4IL1A

Crystal structure of the rat calcineurin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
647
structure length
529
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICFEEAKGLDRINERMPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of calcineurin activation by calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Calmodulin, Calcineurin subunit B type 1, Serine/threonine-p
total genus 174
structure length 529
sequence length 647
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4il1A01
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4il1A02
2CCMA 2M1UA 1QLSA 2Q91A 3CGAA 4YRUA 4QJ4B 1B8LA 2WC8A 1CM4A 1AJ5A 1S8EA 4AOMA 1CDLA 3F45A 4P5OE 4DRWA 1LVCD 2AUCA 1SBJA 4TUGA 1CDMA 2KFFA 4MZKA 2PVBA 1KFXS 1U5IA 2AMIA 2G2BA 1OIDA 1K94A 1S5GZ 1DF0B 1JUOA 1QXPA 2NCOA 2LHLA 1CMFA 2KBIA 4JA7A 1K95A 1IRJA 1SMGA 2MLFC 1OMRA 3PM8A 3WHTB 3JVTC 4D1EA 1F4OA 4GGNA 2LM5A 5IBWA 1DJWA 2LNKA 1M31A 2TN4A 1JBAA 1QIVA 2NYMC 2LMTA 2M3WA 3NXAA 5HLVA 3TZ1A 4ORAA 2F2OA 2LMVA 5ER5A 1Y1AA 1W24A 1UUSA 2PSRA 4NZVA 1JWDA 4CPVA 1MXLC 3AAKA 4N1GA 4FBQA 1XFZO 2WCBA 1UHHA 3GVEA 4XPNA 3NSOA 3EK7A 2NZ0A 4DT2A 1Y0VH 2JOGA 1BT6A 1CDPA 3BUNB 1CKKA 1CDNA 5JJGA 4I5LB 3K21A 1T71A 1EG3A 2KI6D 3VRNA 4WWLA 2CNPA 5FYXA 1KK8B 3E7BA 1XK4C 3BOWA 2O5GA 2CT9A 1XK4A 3OP0A 2MBXA 4I5LC 2BDXA 4JA9A 3BXKA 1AJ4A 4FBKA 1TTXA 2I18A 4MRYA 1QX2A 3SG2A 1OOJA 2M0RA 1WLZA 2OPOA 2M8UA 1JC2A 4BY4A 3DVMA 1II7A 2AHDA 4DCKA 4O43A 1IJ6A 1M63B 1F70A 1OMDA 1NX0A 3JYFA 2ZFDA 2BCDA 2PALA 4GFTA 3PFVA 1UHKA 2H61A 2KHNA 4JQ0D 3NSKA 1ODBA 2KSPA 2Y1MA 3EK4A 2MAZA 4YGAA 1U32A 4H1SA 1CFFA 2LLTA 2FCEA 3BUXB 1BOCA 4V0VA 2B1UA 4MEWA 4P2YB 2K7OA 2A4JA 4YBHB 2Z72A 5HKYA 1IT6A 4M0VA 2LC5A 1K96A 2F3YA 4PE4A 4DSYA 2LV7A 5HKWA 5AFPA 4PHKA 1AK8A 4YKEA 2NLNA 2L5XB 2DFJA 1K9KA 4NDCA 2KDHA 2HYOA 1KFUS 3E3RA 2K2FA 4HRHA 1SKTA 2EGDA 1DF0A 2XMOA 1TN4A 3QFOA 1H8BA 1N0YA 4H2BA 5DNYA 2JPTA 1SU1A 2Y4QA 4MOYA 1BJFA 2BCAA 3OHMB 4JWQA 1NCZA 1QJTA 3SG3A 3KPXA 4HD0A 2PRUA 1HO5A 1VRKA 2L4IA 1KK8C 2QACA 1JF0A 1TNXA 3TUYB 4A4CA 1MR8A 4NQGA 1IG5A 1YUSA 2GV5A 4I5JA 1CFPA 1XFVO 1MHOA 1EL4A 2EC6B 2JT8A 2Q4UA 4PE0A 3VGOA 1TCOA 1G4YR 4LTYA 3KEVA 3KO0A 2L4HA 1IJ5A 2ISDA 1OI8A 1S1EA 2SCPA 1BLQA 5I8NA 2BCBA 2MA2A 1KFUL 1JF2A 5AXIA 2IS9A 1IQ3A 1MUXA 4XYNA 1OE9B 1CB1A 3K7WC 4DHLA 4PE1A 3HX4A 4OV2A 2P6BA 2KFHA 1TOPA 2KQYA 1FI6A 2GGMA 2F33A 4YGBB 3H4SE 1A03A 4PCWA 3WNXB 1MF8B 1YUUA 2Y1NA 3SG5A 1SY9A 1QV1A 5EQVA 1PRWA 2M1KB 2M9GA 3GK1A 4MLWA 2WDDA 1XO5A 2MHHA 4UT2A 5JPFA 2KOTA 3ICBA 1JK7A 3C9FA 4M2QA 4IYPC 1TNPA 3M0WA 1EXRA 2BBMA 1KQMC 3FWCA 3LK1A 1B1GA 3E7AA 3ICFA 1FPWA 2WOSA 4A4BA 4KKZA 1HQVA 1DJIA 1UHIA 4UPGA 2K2AA 1HPUA 2FJUB 1GJYA 1A75A 2K7BA 4V0XA 4I5NB 1IH0A 3RL5A 1M45A 4IL1A 1J7PA 2RGIA 3NSLA 2I2RE 2WCEA 4FQOA 5JOLA 4PHNA 1A29A 5CSIA 1FF1A 2KGBC 2LLSA 1K90D 3GOFA 4FTGA 2EHBA 1AP4A 1EG4A 2BL0C 2JNXA 4UWQA 4J6OA 4YI8A 2LP3A 1QASA 3BUWB 4HSZA 1SW8A 4C0JA 1XFXO 5GQQC 2PASA 3RM1A 1CLBA 2KKNA 4MVFA 1DJYA 1HT9A 3I5IC 2YVTA 2VRGA 1T70A 4OR9A 1IWQA 1KSMA 4GGFA 4ZVZA 2WORA 2QFRA 4U8DA 1QHWA 4H2GA 2BCXA 4ICBA 4MZLA 3VROA 3OB1B 2HETA 2FOTA 1B8CA 2BE6A 3SJSA 1QFCA 3IVDA 1CFDA 1LXFC 3V4YA 1SYMA 2K61A 4GAOA 1MF8A 3BQ3A 1B9AA 3OB2B 1TCFA 3H61A 1CNPA 1KSOA 2ZKMX 2OS8B 3LL8B 2QJCA 4MSPA 1OMVA 4YI9A 5B8IB 1RTP1 4PDZA 5HKZA 1SK6D 2I94A 4E68A 2MLEC 5D69A 3D10A 3EVRA 4CIDA 1S6IA 4BY5A 5K89A 3QFKA 1WDCC 2LVKA 1SCMC 3DSCA 1SL9A 3RL3A 2WDFA 4GUKA 3SG4A 2BECA 3VRRA 1W7IB 1Y1XA 1SCMB 1YTZC 2HPSA 2BQ8X 1IGVA 2P6BB 2I7AA 1KQVA 3PSNA 4OKHA 2L2EA 4M2PA 1QATA 1IQ5A 2KFGA 2MJWB 1YX7A 5IOHA 1OQPA 1NSHA 3EGGA 3BUMB 2M7LA 1C7VA 3LLEA 1OSAA 1QIWA 1KCYA 4DS7A 1S6CA 1TNWA 4CFQA 5INBA 1ZUZA 3I5HB 1PALA 1BR1B 1OZSA 1CM1A 1UTEA 1XM7A 3H67A 3PSOA 1GGZA 2JTTA 4GNKB 1NYAA 1S70A 3H66A 2K7DA 2LHIA 2LVIA 2JC2A 2Z1AA 4YGDB 1ZOTB 2PMYA 1XA5A 1DJGA 4WQ2A 4N5XA 2L51A 4PALA 1CLMA 1WAO1 2Z06A 3RQZA 4B2OA 2KGRA 5KSZA 2COLB 1DJZA 3O78A 1DGUA 4MZJA 3CS1A 2BBNA 3AUZA 1PSRA 1UWOA 4PHJA 1NWDA 1XVJA 1LA0A 1QVIY 3TDIA 1BMOA 2JRFA 2JT3A 3C1VA 2M49B 1BR4B 3PALA 2LANA 1NUBA 1TCOB 4HREE 4LU9A 2L98A 3PLFB 2WNDA 4G9JA 1NIWA 3O4YA 3KBPA 1Z2XA 3H64A 3JVTB 3N5UA 1G5BA 3VRPA 3AV0A 5KU1A 3DD4A 1USHA 1JFJA 3THNA 1XFYO 3CZTX 3JTDB 3DVEA 1KWOB 3I5GB 4AQJA 5CSNA 1BF5A 4Q04A 3LL8A 1UHNA 4LACC 1QS7A 2KYCA 1FI5A 5B8IA 3ZU0A 2ZRSA 1J1EA 1S3MA 2SASA 2IE3C 1KWOC 1CFCA 3IF7A 2GGZA 2BKIB 2JZIA 2KQ6A 2E6WA 2WDCA 4KBPA 3GK4X 1N2DA 5JPEA 1C07A 1GGWA 2DOQA 4I5KA 1C7WA 1CLLA 2BKHB 2LAPA 2G9BA 1AUIA 1RJVA 1IKUA 2MRDA 1NX1A 1YR5A 3IQOA 1A4PA 2ZNDA 4R1EA 2NXFA 2GJUA 3I5HC 4HRGA 5I2QA 2AAOA 4ORBA 1DT7B 3EKJA 2OTGC 3EGHA 1UURA 4ORBB 2KNEA 4MBEA 1D1OA 4M2OA 4DUQA 4H2IA 3IB8A 4Q7FA 3KF9A 2WCFA 1F4QA 2L50A 2HF5A 2OTGB 3TDUA 2QPTA 2R17A 1J7RA 2NXQA 1QVIZ 2ZRTA 3IB7A 5J28A 1YRUB 1RECA 2IE4C 2O60A 1BODA 1NX3A 3MSEB 5J3XA 1YRTB 3H62B 3I5FB 3FWBA 1YURA 1WLMA 1AHRA 1WRKA 1KBPA 1U5IB 5CSJA 4QJ5B 1CTRA 2QFPA 1OZOA 3QFMA 4GBAA 2KAYA 3FGAC 1ALWA 1KQMB 1V1GA 2JNFA 3I5FC 5CSFA 4C0KA 3H69A 1SCVA 1WRLA 4USLA 2LLUA 2LVJA 1M63A 2HYPA 3H68A 1AUIB 3QFNA 1SL7A 4L9MA 3HVQA 1B8RA 5TNCA 3ZWHA 2E30A 5DKRA 1DGVA 4CFRA 1BG1A 1ZFSA 3WHUB 1L7ZA 1H4BA 3HCMA 1WY9A 1CMGA 3FIAA 1R6PA 2M97A 2ZN8A 1Y6WA 2LE9B 1B4CA 3BOWB 1W7JB 5BPJA 3JTDC 3TGHA 4ZCUA 5PALA 3EVUA 1WARA 2BL0B 2JXLA 1E8AA 1LA3A 2KBMA 1TNQA 2M29A 1S3PA 5G08A 2NYLC 1EH2A 2F2PA 2HQ8A 1F55A 2HY1A 1ZACA 1F71A 5CPVA 1KFXL 2LP2A 1YVHA 1QLKA 2JQ6A 3DVJA 1NX2A 3WXAA 2EC6C 4F0ZB 1L2OB 3I5IB 3CTNA 3KHEA 1RROA 5ER4X 1S6JA 1QV0A 2K0JA 1K9PA 1LKJA 4YGCB 3ZTVA 2LUCA 4GGFC 3CR4X 5HYDA 1GQMA 1XFUO 3TUYC 2BE4A 3BYAA 2ZN9A 4OCIA 2L0PA 2CBLA 3VRQA 1J55A 2K7CA 4C0LA 1S36A 1RFJA 1QX5B 2JTZA 2KI6C 1S95A 4DIRA 1PVAA 1QX7A 2D8NA 3CWGA 3O2PA 2KI4B 3ZNIA 1B7TY 3RL4A 3NSIA 1K8UA 2ZNEA 4XJKA 3IQQA 5AEQA 3A8RA 4AQIA 1F54A 1LINA 2NPPC 3TS5C 1TRFA 5D7FA 1SR6B 3EKHA 1MQ1A 2KI4C 4ZCVA 1KK7Z 2CV9A 1WDCB 5DKQA 3BUOB 5HPEA 1SR6C 1R2UA 1JSAA 1J7OA 3T1IA 1NP8A 2KYFA 4NDDA 3AKAA 3P71C 4F0ZA 5DKNA 1DMOA 1B47A 2USHA 3D0YA 1WRZA 4WQ3A 2WDEA 3FS7A 1B7TZ 5F6TA 4FBWA 4MRXA 1SNLA 3EVVA 3PN7C 4H2FA 2HQWA 1A2XA 1NCYA 4GPLB 2O8GA 1SRAA 2CXJA 3SG6A 4O5GA 1N65A 1FW4A 4MN0A 3AKBA 4TUIA 3DW8C 1MWNA 1SPYA 1TIZA 3A4UB 1FJMA 5F3WA 1SL8A 1XZWA 2H61C 1YX8A 2NCPA 1DVIA 2V53A 2Q8UA 3QG5C 1YVLA 3K7VC 1ZMZA 4ZX2A 4ORCA 2FCDA 5C1VA 1J7QA 1M46A 1Q80A 1X02A 4PE7A 4YGEB 3IVEA 3DVKA 5AANA 4O4KA 2A22A 1BU3A 1NNWA 1UF3A 1UHJA 1OIEA 3SIBA 3OX6A 3PSRA 1EJ3A 3AAJA 3TDZA 1MXEA 5KTYA 2LUXA 1XYDA 1L2OC 2F3ZA 3CLNA 4PHMA 5I2LA 3SG7A 1G33A 2IAEC 3CR2A 3DF0A 1JFKA 3D0YB 1J1DA 4ETOA 1NCXA 4NDBA 5HLOA 4WRIA 3DF0B 3CK2A 2M7NA 1KK7Y 1QTXA 2KAVA 2OS8C 4FCXA 4MP0A 4TNCA 2JT0A 4QJ3B 3SIAA 3THOB 1HP1A 3GK2A 1G8IA 1S26D 1S3NA 4JPZB 1XFWO 3DSDA 3H63A 1S5GY 5GTUA 4N1FA 3TS5B 2LVVA 1K9UA 3OX5A 4OR9B 1V73A 4UT3A 4ORCB 5I2OA 1DJHA 2R2IA 3RLZA 2JWWA 1RK9A 4UT3B 3C5WC 1DJXA 3I5GC 4ORAB 1M39A 1AVSA 1PSBA 3O6BA 2ZBMA 1V1FA 1FBVA 2F8PA 3QRXA 4O24A 1NPQA 1PK0D 3PATA 2LMUA 4XJKB 1ALVA 1Y1UA 5AERA 1Z2WA 2H2KA 3PN7B 1PVBA 1YUTA 4V0WA 2KAXA 2JU0A 1S3LA 2JXCA 3LCPC 1F8HA 2LCPA 1K2HA 2K8MB 4OVNF 3LK0A 2JULA 4H1YP 4CLNA 3EK8A 4MOVA 1PULA 3CR5X 2CTNA 2O8AA 4I5NC 1DTLA 3H60A 5JJTA 2Y5IA 1RWYA 1A75B 1K93D 1UP5A 2JOJA
chains in the Genus database with same CATH superfamily
2CCMA 2M1UA 1QLSA 2Q91A 3CGAA 4YRUA 3CZ1A 4QJ4B 1B8LA 2KPHA 2WC8A 3S0FA 1CM4A 1AJ5A 1S8EA 4AOMA 1CDLA 3F45A 4P5OE 4DRWA 1LVCD 1C3YA 2AUCA 1SBJA 4TUGA 3V2LA 3DYEA 1CDMA 2KFFA 3B88A 4MZKA 2PVBA 1KFXS 1U5IA 2AMIA 2G2BA 1OIDA 1K94A 1S5GZ 1DF0B 1JUOA 1QXPA 2NCOA 2LHLA 1CMFA 2KBIA 4JA7A 1K95A 3NHTA 1IRJA 1SMGA 2MLFC 1OMRA 3PM8A 3WHTB 3CABA 3JVTC 4D1EA 1F4OA 4GGNA 2LM5A 5IBWA 1DJWA 2LNKA 1M31A 2TN4A 1JBAA 1QIVA 3IVTA 2LMTA 2M3WA 3NXAA 5HLVA 3TZ1A 4ORAA 2F2OA 2LMVA 5ER5A 1Y1AA 1W24A 1UUSA 5D3OA 2PSRA 3TUYB 4C0LA 4CPVA 1MXLC 3AAKA 4N1GA 1JWDA 4FBQA 1XFZO 2WCBA 1UHHA 3GVEA 4XPNA 3NSOA 3EK7A 2NZ0A 4DT2A 1Y0VH 2JOGA 1BT6A 1CDPA 3BUNB 1CKKA 3S0EA 1CDNA 3D73A 2JPOA 5JJGA 3L47A 3K21A 4I5LB 1T71A 1EG3A 2KI6D 3VRNA 4WWLA 2CNPA 5FYXA 1KK8B 3E7BA 1XK4C 3BOWA 2O5GA 2WCKA 2CT9A 1XK4A 3OP0A 2MBXA 4I5LC 2BDXA 4JA9A 3BXKA 1AJ4A 4FBKA 1TTXA 5FI6A 2I18A 4MRYA 1QX2A 3SG2A 5HL1A 1OOJA 2M0RA 1WLZA 2OPOA 2M8UA 1JC2A 2QDIA 4BY4A 2FJYA 3DVMA 1II7A 2AHDA 4DCKA 4O43A 1IJ6A 1M63B 1F70A 1OMDA 1NX0A 3JYFA 2ZFDA 2BCDA 2PALA 4GFTA 3PFVA 3QMEA 1UHKA 2H61A 2KHNA 4JQ0D 3NSKA 1ODBA 2KSPA 2Y1MA 3EK4A 2MAZA 3L4AA 4YGAA 1U32A 1CFFA 2LLTA 4H1SA 2FCEA 3BUXB 1BOCA 4V0VA 2B1UA 4MEWA 4P2YB 2K7OA 2A4JA 4YBHB 2Z72A 5HKYA 1IT6A 4M0VA 2LC5A 1K96A 1OOHA 2F3YA 2L2CA 4PE4A 4DSYA 3PJIA 2LV7A 5HKWA 5AFPA 1T14A 4PHKA 1AK8A 4YKEA 5I94A 2NLNA 2L5XB 2DFJA 1K9KA 4NDCA 1OOIX 2KDHA 1KFUS 3E3RA 2K2FA 4HRHA 2EGDA 1SKTA 2HYOA 1DF0A 2XMOA 1TN4A 3QFOA 1H8BA 1N0YA 3O4XA 3S0BA 4H2BA 5DNYA 2JPTA 1SU1A 2Y4QA 4MOYA 2BCAA 1BJFA 3OHMB 3B87A 1NCZA 4JWQA 5FI7A 5EL2A 3RZSA 1QJTA 3SG3A 3KPXA 4HD0A 3OBVA 2PRUA 1HO5A 1VRKA 2NYMC 3SS4A 2L4IA 1KK8C 2QACA 1JF0A 1OW4A 1TNXA 2PQLA 1MR8A 4NQGA 1IG5A 1YUSA 2GV5A 4A4CA 4I5JA 1CFPA 1XFVO 1MHOA 1EL4A 2EC6B 2JT8A 2Q4UA 4PE0A 3VGOA 1TCOA 1G4YR 3D77A 4LTYA 3KEVA 3KO0A 2L4HA 1IJ5A 2ISDA 1OI8A 1S1EA 2SCPA 1BLQA 5I8NA 2BCBA 2MA2A 1KFUL 1JF2A 5AXIA 2IS9A 1IQ3A 2KLDA 1MUXA 4XYNA 1OE9B 1CB1A 3K7WC 4DHLA 4PE1A 3DZTA 3HX4A 4OV2A 2P6BA 2KFHA 1TOPA 2KQYA 1FI6A 2GGMA 2F33A 4YGBB 3H4SE 1A03A 2WCJA 4PCWA 3WNXB 1MF8B 1YUUA 1TWOA 2Y1NA 3SG5A 1SY9A 1QV1A 5EQVA 1PRWA 2M1KB 2M9GA 3FE8A 3GK1A 4MLWA 2WDDA 1XO5A 2MHHA 4UT2A 5JPFA 2KOTA 3ICBA 1JK7A 3C9FA 3BFAA 4M2QA 1TNPA 3M0WA 1EXRA 2BBMA 4IYPC 1KQMC 3FWCA 3LK1A 4IJ7A 1B1GA 3E7AA 3ICFA 1FPWA 2WOSA 4A4BA 4KKZA 1HQVA 1DJIA 1UHIA 3UO9A 4UPGA 2K2AA 1HPUA 2FJUB 1DC1A 4F7FA 1GJYA 1A75A 2K7BA 4V0XA 3SS5A 4I5NB 1IH0A 3RL5A 1M45A 4IL1A 1W9ZA 2RGIA 3S0DA 1DEKA 3R1VA 1J7PA 3NSLA 2I2RE 2WCEA 4FQOA 5JOLA 4PHNA 1A29A 5CSIA 1FF1A 2KGBC 2LLSA 1K90D 3GOFA 4FTGA 2EHBA 1AP4A 1EG4A 2BL0C 2JNXA 4UWQA 1C3ZA 5KTYA 4J6OA 4YI8A 3FLOA 2LP3A 1OOGA 1QASA 3BUWB 4NZVA 4HSZA 1SW8A 4C0JA 1XFXO 5GQQC 2PASA 3RM1A 1CLBA 2KKNA 2BAPA 3D03A 4MVFA 1Z2CB 1DJYA 1HT9A 3I5IC 2YVTA 2VRGA 1T70A 4OR9A 1IWQA 1KSMA 4GGFA 4ZVZA 2WORA 2QFRA 4U8DA 1QHWA 4H2GA 2BCXA 4ICBA 4MZLA 3VROA 3OB1B 4KYNA 2HETA 2FOTA 1B8CA 2BE6A 5FI2A 3SJSA 1QFCA 3IVDA 1CFDA 1LXFC 3V4YA 1SYMA 2K61A 4GAOA 1MF8A 3BQ3A 1B9AA 3OB2B 1TCFA 3K1EA 3H61A 1CNPA 1KSOA 2ZKMX 2OS8B 3LL8B 3NHIA 2QJCA 4MSPA 1OMVA 4YI9A 5B8IB 1RTP1 4PDZA 5HKZA 1SK6D 2I94A 4E68A 2MLEC 5D69A 3D10A 3EVRA 4CIDA 1S6IA 4BY5A 5K89A 3QFKA 1WDCC 2LVKA 1SCMC 3DSCA 1SL9A 3RL3A 2WDFA 4GUKA 3SG4A 2BECA 3EG5B 3VRRA 1W7IB 1Y1XA 1SCMB 1YTZC 2QEHA 2HPSA 2BQ8X 1IGVA 2P6BB 2I7AA 1KQVA 3PSNA 4OKHA 2L2EA 2DXNA 4M2PA 1QATA 1TUJA 1IQ5A 2KFGA 2L5YA 2MJWB 1YX7A 2QEOA 1OQPA 1QWVA 5IOHA 4FQTA 1NSHA 3EGGA 4H1YP 3BUMB 2M7LA 1C7VA 3LLEA 1OSAA 1QIWA 1KCYA 4DS7A 1S6CA 1TNWA 4CFQA 5INBA 1ZUZA 3I5HB 1PALA 1BR1B 1OZSA 1CM1A 1UTEA 2P70A 1XM7A 3H67A 1GGZA 3PSOA 2JTTA 4GNKB 1NYAA 1S70A 3H66A 1OIEA 3S0AA 2K7DA 2LHIA 2LVIA 2JC2A 2Z1AA 4YGDB 1ZOTB 2PMYA 1XA5A 1DJGA 4WQ2A 4N5XA 3N7HA 2L51A 4PALA 1CLMA 1WAO1 2Z06A 3RQZA 4B2OA 2KGRA 3BJHA 5KSZA 2COLB 1DJZA 3D75A 3O78A 1DGUA 4MZJA 3CS1A 3UNWA 2BBNA 3AUZA 1PSRA 1UWOA 4PHJA 1NWDA 1XVJA 1LA0A 1QVIY 3TDIA 1BMOA 2WCLA 3CZ2A 2JRFA 2JT3A 3C1VA 2M49B 1BR4B 3PALA 2LANA 1NUBA 1TCOB 4HREE 4LU9A 2L98A 1OOFA 3PLFB 2WNDA 4G9JA 1NIWA 3O4YA 3KBPA 1Z2XA 3H64A 3JVTB 3N5UA 1G5BA 3VRPA 3AV0A 5KU1A 3DD4A 1USHA 1JFJA 3THNA 1XFYO 3CZTX 3JTDB 3DVEA 1KWOB 3I5GB 4AQJA 5CSNA 1BF5A 4Q04A 3LL8A 1UHNA 4LACC 1QS7A 2WC6A 1DELA 2KYCA 1FI5A 3PM2A 5B8IA 3ZU0A 2ZRSA 4AQIA 1J1EA 3B86A 1S3MA 2KLEA 2SASA 1KWOC 1CFCA 2IE3C 3IF7A 2GGZA 2BKIB 2JZIA 2KQ6A 2E6WA 2WCHA 3B6XA 3D78A 3DXLA 3GK4X 2WDCA 4KBPA 1N2DA 2BNXA 5JPEA 1C07A 1GGWA 2DOQA 4I5KA 1C7WA 1CLLA 2BKHB 2LAPA 2G9BA 3D74A 1AUIA 1RJVA 1IKUA 2MRDA 1NX1A 1YR5A 3IQOA 1A4PA 2ZNDA 2WC5A 4R1EA 2NXFA 2GJUA 3I5HC 4HRGA 4JKTA 2AAOA 4INWA 5I2QA 3EKJA 1DT7B 3E0JA 4ORBA 2OTGC 3L4LA 3EGHA 1UURA 3D76A 2KNEA 4MBEA 4ORBB 1Z4HA 4M2OA 4DUQA 1D1OA 4H2IA 3FE6A 3IB8A 4Q7FA 3KF9A 2WCFA 1F4QA 2L50A 2HF5A 2OTGB 3TDUA 2QPTA 2R17A 1J7RA 2NXQA 1QVIZ 2ZRTA 3IB7A 5J28A 1YRUB 1RECA 2IE4C 2O60A 1BODA 1NX3A 3MSEB 5J3XA 1YRTB 3H62B 3I5FB 1GM0A 3FWBA 1YURA 1WLMA 1AHRA 1WRKA 1KBPA 2H8VA 1U5IB 5CSJA 4QJ5B 1CTRA 2QFPA 1OZOA 3QFMA 4GBAA 2KAYA 3FGAC 1ALWA 1KQMB 1V1GA 3CZ0A 2JNFA 3I5FC 5CSFA 2DXLA 4C0KA 3H69A 3VB1A 1SCVA 1WRLA 4PT1A 2LLUA 2LVJA 4USLA 1M63A 2HYPA 3H68A 1AUIB 3S0GA 3QFNA 1SL7A 4L9MA 3HVQA 1B8RA 2ERBA 5TNCA 3ZWHA 2E30A 5DKRA 1DGVA 3CDNA 4CFRA 1ZFSA 3WHUB 1BG1A 1L7ZA 3SS3A 1H4BA 3HCMA 1WY9A 1CMGA 3FIAA 1R6PA 2M97A 2ZN8A 1Y6WA 2LE9B 1B4CA 3BOWB 1W7JB 5BPJA 1XFRA 3JTDC 3TGHA 4ZCUA 5PALA 3EVUA 1WARA 2BL0B 2JXLA 1E8AA 1LA3A 2KBMA 1TNQA 2M29A 1S3PA 5G08A 2NYLC 1EH2A 2ZOAA 2F2PA 2HQ8A 1F55A 1IIOA 2HY1A 1ZACA 1F71A 5CPVA 1KFXL 2LP2A 1YVHA 1QLKA 2JQ6A 1P28A 3DVJA 1NX2A 3Q8IA 4INXA 3WXAA 2EC6C 4F0ZB 1L2OB 3I5IB 3CTNA 3KHEA 1RROA 5ER4X 1S6JA 1QV0A 2K0JA 1K9PA 1DQEA 1LKJA 1TUZA 4YGCB 3TUYC 2QEVA 3ZTVA 2LUCA 4GGFC 3CR4X 5HYDA 1GQMA 2P71A 1XFUO 2QEBA 2BE4A 3BYAA 2ZN9A 4OCIA 2L0PA 2CBLA 2WCMA 1J55A 2K7CA 3VRQA 1S36A 1RFJA 1QX5B 2JTZA 2KI6C 1S95A 4DIRA 1PVAA 1LS8A 1QX7A 2D8NA 3CWGA 3O2PA 2KI4B 3ZNIA 1B7TY 3RL4A 3NSIA 1K8UA 2ZNEA 3R1PA 3IQQA 4XJKA 3A8RA 3CYZA 5AEQA 1LINA 1F54A 2NPPC 3TS5C 1TRFA 5D7FA 1SR6B 3EKHA 3NGVA 1MQ1A 3OGNA 2KI4C 4ZCVA 1KK7Z 4OZDA 3R72A 2CV9A 3R1OA 1WDCB 5DKQA 3BUOB 5HPEA 1SR6C 1R2UA 1JSAA 1J7OA 3T1IA 1NP8A 2KYFA 4NDDA 3AKAA 3P71C 4F0ZA 5DKNA 2K60A 1B47A 1DMOA 2USHA 3D0YA 1WRZA 4WQ3A 2WDEA 3FS7A 1B7TZ 5F6TA 4FBWA 1ORGA 4MRXA 1SNLA 3EVVA 3PN7C 4H2FA 2HQWA 1A2XA 1NCYA 2PYQA 4GPLB 2O8GA 1SRAA 2CXJA 3SG6A 4O5GA 1N65A 1FW4A 4MN0A 3AKBA 4TUIA 3DW8C 1MWNA 1SPYA 1TIZA 3A4UB 1FJMA 5F3WA 1SL8A 1XZWA 2H61C 1YX8A 2NCPA 1DVIA 2V53A 2Q8UA 3QG5C 1YVLA 3K7VC 1ZMZA 2ZO9B 4ORCA 4ZX2A 2FCDA 5C1VA 1J7QA 1M46A 1Q80A 1X02A 4PE7A 4YGEB 3IVEA 3DVKA 5AANA 4O4KA 2A22A 1BU3A 1NNWA 1UF3A 1UHJA 3FE9A 3SIBA 4JD9A 3OX6A 3PSRA 1EJ3A 3AAJA 3BFHA 1MXEA 3TDZA 2LUXA 1XYDA 1L2OC 2F3ZA 3CLNA 4PHMA 5I2LA 3SG7A 1G33A 2IAEC 2YGUA 3CR2A 3DF0A 1JFKA 3D0YB 1J1DA 4ETOA 1NCXA 4NDBA 5HLOA 4WRIA 3DF0B 3CK2A 2GTEA 2M7NA 1KK7Y 1QTXA 2KAVA 2OS8C 4FCXA 2YEQA 4MP0A 4TNCA 2JT0A 4QJ3B 3SIAA 3THOB 1HP1A 3GK2A 1G8IA 1S26D 1S3NA 4JPZB 1XFWO 3DSDA 3H63A 5DICA 1S5GY 5GTUA 4N1FA 3TS5B 2LVVA 1K9UA 3OX5A 4OR9B 1V73A 4UT3A 4ORCB 5I2OA 1DJHA 2R2IA 3B7AA 3RLZA 2JWWA 1RK9A 4UT3B 3C5WC 1SSEB 1DJXA 3I5GC 4ORAB 1M39A 1AVSA 1PSBA 3O6BA 2ZBMA 1V1FA 3BFBA 1FBVA 2F8PA 3QRXA 4O24A 1NPQA 1PK0D 3PATA 2LMUA 4XJKB 1ALVA 1Y1UA 5AERA 1Z2WA 2H2KA 3PN7B 1PVBA 1YUTA 4V0WA 2KAXA 2JU0A 1S3LA 2JXCA 3LCPC 1F8HA 2LCPA 1K2HA 2K8MB 4OVNF 3LK0A 2JULA 3DY9A 4CLNA 3EK8A 4MOVA 1PULA 3CR5X 2CTNA 2O8AA 4I5NC 1DTLA 3H60A 5JJTA 2Y5IA 1RWYA 1A75B 1K93D 1UP5A 2JOJA
chains in the Genus database with same CATH topology
2CCMA 2M1UA 1QLSA 2Q91A 3CGAA 4YRUA 4QJ4B 1B8LA 2WC8A 1CM4A 1AJ5A 1S8EA 4AOMA 1CDLA 3F45A 4P5OE 4DRWA 1LVCD 2AUCA 1SBJA 4TUGA 1CDMA 2KFFA 4MZKA 2PVBA 1KFXS 1U5IA 2AMIA 2G2BA 1OIDA 1K94A 1S5GZ 1DF0B 1JUOA 1QXPA 2NCOA 2LHLA 1CMFA 2KBIA 4JA7A 1K95A 1IRJA 1SMGA 2MLFC 1OMRA 3PM8A 3WHTB 3JVTC 4D1EA 1F4OA 4GGNA 2LM5A 5IBWA 1DJWA 2LNKA 1M31A 2TN4A 1JBAA 1QIVA 2NYMC 2LMTA 2M3WA 3NXAA 5HLVA 3TZ1A 4ORAA 2F2OA 2LMVA 5ER5A 1Y1AA 1W24A 1UUSA 2PSRA 4NZVA 1JWDA 4CPVA 1MXLC 3AAKA 4N1GA 4FBQA 1XFZO 2WCBA 1UHHA 3GVEA 4XPNA 3NSOA 3EK7A 2NZ0A 4DT2A 1Y0VH 2JOGA 1BT6A 1CDPA 3BUNB 1CKKA 1CDNA 5JJGA 4I5LB 3K21A 1T71A 1EG3A 2KI6D 3VRNA 4WWLA 2CNPA 5FYXA 1KK8B 3E7BA 1XK4C 3BOWA 2O5GA 2CT9A 1XK4A 3OP0A 2MBXA 4I5LC 2BDXA 4JA9A 3BXKA 1AJ4A 4FBKA 1TTXA 2I18A 4MRYA 1QX2A 3SG2A 1OOJA 2M0RA 1WLZA 2OPOA 2M8UA 1JC2A 4BY4A 3DVMA 1II7A 2AHDA 4DCKA 4O43A 1IJ6A 1M63B 1F70A 1OMDA 1NX0A 3JYFA 2ZFDA 2BCDA 2PALA 4GFTA 3PFVA 1UHKA 2H61A 2KHNA 4JQ0D 3NSKA 1ODBA 2KSPA 2Y1MA 3EK4A 2MAZA 4YGAA 1U32A 4H1SA 1CFFA 2LLTA 2FCEA 3BUXB 1BOCA 4V0VA 2B1UA 4MEWA 4P2YB 2K7OA 2A4JA 4YBHB 2Z72A 5HKYA 1IT6A 4M0VA 2LC5A 1K96A 2F3YA 4PE4A 4DSYA 2LV7A 5HKWA 5AFPA 4PHKA 1AK8A 4YKEA 2NLNA 2L5XB 2DFJA 1K9KA 4NDCA 2KDHA 2HYOA 1KFUS 3E3RA 2K2FA 4HRHA 1SKTA 2EGDA 1DF0A 2XMOA 1TN4A 3QFOA 1H8BA 1N0YA 4H2BA 5DNYA 2JPTA 1SU1A 2Y4QA 4MOYA 1BJFA 2BCAA 3OHMB 4JWQA 1NCZA 1QJTA 3SG3A 3KPXA 4HD0A 2PRUA 1HO5A 1VRKA 2L4IA 1KK8C 2QACA 1JF0A 1TNXA 3TUYB 4A4CA 1MR8A 4NQGA 1IG5A 1YUSA 2GV5A 4I5JA 1CFPA 1XFVO 1MHOA 1EL4A 2EC6B 2JT8A 2Q4UA 4PE0A 3VGOA 1TCOA 1G4YR 4LTYA 3KEVA 3KO0A 2L4HA 1IJ5A 2ISDA 1OI8A 1S1EA 2SCPA 1BLQA 5I8NA 2BCBA 2MA2A 1KFUL 1JF2A 5AXIA 2IS9A 1IQ3A 1MUXA 4XYNA 1OE9B 1CB1A 3K7WC 4DHLA 4PE1A 3HX4A 4OV2A 2P6BA 2KFHA 1TOPA 2KQYA 1FI6A 2GGMA 2F33A 4YGBB 3H4SE 1A03A 4PCWA 3WNXB 1MF8B 1YUUA 2Y1NA 3SG5A 1SY9A 1QV1A 5EQVA 1PRWA 2M1KB 2M9GA 3GK1A 4MLWA 2WDDA 1XO5A 2MHHA 4UT2A 5JPFA 2KOTA 3ICBA 1JK7A 3C9FA 4M2QA 4IYPC 1TNPA 3M0WA 1EXRA 2BBMA 1KQMC 3FWCA 3LK1A 1B1GA 3E7AA 3ICFA 1FPWA 2WOSA 4A4BA 4KKZA 1HQVA 1DJIA 1UHIA 4UPGA 2K2AA 1HPUA 2FJUB 1GJYA 1A75A 2K7BA 4V0XA 4I5NB 1IH0A 3RL5A 1M45A 4IL1A 1J7PA 2RGIA 3NSLA 2I2RE 2WCEA 4FQOA 5JOLA 4PHNA 1A29A 5CSIA 1FF1A 2KGBC 2LLSA 1K90D 3GOFA 4FTGA 2EHBA 1AP4A 1EG4A 2BL0C 2JNXA 4UWQA 4J6OA 4YI8A 3FLOA 2LP3A 1QASA 3BUWB 4HSZA 1SW8A 4C0JA 1XFXO 5GQQC 2PASA 3RM1A 1CLBA 2KKNA 3D03A 4MVFA 1DJYA 1HT9A 3I5IC 2YVTA 2VRGA 1T70A 4OR9A 1IWQA 1KSMA 4GGFA 4ZVZA 2WORA 2QFRA 4U8DA 1QHWA 4H2GA 2BCXA 4ICBA 4MZLA 3VROA 3OB1B 2HETA 2FOTA 1B8CA 2BE6A 3SJSA 1QFCA 3IVDA 1CFDA 1LXFC 3V4YA 1SYMA 2K61A 4GAOA 1MF8A 3BQ3A 1B9AA 3OB2B 1TCFA 3H61A 1CNPA 1KSOA 2ZKMX 2OS8B 3LL8B 2QJCA 4MSPA 1OMVA 4YI9A 5B8IB 1RTP1 4PDZA 5HKZA 1SK6D 2I94A 4E68A 2MLEC 5D69A 3D10A 3EVRA 4CIDA 1S6IA 4BY5A 5K89A 3QFKA 1WDCC 2LVKA 1SCMC 3DSCA 1SL9A 3RL3A 2WDFA 4GUKA 3SG4A 2BECA 3VRRA 1W7IB 1Y1XA 1SCMB 1YTZC 2HPSA 2BQ8X 1IGVA 2P6BB 2I7AA 1KQVA 3PSNA 4OKHA 2L2EA 2DXNA 4M2PA 1QATA 1IQ5A 2KFGA 2MJWB 1YX7A 5IOHA 1OQPA 1NSHA 3EGGA 3BUMB 2M7LA 1C7VA 3LLEA 1OSAA 1QIWA 1KCYA 4DS7A 1S6CA 1TNWA 4CFQA 5INBA 1ZUZA 3I5HB 1PALA 1BR1B 1OZSA 1CM1A 1UTEA 1XM7A 3H67A 3PSOA 1GGZA 2JTTA 4GNKB 1NYAA 1S70A 3H66A 2K7DA 2LHIA 2LVIA 2JC2A 2Z1AA 4YGDB 1ZOTB 2PMYA 1XA5A 1DJGA 4WQ2A 4N5XA 2L51A 4PALA 1CLMA 1WAO1 2Z06A 3RQZA 4B2OA 2KGRA 5KSZA 2COLB 1DJZA 3O78A 1DGUA 4MZJA 3CS1A 2BBNA 3AUZA 1PSRA 1UWOA 4PHJA 1NWDA 1XVJA 1LA0A 1QVIY 3TDIA 1BMOA 2JRFA 2JT3A 3C1VA 2M49B 1BR4B 3PALA 2LANA 1NUBA 1TCOB 4HREE 4LU9A 2L98A 3PLFB 2WNDA 4G9JA 1NIWA 3O4YA 3KBPA 1Z2XA 3H64A 3JVTB 3N5UA 1G5BA 3VRPA 3AV0A 5KU1A 3DD4A 1USHA 1JFJA 3THNA 1XFYO 3CZTX 3JTDB 3DVEA 1KWOB 3I5GB 4AQJA 5CSNA 1BF5A 4Q04A 3LL8A 1UHNA 4LACC 1QS7A 2KYCA 1FI5A 5B8IA 3ZU0A 2ZRSA 1J1EA 1S3MA 2SASA 2IE3C 1KWOC 1CFCA 3IF7A 2GGZA 2BKIB 2JZIA 2KQ6A 2E6WA 2WDCA 4KBPA 3GK4X 1N2DA 5JPEA 1C07A 1GGWA 2DOQA 4I5KA 1C7WA 1CLLA 2BKHB 2LAPA 2G9BA 1AUIA 1RJVA 1IKUA 2MRDA 1NX1A 1YR5A 3IQOA 1A4PA 2ZNDA 4R1EA 2NXFA 2GJUA 3I5HC 4HRGA 5I2QA 2AAOA 3E0JA 1DT7B 3EKJA 4ORBA 2OTGC 3EGHA 1UURA 4ORBB 2KNEA 4MBEA 1D1OA 4M2OA 4DUQA 4H2IA 3IB8A 4Q7FA 3KF9A 2WCFA 1F4QA 2L50A 2HF5A 2OTGB 3TDUA 2QPTA 2R17A 1J7RA 2NXQA 1QVIZ 2ZRTA 3IB7A 5J28A 1YRUB 1RECA 2IE4C 2O60A 1BODA 1NX3A 3MSEB 5J3XA 1YRTB 3H62B 3I5FB 3FWBA 1YURA 1WLMA 1AHRA 1WRKA 1KBPA 1U5IB 5CSJA 4QJ5B 1CTRA 2QFPA 1OZOA 3QFMA 4GBAA 2KAYA 3FGAC 1ALWA 1KQMB 1V1GA 2JNFA 3I5FC 5CSFA 2DXLA 4C0KA 3H69A 1SCVA 1WRLA 4USLA 2LLUA 2LVJA 1M63A 2HYPA 3H68A 1AUIB 3QFNA 1SL7A 4L9MA 3HVQA 1B8RA 5TNCA 3ZWHA 2E30A 5DKRA 1DGVA 4CFRA 1BG1A 1ZFSA 3WHUB 1L7ZA 1H4BA 3HCMA 1WY9A 1CMGA 3FIAA 1R6PA 2M97A 2ZN8A 1Y6WA 2LE9B 1B4CA 3BOWB 1W7JB 5BPJA 3JTDC 3TGHA 4ZCUA 5PALA 3EVUA 1WARA 2BL0B 2JXLA 1E8AA 1LA3A 2KBMA 1TNQA 2M29A 1S3PA 5G08A 2NYLC 1EH2A 2ZOAA 2F2PA 2HQ8A 1F55A 2HY1A 1ZACA 1F71A 5CPVA 1KFXL 2LP2A 1YVHA 1QLKA 2JQ6A 3DVJA 1NX2A 3WXAA 2EC6C 4F0ZB 1L2OB 3I5IB 3CTNA 3KHEA 1RROA 5ER4X 1S6JA 1QV0A 2K0JA 1K9PA 1LKJA 4YGCB 3ZTVA 2LUCA 4GGFC 3CR4X 5HYDA 1GQMA 1XFUO 3TUYC 2BE4A 3BYAA 2ZN9A 4OCIA 2L0PA 2CBLA 3VRQA 1J55A 2K7CA 4C0LA 1S36A 1RFJA 1QX5B 2JTZA 2KI6C 1S95A 4DIRA 1PVAA 1QX7A 2D8NA 3CWGA 3O2PA 2KI4B 3ZNIA 1B7TY 3RL4A 3NSIA 1K8UA 2ZNEA 4XJKA 3IQQA 5AEQA 3A8RA 4AQIA 1F54A 1LINA 2NPPC 3TS5C 1TRFA 5D7FA 1SR6B 3EKHA 1MQ1A 2KI4C 4ZCVA 1KK7Z 2CV9A 1WDCB 5DKQA 3BUOB 5HPEA 1SR6C 1R2UA 1JSAA 1J7OA 3T1IA 1NP8A 2KYFA 4NDDA 3AKAA 3P71C 4F0ZA 5DKNA 1DMOA 1B47A 2USHA 3D0YA 1WRZA 4WQ3A 2WDEA 3FS7A 1B7TZ 5F6TA 4FBWA 4MRXA 1SNLA 3EVVA 3PN7C 4H2FA 2HQWA 1A2XA 1NCYA 4GPLB 2O8GA 1SRAA 2CXJA 3SG6A 4O5GA 1N65A 1FW4A 4MN0A 3AKBA 4TUIA 3DW8C 1MWNA 1SPYA 1TIZA 3A4UB 1FJMA 5F3WA 1SL8A 1XZWA 2H61C 1YX8A 2NCPA 1DVIA 2V53A 2Q8UA 3QG5C 1YVLA 3K7VC 1ZMZA 2ZO9B 4ORCA 4ZX2A 2FCDA 5C1VA 1J7QA 1M46A 1Q80A 1X02A 4PE7A 4YGEB 3IVEA 3DVKA 5AANA 4O4KA 2A22A 1BU3A 1NNWA 1UF3A 1UHJA 1OIEA 3SIBA 3OX6A 3PSRA 1EJ3A 3AAJA 3TDZA 1MXEA 5KTYA 2LUXA 1XYDA 1L2OC 2F3ZA 3CLNA 4PHMA 5I2LA 3SG7A 1G33A 2IAEC 3CR2A 3DF0A 1JFKA 3D0YB 1J1DA 4ETOA 1NCXA 4NDBA 5HLOA 4WRIA 3DF0B 3CK2A 2M7NA 1KK7Y 1QTXA 2KAVA 2OS8C 4FCXA 2YEQA 4MP0A 4TNCA 2JT0A 4QJ3B 3SIAA 3THOB 1HP1A 3GK2A 1G8IA 1S26D 1S3NA 4JPZB 1XFWO 3DSDA 3H63A 1S5GY 5GTUA 4N1FA 3TS5B 2LVVA 1K9UA 3OX5A 4OR9B 1V73A 4UT3A 4ORCB 5I2OA 1DJHA 2R2IA 3RLZA 2JWWA 1RK9A 4UT3B 3C5WC 1DJXA 3I5GC 4ORAB 1M39A 1AVSA 1PSBA 3O6BA 2ZBMA 1V1FA 1FBVA 2F8PA 3QRXA 4O24A 1NPQA 1PK0D 3PATA 2LMUA 4XJKB 1ALVA 1Y1UA 5AERA 1Z2WA 2H2KA 3PN7B 1PVBA 1YUTA 4V0WA 2KAXA 2JU0A 1S3LA 2JXCA 3LCPC 1F8HA 2LCPA 1K2HA 2K8MB 4OVNF 3LK0A 2JULA 4H1YP 4CLNA 3EK8A 4MOVA 1PULA 3CR5X 2CTNA 2O8AA 4I5NC 1DTLA 3H60A 5JJTA 2Y5IA 1RWYA 1A75B 1K93D 1UP5A 2JOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCM A;  2M1U A;  1QLS A;  2Q91 A;  3CGA A;  4YRU A;  4QJ4 B;  1B8L A;  2WC8 A;  1CM4 A;  1AJ5 A;  1S8E A;  4AOM A;  1CDL A;  3F45 A;  4P5O E;  4DRW A;  1LVC D;  2AUC A;  1SBJ A;  4TUG A;  1CDM A;  2KFF A;  4MZK A;  2PVB A;  1KFX S;  1U5I A;  2AMI A;  2G2B A;  1OID A;  1K94 A;  1S5G Z;  1DF0 B;  1JUO A;  1QXP A;  2NCO A;  2LHL A;  1CMF A;  2KBI A;  4JA7 A;  1K95 A;  1IRJ A;  1SMG A;  2MLF C;  1OMR A;  3PM8 A;  3WHT B;  3JVT C;  4D1E A;  1F4O A;  4GGN A;  2LM5 A;  5IBW A;  1DJW A;  2LNK A;  1M31 A;  2TN4 A;  1JBA A;  1QIV A;  2NYM C;  2LMT A;  2M3W A;  3NXA A;  5HLV A;  3TZ1 A;  4ORA A;  2F2O A;  2LMV A;  5ER5 A;  1Y1A A;  1W24 A;  1UUS A;  2PSR A;  4NZV A;  1JWD A;  4CPV A;  1MXL C;  3AAK A;  4N1G A;  4FBQ A;  1XFZ O;  2WCB A;  1UHH A;  3GVE A;  4XPN A;  3NSO A;  3EK7 A;  2NZ0 A;  4DT2 A;  1Y0V H;  2JOG A;  1BT6 A;  1CDP A;  3BUN B;  1CKK A;  1CDN A;  5JJG A;  4I5L B;  3K21 A;  1T71 A;  1EG3 A;  2KI6 D;  3VRN A;  4WWL A;  2CNP A;  5FYX A;  1KK8 B;  3E7B A;  1XK4 C;  3BOW A;  2O5G A;  2CT9 A;  1XK4 A;  3OP0 A;  2MBX A;  4I5L C;  2BDX A;  4JA9 A;  3BXK A;  1AJ4 A;  4FBK A;  1TTX A;  2I18 A;  4MRY A;  1QX2 A;  3SG2 A;  1OOJ A;  2M0R A;  1WLZ A;  2OPO A;  2M8U A;  1JC2 A;  4BY4 A;  3DVM A;  1II7 A;  2AHD A;  4DCK A;  4O43 A;  1IJ6 A;  1M63 B;  1F70 A;  1OMD A;  1NX0 A;  3JYF A;  2ZFD A;  2BCD A;  2PAL A;  4GFT A;  3PFV A;  1UHK A;  2H61 A;  2KHN A;  4JQ0 D;  3NSK A;  1ODB A;  2KSP A;  2Y1M A;  3EK4 A;  2MAZ A;  4YGA A;  1U32 A;  4H1S A;  1CFF A;  2LLT A;  2FCE A;  3BUX B;  1BOC A;  4V0V A;  2B1U A;  4MEW A;  4P2Y B;  2K7O A;  2A4J A;  4YBH B;  2Z72 A;  5HKY A;  1IT6 A;  4M0V A;  2LC5 A;  1K96 A;  2F3Y A;  4PE4 A;  4DSY A;  2LV7 A;  5HKW A;  5AFP A;  4PHK A;  1AK8 A;  4YKE A;  2NLN A;  2L5X B;  2DFJ A;  1K9K A;  4NDC A;  2KDH A;  2HYO A;  1KFU S;  3E3R A;  2K2F A;  4HRH A;  1SKT A;  2EGD A;  1DF0 A;  2XMO A;  1TN4 A;  3QFO A;  1H8B A;  1N0Y A;  4H2B A;  5DNY A;  2JPT A;  1SU1 A;  2Y4Q A;  4MOY A;  1BJF A;  2BCA A;  3OHM B;  4JWQ A;  1NCZ A;  1QJT A;  3SG3 A;  3KPX A;  4HD0 A;  2PRU A;  1HO5 A;  1VRK A;  2L4I A;  1KK8 C;  2QAC A;  1JF0 A;  1TNX A;  3TUY B;  4A4C A;  1MR8 A;  4NQG A;  1IG5 A;  1YUS A;  2GV5 A;  4I5J A;  1CFP A;  1XFV O;  1MHO A;  1EL4 A;  2EC6 B;  2JT8 A;  2Q4U A;  4PE0 A;  3VGO A;  1TCO A;  1G4Y R;  4LTY A;  3KEV A;  3KO0 A;  2L4H A;  1IJ5 A;  2ISD A;  1OI8 A;  1S1E A;  2SCP A;  1BLQ A;  5I8N A;  2BCB A;  2MA2 A;  1KFU L;  1JF2 A;  5AXI A;  2IS9 A;  1IQ3 A;  1MUX A;  4XYN A;  1OE9 B;  1CB1 A;  3K7W C;  4DHL A;  4PE1 A;  3HX4 A;  4OV2 A;  2P6B A;  2KFH A;  1TOP A;  2KQY A;  1FI6 A;  2GGM A;  2F33 A;  4YGB B;  3H4S E;  1A03 A;  4PCW A;  3WNX B;  1MF8 B;  1YUU A;  2Y1N A;  3SG5 A;  1SY9 A;  1QV1 A;  5EQV A;  1PRW A;  2M1K B;  2M9G A;  3GK1 A;  4MLW A;  2WDD A;  1XO5 A;  2MHH A;  4UT2 A;  5JPF A;  2KOT A;  3ICB A;  1JK7 A;  3C9F A;  4M2Q A;  4IYP C;  1TNP A;  3M0W A;  1EXR A;  2BBM A;  1KQM C;  3FWC A;  3LK1 A;  1B1G A;  3E7A A;  3ICF A;  1FPW A;  2WOS A;  4A4B A;  4KKZ A;  1HQV A;  1DJI A;  1UHI A;  4UPG A;  2K2A A;  1HPU A;  2FJU B;  1GJY A;  1A75 A;  2K7B A;  4V0X A;  4I5N B;  1IH0 A;  3RL5 A;  1M45 A;  4IL1 A;  1J7P A;  2RGI A;  3NSL A;  2I2R E;  2WCE A;  4FQO A;  5JOL A;  4PHN A;  1A29 A;  5CSI A;  1FF1 A;  2KGB C;  2LLS A;  1K90 D;  3GOF A;  4FTG A;  2EHB A;  1AP4 A;  1EG4 A;  2BL0 C;  2JNX A;  4UWQ A;  4J6O A;  4YI8 A;  2LP3 A;  1QAS A;  3BUW B;  4HSZ A;  1SW8 A;  4C0J A;  1XFX O;  5GQQ C;  2PAS A;  3RM1 A;  1CLB A;  2KKN A;  4MVF A;  1DJY A;  1HT9 A;  3I5I C;  2YVT A;  2VRG A;  1T70 A;  4OR9 A;  1IWQ A;  1KSM A;  4GGF A;  4ZVZ A;  2WOR A;  2QFR A;  4U8D A;  1QHW A;  4H2G A;  2BCX A;  4ICB A;  4MZL A;  3VRO A;  3OB1 B;  2HET A;  2FOT A;  1B8C A;  2BE6 A;  3SJS A;  1QFC A;  3IVD A;  1CFD A;  1LXF C;  3V4Y A;  1SYM A;  2K61 A;  4GAO A;  1MF8 A;  3BQ3 A;  1B9A A;  3OB2 B;  1TCF A;  3H61 A;  1CNP A;  1KSO A;  2ZKM X;  2OS8 B;  3LL8 B;  2QJC A;  4MSP A;  1OMV A;  4YI9 A;  5B8I B;  1RTP 1;  4PDZ A;  5HKZ A;  1SK6 D;  2I94 A;  4E68 A;  2MLE C;  5D69 A;  3D10 A;  3EVR A;  4CID A;  1S6I A;  4BY5 A;  5K89 A;  3QFK A;  1WDC C;  2LVK A;  1SCM C;  3DSC A;  1SL9 A;  3RL3 A;  2WDF A;  4GUK A;  3SG4 A;  2BEC A;  3VRR A;  1W7I B;  1Y1X A;  1SCM B;  1YTZ C;  2HPS A;  2BQ8 X;  1IGV A;  2P6B B;  2I7A A;  1KQV A;  3PSN A;  4OKH A;  2L2E A;  4M2P A;  1QAT A;  1IQ5 A;  2KFG A;  2MJW B;  1YX7 A;  5IOH A;  1OQP A;  1NSH A;  3EGG A;  3BUM B;  2M7L A;  1C7V A;  3LLE A;  1OSA A;  1QIW A;  1KCY A;  4DS7 A;  1S6C A;  1TNW A;  4CFQ A;  5INB A;  1ZUZ A;  3I5H B;  1PAL A;  1BR1 B;  1OZS A;  1CM1 A;  1UTE A;  1XM7 A;  3H67 A;  3PSO A;  1GGZ A;  2JTT A;  4GNK B;  1NYA A;  1S70 A;  3H66 A;  2K7D A;  2LHI A;  2LVI A;  2JC2 A;  2Z1A A;  4YGD B;  1ZOT B;  2PMY A;  1XA5 A;  1DJG A;  4WQ2 A;  4N5X A;  2L51 A;  4PAL A;  1CLM A;  1WAO 1;  2Z06 A;  3RQZ A;  4B2O A;  2KGR A;  5KSZ A;  2COL B;  1DJZ A;  3O78 A;  1DGU A;  4MZJ A;  3CS1 A;  2BBN A;  3AUZ A;  1PSR A;  1UWO A;  4PHJ A;  1NWD A;  1XVJ A;  1LA0 A;  1QVI Y;  3TDI A;  1BMO A;  2JRF A;  2JT3 A;  3C1V A;  2M49 B;  1BR4 B;  3PAL A;  2LAN A;  1NUB A;  1TCO B;  4HRE E;  4LU9 A;  2L98 A;  3PLF B;  2WND A;  4G9J A;  1NIW A;  3O4Y A;  3KBP A;  1Z2X A;  3H64 A;  3JVT B;  3N5U A;  1G5B A;  3VRP A;  3AV0 A;  5KU1 A;  3DD4 A;  1USH A;  1JFJ A;  3THN A;  1XFY O;  3CZT X;  3JTD B;  3DVE A;  1KWO B;  3I5G B;  4AQJ A;  5CSN A;  1BF5 A;  4Q04 A;  3LL8 A;  1UHN A;  4LAC C;  1QS7 A;  2KYC A;  1FI5 A;  5B8I A;  3ZU0 A;  2ZRS A;  1J1E A;  1S3M A;  2SAS A;  2IE3 C;  1KWO C;  1CFC A;  3IF7 A;  2GGZ A;  2BKI B;  2JZI A;  2KQ6 A;  2E6W A;  2WDC A;  4KBP A;  3GK4 X;  1N2D A;  5JPE A;  1C07 A;  1GGW A;  2DOQ A;  4I5K A;  1C7W A;  1CLL A;  2BKH B;  2LAP A;  2G9B A;  1AUI A;  1RJV A;  1IKU A;  2MRD A;  1NX1 A;  1YR5 A;  3IQO A;  1A4P A;  2ZND A;  4R1E A;  2NXF A;  2GJU A;  3I5H C;  4HRG A;  5I2Q A;  2AAO A;  4ORB A;  1DT7 B;  3EKJ A;  2OTG C;  3EGH A;  1UUR A;  4ORB B;  2KNE A;  4MBE A;  1D1O A;  4M2O A;  4DUQ A;  4H2I A;  3IB8 A;  4Q7F A;  3KF9 A;  2WCF A;  1F4Q A;  2L50 A;  2HF5 A;  2OTG B;  3TDU A;  2QPT A;  2R17 A;  1J7R A;  2NXQ A;  1QVI Z;  2ZRT A;  3IB7 A;  5J28 A;  1YRU B;  1REC A;  2IE4 C;  2O60 A;  1BOD A;  1NX3 A;  3MSE B;  5J3X A;  1YRT B;  3H62 B;  3I5F B;  3FWB A;  1YUR A;  1WLM A;  1AHR A;  1WRK A;  1KBP A;  1U5I B;  5CSJ A;  4QJ5 B;  1CTR A;  2QFP A;  1OZO A;  3QFM A;  4GBA A;  2KAY A;  3FGA C;  1ALW A;  1KQM B;  1V1G A;  2JNF A;  3I5F C;  5CSF A;  4C0K A;  3H69 A;  1SCV A;  1WRL A;  4USL A;  2LLU A;  2LVJ A;  1M63 A;  2HYP A;  3H68 A;  1AUI B;  3QFN A;  1SL7 A;  4L9M A;  3HVQ A;  1B8R A;  5TNC A;  3ZWH A;  2E30 A;  5DKR A;  1DGV A;  4CFR A;  1BG1 A;  1ZFS A;  3WHU B;  1L7Z A;  1H4B A;  3HCM A;  1WY9 A;  1CMG A;  3FIA A;  1R6P A;  2M97 A;  2ZN8 A;  1Y6W A;  2LE9 B;  1B4C A;  3BOW B;  1W7J B;  5BPJ A;  3JTD C;  3TGH A;  4ZCU A;  5PAL A;  3EVU A;  1WAR A;  2BL0 B;  2JXL A;  1E8A A;  1LA3 A;  2KBM A;  1TNQ A;  2M29 A;  1S3P A;  5G08 A;  2NYL C;  1EH2 A;  2F2P A;  2HQ8 A;  1F55 A;  2HY1 A;  1ZAC A;  1F71 A;  5CPV A;  1KFX L;  2LP2 A;  1YVH A;  1QLK A;  2JQ6 A;  3DVJ A;  1NX2 A;  3WXA A;  2EC6 C;  4F0Z B;  1L2O B;  3I5I B;  3CTN A;  3KHE A;  1RRO A;  5ER4 X;  1S6J A;  1QV0 A;  2K0J A;  1K9P A;  1LKJ A;  4YGC B;  3ZTV A;  2LUC A;  4GGF C;  3CR4 X;  5HYD A;  1GQM A;  1XFU O;  3TUY C;  2BE4 A;  3BYA A;  2ZN9 A;  4OCI A;  2L0P A;  2CBL A;  3VRQ A;  1J55 A;  2K7C A;  4C0L A;  1S36 A;  1RFJ A;  1QX5 B;  2JTZ A;  2KI6 C;  1S95 A;  4DIR A;  1PVA A;  1QX7 A;  2D8N A;  3CWG A;  3O2P A;  2KI4 B;  3ZNI A;  1B7T Y;  3RL4 A;  3NSI A;  1K8U A;  2ZNE A;  4XJK A;  3IQQ A;  5AEQ A;  3A8R A;  4AQI A;  1F54 A;  1LIN A;  2NPP C;  3TS5 C;  1TRF A;  5D7F A;  1SR6 B;  3EKH A;  1MQ1 A;  2KI4 C;  4ZCV A;  1KK7 Z;  2CV9 A;  1WDC B;  5DKQ A;  3BUO B;  5HPE A;  1SR6 C;  1R2U A;  1JSA A;  1J7O A;  3T1I A;  1NP8 A;  2KYF A;  4NDD A;  3AKA A;  3P71 C;  4F0Z A;  5DKN A;  1DMO A;  1B47 A;  2USH A;  3D0Y A;  1WRZ A;  4WQ3 A;  2WDE A;  3FS7 A;  1B7T Z;  5F6T A;  4FBW A;  4MRX A;  1SNL A;  3EVV A;  3PN7 C;  4H2F A;  2HQW A;  1A2X A;  1NCY A;  4GPL B;  2O8G A;  1SRA A;  2CXJ A;  3SG6 A;  4O5G A;  1N65 A;  1FW4 A;  4MN0 A;  3AKB A;  4TUI A;  3DW8 C;  1MWN A;  1SPY A;  1TIZ A;  3A4U B;  1FJM A;  5F3W A;  1SL8 A;  1XZW A;  2H61 C;  1YX8 A;  2NCP A;  1DVI A;  2V53 A;  2Q8U A;  3QG5 C;  1YVL A;  3K7V C;  1ZMZ A;  4ZX2 A;  4ORC A;  2FCD A;  5C1V A;  1J7Q A;  1M46 A;  1Q80 A;  1X02 A;  4PE7 A;  4YGE B;  3IVE A;  3DVK A;  5AAN A;  4O4K A;  2A22 A;  1BU3 A;  1NNW A;  1UF3 A;  1UHJ A;  1OIE A;  3SIB A;  3OX6 A;  3PSR A;  1EJ3 A;  3AAJ A;  3TDZ A;  1MXE A;  5KTY A;  2LUX A;  1XYD A;  1L2O C;  2F3Z A;  3CLN A;  4PHM A;  5I2L A;  3SG7 A;  1G33 A;  2IAE C;  3CR2 A;  3DF0 A;  1JFK A;  3D0Y B;  1J1D A;  4ETO A;  1NCX A;  4NDB A;  5HLO A;  4WRI A;  3DF0 B;  3CK2 A;  2M7N A;  1KK7 Y;  1QTX A;  2KAV A;  2OS8 C;  4FCX A;  4MP0 A;  4TNC A;  2JT0 A;  4QJ3 B;  3SIA A;  3THO B;  1HP1 A;  3GK2 A;  1G8I A;  1S26 D;  1S3N A;  4JPZ B;  1XFW O;  3DSD A;  3H63 A;  1S5G Y;  5GTU A;  4N1F A;  3TS5 B;  2LVV A;  1K9U A;  3OX5 A;  4OR9 B;  1V73 A;  4UT3 A;  4ORC B;  5I2O A;  1DJH A;  2R2I A;  3RLZ A;  2JWW A;  1RK9 A;  4UT3 B;  3C5W C;  1DJX A;  3I5G C;  4ORA B;  1M39 A;  1AVS A;  1PSB A;  3O6B A;  2ZBM A;  1V1F A;  1FBV A;  2F8P A;  3QRX A;  4O24 A;  1NPQ A;  1PK0 D;  3PAT A;  2LMU A;  4XJK B;  1ALV A;  1Y1U A;  5AER A;  1Z2W A;  2H2K A;  3PN7 B;  1PVB A;  1YUT A;  4V0W A;  2KAX A;  2JU0 A;  1S3L A;  2JXC A;  3LCP C;  1F8H A;  2LCP A;  1K2H A;  2K8M B;  4OVN F;  3LK0 A;  2JUL A;  4H1Y P;  4CLN A;  3EK8 A;  4MOV A;  1PUL A;  3CR5 X;  2CTN A;  2O8A A;  4I5N C;  1DTL A;  3H60 A;  5JJT A;  2Y5I A;  1RWY A;  1A75 B;  1K93 D;  1UP5 A;  2JOJ A; 
#chains in the Genus database with same CATH topology
 2CCM A;  2M1U A;  1QLS A;  2Q91 A;  3CGA A;  4YRU A;  3CZ1 A;  4QJ4 B;  1B8L A;  2KPH A;  2WC8 A;  3S0F A;  1CM4 A;  1AJ5 A;  1S8E A;  4AOM A;  1CDL A;  3F45 A;  4P5O E;  4DRW A;  1LVC D;  1C3Y A;  2AUC A;  1SBJ A;  4TUG A;  3V2L A;  3DYE A;  1CDM A;  2KFF A;  3B88 A;  4MZK A;  2PVB A;  1KFX S;  1U5I A;  2AMI A;  2G2B A;  1OID A;  1K94 A;  1S5G Z;  1DF0 B;  1JUO A;  1QXP A;  2NCO A;  2LHL A;  1CMF A;  2KBI A;  4JA7 A;  1K95 A;  3NHT A;  1IRJ A;  1SMG A;  2MLF C;  1OMR A;  3PM8 A;  3WHT B;  3CAB A;  3JVT C;  4D1E A;  1F4O A;  4GGN A;  2LM5 A;  5IBW A;  1DJW A;  2LNK A;  1M31 A;  2TN4 A;  1JBA A;  1QIV A;  3IVT A;  2LMT A;  2M3W A;  3NXA A;  5HLV A;  3TZ1 A;  4ORA A;  2F2O A;  2LMV A;  5ER5 A;  1Y1A A;  1W24 A;  1UUS A;  5D3O A;  2PSR A;  3TUY B;  4C0L A;  4CPV A;  1MXL C;  3AAK A;  4N1G A;  1JWD A;  4FBQ A;  1XFZ O;  2WCB A;  1UHH A;  3GVE A;  4XPN A;  3NSO A;  3EK7 A;  2NZ0 A;  4DT2 A;  1Y0V H;  2JOG A;  1BT6 A;  1CDP A;  3BUN B;  1CKK A;  3S0E A;  1CDN A;  3D73 A;  2JPO A;  5JJG A;  3L47 A;  3K21 A;  4I5L B;  1T71 A;  1EG3 A;  2KI6 D;  3VRN A;  4WWL A;  2CNP A;  5FYX A;  1KK8 B;  3E7B A;  1XK4 C;  3BOW A;  2O5G A;  2WCK A;  2CT9 A;  1XK4 A;  3OP0 A;  2MBX A;  4I5L C;  2BDX A;  4JA9 A;  3BXK A;  1AJ4 A;  4FBK A;  1TTX A;  5FI6 A;  2I18 A;  4MRY A;  1QX2 A;  3SG2 A;  5HL1 A;  1OOJ A;  2M0R A;  1WLZ A;  2OPO A;  2M8U A;  1JC2 A;  2QDI A;  4BY4 A;  2FJY A;  3DVM A;  1II7 A;  2AHD A;  4DCK A;  4O43 A;  1IJ6 A;  1M63 B;  1F70 A;  1OMD A;  1NX0 A;  3JYF A;  2ZFD A;  2BCD A;  2PAL A;  4GFT A;  3PFV A;  3QME A;  1UHK A;  2H61 A;  2KHN A;  4JQ0 D;  3NSK A;  1ODB A;  2KSP A;  2Y1M A;  3EK4 A;  2MAZ A;  3L4A A;  4YGA A;  1U32 A;  1CFF A;  2LLT A;  4H1S A;  2FCE A;  3BUX B;  1BOC A;  4V0V A;  2B1U A;  4MEW A;  4P2Y B;  2K7O A;  2A4J A;  4YBH B;  2Z72 A;  5HKY A;  1IT6 A;  4M0V A;  2LC5 A;  1K96 A;  1OOH A;  2F3Y A;  2L2C A;  4PE4 A;  4DSY A;  3PJI A;  2LV7 A;  5HKW A;  5AFP A;  1T14 A;  4PHK A;  1AK8 A;  4YKE A;  5I94 A;  2NLN A;  2L5X B;  2DFJ A;  1K9K A;  4NDC A;  1OOI X;  2KDH A;  1KFU S;  3E3R A;  2K2F A;  4HRH A;  2EGD A;  1SKT A;  2HYO A;  1DF0 A;  2XMO A;  1TN4 A;  3QFO A;  1H8B A;  1N0Y A;  3O4X A;  3S0B A;  4H2B A;  5DNY A;  2JPT A;  1SU1 A;  2Y4Q A;  4MOY A;  2BCA A;  1BJF A;  3OHM B;  3B87 A;  1NCZ A;  4JWQ A;  5FI7 A;  5EL2 A;  3RZS A;  1QJT A;  3SG3 A;  3KPX A;  4HD0 A;  3OBV A;  2PRU A;  1HO5 A;  1VRK A;  2NYM C;  3SS4 A;  2L4I A;  1KK8 C;  2QAC A;  1JF0 A;  1OW4 A;  1TNX A;  2PQL A;  1MR8 A;  4NQG A;  1IG5 A;  1YUS A;  2GV5 A;  4A4C A;  4I5J A;  1CFP A;  1XFV O;  1MHO A;  1EL4 A;  2EC6 B;  2JT8 A;  2Q4U A;  4PE0 A;  3VGO A;  1TCO A;  1G4Y R;  3D77 A;  4LTY A;  3KEV A;  3KO0 A;  2L4H A;  1IJ5 A;  2ISD A;  1OI8 A;  1S1E A;  2SCP A;  1BLQ A;  5I8N A;  2BCB A;  2MA2 A;  1KFU L;  1JF2 A;  5AXI A;  2IS9 A;  1IQ3 A;  2KLD A;  1MUX A;  4XYN A;  1OE9 B;  1CB1 A;  3K7W C;  4DHL A;  4PE1 A;  3DZT A;  3HX4 A;  4OV2 A;  2P6B A;  2KFH A;  1TOP A;  2KQY A;  1FI6 A;  2GGM A;  2F33 A;  4YGB B;  3H4S E;  1A03 A;  2WCJ A;  4PCW A;  3WNX B;  1MF8 B;  1YUU A;  1TWO A;  2Y1N A;  3SG5 A;  1SY9 A;  1QV1 A;  5EQV A;  1PRW A;  2M1K B;  2M9G A;  3FE8 A;  3GK1 A;  4MLW A;  2WDD A;  1XO5 A;  2MHH A;  4UT2 A;  5JPF A;  2KOT A;  3ICB A;  1JK7 A;  3C9F A;  3BFA A;  4M2Q A;  1TNP A;  3M0W A;  1EXR A;  2BBM A;  4IYP C;  1KQM C;  3FWC A;  3LK1 A;  4IJ7 A;  1B1G A;  3E7A A;  3ICF A;  1FPW A;  2WOS A;  4A4B A;  4KKZ A;  1HQV A;  1DJI A;  1UHI A;  3UO9 A;  4UPG A;  2K2A A;  1HPU A;  2FJU B;  1DC1 A;  4F7F A;  1GJY A;  1A75 A;  2K7B A;  4V0X A;  3SS5 A;  4I5N B;  1IH0 A;  3RL5 A;  1M45 A;  4IL1 A;  1W9Z A;  2RGI A;  3S0D A;  1DEK A;  3R1V A;  1J7P A;  3NSL A;  2I2R E;  2WCE A;  4FQO A;  5JOL A;  4PHN A;  1A29 A;  5CSI A;  1FF1 A;  2KGB C;  2LLS A;  1K90 D;  3GOF A;  4FTG A;  2EHB A;  1AP4 A;  1EG4 A;  2BL0 C;  2JNX A;  4UWQ A;  1C3Z A;  5KTY A;  4J6O A;  4YI8 A;  3FLO A;  2LP3 A;  1OOG A;  1QAS A;  3BUW B;  4NZV A;  4HSZ A;  1SW8 A;  4C0J A;  1XFX O;  5GQQ C;  2PAS A;  3RM1 A;  1CLB A;  2KKN A;  2BAP A;  3D03 A;  4MVF A;  1Z2C B;  1DJY A;  1HT9 A;  3I5I C;  2YVT A;  2VRG A;  1T70 A;  4OR9 A;  1IWQ A;  1KSM A;  4GGF A;  4ZVZ A;  2WOR A;  2QFR A;  4U8D A;  1QHW A;  4H2G A;  2BCX A;  4ICB A;  4MZL A;  3VRO A;  3OB1 B;  4KYN A;  2HET A;  2FOT A;  1B8C A;  2BE6 A;  5FI2 A;  3SJS A;  1QFC A;  3IVD A;  1CFD A;  1LXF C;  3V4Y A;  1SYM A;  2K61 A;  4GAO A;  1MF8 A;  3BQ3 A;  1B9A A;  3OB2 B;  1TCF A;  3K1E A;  3H61 A;  1CNP A;  1KSO A;  2ZKM X;  2OS8 B;  3LL8 B;  3NHI A;  2QJC A;  4MSP A;  1OMV A;  4YI9 A;  5B8I B;  1RTP 1;  4PDZ A;  5HKZ A;  1SK6 D;  2I94 A;  4E68 A;  2MLE C;  5D69 A;  3D10 A;  3EVR A;  4CID A;  1S6I A;  4BY5 A;  5K89 A;  3QFK A;  1WDC C;  2LVK A;  1SCM C;  3DSC A;  1SL9 A;  3RL3 A;  2WDF A;  4GUK A;  3SG4 A;  2BEC A;  3EG5 B;  3VRR A;  1W7I B;  1Y1X A;  1SCM B;  1YTZ C;  2QEH A;  2HPS A;  2BQ8 X;  1IGV A;  2P6B B;  2I7A A;  1KQV A;  3PSN A;  4OKH A;  2L2E A;  2DXN A;  4M2P A;  1QAT A;  1TUJ A;  1IQ5 A;  2KFG A;  2L5Y A;  2MJW B;  1YX7 A;  2QEO A;  1OQP A;  1QWV A;  5IOH A;  4FQT A;  1NSH A;  3EGG A;  4H1Y P;  3BUM B;  2M7L A;  1C7V A;  3LLE A;  1OSA A;  1QIW A;  1KCY A;  4DS7 A;  1S6C A;  1TNW A;  4CFQ A;  5INB A;  1ZUZ A;  3I5H B;  1PAL A;  1BR1 B;  1OZS A;  1CM1 A;  1UTE A;  2P70 A;  1XM7 A;  3H67 A;  1GGZ A;  3PSO A;  2JTT A;  4GNK B;  1NYA A;  1S70 A;  3H66 A;  1OIE A;  3S0A A;  2K7D A;  2LHI A;  2LVI A;  2JC2 A;  2Z1A A;  4YGD B;  1ZOT B;  2PMY A;  1XA5 A;  1DJG A;  4WQ2 A;  4N5X A;  3N7H A;  2L51 A;  4PAL A;  1CLM A;  1WAO 1;  2Z06 A;  3RQZ A;  4B2O A;  2KGR A;  3BJH A;  5KSZ A;  2COL B;  1DJZ A;  3D75 A;  3O78 A;  1DGU A;  4MZJ A;  3CS1 A;  3UNW A;  2BBN A;  3AUZ A;  1PSR A;  1UWO A;  4PHJ A;  1NWD A;  1XVJ A;  1LA0 A;  1QVI Y;  3TDI A;  1BMO A;  2WCL A;  3CZ2 A;  2JRF A;  2JT3 A;  3C1V A;  2M49 B;  1BR4 B;  3PAL A;  2LAN A;  1NUB A;  1TCO B;  4HRE E;  4LU9 A;  2L98 A;  1OOF A;  3PLF B;  2WND A;  4G9J A;  1NIW A;  3O4Y A;  3KBP A;  1Z2X A;  3H64 A;  3JVT B;  3N5U A;  1G5B A;  3VRP A;  3AV0 A;  5KU1 A;  3DD4 A;  1USH A;  1JFJ A;  3THN A;  1XFY O;  3CZT X;  3JTD B;  3DVE A;  1KWO B;  3I5G B;  4AQJ A;  5CSN A;  1BF5 A;  4Q04 A;  3LL8 A;  1UHN A;  4LAC C;  1QS7 A;  2WC6 A;  1DEL A;  2KYC A;  1FI5 A;  3PM2 A;  5B8I A;  3ZU0 A;  2ZRS A;  4AQI A;  1J1E A;  3B86 A;  1S3M A;  2KLE A;  2SAS A;  1KWO C;  1CFC A;  2IE3 C;  3IF7 A;  2GGZ A;  2BKI B;  2JZI A;  2KQ6 A;  2E6W A;  2WCH A;  3B6X A;  3D78 A;  3DXL A;  3GK4 X;  2WDC A;  4KBP A;  1N2D A;  2BNX A;  5JPE A;  1C07 A;  1GGW A;  2DOQ A;  4I5K A;  1C7W A;  1CLL A;  2BKH B;  2LAP A;  2G9B A;  3D74 A;  1AUI A;  1RJV A;  1IKU A;  2MRD A;  1NX1 A;  1YR5 A;  3IQO A;  1A4P A;  2ZND A;  2WC5 A;  4R1E A;  2NXF A;  2GJU A;  3I5H C;  4HRG A;  4JKT A;  2AAO A;  4INW A;  5I2Q A;  3EKJ A;  1DT7 B;  3E0J A;  4ORB A;  2OTG C;  3L4L A;  3EGH A;  1UUR A;  3D76 A;  2KNE A;  4MBE A;  4ORB B;  1Z4H A;  4M2O A;  4DUQ A;  1D1O A;  4H2I A;  3FE6 A;  3IB8 A;  4Q7F A;  3KF9 A;  2WCF A;  1F4Q A;  2L50 A;  2HF5 A;  2OTG B;  3TDU A;  2QPT A;  2R17 A;  1J7R A;  2NXQ A;  1QVI Z;  2ZRT A;  3IB7 A;  5J28 A;  1YRU B;  1REC A;  2IE4 C;  2O60 A;  1BOD A;  1NX3 A;  3MSE B;  5J3X A;  1YRT B;  3H62 B;  3I5F B;  1GM0 A;  3FWB A;  1YUR A;  1WLM A;  1AHR A;  1WRK A;  1KBP A;  2H8V A;  1U5I B;  5CSJ A;  4QJ5 B;  1CTR A;  2QFP A;  1OZO A;  3QFM A;  4GBA A;  2KAY A;  3FGA C;  1ALW A;  1KQM B;  1V1G A;  3CZ0 A;  2JNF A;  3I5F C;  5CSF A;  2DXL A;  4C0K A;  3H69 A;  3VB1 A;  1SCV A;  1WRL A;  4PT1 A;  2LLU A;  2LVJ A;  4USL A;  1M63 A;  2HYP A;  3H68 A;  1AUI B;  3S0G A;  3QFN A;  1SL7 A;  4L9M A;  3HVQ A;  1B8R A;  2ERB A;  5TNC A;  3ZWH A;  2E30 A;  5DKR A;  1DGV A;  3CDN A;  4CFR A;  1ZFS A;  3WHU B;  1BG1 A;  1L7Z A;  3SS3 A;  1H4B A;  3HCM A;  1WY9 A;  1CMG A;  3FIA A;  1R6P A;  2M97 A;  2ZN8 A;  1Y6W A;  2LE9 B;  1B4C A;  3BOW B;  1W7J B;  5BPJ A;  1XFR A;  3JTD C;  3TGH A;  4ZCU A;  5PAL A;  3EVU A;  1WAR A;  2BL0 B;  2JXL A;  1E8A A;  1LA3 A;  2KBM A;  1TNQ A;  2M29 A;  1S3P A;  5G08 A;  2NYL C;  1EH2 A;  2ZOA A;  2F2P A;  2HQ8 A;  1F55 A;  1IIO A;  2HY1 A;  1ZAC A;  1F71 A;  5CPV A;  1KFX L;  2LP2 A;  1YVH A;  1QLK A;  2JQ6 A;  1P28 A;  3DVJ A;  1NX2 A;  3Q8I A;  4INX A;  3WXA A;  2EC6 C;  4F0Z B;  1L2O B;  3I5I B;  3CTN A;  3KHE A;  1RRO A;  5ER4 X;  1S6J A;  1QV0 A;  2K0J A;  1K9P A;  1DQE A;  1LKJ A;  1TUZ A;  4YGC B;  3TUY C;  2QEV A;  3ZTV A;  2LUC A;  4GGF C;  3CR4 X;  5HYD A;  1GQM A;  2P71 A;  1XFU O;  2QEB A;  2BE4 A;  3BYA A;  2ZN9 A;  4OCI A;  2L0P A;  2CBL A;  2WCM A;  1J55 A;  2K7C A;  3VRQ A;  1S36 A;  1RFJ A;  1QX5 B;  2JTZ A;  2KI6 C;  1S95 A;  4DIR A;  1PVA A;  1LS8 A;  1QX7 A;  2D8N A;  3CWG A;  3O2P A;  2KI4 B;  3ZNI A;  1B7T Y;  3RL4 A;  3NSI A;  1K8U A;  2ZNE A;  3R1P A;  3IQQ A;  4XJK A;  3A8R A;  3CYZ A;  5AEQ A;  1LIN A;  1F54 A;  2NPP C;  3TS5 C;  1TRF A;  5D7F A;  1SR6 B;  3EKH A;  3NGV A;  1MQ1 A;  3OGN A;  2KI4 C;  4ZCV A;  1KK7 Z;  4OZD A;  3R72 A;  2CV9 A;  3R1O A;  1WDC B;  5DKQ A;  3BUO B;  5HPE A;  1SR6 C;  1R2U A;  1JSA A;  1J7O A;  3T1I A;  1NP8 A;  2KYF A;  4NDD A;  3AKA A;  3P71 C;  4F0Z A;  5DKN A;  2K60 A;  1B47 A;  1DMO A;  2USH A;  3D0Y A;  1WRZ A;  4WQ3 A;  2WDE A;  3FS7 A;  1B7T Z;  5F6T A;  4FBW A;  1ORG A;  4MRX A;  1SNL A;  3EVV A;  3PN7 C;  4H2F A;  2HQW A;  1A2X A;  1NCY A;  2PYQ A;  4GPL B;  2O8G A;  1SRA A;  2CXJ A;  3SG6 A;  4O5G A;  1N65 A;  1FW4 A;  4MN0 A;  3AKB A;  4TUI A;  3DW8 C;  1MWN A;  1SPY A;  1TIZ A;  3A4U B;  1FJM A;  5F3W A;  1SL8 A;  1XZW A;  2H61 C;  1YX8 A;  2NCP A;  1DVI A;  2V53 A;  2Q8U A;  3QG5 C;  1YVL A;  3K7V C;  1ZMZ A;  2ZO9 B;  4ORC A;  4ZX2 A;  2FCD A;  5C1V A;  1J7Q A;  1M46 A;  1Q80 A;  1X02 A;  4PE7 A;  4YGE B;  3IVE A;  3DVK A;  5AAN A;  4O4K A;  2A22 A;  1BU3 A;  1NNW A;  1UF3 A;  1UHJ A;  3FE9 A;  3SIB A;  4JD9 A;  3OX6 A;  3PSR A;  1EJ3 A;  3AAJ A;  3BFH A;  1MXE A;  3TDZ A;  2LUX A;  1XYD A;  1L2O C;  2F3Z A;  3CLN A;  4PHM A;  5I2L A;  3SG7 A;  1G33 A;  2IAE C;  2YGU A;  3CR2 A;  3DF0 A;  1JFK A;  3D0Y B;  1J1D A;  4ETO A;  1NCX A;  4NDB A;  5HLO A;  4WRI A;  3DF0 B;  3CK2 A;  2GTE A;  2M7N A;  1KK7 Y;  1QTX A;  2KAV A;  2OS8 C;  4FCX A;  2YEQ A;  4MP0 A;  4TNC A;  2JT0 A;  4QJ3 B;  3SIA A;  3THO B;  1HP1 A;  3GK2 A;  1G8I A;  1S26 D;  1S3N A;  4JPZ B;  1XFW O;  3DSD A;  3H63 A;  5DIC A;  1S5G Y;  5GTU A;  4N1F A;  3TS5 B;  2LVV A;  1K9U A;  3OX5 A;  4OR9 B;  1V73 A;  4UT3 A;  4ORC B;  5I2O A;  1DJH A;  2R2I A;  3B7A A;  3RLZ A;  2JWW A;  1RK9 A;  4UT3 B;  3C5W C;  1SSE B;  1DJX A;  3I5G C;  4ORA B;  1M39 A;  1AVS A;  1PSB A;  3O6B A;  2ZBM A;  1V1F A;  3BFB A;  1FBV A;  2F8P A;  3QRX A;  4O24 A;  1NPQ A;  1PK0 D;  3PAT A;  2LMU A;  4XJK B;  1ALV A;  1Y1U A;  5AER A;  1Z2W A;  2H2K A;  3PN7 B;  1PVB A;  1YUT A;  4V0W A;  2KAX A;  2JU0 A;  1S3L A;  2JXC A;  3LCP C;  1F8H A;  2LCP A;  1K2H A;  2K8M B;  4OVN F;  3LK0 A;  2JUL A;  3DY9 A;  4CLN A;  3EK8 A;  4MOV A;  1PUL A;  3CR5 X;  2CTN A;  2O8A A;  4I5N C;  1DTL A;  3H60 A;  5JJT A;  2Y5I A;  1RWY A;  1A75 B;  1K93 D;  1UP5 A;  2JOJ A; 
#chains in the Genus database with same CATH homology
 2CCM A;  2M1U A;  1QLS A;  2Q91 A;  3CGA A;  4YRU A;  4QJ4 B;  1B8L A;  2WC8 A;  1CM4 A;  1AJ5 A;  1S8E A;  4AOM A;  1CDL A;  3F45 A;  4P5O E;  4DRW A;  1LVC D;  2AUC A;  1SBJ A;  4TUG A;  1CDM A;  2KFF A;  4MZK A;  2PVB A;  1KFX S;  1U5I A;  2AMI A;  2G2B A;  1OID A;  1K94 A;  1S5G Z;  1DF0 B;  1JUO A;  1QXP A;  2NCO A;  2LHL A;  1CMF A;  2KBI A;  4JA7 A;  1K95 A;  1IRJ A;  1SMG A;  2MLF C;  1OMR A;  3PM8 A;  3WHT B;  3JVT C;  4D1E A;  1F4O A;  4GGN A;  2LM5 A;  5IBW A;  1DJW A;  2LNK A;  1M31 A;  2TN4 A;  1JBA A;  1QIV A;  2NYM C;  2LMT A;  2M3W A;  3NXA A;  5HLV A;  3TZ1 A;  4ORA A;  2F2O A;  2LMV A;  5ER5 A;  1Y1A A;  1W24 A;  1UUS A;  2PSR A;  4NZV A;  1JWD A;  4CPV A;  1MXL C;  3AAK A;  4N1G A;  4FBQ A;  1XFZ O;  2WCB A;  1UHH A;  3GVE A;  4XPN A;  3NSO A;  3EK7 A;  2NZ0 A;  4DT2 A;  1Y0V H;  2JOG A;  1BT6 A;  1CDP A;  3BUN B;  1CKK A;  1CDN A;  5JJG A;  4I5L B;  3K21 A;  1T71 A;  1EG3 A;  2KI6 D;  3VRN A;  4WWL A;  2CNP A;  5FYX A;  1KK8 B;  3E7B A;  1XK4 C;  3BOW A;  2O5G A;  2CT9 A;  1XK4 A;  3OP0 A;  2MBX A;  4I5L C;  2BDX A;  4JA9 A;  3BXK A;  1AJ4 A;  4FBK A;  1TTX A;  2I18 A;  4MRY A;  1QX2 A;  3SG2 A;  1OOJ A;  2M0R A;  1WLZ A;  2OPO A;  2M8U A;  1JC2 A;  4BY4 A;  3DVM A;  1II7 A;  2AHD A;  4DCK A;  4O43 A;  1IJ6 A;  1M63 B;  1F70 A;  1OMD A;  1NX0 A;  3JYF A;  2ZFD A;  2BCD A;  2PAL A;  4GFT A;  3PFV A;  1UHK A;  2H61 A;  2KHN A;  4JQ0 D;  3NSK A;  1ODB A;  2KSP A;  2Y1M A;  3EK4 A;  2MAZ A;  4YGA A;  1U32 A;  4H1S A;  1CFF A;  2LLT A;  2FCE A;  3BUX B;  1BOC A;  4V0V A;  2B1U A;  4MEW A;  4P2Y B;  2K7O A;  2A4J A;  4YBH B;  2Z72 A;  5HKY A;  1IT6 A;  4M0V A;  2LC5 A;  1K96 A;  2F3Y A;  4PE4 A;  4DSY A;  2LV7 A;  5HKW A;  5AFP A;  4PHK A;  1AK8 A;  4YKE A;  2NLN A;  2L5X B;  2DFJ A;  1K9K A;  4NDC A;  2KDH A;  2HYO A;  1KFU S;  3E3R A;  2K2F A;  4HRH A;  1SKT A;  2EGD A;  1DF0 A;  2XMO A;  1TN4 A;  3QFO A;  1H8B A;  1N0Y A;  4H2B A;  5DNY A;  2JPT A;  1SU1 A;  2Y4Q A;  4MOY A;  1BJF A;  2BCA A;  3OHM B;  4JWQ A;  1NCZ A;  1QJT A;  3SG3 A;  3KPX A;  4HD0 A;  2PRU A;  1HO5 A;  1VRK A;  2L4I A;  1KK8 C;  2QAC A;  1JF0 A;  1TNX A;  3TUY B;  4A4C A;  1MR8 A;  4NQG A;  1IG5 A;  1YUS A;  2GV5 A;  4I5J A;  1CFP A;  1XFV O;  1MHO A;  1EL4 A;  2EC6 B;  2JT8 A;  2Q4U A;  4PE0 A;  3VGO A;  1TCO A;  1G4Y R;  4LTY A;  3KEV A;  3KO0 A;  2L4H A;  1IJ5 A;  2ISD A;  1OI8 A;  1S1E A;  2SCP A;  1BLQ A;  5I8N A;  2BCB A;  2MA2 A;  1KFU L;  1JF2 A;  5AXI A;  2IS9 A;  1IQ3 A;  1MUX A;  4XYN A;  1OE9 B;  1CB1 A;  3K7W C;  4DHL A;  4PE1 A;  3HX4 A;  4OV2 A;  2P6B A;  2KFH A;  1TOP A;  2KQY A;  1FI6 A;  2GGM A;  2F33 A;  4YGB B;  3H4S E;  1A03 A;  4PCW A;  3WNX B;  1MF8 B;  1YUU A;  2Y1N A;  3SG5 A;  1SY9 A;  1QV1 A;  5EQV A;  1PRW A;  2M1K B;  2M9G A;  3GK1 A;  4MLW A;  2WDD A;  1XO5 A;  2MHH A;  4UT2 A;  5JPF A;  2KOT A;  3ICB A;  1JK7 A;  3C9F A;  4M2Q A;  4IYP C;  1TNP A;  3M0W A;  1EXR A;  2BBM A;  1KQM C;  3FWC A;  3LK1 A;  1B1G A;  3E7A A;  3ICF A;  1FPW A;  2WOS A;  4A4B A;  4KKZ A;  1HQV A;  1DJI A;  1UHI A;  4UPG A;  2K2A A;  1HPU A;  2FJU B;  1GJY A;  1A75 A;  2K7B A;  4V0X A;  4I5N B;  1IH0 A;  3RL5 A;  1M45 A;  4IL1 A;  1J7P A;  2RGI A;  3NSL A;  2I2R E;  2WCE A;  4FQO A;  5JOL A;  4PHN A;  1A29 A;  5CSI A;  1FF1 A;  2KGB C;  2LLS A;  1K90 D;  3GOF A;  4FTG A;  2EHB A;  1AP4 A;  1EG4 A;  2BL0 C;  2JNX A;  4UWQ A;  4J6O A;  4YI8 A;  3FLO A;  2LP3 A;  1QAS A;  3BUW B;  4HSZ A;  1SW8 A;  4C0J A;  1XFX O;  5GQQ C;  2PAS A;  3RM1 A;  1CLB A;  2KKN A;  3D03 A;  4MVF A;  1DJY A;  1HT9 A;  3I5I C;  2YVT A;  2VRG A;  1T70 A;  4OR9 A;  1IWQ A;  1KSM A;  4GGF A;  4ZVZ A;  2WOR A;  2QFR A;  4U8D A;  1QHW A;  4H2G A;  2BCX A;  4ICB A;  4MZL A;  3VRO A;  3OB1 B;  2HET A;  2FOT A;  1B8C A;  2BE6 A;  3SJS A;  1QFC A;  3IVD A;  1CFD A;  1LXF C;  3V4Y A;  1SYM A;  2K61 A;  4GAO A;  1MF8 A;  3BQ3 A;  1B9A A;  3OB2 B;  1TCF A;  3H61 A;  1CNP A;  1KSO A;  2ZKM X;  2OS8 B;  3LL8 B;  2QJC A;  4MSP A;  1OMV A;  4YI9 A;  5B8I B;  1RTP 1;  4PDZ A;  5HKZ A;  1SK6 D;  2I94 A;  4E68 A;  2MLE C;  5D69 A;  3D10 A;  3EVR A;  4CID A;  1S6I A;  4BY5 A;  5K89 A;  3QFK A;  1WDC C;  2LVK A;  1SCM C;  3DSC A;  1SL9 A;  3RL3 A;  2WDF A;  4GUK A;  3SG4 A;  2BEC A;  3VRR A;  1W7I B;  1Y1X A;  1SCM B;  1YTZ C;  2HPS A;  2BQ8 X;  1IGV A;  2P6B B;  2I7A A;  1KQV A;  3PSN A;  4OKH A;  2L2E A;  2DXN A;  4M2P A;  1QAT A;  1IQ5 A;  2KFG A;  2MJW B;  1YX7 A;  5IOH A;  1OQP A;  1NSH A;  3EGG A;  3BUM B;  2M7L A;  1C7V A;  3LLE A;  1OSA A;  1QIW A;  1KCY A;  4DS7 A;  1S6C A;  1TNW A;  4CFQ A;  5INB A;  1ZUZ A;  3I5H B;  1PAL A;  1BR1 B;  1OZS A;  1CM1 A;  1UTE A;  1XM7 A;  3H67 A;  3PSO A;  1GGZ A;  2JTT A;  4GNK B;  1NYA A;  1S70 A;  3H66 A;  2K7D A;  2LHI A;  2LVI A;  2JC2 A;  2Z1A A;  4YGD B;  1ZOT B;  2PMY A;  1XA5 A;  1DJG A;  4WQ2 A;  4N5X A;  2L51 A;  4PAL A;  1CLM A;  1WAO 1;  2Z06 A;  3RQZ A;  4B2O A;  2KGR A;  5KSZ A;  2COL B;  1DJZ A;  3O78 A;  1DGU A;  4MZJ A;  3CS1 A;  2BBN A;  3AUZ A;  1PSR A;  1UWO A;  4PHJ A;  1NWD A;  1XVJ A;  1LA0 A;  1QVI Y;  3TDI A;  1BMO A;  2JRF A;  2JT3 A;  3C1V A;  2M49 B;  1BR4 B;  3PAL A;  2LAN A;  1NUB A;  1TCO B;  4HRE E;  4LU9 A;  2L98 A;  3PLF B;  2WND A;  4G9J A;  1NIW A;  3O4Y A;  3KBP A;  1Z2X A;  3H64 A;  3JVT B;  3N5U A;  1G5B A;  3VRP A;  3AV0 A;  5KU1 A;  3DD4 A;  1USH A;  1JFJ A;  3THN A;  1XFY O;  3CZT X;  3JTD B;  3DVE A;  1KWO B;  3I5G B;  4AQJ A;  5CSN A;  1BF5 A;  4Q04 A;  3LL8 A;  1UHN A;  4LAC C;  1QS7 A;  2KYC A;  1FI5 A;  5B8I A;  3ZU0 A;  2ZRS A;  1J1E A;  1S3M A;  2SAS A;  2IE3 C;  1KWO C;  1CFC A;  3IF7 A;  2GGZ A;  2BKI B;  2JZI A;  2KQ6 A;  2E6W A;  2WDC A;  4KBP A;  3GK4 X;  1N2D A;  5JPE A;  1C07 A;  1GGW A;  2DOQ A;  4I5K A;  1C7W A;  1CLL A;  2BKH B;  2LAP A;  2G9B A;  1AUI A;  1RJV A;  1IKU A;  2MRD A;  1NX1 A;  1YR5 A;  3IQO A;  1A4P A;  2ZND A;  4R1E A;  2NXF A;  2GJU A;  3I5H C;  4HRG A;  5I2Q A;  2AAO A;  3E0J A;  1DT7 B;  3EKJ A;  4ORB A;  2OTG C;  3EGH A;  1UUR A;  4ORB B;  2KNE A;  4MBE A;  1D1O A;  4M2O A;  4DUQ A;  4H2I A;  3IB8 A;  4Q7F A;  3KF9 A;  2WCF A;  1F4Q A;  2L50 A;  2HF5 A;  2OTG B;  3TDU A;  2QPT A;  2R17 A;  1J7R A;  2NXQ A;  1QVI Z;  2ZRT A;  3IB7 A;  5J28 A;  1YRU B;  1REC A;  2IE4 C;  2O60 A;  1BOD A;  1NX3 A;  3MSE B;  5J3X A;  1YRT B;  3H62 B;  3I5F B;  3FWB A;  1YUR A;  1WLM A;  1AHR A;  1WRK A;  1KBP A;  1U5I B;  5CSJ A;  4QJ5 B;  1CTR A;  2QFP A;  1OZO A;  3QFM A;  4GBA A;  2KAY A;  3FGA C;  1ALW A;  1KQM B;  1V1G A;  2JNF A;  3I5F C;  5CSF A;  2DXL A;  4C0K A;  3H69 A;  1SCV A;  1WRL A;  4USL A;  2LLU A;  2LVJ A;  1M63 A;  2HYP A;  3H68 A;  1AUI B;  3QFN A;  1SL7 A;  4L9M A;  3HVQ A;  1B8R A;  5TNC A;  3ZWH A;  2E30 A;  5DKR A;  1DGV A;  4CFR A;  1BG1 A;  1ZFS A;  3WHU B;  1L7Z A;  1H4B A;  3HCM A;  1WY9 A;  1CMG A;  3FIA A;  1R6P A;  2M97 A;  2ZN8 A;  1Y6W A;  2LE9 B;  1B4C A;  3BOW B;  1W7J B;  5BPJ A;  3JTD C;  3TGH A;  4ZCU A;  5PAL A;  3EVU A;  1WAR A;  2BL0 B;  2JXL A;  1E8A A;  1LA3 A;  2KBM A;  1TNQ A;  2M29 A;  1S3P A;  5G08 A;  2NYL C;  1EH2 A;  2ZOA A;  2F2P A;  2HQ8 A;  1F55 A;  2HY1 A;  1ZAC A;  1F71 A;  5CPV A;  1KFX L;  2LP2 A;  1YVH A;  1QLK A;  2JQ6 A;  3DVJ A;  1NX2 A;  3WXA A;  2EC6 C;  4F0Z B;  1L2O B;  3I5I B;  3CTN A;  3KHE A;  1RRO A;  5ER4 X;  1S6J A;  1QV0 A;  2K0J A;  1K9P A;  1LKJ A;  4YGC B;  3ZTV A;  2LUC A;  4GGF C;  3CR4 X;  5HYD A;  1GQM A;  1XFU O;  3TUY C;  2BE4 A;  3BYA A;  2ZN9 A;  4OCI A;  2L0P A;  2CBL A;  3VRQ A;  1J55 A;  2K7C A;  4C0L A;  1S36 A;  1RFJ A;  1QX5 B;  2JTZ A;  2KI6 C;  1S95 A;  4DIR A;  1PVA A;  1QX7 A;  2D8N A;  3CWG A;  3O2P A;  2KI4 B;  3ZNI A;  1B7T Y;  3RL4 A;  3NSI A;  1K8U A;  2ZNE A;  4XJK A;  3IQQ A;  5AEQ A;  3A8R A;  4AQI A;  1F54 A;  1LIN A;  2NPP C;  3TS5 C;  1TRF A;  5D7F A;  1SR6 B;  3EKH A;  1MQ1 A;  2KI4 C;  4ZCV A;  1KK7 Z;  2CV9 A;  1WDC B;  5DKQ A;  3BUO B;  5HPE A;  1SR6 C;  1R2U A;  1JSA A;  1J7O A;  3T1I A;  1NP8 A;  2KYF A;  4NDD A;  3AKA A;  3P71 C;  4F0Z A;  5DKN A;  1DMO A;  1B47 A;  2USH A;  3D0Y A;  1WRZ A;  4WQ3 A;  2WDE A;  3FS7 A;  1B7T Z;  5F6T A;  4FBW A;  4MRX A;  1SNL A;  3EVV A;  3PN7 C;  4H2F A;  2HQW A;  1A2X A;  1NCY A;  4GPL B;  2O8G A;  1SRA A;  2CXJ A;  3SG6 A;  4O5G A;  1N65 A;  1FW4 A;  4MN0 A;  3AKB A;  4TUI A;  3DW8 C;  1MWN A;  1SPY A;  1TIZ A;  3A4U B;  1FJM A;  5F3W A;  1SL8 A;  1XZW A;  2H61 C;  1YX8 A;  2NCP A;  1DVI A;  2V53 A;  2Q8U A;  3QG5 C;  1YVL A;  3K7V C;  1ZMZ A;  2ZO9 B;  4ORC A;  4ZX2 A;  2FCD A;  5C1V A;  1J7Q A;  1M46 A;  1Q80 A;  1X02 A;  4PE7 A;  4YGE B;  3IVE A;  3DVK A;  5AAN A;  4O4K A;  2A22 A;  1BU3 A;  1NNW A;  1UF3 A;  1UHJ A;  1OIE A;  3SIB A;  3OX6 A;  3PSR A;  1EJ3 A;  3AAJ A;  3TDZ A;  1MXE A;  5KTY A;  2LUX A;  1XYD A;  1L2O C;  2F3Z A;  3CLN A;  4PHM A;  5I2L A;  3SG7 A;  1G33 A;  2IAE C;  3CR2 A;  3DF0 A;  1JFK A;  3D0Y B;  1J1D A;  4ETO A;  1NCX A;  4NDB A;  5HLO A;  4WRI A;  3DF0 B;  3CK2 A;  2M7N A;  1KK7 Y;  1QTX A;  2KAV A;  2OS8 C;  4FCX A;  2YEQ A;  4MP0 A;  4TNC A;  2JT0 A;  4QJ3 B;  3SIA A;  3THO B;  1HP1 A;  3GK2 A;  1G8I A;  1S26 D;  1S3N A;  4JPZ B;  1XFW O;  3DSD A;  3H63 A;  1S5G Y;  5GTU A;  4N1F A;  3TS5 B;  2LVV A;  1K9U A;  3OX5 A;  4OR9 B;  1V73 A;  4UT3 A;  4ORC B;  5I2O A;  1DJH A;  2R2I A;  3RLZ A;  2JWW A;  1RK9 A;  4UT3 B;  3C5W C;  1DJX A;  3I5G C;  4ORA B;  1M39 A;  1AVS A;  1PSB A;  3O6B A;  2ZBM A;  1V1F A;  1FBV A;  2F8P A;  3QRX A;  4O24 A;  1NPQ A;  1PK0 D;  3PAT A;  2LMU A;  4XJK B;  1ALV A;  1Y1U A;  5AER A;  1Z2W A;  2H2K A;  3PN7 B;  1PVB A;  1YUT A;  4V0W A;  2KAX A;  2JU0 A;  1S3L A;  2JXC A;  3LCP C;  1F8H A;  2LCP A;  1K2H A;  2K8M B;  4OVN F;  3LK0 A;  2JUL A;  4H1Y P;  4CLN A;  3EK8 A;  4MOV A;  1PUL A;  3CR5 X;  2CTN A;  2O8A A;  4I5N C;  1DTL A;  3H60 A;  5JJT A;  2Y5I A;  1RWY A;  1A75 B;  1K93 D;  1UP5 A;  2JOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...