBA 1GGWA 4I5JA 3OP0A 3C5WC 3H67A 1WLMA 3O2PA 3PALA 1B8RA 2HQ8A 5HKYA 1NX3A 1B8CA 1JFKA 1QX2A 1IT6A 1DJZA 2AMIA 1QHWA 1S6IA 3QFNA 2LAPA 3EVUA 2KDHA 4IL1A 1DGUA 4G9JA 1RK9A 2JQ6A 4MBEA 1CLLA 4MSPA 3H63A 4H1SA 3C1VA 2LMTA 1IH0A 2M3WA 2JZIA 1NCXA 1VRKA 2L50A 3DF0A 2ZBMA 2ZNDA 3TDZA 2Q4UA 4A4CA 2FCDA 2COLB 4V0XA 1K9UA 2ZN8A 2Q8UA 3BXKA 1OMVA 4PHJA 3EKJA 3NXAA 3TS5B 1Z2XA 1FPWA 1CM1A 1AP4A 2BDXA 1DJIA 3O6BA 1ALWA 1YTZC 1H4BA 1L2OC 3WNXB 1UHHA 4FTGA 3PSNA 1OSAA 1OZOA 3I5FB 4C0JA 2JT3A 2M1KB 1AVSA 1HO5A 2JOJA 3JYFA 5JPFA 5JJTA 4N1FA 2K7DA 1CDPA 1TTXA 1EJ3A 3BOWA 4YGCB 1JBAA 1U32A 2QFRA 1XFWO 2CTNA 3IF7A 5GQQC 1JF2A 2O5GA 4OVNF 4M0VA 2Y5IA 1S3LA 1KBPA 2GV5A 4UPGA 5HLOA 5KSZA 1C7VA 1DGVA 3NSKA 3VRQA 1IWQA 1KK8C 3IB7A 1SNLA 4CFRA 2CT9A 1BODA 2BCBA 3OHMB 1TNWA 1A2XA 1CTRA 3IB8A 3EVVA 3KBPA 2KBIA 2VRGA 1ZACA 1SCMC 1XFUO 2PRUA 1DMOA 2BE6A 2LLSA 3QG5C 4JA9A 1RFJA 1WLZA 2Y1MA 2USHA 1N2DA 3D10A 3BUWB 1EG3A 1CDMA 2WDEA 1KFUL 2QPTA 2LHIA 1EH2A 2BCDA 5B8IA 2MHHA 1AJ5A 1YUUA 2L5XB 3AKBA 3CR5X 4Q04A 2O8GA 3H69A 4MOVA 2ZKMX 2KGBC 3DW8C 3CGAA 1LA0A 3BQ3A 4WQ2A 1LA3A 4PE7A 1F54A 4ORAA 2NLNA 4CIDA 3EVRA 1B1GA 2KBMA 4FBQA 2KQ6A 2KYFA 1WRLA 1V1GA 2BL0B 1M63B 3QRXA 2OPOA 4DS7A 2ZRSA 3VRRA 1ODBA 4I5NB 4H1YP 3VROA 1KSOA 4P5OE 2LMVA 4BY5A 1S8EA 1DJXA 3H64A 1WRKA 1DF0B 2PALA 1JC2A 1AK8A 1UTEA 4O4KA 1XYDA 3A8RA 4TNCA 1USHA 2I2RE 4UT3A 1WRZA 1CFPA 1DTLA 1Y6WA 3PN7C 1DJWA 2LUCA 3K21A 3VGOA 1NCZA 4PHMA 2TN4A 1H8BA 3EK8A 3CLNA 4ORBA 2JTTA 4KBPA 3IVDA 1CFCA 2QFPA 4H2IA 1OI8A 5F3WA 5D69A 1DT7B 1R2UA 4YRUA 1DVIA 2GGMA 2LE9B 1SCVA 5PALA 1HT9A 2BBNA 2ZNEA 4PHNA 1A75B 5JJGA 1BR1B 1TCOA 3SJSA 1KQVA 1SL7A 2LLTA 1B7TZ 2I7AA 4NDBA 2BKHB 2GJUA 2AUCA 1F4QA 3GK2A 1MWNA 1CDLA 3PM8A 1UUSA 4OV2A 1XO5A 1KFXL 1J7RA 1XZWA 2BBMA 5DKRA 1YVHA 3O78A 1LKJA 4MN0A 1S95A 3DSDA 2FJUB 2JRFA 2RGIA 1II7A 2PSRA 1SR6C 4M2OA 2NYMC 1QX5B 2XMOA 4LTYA 5TNCA 1UURA 1J7QA 4PALA 3TDIA 1TNPA 2M9GA 4R1EA 1CMFA 3VRNA 3QFKA 3WHTB 2Y4QA 3PSOA 4ZX2A 5IOHA 4YI9A 3DVMA 4I5LB 3AAKA 4PHKA 3SIBA 1K90D 5HPEA 3QFOA 1G8IA 1NPQA 1QS7A 2K0JA 4FCXA 1NUBA 1IQ5A 2O8AA 2LM5A 3SG7A 1PVAA 1QVIY 3I5GC 2OTGB 1PSBA 1PK0D 1S6JA 2KFHA 3D0YA 4DT2A 3AKAA 3E7AA 2MA2A 3LLEA 4PDZA 3E7BA 1QJTA 1WDCB 2LHLA 2LC5A 1JUOA 2BQ8X 4LU9A 4NQGA 1S3PA 1KQMB 1UF3A 1J7PA 2M7LA 3KHEA 1HPUA 1S1EA 3RLZA 2I18A 2KHNA 1HP1A 2P6BA 2NXQA 3SG3A 3K7VC 4KKZA 4HRHA 5HYDA 1Q80A 3I5IC 4MOYA 3MSEB 2M97A 3GVEA 3H62B 4V0VA 1W7IB 2WCFA 2K8MB 5CSNA 4H2GA 1PVBA 4CFQA 5K89A 1Y1XA 2K7BA 1XA5A 1SU1A 1V1FA 1EG4A 2KGRA 1G5BA 1WAO1 2OS8B 1PULA 2B1UA 2HPSA 2L0PA 1FBVA 3HCMA 3H66A 3A4UB 5AXIA 3SIAA 3ZU0A 2F2OA 2F3ZA 3DVJA 1GQMA 4XYNA 4FBKA 1FI5A 2EHBA 1NSHA 1XM7A 1KK7Z 3JTDB 4HD0A 1UHIA 1XVJA 1NYAA 5CPVA 1YVLA 3CZTX 1AUIB 2EGDA 1TNQA 3KO0A 4N5XA 2FCEA 1T70A 2K2FA 2KQYA 4C0KA 1K96A 1WARA 3EK7A 3HVQA 3SG2A 3THOB 4PE1A 1FJMA 1NNWA 1KWOB 2Z1AA 1EL4A 1XK4A 1YRTB 1SK6D 1F70A 2JPTA 2LLUA 4PCWA 3EK4A 5HKZA 5CSFA 1S3NA 1L7ZA 1A4PA 2KYCA 4ZVZA 1MR8A 4GGNA 1SMGA 3BUNB 1AHRA 3F45A 2M29A 3FWCA 5INBA 4Q7FA 2K61A 1A75A 2IAEC 2LMUA 2JT8A 2WCBA 2WDDA 2NYLC 4M2QA 3THNA 2WDFA 3T1IA 4DHLA 1OZSA 4CLNA 5ER5A 1XK4C 3LL8A 2JNFA 1RWYA 1S6CA 4IYPC 2MAZA 2MLFC 2CBLA 4XJKA 1S5GZ 1Y0VH 1YX7A 2MBXA 2WNDA 4O43A 2BECA 5JPEA 1M45A 4GPLB 1PALA 4OR9B 2JXCA 3CWGA 1ALVA 1SBJA 1PSRA 2JT0A 5F6TA 3KEVA 3CR4X 2KOTA 3FS7A 3H68A 1KFUS 2BE4A 1M31A 3DF0B 3DSCA 1NWDA 4ORCB 5DKQA 1T71A 4HREE 4YKEA 1CNPA 1NX1A 1SL9A 3ICBA 3K7WC 2KI4C 3H4SE 5AERA 4MRXA 1AJ4A 2JTZA 2E30A 4MRYA 1XFVO 4QJ3B 2KAYA 4HSZA 3JVTC 1K2HA 3CTNA 4AQJA 2ZFDA 5AEQA 1Y1UA 2O60A 1IGVA 2WORA 4JA7A 2G2BA 1K93D 4MEWA 4YI8A 5G08A 4CPVA 2FOTA 2LCPA 3DVKA 1K8UA 1TOPA 1RTP1 3GOFA 3OX5A 5KU1A 4ZCVA 1S3MA 2H2KA 2ZN9A 3M0WA 1RJVA 4NZVA 1QX7A 2EC6B 1OMRA 2G9BA 2LP3A 2M0RA 4YGBB 1ZMZA 1OQPA 4TUGA 1MF8B 3FWBA 1SKTA 1W24A 5CSJA 4GFTA 2L51A 1MXLC 1KQMC 1NP8A 1BT6A 1MXEA 4NDDA 1YUSA 4GGFA 4DUQA 2KFFA 2A22A 1C7WA 3TUYB 3BYAA 4YGAA 2HY1A 2SASA 3SG4A 2JWWA 1S5GY 1KFXS 1LINA 4D1EA 1SL8A 2A4JA 3I5HB 1SYMA 3GK4X 3WHUB 3AAJA 4ETOA 2SCPA 3KPXA 5B8IB 5I2QA 1BR4B 5I2LA 2ISDA 4NDCA 3PN7B 2MRDA 1R6PA 2JU0A 4GGFC 5J28A 3OB2B 1TIZA 5AANA 4OKHA 4M2PA 1K94A 1GGZA 3ZWHA 1S70A 1JF0A 2OS8C 1DJGA 3TS5C 5IBWA 2WCEA 4J6OA 4UWQA 5D7FA 3TZ1A 4PE0A 4YBHB 1BLQA 1Y1AA 2GGZA 2JOGA 2JXLA 3C9FA 3OX6A 2BCAA 3RM1A 2JULA 1CFDA 1PRWA 3I5FC 1JWDA 3JTDC 1CDNA 2K7OA 4UT3B 4WWLA 3NSIA 1UHKA 1QASA 2KFGA 1QIWA 2M1UA 1B7TY 1BOCA 4ORBB 2QJCA 2M49B 1N65A 1IJ5A 1LXFC 2KI6C 1SR6B 2WC8A 3BUXB 4MZJA 4N1GA 3P71C 5FYXA 4F0ZB 1J1EA 1G4YR 1YR5A 1TNXA 4MP0A 1TCOB 1TN4A 1BF5A 1XFYO 4P2YB 4USLA 2H61A 1UHNA 2I94A 4YGEB 1NX0A 1TCFA 1JK7A 2HYPA 1QLKA 3NSOA 4U8DA 4OR9A 3I5GB 1M63A 1CLMA 1U5IB 3DD4A 2IS9A
chains in the Genus database with same CATH superfamily
5DKNA 1CB1A 4JPZB 2QEVA 1DF0A 1B47A 3O4YA 3WXAA 1OE9B 5I2OA 4ORCA 2ZRTA 1UWOA 1OOJA 2KAXA 2R2IA 3OB1B 3PJIA 3H61A 1YX8A 3IVEA 2JNXA 1M46A 1QATA 2LP2A 2H61C 3R1VA 2QACA 1SPYA 2CCMA 3AV0A 2WC6A 4QJ5B 4H2FA 1GJYA 4H2BA 2HQWA 1NIWA 2F33A 2LNKA 2NCPA 1B8LA 1WAO1 5GTUA 2BL0C 2D8NA 5J3XA 1FF1A 4UT2A 3D03A 1YUTA 4I5NC 3D0YB 1OMDA 4INWA 1IKUA 2AHDA 1M39A 3I5IB 2Y1NA 1LVCD 2QEOA 1W7JB 1B4CA 1QTXA 1SW8A 2K7CA 3EKHA 2IE3C 2Z06A 2NZ0A 2YVTA 4GAOA 1YRUB 1A29A 1CM4A 3SG6A 3D75A 1V73A 4DCKA 1HQVA 4PE4A 1MF8A 1F8HA 2PYQA 1RROA 2F2PA 2K2AA 2P6BB 3R1OA 4JWQA 4KYNA 1N0YA 4C0LA 1QFCA 4HRGA 1ZUZA 2IE4C 2LVVA 4XPNA 2V53A 2L98A 3N5UA 2M7NA 1NX2A 1QV0A 2HETA 3H60A 3V4YA 1J1DA 4GBAA 5DNYA 2AAOA 3LK0A 2PMYA 2NXFA 1L2OB 2F3YA 1OIEA 1QLSA 1D1OA 2DXLA 3PSRA 3DVEA 4DSYA 2KAVA 2EC6C 1J7OA 3FE8A 5HKWA 2KKNA 4BY4A 3QFMA 2L2EA 1CKKA 2KSPA 1QIVA 1KK7Y 2WOSA 3KF9A 1OIDA 2F8PA 2LANA 3BUMB 3IVTA 2ERBA 4YGDB 1F4OA 1EXRA 1UP5A 1B9AA 3PFVA 1KCYA 2CV9A 1KK8B 1MUXA 2M8UA 2JC2A 4PT1A 3ZNIA 3TUYC 4I5LC 5I8NA 3TGHA 1S36A 4L9MA 1QVIZ 2BCXA 2BKIB 2L4HA 2KI6D 4IJ7A 2KNEA 4DIRA 2MJWB 5I94A 2MLEC 3I5HC 4TUIA 1SCMB 3CDNA 3IQQA 3PATA 2LVIA 3BOWB 2WDCA 2OTGC 1E8AA 2E6WA 2WCLA 2CNPA 4DRWA 5AFPA 2P70A 2DFJA 2LVKA 3CZ1A 1RECA 4V0WA 3PLFB 1BG1A 1SSEB 1WDCC 3CZ2A 1A03A 3VRPA 4FBWA 3RL5A 4A4BA 1DC1A 4ZCUA 3LCPC 4GNKB 4WQ3A 2PASA 5JOLA 1SY9A 4F0ZA 2LVJA 3GK1A 1CFFA 2DOQA 1IQ3A 1JFJA 1FW4A 3BUOB 4MLWA 1TRFA 4MZLA 3E3RA 1IRJA 1TUJA 5BPJA 1F55A 1K95A 1SRAA 3FIAA 1ZFSA 3LL8B 2NPPC 3RL3A 4MVFA 2L4IA 2NCOA 4I5KA 4WRIA 1BJFA 3FGAC 1IJ6A 2BAPA 4XJKB 1JSAA 1FI6A 3EGHA 3CK2A 2KI4B 5HLVA 3ICFA 1U5IA 4ORAB 3SG5A 1KSMA 1G33A 1XFZO 3TDUA 4E68A 1BU3A 1C07A 1AUIA 1NCYA 4MOVA 4QJ4B 5C1VA 1K9PA 4AQIA 1QV1A 3ZTVA 3LK1A 1ZOTB 1YURA 4B2OA 3JVTB 3HX4A 2Q91A 1MQ1A 4LACC 1F71A 2FJYA 4O24A 4MZKA 1J55A 5ER4X 5CSIA 4O5GA 3RL4A 2LUXA 4OCIA 3B7AA 3CS1A 1MHOA 4FQOA 5KTYA 4AOMA 1CMGA 4JQ0D 3EGGA 3RQZA 1DJHA 2CXJA 4ICBA 3CR2A 1DJYA 3AUZA 1S26D 2ZO9B 1BMOA 2HYOA 1K9KA 1IG5A 3IQOA 2Z72A 1X02A 4GUKA 2LV7A 3NSLA 1OW4A 1Z2WA 1QXPA 1WY9A 1KWOC 2HF5A 2WCHA 1UHJA 2PVBA 1XFXO 1CLBA 2R17A 1GGWA 4I5JA 3OP0A 3C5WC 3H67A 1WLMA 3O2PA 3PALA 1B8RA 2HQ8A 5HKYA 3D78A 1NX3A 1B8CA 3EG5B 1JFKA 1QX2A 3V2LA 1IT6A 1DJZA 2AMIA 1QHWA 1S6IA 3BFHA 3QFNA 2LAPA 3EVUA 2ZOAA 2KDHA 3FLOA 4IL1A 1DGUA 4G9JA 1RK9A 2JQ6A 4MBEA 1CLLA 4MSPA 3H63A 4H1SA 3C1VA 2LMTA 1IH0A 2M3WA 2JZIA 3DYEA 2WC5A 1NCXA 1VRKA 2L50A 3DF0A 2ZBMA 2ZNDA 3TDZA 2Q4UA 4A4CA 2FCDA 2COLB 4V0XA 1K9UA 2ZN8A 2Q8UA 3BXKA 1OMVA 3FE9A 4PHJA 3EKJA 3NXAA 3TS5B 1Z2XA 1FPWA 1CM1A 1AP4A 2BDXA 1DJIA 3O6BA 2WCJA 1ALWA 3DY9A 1YTZC 3B86A 1H4BA 1L2OC 3WNXB 1UHHA 4FTGA 3PSNA 1OSAA 1OZOA 3I5FB 4C0JA 2GTEA 2JT3A 2M1KB 3S0BA 1AVSA 1HO5A 2JOJA 3JYFA 5JPFA 5JJTA 4N1FA 2K7DA 1CDPA 1ORGA 1EJ3A 1TTXA 3BOWA 4YGCB 1JBAA 1U32A 1W9ZA 2QFRA 1XFWO 2CTNA 2L2CA 3IF7A 5GQQC 1JF2A 2O5GA 4OVNF 4M0VA 2Y5IA 1S3LA 1KBPA 2GV5A 4FQTA 5HLOA 4UPGA 5KSZA 1C7VA 1DGVA 3NSKA 3VRQA 1IWQA 1KK8C 3IB7A 1SNLA 4CFRA 2CT9A 1BODA 3S0DA 2BCBA 3OHMB 1TNWA 1A2XA 1CTRA 3IB8A 3EVVA 3KBPA 2KBIA 2VRGA 1ZACA 1SCMC 1XFUO 2PRUA 3PM2A 1DMOA 2BE6A 2LLSA 3QG5C 4JA9A 1RFJA 1WLZA 2Y1MA 2USHA 3UO9A 1N2DA 3D10A 3BUWB 3S0GA 1EG3A 1CDMA 2WDEA 1KFUL 2QPTA 2LHIA 1EH2A 5FI2A 2BCDA 2YEQA 2MHHA 5B8IA 1AJ5A 1YUUA 2L5XB 3AKBA 3CR5X 2QEHA 4Q04A 2O8GA 3H69A 2ZKMX 2KGBC 3DW8C 3CGAA 1LA0A 3BQ3A 4WQ2A 1LA3A 4PE7A 3SS5A 4F7FA 2NLNA 4CIDA 3EVRA 1B1GA 1F54A 2KBMA 4FBQA 2KQ6A 2KYFA 1WRLA 1DELA 1V1GA 2BL0B 4OZDA 1M63B 3QRXA 2OPOA 4DS7A 2ZRSA 3VRRA 1ODBA 4I5NB 4H1YP 3VROA 1KSOA 4P5OE 2LMVA 4BY5A 1S8EA 1DJXA 3H64A 5D3OA 1WRKA 1DF0B 2PALA 1JC2A 1AK8A 1UTEA 4O4KA 1XYDA 3A8RA 4TNCA 1USHA 2I2RE 4UT3A 1IIOA 1WRZA 1CFPA 1DTLA 3D74A 1Y6WA 3PN7C 1DJWA 2JPOA 2LUCA 3K21A 3VGOA 1NCZA 4PHMA 2TN4A 1H8BA 3EK8A 3CLNA 4ORBA 2JTTA 4KBPA 3IVDA 1CFCA 2QFPA 4H2IA 1OI8A 1OOGA 5F3WA 5D69A 1DT7B 1R2UA 4YRUA 1DVIA 2GGMA 2KLEA 2LE9B 1SCVA 5PALA 1HT9A 2BBNA 2ZNEA 4PHNA 1A75B 5JJGA 1BR1B 1TCOA 3SJSA 1KQVA 1SL7A 2LLTA 1B7TZ 2I7AA 4NDBA 2BKHB 2GJUA 2AUCA 1F4QA 3GK2A 1MWNA 1CDLA 3PM8A 1UUSA 4OV2A 1XO5A 1KFXL 1J7RA 1XZWA 2BBMA 5DKRA 1YVHA 3O78A 1LKJA 2L5YA 4MN0A 1S95A 3DSDA 1C3ZA 2FJUB 2JRFA 2RGIA 2PSRA 1II7A 1SR6C 4M2OA 2NYMC 1QX5B 2XMOA 4LTYA 5TNCA 1UURA 1J7QA 4PALA 3TDIA 1TNPA 2M9GA 4R1EA 1CMFA 3VRNA 3QFKA 3WHTB 2Y4QA 3PSOA 4ZX2A 5IOHA 4YI9A 3DVMA 4I5LB 3AAKA 4PHKA 3SIBA 5FI6A 3L4AA 1K90D 2H8VA 5HPEA 3QFOA 1G8IA 1NPQA 1QS7A 2K0JA 4FCXA 1OOHA 1NUBA 1IQ5A 2O8AA 2LM5A 3SG7A 3B88A 1PVAA 1QVIY 2YGUA 3I5GC 2OTGB 1PSBA 1PK0D 2WCMA 1S6JA 2KFHA 3D0YA 4DT2A 3AKAA 3NHIA 3E7AA 2MA2A 3LLEA 4PDZA 3E7BA 1QJTA 1WDCB 2LHLA 2LC5A 1JUOA 2BQ8X 4LU9A 4NQGA 1S3PA 3S0EA 5EQVA 1KQMB 1UF3A 1J7PA 2M7LA 3KHEA 1HPUA 1S1EA 3RLZA 2I18A 2KHNA 3D77A 1HP1A 3R1PA 2P6BA 2NXQA 3SG3A 3K7VC 4KKZA 4HRHA 5HYDA 1Q80A 4JD9A 3I5IC 4MOYA 3MSEB 2M97A 3SS4A 3GVEA 4JKTA 3H62B 4V0VA 1W7IB 2P71A 3S0AA 2WCFA 2K8MB 2BNXA 5CSNA 3D76A 3VB1A 1XFRA 4H2GA 1PVBA 4CFQA 5K89A 1Y1XA 2K7BA 1XA5A 1SU1A 1V1FA 3B87A 1EG4A 2K60A 2KGRA 1P28A 3BFBA 3BFAA 1GM0A 1G5BA 2OS8B 1PULA 2B1UA 2HPSA 2L0PA 1FBVA 3HCMA 3H66A 3A4UB 5AXIA 3SIAA 3ZU0A 2F2OA 2F3ZA 3DVJA 1GQMA 4XYNA 4FBKA 1FI5A 1Z2CB 3BJHA 2EHBA 1NSHA 3E0JA 1XM7A 1KK7Z 3JTDB 4HD0A 1UHIA 1XVJA 1NYAA 3B6XA 1YVLA 3CZTX 3FE6A 5CPVA 3NGVA 1AUIB 2EGDA 1TNQA 3CABA 3KO0A 2FCEA 4N5XA 1T70A 2K2FA 2KQYA 3QMEA 4C0KA 1K96A 3OBVA 1WARA 3EK7A 3HVQA 3SG2A 3THOB 3K1EA 4PE1A 1FJMA 1NNWA 1KWOB 2Z1AA 1YRTB 1EL4A 1XK4A 1SK6D 1F70A 2JPTA 2LLUA 4PCWA 3EK4A 5HKZA 5CSFA 1S3NA 1L7ZA 3DXLA 1A4PA 2KYCA 4ZVZA 1MR8A 4GGNA 5DICA 1SMGA 3BUNB 1AHRA 3F45A 2M29A 3FWCA 5INBA 4Q7FA 2K61A 1A75A 2IAEC 2LMUA 2JT8A 2WCBA 2WDDA 2NYLC 4M2QA 3THNA 2WDFA 3T1IA 4DHLA 1OZSA 1TUZA 4CLNA 3NHTA 5ER5A 1XK4C 3LL8A 2JNFA 1RWYA 3OGNA 1S6CA 4IYPC 2MAZA 2MLFC 2CBLA 1DEKA 4XJKA 1S5GZ 1Y0VH 1YX7A 3Q8IA 2MBXA 2WNDA 4O43A 2BECA 5JPEA 1M45A 4GPLB 1PALA 4OR9B 2JXCA 3CWGA 1ALVA 1SBJA 1PSRA 2JT0A 5F6TA 3KEVA 3N7HA 3CR4X 2KOTA 3FS7A 3H68A 1KFUS 2BE4A 1M31A 3CYZA 3DF0B 3O4XA 3DSCA 1NWDA 3L47A 4ORCB 5DKQA 1T71A 4HREE 4YKEA 1CNPA 1NX1A 1SL9A 3ICBA 3K7WC 2KI4C 1OOIX 2QDIA 3H4SE 5AERA 4MRXA 1AJ4A 2JTZA 2E30A 4MRYA 1XFVO 4QJ3B 2KAYA 4HSZA 3JVTC 1K2HA 3CTNA 4AQJA 2ZFDA 5AEQA 1Y1UA 3L4LA 2O60A 1IGVA 2WORA 4JA7A 2G2BA 1K93D 1TWOA 4MEWA 4YI8A 5EL2A 5G08A 4CPVA 2FOTA 2LCPA 3DVKA 1K8UA 1TOPA 1RTP1 3GOFA 3OX5A 5KU1A 4ZCVA 1S3MA 2PQLA 2H2KA 2ZN9A 3M0WA 1RJVA 4NZVA 1QX7A 2EC6B 1OMRA 2G9BA 2LP3A 2M0RA 4YGBB 1ZMZA 1OQPA 1Z4HA 4TUGA 1MF8B 3FWBA 1SKTA 1T14A 1W24A 5CSJA 5HL1A 4GFTA 2L51A 1MXLC 1KQMC 1NP8A 4ORAA 1BT6A 1MXEA 1QWVA 4NDDA 1OOFA 1YUSA 4GGFA 3S0FA 1DQEA 4DUQA 2KFFA 2A22A 1C7WA 3TUYB 3BYAA 4YGAA 2HY1A 2SASA 3SG4A 2JWWA 1S5GY 1KFXS 1LINA 4D1EA 1SL8A 2A4JA 3I5HB 1SYMA 3GK4X 3WHUB 3AAJA 2KLDA 4ETOA 2SCPA 3KPXA 5B8IB 5I2QA 1BR4B 5I2LA 4UT3B 2ISDA 4NDCA 3PN7B 2DXNA 1LS8A 2MRDA 1R6PA 2JU0A 4GGFC 5J28A 3OB2B 1TIZA 5AANA 4OKHA 4M2PA 1K94A 2KPHA 1GGZA 3ZWHA 1S70A 1JF0A 2OS8C 1DJGA 3TS5C 3DZTA 2WCEA 5IBWA 4J6OA 5D7FA 3TZ1A 4UWQA 4PE0A 4YBHB 1BLQA 1Y1AA 2GGZA 3CZ0A 2JOGA 2JXLA 3C9FA 3OX6A 2QEBA 2BCAA 3RM1A 2JULA 1CFDA 1PRWA 3I5FC 1JWDA 3JTDC 5FI7A 2K7OA 1CDNA 4WWLA 3NSIA 1UHKA 1QASA 2KFGA 1QIWA 2M1UA 3R72A 1B7TY 1BOCA 4ORBB 2QJCA 2M49B 1N65A 1IJ5A 1LXFC 2KI6C 1SR6B 2WC8A 3BUXB 4MZJA 4N1GA 1C3YA 5FYXA 2WCKA 4F0ZB 1J1EA 1G4YR 1YR5A 4INXA 1TNXA 4MP0A 1TCOB 1TN4A 3D73A 1BF5A 1XFYO 4P2YB 4USLA 2H61A 3UNWA 1UHNA 3RZSA 2I94A 4YGEB 1NX0A 1TCFA 1JK7A 2HYPA 1QLKA 3P71C 3NSOA 4U8DA 4OR9A 3I5GB 1M63A 1CLMA 3SS3A 1U5IB 3DD4A 2IS9A
chains in the Genus database with same CATH topology
5DKNA 1CB1A 4JPZB 1DF0A 1B47A 3O4YA 3WXAA 1OE9B 5I2OA 4ORCA 2ZRTA 1UWOA 1OOJA 2KAXA 2R2IA 3OB1B 3H61A 3IVEA 1YX8A 2JNXA 1M46A 1QATA 2LP2A 2H61C 2QACA 1SPYA 2CCMA 3AV0A 4QJ5B 4H2FA 4H2BA 1GJYA 2HQWA 1NIWA 2F33A 2LNKA 2NCPA 1B8LA 5GTUA 2BL0C 2D8NA 5J3XA 1FF1A 4UT2A 3D03A 1YUTA 4I5NC 3D0YB 1OMDA 1IKUA 2AHDA 1M39A 3I5IB 2Y1NA 1LVCD 1W7JB 1B4CA 1QTXA 1SW8A 2K7CA 3EKHA 2IE3C 2Z06A 2NZ0A 2YVTA 4GAOA 1YRUB 1A29A 1CM4A 3SG6A 1V73A 4DCKA 1HQVA 4PE4A 1MF8A 1F8HA 1RROA 2F2PA 2K2AA 2P6BB 4JWQA 5EQVA 1N0YA 4C0LA 1QFCA 4HRGA 1ZUZA 2IE4C 2LVVA 4XPNA 2V53A 2L98A 3N5UA 2M7NA 1NX2A 1QV0A 2HETA 3H60A 3V4YA 1J1DA 4GBAA 5DNYA 2AAOA 3LK0A 2PMYA 2NXFA 1L2OB 2F3YA 1OIEA 1QLSA 1D1OA 2DXLA 3PSRA 3DVEA 4DSYA 2KAVA 2EC6C 1J7OA 5HKWA 2KKNA 4BY4A 3QFMA 2L2EA 1CKKA 2KSPA 1QIVA 1KK7Y 2WOSA 3KF9A 1OIDA 2F8PA 2LANA 3BUMB 4YGDB 2CV9A 1F4OA 1EXRA 1UP5A 1B9AA 3PFVA 1KCYA 1KK8B 1MUXA 2M8UA 2JC2A 3ZNIA 3TUYC 4I5LC 5I8NA 3TGHA 1S36A 4L9MA 1QVIZ 2BCXA 2BKIB 2L4HA 2KI6D 2KNEA 4DIRA 2MJWB 4TUIA 2MLEC 3I5HC 1SCMB 3PATA 3IQQA 2LVIA 3BOWB 2WDCA 2OTGC 1E8AA 2E6WA 5AFPA 2CNPA 4DRWA 2DFJA 2LVKA 1RECA 4V0WA 3PLFB 1BG1A 1WDCC 1A03A 3VRPA 4FBWA 3RL5A 4A4BA 4ZCUA 3LCPC 4GNKB 4WQ3A 2PASA 5JOLA 1SY9A 4F0ZA 2LVJA 3GK1A 1CFFA 2DOQA 1IQ3A 1JFJA 1FW4A 3BUOB 4MLWA 1TRFA 4MZLA 3E3RA 1IRJA 5BPJA 1F55A 1K95A 1SRAA 3FIAA 1ZFSA 3LL8B 2NPPC 3RL3A 4MVFA 2L4IA 2NCOA 4I5KA 4WRIA 1BJFA 3FGAC 1IJ6A 4XJKB 1JSAA 3EGHA 1FI6A 3CK2A 2KI4B 5HLVA 3ICFA 1U5IA 4ORAB 3SG5A 1KSMA 1G33A 1XFZO 3TDUA 4E68A 1BU3A 1C07A 1AUIA 1NCYA 4QJ4B 5C1VA 1K9PA 4AQIA 1QV1A 3ZTVA 3LK1A 1ZOTB 1YURA 4B2OA 3JVTB 3HX4A 2Q91A 1MQ1A 4LACC 1F71A 4O24A 4MZKA 1J55A 5ER4X 5CSIA 4O5GA 3RL4A 2LUXA 4OCIA 3CS1A 1MHOA 4FQOA 5KTYA 4AOMA 1CMGA 4JQ0D 3EGGA 3RQZA 1DJHA 2CXJA 4ICBA 3CR2A 1DJYA 3AUZA 1S26D 2ZO9B 1BMOA 2HYOA 1K9KA 1IG5A 3IQOA 2Z72A 1X02A 4GUKA 2LV7A 3NSLA 1Z2WA 1QXPA 1WY9A 1KWOC 2HF5A 2R17A 1UHJA 2PVBA 1XFXO 1CLBA 1GGWA 4I5JA 3OP0A 3C5WC 3H67A 1WLMA 3O2PA 3PALA 1B8RA 2HQ8A 5HKYA 1NX3A 1B8CA 1JFKA 1QX2A 1IT6A 1DJZA 2AMIA 1QHWA 1S6IA 3QFNA 2LAPA 3EVUA 2ZOAA 2KDHA 3FLOA 4IL1A 1DGUA 4G9JA 1RK9A 2JQ6A 4MBEA 1CLLA 4MSPA 3H63A 4H1SA 3C1VA 2LMTA 1IH0A 2M3WA 2JZIA 1NCXA 1VRKA 2L50A 3DF0A 2ZBMA 2ZNDA 3TDZA 2Q4UA 4A4CA 2FCDA 2COLB 4V0XA 1K9UA 2ZN8A 2Q8UA 3BXKA 1OMVA 4PHJA 3EKJA 3NXAA 3TS5B 1Z2XA 1FPWA 1CM1A 1AP4A 2BDXA 1DJIA 3O6BA 1ALWA 1YTZC 1H4BA 1L2OC 3WNXB 1UHHA 4FTGA 3PSNA 1OSAA 1OZOA 3I5FB 4C0JA 2JT3A 2M1KB 1AVSA 1HO5A 2JOJA 3JYFA 5JPFA 5JJTA 4N1FA 2K7DA 1CDPA 1TTXA 1EJ3A 3BOWA 4YGCB 1JBAA 1U32A 2QFRA 1XFWO 2CTNA 3IF7A 5GQQC 1JF2A 2O5GA 4OVNF 4M0VA 2Y5IA 1S3LA 1KBPA 2GV5A 4UPGA 5HLOA 5KSZA 1C7VA 1DGVA 3NSKA 3VRQA 1IWQA 1KK8C 3IB7A 1SNLA 4CFRA 2CT9A 1BODA 2BCBA 3OHMB 1TNWA 1A2XA 1CTRA 3IB8A 3EVVA 3KBPA 2KBIA 2VRGA 1ZACA 1SCMC 1XFUO 2PRUA 1DMOA 2BE6A 2LLSA 3QG5C 4JA9A 1RFJA 1WLZA 2Y1MA 2USHA 1N2DA 3D10A 3BUWB 1EG3A 1CDMA 2WDEA 1KFUL 2QPTA 2LHIA 1EH2A 2BCDA 2YEQA 2MHHA 5B8IA 1AJ5A 1YUUA 2L5XB 3AKBA 3CR5X 4Q04A 2O8GA 3H69A 4MOVA 2ZKMX 2KGBC 3DW8C 3CGAA 1LA0A 3BQ3A 4WQ2A 1LA3A 4PE7A 1F54A 4ORAA 2NLNA 4CIDA 3EVRA 1B1GA 2KBMA 4FBQA 2KQ6A 2KYFA 1WRLA 1V1GA 2BL0B 1M63B 3QRXA 2OPOA 4DS7A 2ZRSA 3VRRA 1ODBA 4I5NB 4H1YP 3VROA 1KSOA 4P5OE 2LMVA 4BY5A 1S8EA 1DJXA 3H64A 1WRKA 1DF0B 2PALA 1JC2A 1AK8A 1UTEA 4O4KA 1XYDA 3A8RA 4TNCA 1USHA 2I2RE 4UT3A 1WRZA 1CFPA 1DTLA 1Y6WA 3PN7C 1DJWA 2LUCA 3K21A 3VGOA 1NCZA 4PHMA 2TN4A 1H8BA 3EK8A 3CLNA 4ORBA 2JTTA 4KBPA 3IVDA 1CFCA 2QFPA 4H2IA 1OI8A 5F3WA 5D69A 1DT7B 1R2UA 4YRUA 1DVIA 2GGMA 2LE9B 1SCVA 5PALA 1HT9A 2BBNA 2ZNEA 4PHNA 1A75B 5JJGA 1BR1B 1TCOA 3SJSA 1KQVA 1SL7A 2LLTA 1B7TZ 2I7AA 4NDBA 2BKHB 2GJUA 2AUCA 1F4QA 3GK2A 1MWNA 1CDLA 3PM8A 1UUSA 4OV2A 1XO5A 1KFXL 1J7RA 1XZWA 2BBMA 5DKRA 1YVHA 3O78A 1LKJA 4MN0A 1S95A 3DSDA 2FJUB 2JRFA 2RGIA 1II7A 2PSRA 1SR6C 4M2OA 2NYMC 1QX5B 2XMOA 4LTYA 5TNCA 1UURA 1J7QA 4PALA 3TDIA 1TNPA 2M9GA 4R1EA 1CMFA 3VRNA 3QFKA 3WHTB 2Y4QA 3PSOA 4ZX2A 5IOHA 4YI9A 3DVMA 4I5LB 3AAKA 4PHKA 3SIBA 1K90D 5HPEA 3QFOA 1G8IA 1NPQA 1QS7A 2K0JA 4FCXA 1NUBA 1IQ5A 2O8AA 2LM5A 3SG7A 1PVAA 1QVIY 3I5GC 2OTGB 1PSBA 1PK0D 1S6JA 2KFHA 3D0YA 4DT2A 3AKAA 3E7AA 2MA2A 3LLEA 4PDZA 3E7BA 1QJTA 1WDCB 2LHLA 2LC5A 1JUOA 2BQ8X 4LU9A 4NQGA 1S3PA 1KQMB 1UF3A 1J7PA 2M7LA 3KHEA 1HPUA 1S1EA 3RLZA 2I18A 2KHNA 1HP1A 2P6BA 2NXQA 3SG3A 3K7VC 4KKZA 4HRHA 5HYDA 1Q80A 3I5IC 4MOYA 3MSEB 2M97A 3GVEA 3H62B 4V0VA 1W7IB 2WCFA 2K8MB 5CSNA 4H2GA 1PVBA 4CFQA 5K89A 1Y1XA 2K7BA 1XA5A 1SU1A 1V1FA 1EG4A 2KGRA 1G5BA 1WAO1 2OS8B 1PULA 2B1UA 2HPSA 2L0PA 1FBVA 3HCMA 3H66A 3A4UB 5AXIA 3SIAA 3ZU0A 2F2OA 2F3ZA 3DVJA 1GQMA 4XYNA 4FBKA 1FI5A 2EHBA 1NSHA 3E0JA 1XM7A 1KK7Z 3JTDB 4HD0A 1UHIA 1XVJA 1NYAA 5CPVA 1YVLA 3CZTX 1AUIB 2EGDA 1TNQA 3KO0A 4N5XA 2FCEA 1T70A 2K2FA 2KQYA 4C0KA 1K96A 1WARA 3EK7A 3HVQA 3SG2A 3THOB 4PE1A 1FJMA 1NNWA 1KWOB 2Z1AA 1EL4A 1XK4A 1YRTB 1SK6D 1F70A 2JPTA 2LLUA 4PCWA 3EK4A 5HKZA 5CSFA 1S3NA 1L7ZA 1A4PA 2KYCA 4ZVZA 1MR8A 4GGNA 1SMGA 3BUNB 1AHRA 3F45A 2M29A 3FWCA 5INBA 4Q7FA 2K61A 1A75A 2IAEC 2LMUA 2JT8A 2WCBA 2WDDA 2NYLC 4M2QA 3THNA 2WDFA 3T1IA 4DHLA 1OZSA 4CLNA 5ER5A 1XK4C 3LL8A 2JNFA 1RWYA 1S6CA 4IYPC 2MAZA 2MLFC 2CBLA 4XJKA 1S5GZ 1Y0VH 1YX7A 2MBXA 2WNDA 4O43A 2BECA 5JPEA 1M45A 4GPLB 1PALA 4OR9B 2JXCA 3CWGA 1ALVA 1SBJA 1PSRA 2JT0A 5F6TA 3KEVA 3CR4X 2KOTA 3FS7A 3H68A 1KFUS 2BE4A 1M31A 3DF0B 3DSCA 1NWDA 4ORCB 5DKQA 1T71A 4HREE 4YKEA 1CNPA 1NX1A 1SL9A 3ICBA 3K7WC 2KI4C 3H4SE 5AERA 4MRXA 1AJ4A 2JTZA 2E30A 4MRYA 1XFVO 4QJ3B 2KAYA 4HSZA 3JVTC 1K2HA 3CTNA 4AQJA 2ZFDA 5AEQA 1Y1UA 2O60A 1IGVA 2WORA 4JA7A 2G2BA 1K93D 4MEWA 4YI8A 5G08A 4CPVA 2FOTA 2LCPA 3DVKA 1K8UA 1TOPA 1RTP1 3GOFA 3OX5A 5KU1A 4ZCVA 1S3MA 2H2KA 2ZN9A 3M0WA 1RJVA 4NZVA 1QX7A 2EC6B 1OMRA 2G9BA 2LP3A 2M0RA 4YGBB 1ZMZA 1OQPA 4TUGA 1MF8B 3FWBA 1SKTA 1W24A 5CSJA 4GFTA 2L51A 1MXLC 1KQMC 1NP8A 1BT6A 1MXEA 4NDDA 1YUSA 4GGFA 4DUQA 2KFFA 2A22A 1C7WA 3TUYB 3BYAA 4YGAA 2HY1A 2SASA 3SG4A 2JWWA 1S5GY 1KFXS 1LINA 4D1EA 1SL8A 2A4JA 3I5HB 1SYMA 3GK4X 3WHUB 3AAJA 4ETOA 2SCPA 3KPXA 5B8IB 5I2QA 1BR4B 5I2LA 2ISDA 4NDCA 3PN7B 2DXNA 2MRDA 1R6PA 2JU0A 4GGFC 5J28A 3OB2B 1TIZA 5AANA 4OKHA 4M2PA 1K94A 1GGZA 3ZWHA 1S70A 1JF0A 2OS8C 1DJGA 3TS5C 5IBWA 2WCEA 4J6OA 4UWQA 5D7FA 3TZ1A 4PE0A 4YBHB 1BLQA 1Y1AA 2GGZA 2JOGA 2JXLA 3C9FA 3OX6A 2BCAA 3RM1A 2JULA 1CFDA 1PRWA 3I5FC 1JWDA 3JTDC 1CDNA 2K7OA 4UT3B 4WWLA 3NSIA 1UHKA 1QASA 2KFGA 1QIWA 2M1UA 1B7TY 1BOCA 4ORBB 2QJCA 2M49B 1N65A 1IJ5A 1LXFC 2KI6C 1SR6B 2WC8A 3BUXB 4MZJA 4N1GA 3P71C 5FYXA 4F0ZB 1J1EA 1G4YR 1YR5A 1TNXA 4MP0A 1TCOB 1TN4A 1BF5A 1XFYO 4P2YB 4USLA 2H61A 1UHNA 2I94A 4YGEB 1NX0A 1TCFA 1JK7A 2HYPA 1QLKA 3NSOA 4U8DA 4OR9A 3I5GB 1M63A 1CLMA 1U5IB 3DD4A 2IS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKN A;  1CB1 A;  4JPZ B;  1DF0 A;  1B47 A;  3O4Y A;  3WXA A;  1OE9 B;  5I2O A;  4ORC A;  2ZRT A;  1UWO A;  1OOJ A;  2KAX A;  2R2I A;  3OB1 B;  3H61 A;  3IVE A;  1YX8 A;  2JNX A;  1M46 A;  1QAT A;  2LP2 A;  2H61 C;  2QAC A;  1SPY A;  2CCM A;  3AV0 A;  4QJ5 B;  4H2F A;  4H2B A;  1GJY A;  2HQW A;  1NIW A;  2F33 A;  2LNK A;  2NCP A;  1B8L A;  5GTU A;  2BL0 C;  2D8N A;  5J3X A;  1FF1 A;  4UT2 A;  1YUT A;  4I5N C;  3D0Y B;  1OMD A;  1IKU A;  2AHD A;  1M39 A;  3I5I B;  2Y1N A;  1LVC D;  1W7J B;  1B4C A;  1QTX A;  1SW8 A;  2K7C A;  3EKH A;  2IE3 C;  2Z06 A;  2NZ0 A;  2YVT A;  4GAO A;  1YRU B;  1A29 A;  1CM4 A;  3SG6 A;  1V73 A;  4DCK A;  1HQV A;  4PE4 A;  1MF8 A;  1F8H A;  1RRO A;  2F2P A;  2K2A A;  2P6B B;  4JWQ A;  5EQV A;  1N0Y A;  4C0L A;  1QFC A;  4HRG A;  1ZUZ A;  2IE4 C;  2LVV A;  4XPN A;  2V53 A;  2L98 A;  3N5U A;  2M7N A;  1NX2 A;  1QV0 A;  2HET A;  3H60 A;  3V4Y A;  1J1D A;  4GBA A;  5DNY A;  2AAO A;  3LK0 A;  2PMY A;  2NXF A;  1L2O B;  2F3Y A;  1OIE A;  1QLS A;  1D1O A;  3PSR A;  3DVE A;  4DSY A;  2KAV A;  2EC6 C;  1J7O A;  5HKW A;  2KKN A;  4BY4 A;  3QFM A;  2L2E A;  1CKK A;  2KSP A;  1QIV A;  1KK7 Y;  2WOS A;  3KF9 A;  1OID A;  2F8P A;  2LAN A;  3BUM B;  4YGD B;  2CV9 A;  1F4O A;  1EXR A;  1UP5 A;  1B9A A;  3PFV A;  1KCY A;  1KK8 B;  1MUX A;  2M8U A;  2JC2 A;  3ZNI A;  3TUY C;  4I5L C;  5I8N A;  3TGH A;  1S36 A;  4L9M A;  1QVI Z;  2BCX A;  2BKI B;  2L4H A;  2KI6 D;  2KNE A;  4DIR A;  2MJW B;  4TUI A;  2MLE C;  3I5H C;  1SCM B;  3PAT A;  3IQQ A;  2LVI A;  3BOW B;  2WDC A;  2OTG C;  1E8A A;  2E6W A;  5AFP A;  2CNP A;  4DRW A;  2DFJ A;  2LVK A;  1REC A;  4V0W A;  3PLF B;  1BG1 A;  1WDC C;  1A03 A;  3VRP A;  4FBW A;  3RL5 A;  4A4B A;  4ZCU A;  3LCP C;  4GNK B;  4WQ3 A;  2PAS A;  5JOL A;  1SY9 A;  4F0Z A;  2LVJ A;  3GK1 A;  1CFF A;  2DOQ A;  1IQ3 A;  1JFJ A;  1FW4 A;  3BUO B;  4MLW A;  1TRF A;  4MZL A;  3E3R A;  1IRJ A;  5BPJ A;  1F55 A;  1K95 A;  1SRA A;  3FIA A;  1ZFS A;  3LL8 B;  2NPP C;  3RL3 A;  4MVF A;  2L4I A;  2NCO A;  4I5K A;  4WRI A;  1BJF A;  3FGA C;  1IJ6 A;  4XJK B;  1JSA A;  3EGH A;  1FI6 A;  3CK2 A;  2KI4 B;  5HLV A;  3ICF A;  1U5I A;  4ORA B;  3SG5 A;  1KSM A;  1G33 A;  1XFZ O;  3TDU A;  4E68 A;  1BU3 A;  1C07 A;  1AUI A;  1NCY A;  4QJ4 B;  5C1V A;  1K9P A;  4AQI A;  1QV1 A;  3ZTV A;  3LK1 A;  1ZOT B;  1YUR A;  4B2O A;  3JVT B;  3HX4 A;  2Q91 A;  1MQ1 A;  4LAC C;  1F71 A;  4O24 A;  4MZK A;  1J55 A;  5ER4 X;  5CSI A;  4O5G A;  3RL4 A;  2LUX A;  4OCI A;  3CS1 A;  1MHO A;  4FQO A;  5KTY A;  4AOM A;  1CMG A;  4JQ0 D;  3EGG A;  3RQZ A;  1DJH A;  2CXJ A;  4ICB A;  3CR2 A;  1DJY A;  3AUZ A;  1S26 D;  1BMO A;  2HYO A;  1K9K A;  1IG5 A;  3IQO A;  2Z72 A;  1X02 A;  4GUK A;  2LV7 A;  3NSL A;  1Z2W A;  1QXP A;  1WY9 A;  1KWO C;  2HF5 A;  2R17 A;  1UHJ A;  2PVB A;  1XFX O;  1CLB A;  1GGW A;  4I5J A;  3OP0 A;  3C5W C;  3H67 A;  1WLM A;  3O2P A;  3PAL A;  1B8R A;  2HQ8 A;  5HKY A;  1NX3 A;  1B8C A;  1JFK A;  1QX2 A;  1IT6 A;  1DJZ A;  2AMI A;  1QHW A;  1S6I A;  3QFN A;  2LAP A;  3EVU A;  2KDH A;  4IL1 A;  1DGU A;  4G9J A;  1RK9 A;  2JQ6 A;  4MBE A;  1CLL A;  4MSP A;  3H63 A;  4H1S A;  3C1V A;  2LMT A;  1IH0 A;  2M3W A;  2JZI A;  1NCX A;  1VRK A;  2L50 A;  3DF0 A;  2ZBM A;  2ZND A;  3TDZ A;  2Q4U A;  4A4C A;  2FCD A;  2COL B;  4V0X A;  1K9U A;  2ZN8 A;  2Q8U A;  3BXK A;  1OMV A;  4PHJ A;  3EKJ A;  3NXA A;  3TS5 B;  1Z2X A;  1FPW A;  1CM1 A;  1AP4 A;  2BDX A;  1DJI A;  3O6B A;  1ALW A;  1YTZ C;  1H4B A;  1L2O C;  3WNX B;  1UHH A;  4FTG A;  3PSN A;  1OSA A;  1OZO A;  3I5F B;  4C0J A;  2JT3 A;  2M1K B;  1AVS A;  1HO5 A;  2JOJ A;  3JYF A;  5JPF A;  5JJT A;  4N1F A;  2K7D A;  1CDP A;  1TTX A;  1EJ3 A;  3BOW A;  4YGC B;  1JBA A;  1U32 A;  2QFR A;  1XFW O;  2CTN A;  3IF7 A;  5GQQ C;  1JF2 A;  2O5G A;  4OVN F;  4M0V A;  2Y5I A;  1S3L A;  1KBP A;  2GV5 A;  4UPG A;  5HLO A;  5KSZ A;  1C7V A;  1DGV A;  3NSK A;  3VRQ A;  1IWQ A;  1KK8 C;  3IB7 A;  1SNL A;  4CFR A;  2CT9 A;  1BOD A;  2BCB A;  3OHM B;  1TNW A;  1A2X A;  1CTR A;  3IB8 A;  3EVV A;  3KBP A;  2KBI A;  2VRG A;  1ZAC A;  1SCM C;  1XFU O;  2PRU A;  1DMO A;  2BE6 A;  2LLS A;  3QG5 C;  4JA9 A;  1RFJ A;  1WLZ A;  2Y1M A;  2USH A;  1N2D A;  3D10 A;  3BUW B;  1EG3 A;  1CDM A;  2WDE A;  1KFU L;  2QPT A;  2LHI A;  1EH2 A;  2BCD A;  5B8I A;  2MHH A;  1AJ5 A;  1YUU A;  2L5X B;  3AKB A;  3CR5 X;  4Q04 A;  2O8G A;  3H69 A;  4MOV A;  2ZKM X;  2KGB C;  3DW8 C;  3CGA A;  1LA0 A;  3BQ3 A;  4WQ2 A;  1LA3 A;  4PE7 A;  1F54 A;  4ORA A;  2NLN A;  4CID A;  3EVR A;  1B1G A;  2KBM A;  4FBQ A;  2KQ6 A;  2KYF A;  1WRL A;  1V1G A;  2BL0 B;  1M63 B;  3QRX A;  2OPO A;  4DS7 A;  2ZRS A;  3VRR A;  1ODB A;  4I5N B;  4H1Y P;  3VRO A;  1KSO A;  4P5O E;  2LMV A;  4BY5 A;  1S8E A;  1DJX A;  3H64 A;  1WRK A;  1DF0 B;  2PAL A;  1JC2 A;  1AK8 A;  1UTE A;  4O4K A;  1XYD A;  3A8R A;  4TNC A;  1USH A;  2I2R E;  4UT3 A;  1WRZ A;  1CFP A;  1DTL A;  1Y6W A;  3PN7 C;  1DJW A;  2LUC A;  3K21 A;  3VGO A;  1NCZ A;  4PHM A;  2TN4 A;  1H8B A;  3EK8 A;  3CLN A;  4ORB A;  2JTT A;  4KBP A;  3IVD A;  1CFC A;  2QFP A;  4H2I A;  1OI8 A;  5F3W A;  5D69 A;  1DT7 B;  1R2U A;  4YRU A;  1DVI A;  2GGM A;  2LE9 B;  1SCV A;  5PAL A;  1HT9 A;  2BBN A;  2ZNE A;  4PHN A;  1A75 B;  5JJG A;  1BR1 B;  1TCO A;  3SJS A;  1KQV A;  1SL7 A;  2LLT A;  1B7T Z;  2I7A A;  4NDB A;  2BKH B;  2GJU A;  2AUC A;  1F4Q A;  3GK2 A;  1MWN A;  1CDL A;  3PM8 A;  1UUS A;  4OV2 A;  1XO5 A;  1KFX L;  1J7R A;  1XZW A;  2BBM A;  5DKR A;  1YVH A;  3O78 A;  1LKJ A;  4MN0 A;  1S95 A;  3DSD A;  2FJU B;  2JRF A;  2RGI A;  1II7 A;  2PSR A;  1SR6 C;  4M2O A;  2NYM C;  1QX5 B;  2XMO A;  4LTY A;  5TNC A;  1UUR A;  1J7Q A;  4PAL A;  3TDI A;  1TNP A;  2M9G A;  4R1E A;  1CMF A;  3VRN A;  3QFK A;  3WHT B;  2Y4Q A;  3PSO A;  4ZX2 A;  5IOH A;  4YI9 A;  3DVM A;  4I5L B;  3AAK A;  4PHK A;  3SIB A;  1K90 D;  5HPE A;  3QFO A;  1G8I A;  1NPQ A;  1QS7 A;  2K0J A;  4FCX A;  1NUB A;  1IQ5 A;  2O8A A;  2LM5 A;  3SG7 A;  1PVA A;  1QVI Y;  3I5G C;  2OTG B;  1PSB A;  1PK0 D;  1S6J A;  2KFH A;  3D0Y A;  4DT2 A;  3AKA A;  3E7A A;  2MA2 A;  3LLE A;  4PDZ A;  3E7B A;  1QJT A;  1WDC B;  2LHL A;  2LC5 A;  1JUO A;  2BQ8 X;  4LU9 A;  4NQG A;  1S3P A;  1KQM B;  1UF3 A;  1J7P A;  2M7L A;  3KHE A;  1HPU A;  1S1E A;  3RLZ A;  2I18 A;  2KHN A;  1HP1 A;  2P6B A;  2NXQ A;  3SG3 A;  3K7V C;  4KKZ A;  4HRH A;  5HYD A;  1Q80 A;  3I5I C;  4MOY A;  3MSE B;  2M97 A;  3GVE A;  3H62 B;  4V0V A;  1W7I B;  2WCF A;  2K8M B;  5CSN A;  4H2G A;  1PVB A;  4CFQ A;  5K89 A;  1Y1X A;  2K7B A;  1XA5 A;  1SU1 A;  1V1F A;  1EG4 A;  2KGR A;  1G5B A;  1WAO 1;  2OS8 B;  1PUL A;  2B1U A;  2HPS A;  2L0P A;  1FBV A;  3HCM A;  3H66 A;  3A4U B;  5AXI A;  3SIA A;  3ZU0 A;  2F2O A;  2F3Z A;  3DVJ A;  1GQM A;  4XYN A;  4FBK A;  1FI5 A;  2EHB A;  1NSH A;  1XM7 A;  1KK7 Z;  3JTD B;  4HD0 A;  1UHI A;  1XVJ A;  1NYA A;  5CPV A;  1YVL A;  3CZT X;  1AUI B;  2EGD A;  1TNQ A;  3KO0 A;  4N5X A;  2FCE A;  1T70 A;  2K2F A;  2KQY A;  4C0K A;  1K96 A;  1WAR A;  3EK7 A;  3HVQ A;  3SG2 A;  3THO B;  4PE1 A;  1FJM A;  1NNW A;  1KWO B;  2Z1A A;  1EL4 A;  1XK4 A;  1YRT B;  1SK6 D;  1F70 A;  2JPT A;  2LLU A;  4PCW A;  3EK4 A;  5HKZ A;  5CSF A;  1S3N A;  1L7Z A;  1A4P A;  2KYC A;  4ZVZ A;  1MR8 A;  4GGN A;  1SMG A;  3BUN B;  1AHR A;  3F45 A;  2M29 A;  3FWC A;  5INB A;  4Q7F A;  2K61 A;  1A75 A;  2IAE C;  2LMU A;  2JT8 A;  2WCB A;  2WDD A;  2NYL C;  4M2Q A;  3THN A;  2WDF A;  3T1I A;  4DHL A;  1OZS A;  4CLN A;  5ER5 A;  1XK4 C;  3LL8 A;  2JNF A;  1RWY A;  1S6C A;  4IYP C;  2MAZ A;  2MLF C;  2CBL A;  4XJK A;  1S5G Z;  1Y0V H;  1YX7 A;  2MBX A;  2WND A;  4O43 A;  2BEC A;  5JPE A;  1M45 A;  4GPL B;  1PAL A;  4OR9 B;  2JXC A;  3CWG A;  1ALV A;  1SBJ A;  1PSR A;  2JT0 A;  5F6T A;  3KEV A;  3CR4 X;  2KOT A;  3FS7 A;  3H68 A;  1KFU S;  2BE4 A;  1M31 A;  3DF0 B;  3DSC A;  1NWD A;  4ORC B;  5DKQ A;  1T71 A;  4HRE E;  4YKE A;  1CNP A;  1NX1 A;  1SL9 A;  3ICB A;  3K7W C;  2KI4 C;  3H4S E;  5AER A;  4MRX A;  1AJ4 A;  2JTZ A;  2E30 A;  4MRY A;  1XFV O;  4QJ3 B;  2KAY A;  4HSZ A;  3JVT C;  1K2H A;  3CTN A;  4AQJ A;  2ZFD A;  5AEQ A;  1Y1U A;  2O60 A;  1IGV A;  2WOR A;  4JA7 A;  2G2B A;  1K93 D;  4MEW A;  4YI8 A;  5G08 A;  4CPV A;  2FOT A;  2LCP A;  3DVK A;  1K8U A;  1TOP A;  1RTP 1;  3GOF A;  3OX5 A;  5KU1 A;  4ZCV A;  1S3M A;  2H2K A;  2ZN9 A;  3M0W A;  1RJV A;  4NZV A;  1QX7 A;  2EC6 B;  1OMR A;  2G9B A;  2LP3 A;  2M0R A;  4YGB B;  1ZMZ A;  1OQP A;  4TUG A;  1MF8 B;  3FWB A;  1SKT A;  1W24 A;  5CSJ A;  4GFT A;  2L51 A;  1MXL C;  1KQM C;  1NP8 A;  1BT6 A;  1MXE A;  4NDD A;  1YUS A;  4GGF A;  4DUQ A;  2KFF A;  2A22 A;  1C7W A;  3TUY B;  3BYA A;  4YGA A;  2HY1 A;  2SAS A;  3SG4 A;  2JWW A;  1S5G Y;  1KFX S;  1LIN A;  4D1E A;  1SL8 A;  2A4J A;  3I5H B;  1SYM A;  3GK4 X;  3WHU B;  3AAJ A;  4ETO A;  2SCP A;  3KPX A;  5B8I B;  5I2Q A;  1BR4 B;  5I2L A;  2ISD A;  4NDC A;  3PN7 B;  2MRD A;  1R6P A;  2JU0 A;  4GGF C;  5J28 A;  3OB2 B;  1TIZ A;  5AAN A;  4OKH A;  4M2P A;  1K94 A;  1GGZ A;  3ZWH A;  1S70 A;  1JF0 A;  2OS8 C;  1DJG A;  3TS5 C;  5IBW A;  2WCE A;  4J6O A;  4UWQ A;  5D7F A;  3TZ1 A;  4PE0 A;  4YBH B;  1BLQ A;  1Y1A A;  2GGZ A;  2JOG A;  2JXL A;  3C9F A;  3OX6 A;  2BCA A;  3RM1 A;  2JUL A;  1CFD A;  1PRW A;  3I5F C;  1JWD A;  3JTD C;  1CDN A;  2K7O A;  4UT3 B;  4WWL A;  3NSI A;  1UHK A;  1QAS A;  2KFG A;  1QIW A;  2M1U A;  1B7T Y;  1BOC A;  4ORB B;  2QJC A;  2M49 B;  1N65 A;  1IJ5 A;  1LXF C;  2KI6 C;  1SR6 B;  2WC8 A;  3BUX B;  4MZJ A;  4N1G A;  3P71 C;  5FYX A;  4F0Z B;  1J1E A;  1G4Y R;  1YR5 A;  1TNX A;  4MP0 A;  1TCO B;  1TN4 A;  1BF5 A;  1XFY O;  4P2Y B;  4USL A;  2H61 A;  1UHN A;  2I94 A;  4YGE B;  1NX0 A;  1TCF A;  1JK7 A;  2HYP A;  1QLK A;  3NSO A;  4U8D A;  4OR9 A;  3I5G B;  1M63 A;  1CLM A;  1U5I B;  3DD4 A;  2IS9 A; 
#chains in the Genus database with same CATH topology
 5DKN A;  1CB1 A;  4JPZ B;  2QEV A;  1DF0 A;  1B47 A;  3O4Y A;  3WXA A;  1OE9 B;  5I2O A;  4ORC A;  2ZRT A;  1UWO A;  1OOJ A;  2KAX A;  2R2I A;  3OB1 B;  3PJI A;  3H61 A;  1YX8 A;  3IVE A;  2JNX A;  1M46 A;  1QAT A;  2LP2 A;  2H61 C;  3R1V A;  2QAC A;  1SPY A;  2CCM A;  3AV0 A;  2WC6 A;  4QJ5 B;  4H2F A;  1GJY A;  4H2B A;  2HQW A;  1NIW A;  2F33 A;  2LNK A;  2NCP A;  1B8L A;  1WAO 1;  5GTU A;  2BL0 C;  2D8N A;  5J3X A;  1FF1 A;  4UT2 A;  3D03 A;  1YUT A;  4I5N C;  3D0Y B;  1OMD A;  4INW A;  1IKU A;  2AHD A;  1M39 A;  3I5I B;  2Y1N A;  1LVC D;  2QEO A;  1W7J B;  1B4C A;  1QTX A;  1SW8 A;  2K7C A;  3EKH A;  2IE3 C;  2Z06 A;  2NZ0 A;  2YVT A;  4GAO A;  1YRU B;  1A29 A;  1CM4 A;  3SG6 A;  3D75 A;  1V73 A;  4DCK A;  1HQV A;  4PE4 A;  1MF8 A;  1F8H A;  2PYQ A;  1RRO A;  2F2P A;  2K2A A;  2P6B B;  3R1O A;  4JWQ A;  4KYN A;  1N0Y A;  4C0L A;  1QFC A;  4HRG A;  1ZUZ A;  2IE4 C;  2LVV A;  4XPN A;  2V53 A;  2L98 A;  3N5U A;  2M7N A;  1NX2 A;  1QV0 A;  2HET A;  3H60 A;  3V4Y A;  1J1D A;  4GBA A;  5DNY A;  2AAO A;  3LK0 A;  2PMY A;  2NXF A;  1L2O B;  2F3Y A;  1OIE A;  1QLS A;  1D1O A;  2DXL A;  3PSR A;  3DVE A;  4DSY A;  2KAV A;  2EC6 C;  1J7O A;  3FE8 A;  5HKW A;  2KKN A;  4BY4 A;  3QFM A;  2L2E A;  1CKK A;  2KSP A;  1QIV A;  1KK7 Y;  2WOS A;  3KF9 A;  1OID A;  2F8P A;  2LAN A;  3BUM B;  3IVT A;  2ERB A;  4YGD B;  1F4O A;  1EXR A;  1UP5 A;  1B9A A;  3PFV A;  1KCY A;  2CV9 A;  1KK8 B;  1MUX A;  2M8U A;  2JC2 A;  4PT1 A;  3ZNI A;  3TUY C;  4I5L C;  5I8N A;  3TGH A;  1S36 A;  4L9M A;  1QVI Z;  2BCX A;  2BKI B;  2L4H A;  2KI6 D;  4IJ7 A;  2KNE A;  4DIR A;  2MJW B;  5I94 A;  2MLE C;  3I5H C;  4TUI A;  1SCM B;  3CDN A;  3IQQ A;  3PAT A;  2LVI A;  3BOW B;  2WDC A;  2OTG C;  1E8A A;  2E6W A;  2WCL A;  2CNP A;  4DRW A;  5AFP A;  2P70 A;  2DFJ A;  2LVK A;  3CZ1 A;  1REC A;  4V0W A;  3PLF B;  1BG1 A;  1SSE B;  1WDC C;  3CZ2 A;  1A03 A;  3VRP A;  4FBW A;  3RL5 A;  4A4B A;  1DC1 A;  4ZCU A;  3LCP C;  4GNK B;  4WQ3 A;  2PAS A;  5JOL A;  1SY9 A;  4F0Z A;  2LVJ A;  3GK1 A;  1CFF A;  2DOQ A;  1IQ3 A;  1JFJ A;  1FW4 A;  3BUO B;  4MLW A;  1TRF A;  4MZL A;  3E3R A;  1IRJ A;  1TUJ A;  5BPJ A;  1F55 A;  1K95 A;  1SRA A;  3FIA A;  1ZFS A;  3LL8 B;  2NPP C;  3RL3 A;  4MVF A;  2L4I A;  2NCO A;  4I5K A;  4WRI A;  1BJF A;  3FGA C;  1IJ6 A;  2BAP A;  4XJK B;  1JSA A;  1FI6 A;  3EGH A;  3CK2 A;  2KI4 B;  5HLV A;  3ICF A;  1U5I A;  4ORA B;  3SG5 A;  1KSM A;  1G33 A;  1XFZ O;  3TDU A;  4E68 A;  1BU3 A;  1C07 A;  1AUI A;  1NCY A;  4MOV A;  4QJ4 B;  5C1V A;  1K9P A;  4AQI A;  1QV1 A;  3ZTV A;  3LK1 A;  1ZOT B;  1YUR A;  4B2O A;  3JVT B;  3HX4 A;  2Q91 A;  1MQ1 A;  4LAC C;  1F71 A;  2FJY A;  4O24 A;  4MZK A;  1J55 A;  5ER4 X;  5CSI A;  4O5G A;  3RL4 A;  2LUX A;  4OCI A;  3B7A A;  3CS1 A;  1MHO A;  4FQO A;  5KTY A;  4AOM A;  1CMG A;  4JQ0 D;  3EGG A;  3RQZ A;  1DJH A;  2CXJ A;  4ICB A;  3CR2 A;  1DJY A;  3AUZ A;  1S26 D;  2ZO9 B;  1BMO A;  2HYO A;  1K9K A;  1IG5 A;  3IQO A;  2Z72 A;  1X02 A;  4GUK A;  2LV7 A;  3NSL A;  1OW4 A;  1Z2W A;  1QXP A;  1WY9 A;  1KWO C;  2HF5 A;  2WCH A;  1UHJ A;  2PVB A;  1XFX O;  1CLB A;  2R17 A;  1GGW A;  4I5J A;  3OP0 A;  3C5W C;  3H67 A;  1WLM A;  3O2P A;  3PAL A;  1B8R A;  2HQ8 A;  5HKY A;  3D78 A;  1NX3 A;  1B8C A;  3EG5 B;  1JFK A;  1QX2 A;  3V2L A;  1IT6 A;  1DJZ A;  2AMI A;  1QHW A;  1S6I A;  3BFH A;  3QFN A;  2LAP A;  3EVU A;  2ZOA A;  2KDH A;  3FLO A;  4IL1 A;  1DGU A;  4G9J A;  1RK9 A;  2JQ6 A;  4MBE A;  1CLL A;  4MSP A;  3H63 A;  4H1S A;  3C1V A;  2LMT A;  1IH0 A;  2M3W A;  2JZI A;  3DYE A;  2WC5 A;  1NCX A;  1VRK A;  2L50 A;  3DF0 A;  2ZBM A;  2ZND A;  3TDZ A;  2Q4U A;  4A4C A;  2FCD A;  2COL B;  4V0X A;  1K9U A;  2ZN8 A;  2Q8U A;  3BXK A;  1OMV A;  3FE9 A;  4PHJ A;  3EKJ A;  3NXA A;  3TS5 B;  1Z2X A;  1FPW A;  1CM1 A;  1AP4 A;  2BDX A;  1DJI A;  3O6B A;  2WCJ A;  1ALW A;  3DY9 A;  1YTZ C;  3B86 A;  1H4B A;  1L2O C;  3WNX B;  1UHH A;  4FTG A;  3PSN A;  1OSA A;  1OZO A;  3I5F B;  4C0J A;  2GTE A;  2JT3 A;  2M1K B;  3S0B A;  1AVS A;  1HO5 A;  2JOJ A;  3JYF A;  5JPF A;  5JJT A;  4N1F A;  2K7D A;  1CDP A;  1ORG A;  1EJ3 A;  1TTX A;  3BOW A;  4YGC B;  1JBA A;  1U32 A;  1W9Z A;  2QFR A;  1XFW O;  2CTN A;  2L2C A;  3IF7 A;  5GQQ C;  1JF2 A;  2O5G A;  4OVN F;  4M0V A;  2Y5I A;  1S3L A;  1KBP A;  2GV5 A;  4FQT A;  5HLO A;  4UPG A;  5KSZ A;  1C7V A;  1DGV A;  3NSK A;  3VRQ A;  1IWQ A;  1KK8 C;  3IB7 A;  1SNL A;  4CFR A;  2CT9 A;  1BOD A;  3S0D A;  2BCB A;  3OHM B;  1TNW A;  1A2X A;  1CTR A;  3IB8 A;  3EVV A;  3KBP A;  2KBI A;  2VRG A;  1ZAC A;  1SCM C;  1XFU O;  2PRU A;  3PM2 A;  1DMO A;  2BE6 A;  2LLS A;  3QG5 C;  4JA9 A;  1RFJ A;  1WLZ A;  2Y1M A;  2USH A;  3UO9 A;  1N2D A;  3D10 A;  3BUW B;  3S0G A;  1EG3 A;  1CDM A;  2WDE A;  1KFU L;  2QPT A;  2LHI A;  1EH2 A;  5FI2 A;  2BCD A;  2YEQ A;  2MHH A;  5B8I A;  1AJ5 A;  1YUU A;  2L5X B;  3AKB A;  3CR5 X;  2QEH A;  4Q04 A;  2O8G A;  3H69 A;  2ZKM X;  2KGB C;  3DW8 C;  3CGA A;  1LA0 A;  3BQ3 A;  4WQ2 A;  1LA3 A;  4PE7 A;  3SS5 A;  4F7F A;  2NLN A;  4CID A;  3EVR A;  1B1G A;  1F54 A;  2KBM A;  4FBQ A;  2KQ6 A;  2KYF A;  1WRL A;  1DEL A;  1V1G A;  2BL0 B;  4OZD A;  1M63 B;  3QRX A;  2OPO A;  4DS7 A;  2ZRS A;  3VRR A;  1ODB A;  4I5N B;  4H1Y P;  3VRO A;  1KSO A;  4P5O E;  2LMV A;  4BY5 A;  1S8E A;  1DJX A;  3H64 A;  5D3O A;  1WRK A;  1DF0 B;  2PAL A;  1JC2 A;  1AK8 A;  1UTE A;  4O4K A;  1XYD A;  3A8R A;  4TNC A;  1USH A;  2I2R E;  4UT3 A;  1IIO A;  1WRZ A;  1CFP A;  1DTL A;  3D74 A;  1Y6W A;  3PN7 C;  1DJW A;  2JPO A;  2LUC A;  3K21 A;  3VGO A;  1NCZ A;  4PHM A;  2TN4 A;  1H8B A;  3EK8 A;  3CLN A;  4ORB A;  2JTT A;  4KBP A;  3IVD A;  1CFC A;  2QFP A;  4H2I A;  1OI8 A;  1OOG A;  5F3W A;  5D69 A;  1DT7 B;  1R2U A;  4YRU A;  1DVI A;  2GGM A;  2KLE A;  2LE9 B;  1SCV A;  5PAL A;  1HT9 A;  2BBN A;  2ZNE A;  4PHN A;  1A75 B;  5JJG A;  1BR1 B;  1TCO A;  3SJS A;  1KQV A;  1SL7 A;  2LLT A;  1B7T Z;  2I7A A;  4NDB A;  2BKH B;  2GJU A;  2AUC A;  1F4Q A;  3GK2 A;  1MWN A;  1CDL A;  3PM8 A;  1UUS A;  4OV2 A;  1XO5 A;  1KFX L;  1J7R A;  1XZW A;  2BBM A;  5DKR A;  1YVH A;  3O78 A;  1LKJ A;  2L5Y A;  4MN0 A;  1S95 A;  3DSD A;  1C3Z A;  2FJU B;  2JRF A;  2RGI A;  2PSR A;  1II7 A;  1SR6 C;  4M2O A;  2NYM C;  1QX5 B;  2XMO A;  4LTY A;  5TNC A;  1UUR A;  1J7Q A;  4PAL A;  3TDI A;  1TNP A;  2M9G A;  4R1E A;  1CMF A;  3VRN A;  3QFK A;  3WHT B;  2Y4Q A;  3PSO A;  4ZX2 A;  5IOH A;  4YI9 A;  3DVM A;  4I5L B;  3AAK A;  4PHK A;  3SIB A;  5FI6 A;  3L4A A;  1K90 D;  2H8V A;  5HPE A;  3QFO A;  1G8I A;  1NPQ A;  1QS7 A;  2K0J A;  4FCX A;  1OOH A;  1NUB A;  1IQ5 A;  2O8A A;  2LM5 A;  3SG7 A;  3B88 A;  1PVA A;  1QVI Y;  2YGU A;  3I5G C;  2OTG B;  1PSB A;  1PK0 D;  2WCM A;  1S6J A;  2KFH A;  3D0Y A;  4DT2 A;  3AKA A;  3NHI A;  3E7A A;  2MA2 A;  3LLE A;  4PDZ A;  3E7B A;  1QJT A;  1WDC B;  2LHL A;  2LC5 A;  1JUO A;  2BQ8 X;  4LU9 A;  4NQG A;  1S3P A;  3S0E A;  5EQV A;  1KQM B;  1UF3 A;  1J7P A;  2M7L A;  3KHE A;  1HPU A;  1S1E A;  3RLZ A;  2I18 A;  2KHN A;  3D77 A;  1HP1 A;  3R1P A;  2P6B A;  2NXQ A;  3SG3 A;  3K7V C;  4KKZ A;  4HRH A;  5HYD A;  1Q80 A;  4JD9 A;  3I5I C;  4MOY A;  3MSE B;  2M97 A;  3SS4 A;  3GVE A;  4JKT A;  3H62 B;  4V0V A;  1W7I B;  2P71 A;  3S0A A;  2WCF A;  2K8M B;  2BNX A;  5CSN A;  3D76 A;  3VB1 A;  1XFR A;  4H2G A;  1PVB A;  4CFQ A;  5K89 A;  1Y1X A;  2K7B A;  1XA5 A;  1SU1 A;  1V1F A;  3B87 A;  1EG4 A;  2K60 A;  2KGR A;  1P28 A;  3BFB A;  3BFA A;  1GM0 A;  1G5B A;  2OS8 B;  1PUL A;  2B1U A;  2HPS A;  2L0P A;  1FBV A;  3HCM A;  3H66 A;  3A4U B;  5AXI A;  3SIA A;  3ZU0 A;  2F2O A;  2F3Z A;  3DVJ A;  1GQM A;  4XYN A;  4FBK A;  1FI5 A;  1Z2C B;  3BJH A;  2EHB A;  1NSH A;  3E0J A;  1XM7 A;  1KK7 Z;  3JTD B;  4HD0 A;  1UHI A;  1XVJ A;  1NYA A;  3B6X A;  1YVL A;  3CZT X;  3FE6 A;  5CPV A;  3NGV A;  1AUI B;  2EGD A;  1TNQ A;  3CAB A;  3KO0 A;  2FCE A;  4N5X A;  1T70 A;  2K2F A;  2KQY A;  3QME A;  4C0K A;  1K96 A;  3OBV A;  1WAR A;  3EK7 A;  3HVQ A;  3SG2 A;  3THO B;  3K1E A;  4PE1 A;  1FJM A;  1NNW A;  1KWO B;  2Z1A A;  1YRT B;  1EL4 A;  1XK4 A;  1SK6 D;  1F70 A;  2JPT A;  2LLU A;  4PCW A;  3EK4 A;  5HKZ A;  5CSF A;  1S3N A;  1L7Z A;  3DXL A;  1A4P A;  2KYC A;  4ZVZ A;  1MR8 A;  4GGN A;  5DIC A;  1SMG A;  3BUN B;  1AHR A;  3F45 A;  2M29 A;  3FWC A;  5INB A;  4Q7F A;  2K61 A;  1A75 A;  2IAE C;  2LMU A;  2JT8 A;  2WCB A;  2WDD A;  2NYL C;  4M2Q A;  3THN A;  2WDF A;  3T1I A;  4DHL A;  1OZS A;  1TUZ A;  4CLN A;  3NHT A;  5ER5 A;  1XK4 C;  3LL8 A;  2JNF A;  1RWY A;  3OGN A;  1S6C A;  4IYP C;  2MAZ A;  2MLF C;  2CBL A;  1DEK A;  4XJK A;  1S5G Z;  1Y0V H;  1YX7 A;  3Q8I A;  2MBX A;  2WND A;  4O43 A;  2BEC A;  5JPE A;  1M45 A;  4GPL B;  1PAL A;  4OR9 B;  2JXC A;  3CWG A;  1ALV A;  1SBJ A;  1PSR A;  2JT0 A;  5F6T A;  3KEV A;  3N7H A;  3CR4 X;  2KOT A;  3FS7 A;  3H68 A;  1KFU S;  2BE4 A;  1M31 A;  3CYZ A;  3DF0 B;  3O4X A;  3DSC A;  1NWD A;  3L47 A;  4ORC B;  5DKQ A;  1T71 A;  4HRE E;  4YKE A;  1CNP A;  1NX1 A;  1SL9 A;  3ICB A;  3K7W C;  2KI4 C;  1OOI X;  2QDI A;  3H4S E;  5AER A;  4MRX A;  1AJ4 A;  2JTZ A;  2E30 A;  4MRY A;  1XFV O;  4QJ3 B;  2KAY A;  4HSZ A;  3JVT C;  1K2H A;  3CTN A;  4AQJ A;  2ZFD A;  5AEQ A;  1Y1U A;  3L4L A;  2O60 A;  1IGV A;  2WOR A;  4JA7 A;  2G2B A;  1K93 D;  1TWO A;  4MEW A;  4YI8 A;  5EL2 A;  5G08 A;  4CPV A;  2FOT A;  2LCP A;  3DVK A;  1K8U A;  1TOP A;  1RTP 1;  3GOF A;  3OX5 A;  5KU1 A;  4ZCV A;  1S3M A;  2PQL A;  2H2K A;  2ZN9 A;  3M0W A;  1RJV A;  4NZV A;  1QX7 A;  2EC6 B;  1OMR A;  2G9B A;  2LP3 A;  2M0R A;  4YGB B;  1ZMZ A;  1OQP A;  1Z4H A;  4TUG A;  1MF8 B;  3FWB A;  1SKT A;  1T14 A;  1W24 A;  5CSJ A;  5HL1 A;  4GFT A;  2L51 A;  1MXL C;  1KQM C;  1NP8 A;  4ORA A;  1BT6 A;  1MXE A;  1QWV A;  4NDD A;  1OOF A;  1YUS A;  4GGF A;  3S0F A;  1DQE A;  4DUQ A;  2KFF A;  2A22 A;  1C7W A;  3TUY B;  3BYA A;  4YGA A;  2HY1 A;  2SAS A;  3SG4 A;  2JWW A;  1S5G Y;  1KFX S;  1LIN A;  4D1E A;  1SL8 A;  2A4J A;  3I5H B;  1SYM A;  3GK4 X;  3WHU B;  3AAJ A;  2KLD A;  4ETO A;  2SCP A;  3KPX A;  5B8I B;  5I2Q A;  1BR4 B;  5I2L A;  4UT3 B;  2ISD A;  4NDC A;  3PN7 B;  2DXN A;  1LS8 A;  2MRD A;  1R6P A;  2JU0 A;  4GGF C;  5J28 A;  3OB2 B;  1TIZ A;  5AAN A;  4OKH A;  4M2P A;  1K94 A;  2KPH A;  1GGZ A;  3ZWH A;  1S70 A;  1JF0 A;  2OS8 C;  1DJG A;  3TS5 C;  3DZT A;  2WCE A;  5IBW A;  4J6O A;  5D7F A;  3TZ1 A;  4UWQ A;  4PE0 A;  4YBH B;  1BLQ A;  1Y1A A;  2GGZ A;  3CZ0 A;  2JOG A;  2JXL A;  3C9F A;  3OX6 A;  2QEB A;  2BCA A;  3RM1 A;  2JUL A;  1CFD A;  1PRW A;  3I5F C;  1JWD A;  3JTD C;  5FI7 A;  2K7O A;  1CDN A;  4WWL A;  3NSI A;  1UHK A;  1QAS A;  2KFG A;  1QIW A;  2M1U A;  3R72 A;  1B7T Y;  1BOC A;  4ORB B;  2QJC A;  2M49 B;  1N65 A;  1IJ5 A;  1LXF C;  2KI6 C;  1SR6 B;  2WC8 A;  3BUX B;  4MZJ A;  4N1G A;  1C3Y A;  5FYX A;  2WCK A;  4F0Z B;  1J1E A;  1G4Y R;  1YR5 A;  4INX A;  1TNX A;  4MP0 A;  1TCO B;  1TN4 A;  3D73 A;  1BF5 A;  1XFY O;  4P2Y B;  4USL A;  2H61 A;  3UNW A;  1UHN A;  3RZS A;  2I94 A;  4YGE B;  1NX0 A;  1TCF A;  1JK7 A;  2HYP A;  1QLK A;  3P71 C;  3NSO A;  4U8D A;  4OR9 A;  3I5G B;  1M63 A;  1CLM A;  3SS3 A;  1U5I B;  3DD4 A;  2IS9 A; 
#chains in the Genus database with same CATH homology
 5DKN A;  1CB1 A;  4JPZ B;  1DF0 A;  1B47 A;  3O4Y A;  3WXA A;  1OE9 B;  5I2O A;  4ORC A;  2ZRT A;  1UWO A;  1OOJ A;  2KAX A;  2R2I A;  3OB1 B;  3H61 A;  3IVE A;  1YX8 A;  2JNX A;  1M46 A;  1QAT A;  2LP2 A;  2H61 C;  2QAC A;  1SPY A;  2CCM A;  3AV0 A;  4QJ5 B;  4H2F A;  4H2B A;  1GJY A;  2HQW A;  1NIW A;  2F33 A;  2LNK A;  2NCP A;  1B8L A;  5GTU A;  2BL0 C;  2D8N A;  5J3X A;  1FF1 A;  4UT2 A;  3D03 A;  1YUT A;  4I5N C;  3D0Y B;  1OMD A;  1IKU A;  2AHD A;  1M39 A;  3I5I B;  2Y1N A;  1LVC D;  1W7J B;  1B4C A;  1QTX A;  1SW8 A;  2K7C A;  3EKH A;  2IE3 C;  2Z06 A;  2NZ0 A;  2YVT A;  4GAO A;  1YRU B;  1A29 A;  1CM4 A;  3SG6 A;  1V73 A;  4DCK A;  1HQV A;  4PE4 A;  1MF8 A;  1F8H A;  1RRO A;  2F2P A;  2K2A A;  2P6B B;  4JWQ A;  5EQV A;  1N0Y A;  4C0L A;  1QFC A;  4HRG A;  1ZUZ A;  2IE4 C;  2LVV A;  4XPN A;  2V53 A;  2L98 A;  3N5U A;  2M7N A;  1NX2 A;  1QV0 A;  2HET A;  3H60 A;  3V4Y A;  1J1D A;  4GBA A;  5DNY A;  2AAO A;  3LK0 A;  2PMY A;  2NXF A;  1L2O B;  2F3Y A;  1OIE A;  1QLS A;  1D1O A;  2DXL A;  3PSR A;  3DVE A;  4DSY A;  2KAV A;  2EC6 C;  1J7O A;  5HKW A;  2KKN A;  4BY4 A;  3QFM A;  2L2E A;  1CKK A;  2KSP A;  1QIV A;  1KK7 Y;  2WOS A;  3KF9 A;  1OID A;  2F8P A;  2LAN A;  3BUM B;  4YGD B;  2CV9 A;  1F4O A;  1EXR A;  1UP5 A;  1B9A A;  3PFV A;  1KCY A;  1KK8 B;  1MUX A;  2M8U A;  2JC2 A;  3ZNI A;  3TUY C;  4I5L C;  5I8N A;  3TGH A;  1S36 A;  4L9M A;  1QVI Z;  2BCX A;  2BKI B;  2L4H A;  2KI6 D;  2KNE A;  4DIR A;  2MJW B;  4TUI A;  2MLE C;  3I5H C;  1SCM B;  3PAT A;  3IQQ A;  2LVI A;  3BOW B;  2WDC A;  2OTG C;  1E8A A;  2E6W A;  5AFP A;  2CNP A;  4DRW A;  2DFJ A;  2LVK A;  1REC A;  4V0W A;  3PLF B;  1BG1 A;  1WDC C;  1A03 A;  3VRP A;  4FBW A;  3RL5 A;  4A4B A;  4ZCU A;  3LCP C;  4GNK B;  4WQ3 A;  2PAS A;  5JOL A;  1SY9 A;  4F0Z A;  2LVJ A;  3GK1 A;  1CFF A;  2DOQ A;  1IQ3 A;  1JFJ A;  1FW4 A;  3BUO B;  4MLW A;  1TRF A;  4MZL A;  3E3R A;  1IRJ A;  5BPJ A;  1F55 A;  1K95 A;  1SRA A;  3FIA A;  1ZFS A;  3LL8 B;  2NPP C;  3RL3 A;  4MVF A;  2L4I A;  2NCO A;  4I5K A;  4WRI A;  1BJF A;  3FGA C;  1IJ6 A;  4XJK B;  1JSA A;  3EGH A;  1FI6 A;  3CK2 A;  2KI4 B;  5HLV A;  3ICF A;  1U5I A;  4ORA B;  3SG5 A;  1KSM A;  1G33 A;  1XFZ O;  3TDU A;  4E68 A;  1BU3 A;  1C07 A;  1AUI A;  1NCY A;  4QJ4 B;  5C1V A;  1K9P A;  4AQI A;  1QV1 A;  3ZTV A;  3LK1 A;  1ZOT B;  1YUR A;  4B2O A;  3JVT B;  3HX4 A;  2Q91 A;  1MQ1 A;  4LAC C;  1F71 A;  4O24 A;  4MZK A;  1J55 A;  5ER4 X;  5CSI A;  4O5G A;  3RL4 A;  2LUX A;  4OCI A;  3CS1 A;  1MHO A;  4FQO A;  5KTY A;  4AOM A;  1CMG A;  4JQ0 D;  3EGG A;  3RQZ A;  1DJH A;  2CXJ A;  4ICB A;  3CR2 A;  1DJY A;  3AUZ A;  1S26 D;  2ZO9 B;  1BMO A;  2HYO A;  1K9K A;  1IG5 A;  3IQO A;  2Z72 A;  1X02 A;  4GUK A;  2LV7 A;  3NSL A;  1Z2W A;  1QXP A;  1WY9 A;  1KWO C;  2HF5 A;  2R17 A;  1UHJ A;  2PVB A;  1XFX O;  1CLB A;  1GGW A;  4I5J A;  3OP0 A;  3C5W C;  3H67 A;  1WLM A;  3O2P A;  3PAL A;  1B8R A;  2HQ8 A;  5HKY A;  1NX3 A;  1B8C A;  1JFK A;  1QX2 A;  1IT6 A;  1DJZ A;  2AMI A;  1QHW A;  1S6I A;  3QFN A;  2LAP A;  3EVU A;  2ZOA A;  2KDH A;  3FLO A;  4IL1 A;  1DGU A;  4G9J A;  1RK9 A;  2JQ6 A;  4MBE A;  1CLL A;  4MSP A;  3H63 A;  4H1S A;  3C1V A;  2LMT A;  1IH0 A;  2M3W A;  2JZI A;  1NCX A;  1VRK A;  2L50 A;  3DF0 A;  2ZBM A;  2ZND A;  3TDZ A;  2Q4U A;  4A4C A;  2FCD A;  2COL B;  4V0X A;  1K9U A;  2ZN8 A;  2Q8U A;  3BXK A;  1OMV A;  4PHJ A;  3EKJ A;  3NXA A;  3TS5 B;  1Z2X A;  1FPW A;  1CM1 A;  1AP4 A;  2BDX A;  1DJI A;  3O6B A;  1ALW A;  1YTZ C;  1H4B A;  1L2O C;  3WNX B;  1UHH A;  4FTG A;  3PSN A;  1OSA A;  1OZO A;  3I5F B;  4C0J A;  2JT3 A;  2M1K B;  1AVS A;  1HO5 A;  2JOJ A;  3JYF A;  5JPF A;  5JJT A;  4N1F A;  2K7D A;  1CDP A;  1TTX A;  1EJ3 A;  3BOW A;  4YGC B;  1JBA A;  1U32 A;  2QFR A;  1XFW O;  2CTN A;  3IF7 A;  5GQQ C;  1JF2 A;  2O5G A;  4OVN F;  4M0V A;  2Y5I A;  1S3L A;  1KBP A;  2GV5 A;  4UPG A;  5HLO A;  5KSZ A;  1C7V A;  1DGV A;  3NSK A;  3VRQ A;  1IWQ A;  1KK8 C;  3IB7 A;  1SNL A;  4CFR A;  2CT9 A;  1BOD A;  2BCB A;  3OHM B;  1TNW A;  1A2X A;  1CTR A;  3IB8 A;  3EVV A;  3KBP A;  2KBI A;  2VRG A;  1ZAC A;  1SCM C;  1XFU O;  2PRU A;  1DMO A;  2BE6 A;  2LLS A;  3QG5 C;  4JA9 A;  1RFJ A;  1WLZ A;  2Y1M A;  2USH A;  1N2D A;  3D10 A;  3BUW B;  1EG3 A;  1CDM A;  2WDE A;  1KFU L;  2QPT A;  2LHI A;  1EH2 A;  2BCD A;  2YEQ A;  2MHH A;  5B8I A;  1AJ5 A;  1YUU A;  2L5X B;  3AKB A;  3CR5 X;  4Q04 A;  2O8G A;  3H69 A;  4MOV A;  2ZKM X;  2KGB C;  3DW8 C;  3CGA A;  1LA0 A;  3BQ3 A;  4WQ2 A;  1LA3 A;  4PE7 A;  1F54 A;  4ORA A;  2NLN A;  4CID A;  3EVR A;  1B1G A;  2KBM A;  4FBQ A;  2KQ6 A;  2KYF A;  1WRL A;  1V1G A;  2BL0 B;  1M63 B;  3QRX A;  2OPO A;  4DS7 A;  2ZRS A;  3VRR A;  1ODB A;  4I5N B;  4H1Y P;  3VRO A;  1KSO A;  4P5O E;  2LMV A;  4BY5 A;  1S8E A;  1DJX A;  3H64 A;  1WRK A;  1DF0 B;  2PAL A;  1JC2 A;  1AK8 A;  1UTE A;  4O4K A;  1XYD A;  3A8R A;  4TNC A;  1USH A;  2I2R E;  4UT3 A;  1WRZ A;  1CFP A;  1DTL A;  1Y6W A;  3PN7 C;  1DJW A;  2LUC A;  3K21 A;  3VGO A;  1NCZ A;  4PHM A;  2TN4 A;  1H8B A;  3EK8 A;  3CLN A;  4ORB A;  2JTT A;  4KBP A;  3IVD A;  1CFC A;  2QFP A;  4H2I A;  1OI8 A;  5F3W A;  5D69 A;  1DT7 B;  1R2U A;  4YRU A;  1DVI A;  2GGM A;  2LE9 B;  1SCV A;  5PAL A;  1HT9 A;  2BBN A;  2ZNE A;  4PHN A;  1A75 B;  5JJG A;  1BR1 B;  1TCO A;  3SJS A;  1KQV A;  1SL7 A;  2LLT A;  1B7T Z;  2I7A A;  4NDB A;  2BKH B;  2GJU A;  2AUC A;  1F4Q A;  3GK2 A;  1MWN A;  1CDL A;  3PM8 A;  1UUS A;  4OV2 A;  1XO5 A;  1KFX L;  1J7R A;  1XZW A;  2BBM A;  5DKR A;  1YVH A;  3O78 A;  1LKJ A;  4MN0 A;  1S95 A;  3DSD A;  2FJU B;  2JRF A;  2RGI A;  1II7 A;  2PSR A;  1SR6 C;  4M2O A;  2NYM C;  1QX5 B;  2XMO A;  4LTY A;  5TNC A;  1UUR A;  1J7Q A;  4PAL A;  3TDI A;  1TNP A;  2M9G A;  4R1E A;  1CMF A;  3VRN A;  3QFK A;  3WHT B;  2Y4Q A;  3PSO A;  4ZX2 A;  5IOH A;  4YI9 A;  3DVM A;  4I5L B;  3AAK A;  4PHK A;  3SIB A;  1K90 D;  5HPE A;  3QFO A;  1G8I A;  1NPQ A;  1QS7 A;  2K0J A;  4FCX A;  1NUB A;  1IQ5 A;  2O8A A;  2LM5 A;  3SG7 A;  1PVA A;  1QVI Y;  3I5G C;  2OTG B;  1PSB A;  1PK0 D;  1S6J A;  2KFH A;  3D0Y A;  4DT2 A;  3AKA A;  3E7A A;  2MA2 A;  3LLE A;  4PDZ A;  3E7B A;  1QJT A;  1WDC B;  2LHL A;  2LC5 A;  1JUO A;  2BQ8 X;  4LU9 A;  4NQG A;  1S3P A;  1KQM B;  1UF3 A;  1J7P A;  2M7L A;  3KHE A;  1HPU A;  1S1E A;  3RLZ A;  2I18 A;  2KHN A;  1HP1 A;  2P6B A;  2NXQ A;  3SG3 A;  3K7V C;  4KKZ A;  4HRH A;  5HYD A;  1Q80 A;  3I5I C;  4MOY A;  3MSE B;  2M97 A;  3GVE A;  3H62 B;  4V0V A;  1W7I B;  2WCF A;  2K8M B;  5CSN A;  4H2G A;  1PVB A;  4CFQ A;  5K89 A;  1Y1X A;  2K7B A;  1XA5 A;  1SU1 A;  1V1F A;  1EG4 A;  2KGR A;  1G5B A;  1WAO 1;  2OS8 B;  1PUL A;  2B1U A;  2HPS A;  2L0P A;  1FBV A;  3HCM A;  3H66 A;  3A4U B;  5AXI A;  3SIA A;  3ZU0 A;  2F2O A;  2F3Z A;  3DVJ A;  1GQM A;  4XYN A;  4FBK A;  1FI5 A;  2EHB A;  1NSH A;  3E0J A;  1XM7 A;  1KK7 Z;  3JTD B;  4HD0 A;  1UHI A;  1XVJ A;  1NYA A;  5CPV A;  1YVL A;  3CZT X;  1AUI B;  2EGD A;  1TNQ A;  3KO0 A;  4N5X A;  2FCE A;  1T70 A;  2K2F A;  2KQY A;  4C0K A;  1K96 A;  1WAR A;  3EK7 A;  3HVQ A;  3SG2 A;  3THO B;  4PE1 A;  1FJM A;  1NNW A;  1KWO B;  2Z1A A;  1EL4 A;  1XK4 A;  1YRT B;  1SK6 D;  1F70 A;  2JPT A;  2LLU A;  4PCW A;  3EK4 A;  5HKZ A;  5CSF A;  1S3N A;  1L7Z A;  1A4P A;  2KYC A;  4ZVZ A;  1MR8 A;  4GGN A;  1SMG A;  3BUN B;  1AHR A;  3F45 A;  2M29 A;  3FWC A;  5INB A;  4Q7F A;  2K61 A;  1A75 A;  2IAE C;  2LMU A;  2JT8 A;  2WCB A;  2WDD A;  2NYL C;  4M2Q A;  3THN A;  2WDF A;  3T1I A;  4DHL A;  1OZS A;  4CLN A;  5ER5 A;  1XK4 C;  3LL8 A;  2JNF A;  1RWY A;  1S6C A;  4IYP C;  2MAZ A;  2MLF C;  2CBL A;  4XJK A;  1S5G Z;  1Y0V H;  1YX7 A;  2MBX A;  2WND A;  4O43 A;  2BEC A;  5JPE A;  1M45 A;  4GPL B;  1PAL A;  4OR9 B;  2JXC A;  3CWG A;  1ALV A;  1SBJ A;  1PSR A;  2JT0 A;  5F6T A;  3KEV A;  3CR4 X;  2KOT A;  3FS7 A;  3H68 A;  1KFU S;  2BE4 A;  1M31 A;  3DF0 B;  3DSC A;  1NWD A;  4ORC B;  5DKQ A;  1T71 A;  4HRE E;  4YKE A;  1CNP A;  1NX1 A;  1SL9 A;  3ICB A;  3K7W C;  2KI4 C;  3H4S E;  5AER A;  4MRX A;  1AJ4 A;  2JTZ A;  2E30 A;  4MRY A;  1XFV O;  4QJ3 B;  2KAY A;  4HSZ A;  3JVT C;  1K2H A;  3CTN A;  4AQJ A;  2ZFD A;  5AEQ A;  1Y1U A;  2O60 A;  1IGV A;  2WOR A;  4JA7 A;  2G2B A;  1K93 D;  4MEW A;  4YI8 A;  5G08 A;  4CPV A;  2FOT A;  2LCP A;  3DVK A;  1K8U A;  1TOP A;  1RTP 1;  3GOF A;  3OX5 A;  5KU1 A;  4ZCV A;  1S3M A;  2H2K A;  2ZN9 A;  3M0W A;  1RJV A;  4NZV A;  1QX7 A;  2EC6 B;  1OMR A;  2G9B A;  2LP3 A;  2M0R A;  4YGB B;  1ZMZ A;  1OQP A;  4TUG A;  1MF8 B;  3FWB A;  1SKT A;  1W24 A;  5CSJ A;  4GFT A;  2L51 A;  1MXL C;  1KQM C;  1NP8 A;  1BT6 A;  1MXE A;  4NDD A;  1YUS A;  4GGF A;  4DUQ A;  2KFF A;  2A22 A;  1C7W A;  3TUY B;  3BYA A;  4YGA A;  2HY1 A;  2SAS A;  3SG4 A;  2JWW A;  1S5G Y;  1KFX S;  1LIN A;  4D1E A;  1SL8 A;  2A4J A;  3I5H B;  1SYM A;  3GK4 X;  3WHU B;  3AAJ A;  4ETO A;  2SCP A;  3KPX A;  5B8I B;  5I2Q A;  1BR4 B;  5I2L A;  2ISD A;  4NDC A;  3PN7 B;  2DXN A;  2MRD A;  1R6P A;  2JU0 A;  4GGF C;  5J28 A;  3OB2 B;  1TIZ A;  5AAN A;  4OKH A;  4M2P A;  1K94 A;  1GGZ A;  3ZWH A;  1S70 A;  1JF0 A;  2OS8 C;  1DJG A;  3TS5 C;  5IBW A;  2WCE A;  4J6O A;  4UWQ A;  5D7F A;  3TZ1 A;  4PE0 A;  4YBH B;  1BLQ A;  1Y1A A;  2GGZ A;  2JOG A;  2JXL A;  3C9F A;  3OX6 A;  2BCA A;  3RM1 A;  2JUL A;  1CFD A;  1PRW A;  3I5F C;  1JWD A;  3JTD C;  1CDN A;  2K7O A;  4UT3 B;  4WWL A;  3NSI A;  1UHK A;  1QAS A;  2KFG A;  1QIW A;  2M1U A;  1B7T Y;  1BOC A;  4ORB B;  2QJC A;  2M49 B;  1N65 A;  1IJ5 A;  1LXF C;  2KI6 C;  1SR6 B;  2WC8 A;  3BUX B;  4MZJ A;  4N1G A;  3P71 C;  5FYX A;  4F0Z B;  1J1E A;  1G4Y R;  1YR5 A;  1TNX A;  4MP0 A;  1TCO B;  1TN4 A;  1BF5 A;  1XFY O;  4P2Y B;  4USL A;  2H61 A;  1UHN A;  2I94 A;  4YGE B;  1NX0 A;  1TCF A;  1JK7 A;  2HYP A;  1QLK A;  3NSO A;  4U8D A;  4OR9 A;  3I5G B;  1M63 A;  1CLM A;  1U5I B;  3DD4 A;  2IS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...