4IL1A

Crystal structure of the rat calcineurin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
647
structure length
529
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICFEEAKGLDRINERMPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of calcineurin activation by calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Calmodulin, Calcineurin subunit B type 1, Serine/threonine-p
total genus 174
structure length 529
sequence length 647
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4il1A01
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4il1A02
1IJ5A 1BR1B 1YUUA 3F45A 1SNLA 3EKHA 1V73A 5DNYA 1LA0A 4FQOA 3ZNIA 4AQJA 1QS7A 1SY9A 2AAOA 2NXFA 2CCMA 2WORA 3BOWA 3OP0A 4I5NB 1DMOA 2DFJA 4I5KA 2FCEA 3I5IC 2NYMC 3IVDA 4FBKA 5CSNA 4MP0A 4TUGA 1OMRA 1CM1A 4FBWA 1UHHA 3BYAA 3EVRA 1SL7A 4JA9A 4O43A 5HKZA 2KFFA 1KSOA 1BF5A 2PALA 1JFKA 4GGFA 4ORBB 4NQGA 1X02A 1XFYO 5AEQA 2NCPA 3ICBA 2R2IA 4HRGA 4MVFA 2M49B 1NPQA 3VRPA 1YRTB 2FOTA 3SG2A 2P6BB 3EK7A 1JBAA 4A4BA 2OS8B 3QG5C 1CDLA 1QIWA 1OSAA 4BY5A 2GJUA 2Z72A 1WLZA 4WWLA 5IBWA 2JRFA 4ZX2A 1ZMZA 2KAXA 2LNKA 1TCOA 1KWOC 1CFCA 3NSKA 1FF1A 2BDXA 1EG3A 3CK2A 1NIWA 3DVMA 1KFXS 1U5IB 1RK9A 1SCMC 1XFVO 3DSDA 1S6IA 3IB7A 4H2GA 4ORCA 4JPZB 1CNPA 4HD0A 1NX1A 1NX2A 5I2LA 3VGOA 4YI8A 3C9FA 2NYLC 2LAPA 1SR6B 1CFPA 1FPWA 1IWQA 2Z1AA 1IGVA 2LVIA 1PRWA 1WDCB 2HF5A 3KF9A 4JWQA 4MSPA 3VRRA 1IQ3A 4IYPC 1RROA 5DKQA 4YKEA 3RM1A 1KK7Z 1WAO1 2P6BA 2BBMA 2K7DA 3THOB 1PALA 3IQOA 4WQ3A 3SIAA 1NWDA 3SJSA 1ZOTB 1K9PA 1K9UA 1CM4A 2KBMA 2JOGA 1RECA 2E30A 2Z06A 1OOJA 1R2UA 1YURA 2NPPC 1U5IA 2IE3C 1JC2A 1XFUO 3AUZA 1KFUS 1TNWA 5J3XA 2BL0B 2OTGB 4H1SA 4M0VA 1OI8A 1Z2WA 2ZNDA 2Q8UA 4ORAB 1TNQA 2SCPA 3OX6A 5AERA 2NCOA 3N5UA 1JK7A 1DJGA 1BLQA 2LANA 2GV5A 3JYFA 1B8LA 5HKWA 4D1EA 3C1VA 4HSZA 2MLFC 4ORCB 4HREE 5AXIA 1BMOA 5CSJA 4TUIA 1CB1A 5PALA 1XZWA 2KOTA 3CWGA 4C0LA 4V0VA 1B4CA 1RJVA 1YR5A 3DF0A 1Q80A 4MEWA 1DT7B 2QJCA 5C1VA 5FYXA 2BCAA 2Q91A 4QJ5B 2KI4B 2DOQA 2O60A 1W24A 2WCBA 3HX4A 2JQ6A 4YGBB 1KSMA 3H68A 2F3ZA 4H2IA 1QASA 1QV0A 3SG5A 1RFJA 1K90D 2YVTA 4O5GA 2F2OA 1SMGA 2I2RE 5HLOA 4GBAA 1BU3A 4NDDA 1SYMA 3AAKA 1B7TZ 4WQ2A 4ORAA 3MSEB 2F8PA 3KO0A 5KTYA 5DKNA 4V0WA 1NX0A 1TCOB 1AHRA 2KQ6A 1XK4A 1OIEA 3PFVA 1NP8A 1DGUA 3CGAA 3H69A 4N1GA 1ODBA 2D8NA 3BXKA 4I5LC 5INBA 1L2OC 4Q04A 1B8CA 1G5BA 1TN4A 5F3WA 2WDFA 5J28A 4DIRA 5I8NA 4M2OA 2EC6B 4WRIA 4QJ3B 1J7QA 1YX7A 3LK0A 3T1IA 2KI6D 5HPEA 1J7OA 2K2FA 3BUNB 2KAYA 2H61C 1BT6A 2LC5A 3LCPC 1J1DA 1XA5A 3CZTX 1XFZO 1Y1UA 3DF0B 4UT3A 2M7LA 3SG4A 4GGFC 1DJWA 1D1OA 1TTXA 3LL8B 1ALWA 2BCXA 2OPOA 4FTGA 1EL4A 5IOHA 1YUTA 3OX5A 2JT3A 4MZJA 3FWBA 1DF0A 1B9AA 2FJUB 3TUYB 1YRUB 2L4HA 1DJZA 1PVAA 2JOJA 1NCZA 2EGDA 3I5HC 3NXAA 3ZWHA 1EH2A 1W7IB 4ETOA 1QVIZ 2HQ8A 2CTNA 2K7CA 2BQ8X 5JJGA 2ZKMX 4YGEB 3PALA 1WRLA 2ZRSA 1B8RA 4F0ZA 1UHKA 3QRXA 2LUXA 2M3WA 5F6TA 4LTYA 3IVEA 4L9MA 1CMGA 1KK8B 1S3NA 4V0XA 3VRNA 1YVLA 1QLKA 1YUSA 1NYAA 4CPVA 5B8IB 2JU0A 4GPLB 2KKNA 1SW8A 2ZFDA 1YX8A 1JF0A 4DHLA 2LVVA 4PHNA 2QACA 2HPSA 2KBIA 3D10A 4AOMA 3TZ1A 3LL8A 4XYNA 1KQMB 1SRAA 1UF3A 4AQIA 1PULA 1V1FA 2LHIA 1QLSA 2MBXA 3JVTB 1ALVA 5HYDA 2O5GA 3DD4A 2JT0A 4PALA 1USHA 2NZ0A 1SU1A 4UT3B 1A75B 5GQQC 2LV7A 1AVSA 1JWDA 1MXEA 3FIAA 4ZVZA 1KBPA 2AMIA 2PRUA 3TS5C 4C0KA 2JWWA 2PSRA 1ZFSA 4USLA 4YI9A 4YGCB 2AUCA 1B1GA 1QFCA 1NSHA 4BY4A 1PK0D 2Y5IA 3BUWB 1H8BA 1CLLA 2Y1NA 4J6OA 2LP2A 1UHIA 1S36A 1QV1A 1SCVA 5AFPA 1S3MA 4CFQA 1MUXA 2NXQA 2ZRTA 2I94A 1S3PA 3THNA 4OV2A 1J7PA 4H1YP 3OHMB 2Y4QA 3I5FB 1EJ3A 1NX3A 1HP1A 4ICBA 1S5GY 1IJ6A 1SR6C 1GJYA 2KAVA 3TGHA 3ICFA 5JJTA 3SG7A 2HYOA 1PSBA 2CNPA 5D69A 3AKAA 4NDCA 2H2KA 1G4YR 3M0WA 3QFOA 5I2OA 1AP4A 2B1UA 1ZACA 4KBPA 1HO5A 1S26D 4U8DA 2LVKA 1OMDA 5KSZA 1CFFA 2WDDA 4YBHB 2ZBMA 3CLNA 4DUQA 1OE9B 1IKUA 3SG6A 3LK1A 1MWNA 2BCBA 2WCFA 3GVEA 3CR5X 4I5JA 1JSAA 1UURA 1M31A 3PN7C 4JQ0D 2F33A 4F0ZB 2MAZA 1S95A 3FGAC 3VROA 1HT9A 1KK7Y 4H2FA 3EKJA 3OB1B 2GGZA 1II7A 5B8IA 1KQVA 1NUBA 2LMVA 1QX7A 3IF7A 1G8IA 3O4YA 2H61A 1CDPA 1F4OA 1LXFC 2USHA 4DT2A 2QPTA 1AJ4A 1FW4A 1WRKA 4N5XA 4GNKB 3ZU0A 1C07A 1UHJA 2LVJA 3BUXB 3IB8A 4UWQA 4PE0A 1IRJA 4OVNF 4MZLA 3KHEA 4OR9B 4DRWA 4YGDB 4JA7A 1K9KA 1NNWA 4GUKA 2CXJA 4PE4A 1TOPA 1R6PA 1TRFA 3E3RA 2LLSA 1Y1AA 2VRGA 5JOLA 5BPJA 1A03A 1S8EA 1S5GZ 1OQPA 2LMTA 1T71A 1TNXA 2BECA 1L7ZA 1BOCA 4XPNA 2KI4C 3E7BA 2KSPA 1EXRA 1XFWO 2L2EA 5TNCA 1KCYA 1L2OB 1JUOA 1JFJA 2A4JA 4O4KA 1F70A 2WDCA 5HKYA 2M29A 3SIBA 2LMUA 3I5GC 4O24A 3GK2A 3EGGA 2M97A 2KDHA 1K94A 3BUMB 3O6BA 1C7WA 3DW8C 4NZVA 3DVJA 1TCFA 1XVJA 1M45A 3AAJA 1DJHA 1B7TY 2LHLA 3HCMA 2IAEC 2PVBA 4NDBA 5G08A 5JPFA 1F71A 1K2HA 3K21A 4GFTA 4ZCUA 4CLNA 3ZTVA 1RTP1 4I5LB 1IT6A 3V4YA 1S3LA 3HVQA 2LM5A 5CSFA 1A29A 1OMVA 2Y1MA 4FCXA 3DVKA 2LLUA 2O8GA 2ZN8A 5EQVA 1N0YA 1M46A 4HRHA 4YRUA 4MLWA 3RLZA 3LLEA 1PSRA 2A22A 4IL1A 2JNXA 1KFXL 2K61A 2LE9B 3PSNA 3TUYC 3PSOA 2ZN9A 1AUIB 2IE4C 2L5XB 3NSIA 1DVIA 2KNEA 5ER4X 4PHMA 2JULA 2JXCA 1F54A 3FWCA 1QTXA 1A4PA 2G9BA 3BQ3A 4N1FA 3SG3A 1IH0A 1OIDA 1QHWA 1Y1XA 3NSOA 3GK1A 1MQ1A 1DTLA 2K7OA 2M1KB 4I5NC 3RL3A 3A8RA 1QJTA 1M39A 3D0YB 3DVEA 4XJKB 2QFRA 2KI6C 3TDZA 2BE4A 3AKBA 2AHDA 1Z2XA 4LU9A 2BKIB 1YVHA 1CTRA 4MOYA 1JF2A 4GAOA 1CLBA 1KQMC 1XYDA 4PCWA 2G2BA 4MN0A 1A75A 1QVIY 1SL9A 3TDUA 2BE6A 3H60A 4OR9A 4P5OE 2BKHB 2WCEA 3JVTC 5DKRA 4C0JA 1DGVA 1S70A 1FBVA 3AV0A 1SPYA 3OB2B 3WHTB 2R17A 1F8HA 1F55A 3NSLA 2KFGA 2JTZA 4PE7A 4OKHA 1DJIA 4PHJA 1UHNA 2BBNA 4ZCVA 2K8MB 2KGBC 1XM7A 4CFRA 5KU1A 1MHOA 2KYCA 2LP3A 5K89A 1AUIA 1S6JA 3FS7A 3I5GB 3D0YA 1N2DA 1K95A 4ORBA 2F2PA 2L4IA 2FCDA 2OS8C 5ER5A 2K7BA 2JC2A 3H61A 3KBPA 2WOSA 2LUCA 1LVCD 2KFHA 1KWOB 2HY1A 4A4CA 2JNFA 2JXLA 1EG4A 4TNCA 1WLMA 3I5HB 2L51A 3GOFA 1SCMB 3RL5A 1ZUZA 1K96A 2L98A 1GGZA 1GGWA 1MF8A 4E68A 2L0PA 2CV9A 1MXLC 1RWYA 1DJYA 1QATA 3O2PA 5AANA 2QFPA 3TDIA 2MJWB 1UUSA 2HQWA 2M1UA 1AJ5A 2XMOA 1W7JB 1N65A 1CDNA 3K7WC 3WNXB 1J1EA 2JT8A 2M9GA 4UPGA 2BL0C 2OTGC 2SASA 1DJXA 1TNPA 3O78A 3BUOB 2O8AA 1TIZA 2ZNEA 4YGAA 1J7RA 2M8UA 1C7VA 1LINA 3CR2A 5CPVA 1XFXO 2PMYA 1QIVA 2IS9A 3E7AA 1QXPA 5D7FA 1WY9A 1Y6WA 2L50A 1HQVA 3CS1A 1KFUL 1K8UA 3RQZA 1CFDA 1BR4B 2WC8A 2EC6C 1VRKA 3CR4X 2WNDA 3H4SE 3JTDB 1AK8A 2KHNA 1SL8A 3H63A 3DSCA 3TS5B 4DS7A 4H2BA 1LKJA 2TN4A 1WARA 1S6CA 2F3YA 2MA2A 4OCIA 2ISDA 1NCYA 4MBEA 2HYPA 3C5WC 4FBQA 4DCKA 1A2XA 4PHKA 2K0JA 3CTNA 1HPUA 2WDEA 3K7VC 1MR8A 4Q7FA 1WRZA 3H64A 2MLEC 1SKTA 3H67A 2BCDA 2MHHA 4M2QA 3PSRA 3VRQA 2K2AA 3H66A 4GGNA 1UWOA 3A4UB 3QFKA 3I5FC 1UP5A 2EHBA 4MRYA 5GTUA 2V53A 2CBLA 1M63B 4G9JA 2LLTA 1XK4C 2KQYA 4LACC 4CIDA 4B2OA 3I5IB 2JTTA 2GGMA 2HETA 3P71C 1IQ5A 2JPTA 3QFNA 1UTEA 5HLVA 3EGHA 1BG1A 1CLMA 1PVBA 4MZKA 4UT2A 1CDMA 1FJMA 4P2YB 2E6WA 1F4QA 2Q4UA 1BJFA 1E8AA 4KKZA 2KGRA 3EK8A 2MRDA 2I18A 1MF8B 3GK4X 4M2PA 3WHUB 2I7AA 2PASA 1J55A 1QX2A 5JPEA 1LA3A 4R1EA 3KEVA 2M7NA 3PN7B 2CT9A 5I2QA 2RGIA 1BODA 1T70A 1XO5A 3QFMA 1Y0VH 1M63A 2JZIA 3H62B 1K93D 1H4BA 3RL4A 1SK6D 3BOWB 3JTDC 1FI6A 4MRXA 1CKKA 1SBJA 2NLNA 1NCXA 1OZSA 2LCPA 1YTZC 3PM8A 1S1EA 1CMFA 3PLFB 1QX5B 3WXAA 1WDCC 1U32A 3PATA 1FI5A 4XJKA 5CSIA 3KPXA 4QJ4B 4PDZA 2COLB 3EVVA 1DF0B 2KYFA 3IQQA 1IG5A 1GQMA 1V1GA 4DSYA 1G33A 4PE1A 1OZOA 2M0RA 3EVUA 4MOVA 3EK4A 1KK8C 1B47A
chains in the Genus database with same CATH superfamily
1IJ5A 1BR1B 2GTEA 1YUUA 3F45A 1SNLA 3L4LA 3EKHA 1V73A 3FLOA 1LA0A 4FQOA 5DNYA 3ZNIA 4AQJA 1QS7A 1SY9A 2AAOA 2YGUA 2NXFA 2CCMA 2WORA 3BOWA 3OP0A 4I5NB 1DMOA 2DFJA 4I5KA 2FCEA 3I5IC 2NYMC 3IVDA 4FBKA 5CSNA 4MP0A 4TUGA 3FE8A 1OMRA 1CM1A 4FBWA 1UHHA 2WC6A 3BYAA 1SL7A 3EVRA 4JA9A 4O43A 5HKZA 2KFFA 1KSOA 1BF5A 2PALA 1JFKA 4GGFA 4ORBB 5FI7A 4NQGA 1X02A 1XFYO 5AEQA 2NCPA 3ICBA 2R2IA 4HRGA 1TWOA 1DQEA 1NPQA 2M49B 4MVFA 1YRTB 1ORGA 2FOTA 3SG2A 3VRPA 2P6BB 3EK7A 1JBAA 4A4BA 2OS8B 3QG5C 1CDLA 1QIWA 1OSAA 4BY5A 2GJUA 2Z72A 1WLZA 4WWLA 5IBWA 2JRFA 4ZX2A 1ZMZA 2KAXA 2LNKA 3OBVA 1TCOA 1KWOC 1CFCA 3NSKA 1FF1A 3E0JA 2BDXA 1EG3A 3CK2A 1NIWA 3DVMA 1KFXS 1U5IB 1RK9A 1SCMC 1XFVO 3DSDA 1S6IA 3IB7A 5EL2A 4H2GA 3B86A 4ORCA 4JPZB 1CNPA 4HD0A 1NX1A 1NX2A 2PQLA 5I2LA 3VGOA 4YI8A 3C9FA 2NYLC 2LAPA 3S0EA 1SR6B 1CFPA 3QMEA 1FPWA 1IWQA 2Z1AA 1IGVA 2LVIA 1PRWA 1WDCB 2HF5A 3KF9A 4JWQA 4MSPA 3VRRA 1IQ3A 2DXNA 1RROA 4IYPC 5DKQA 4YKEA 3RM1A 1KK7Z 1WAO1 2P6BA 2BBMA 2K7DA 3SS5A 3THOB 1PALA 3IQOA 4WQ3A 3SIAA 1NWDA 3SJSA 1ZOTB 4PT1A 1K9PA 1K9UA 1CM4A 2KBMA 2P71A 1RECA 2E30A 2JOGA 1OOJA 1R2UA 1YURA 3O4XA 2NPPC 1U5IA 2IE3C 1JC2A 1XFUO 3AUZA 3EG5B 1KFUS 1TNWA 5J3XA 2BL0B 2OTGB 4H1SA 2FJYA 4M0VA 1OI8A 1Z2WA 4KYNA 2ZNDA 2Q8UA 4ORAB 1TNQA 2SCPA 3OX6A 5AERA 2NCOA 3N5UA 1JK7A 1DJGA 1BLQA 2LANA 2GV5A 3B7AA 3D76A 1B8LA 5HKWA 3JYFA 4D1EA 3C1VA 4HSZA 2MLFC 4ORCB 4HREE 1W9ZA 1BMOA 5CSJA 5AXIA 4TUIA 1CB1A 5PALA 1XZWA 2KOTA 3CWGA 3R1VA 4C0LA 4V0VA 1B4CA 1RJVA 1YR5A 3DF0A 1Q80A 4MEWA 1DT7B 2QJCA 5C1VA 5FYXA 2BCAA 2Q91A 4QJ5B 2KI4B 2DOQA 2O60A 2QEOA 3CYZA 2WCHA 1W24A 1IIOA 3L4AA 2WCBA 3HX4A 2BAPA 2JQ6A 1KSMA 4YGBB 2F3ZA 2WC5A 1QASA 1QV0A 3B87A 1RFJA 3SG5A 4H2IA 1K90D 1OOFA 2YVTA 4O5GA 2F2OA 1SMGA 2I2RE 5HLOA 4GBAA 1BU3A 4NDDA 1SYMA 3AAKA 1B7TZ 4WQ2A 5FI6A 4ORAA 3MSEB 2F8PA 3KO0A 5KTYA 5DKNA 4V0WA 1NX0A 1LS8A 1TCOB 2KLEA 1AHRA 1OOGA 2KQ6A 1XK4A 1OIEA 3PFVA 1NP8A 1DGUA 3CGAA 3H69A 4N1GA 1ODBA 2D8NA 3BXKA 4I5LC 5INBA 1L2OC 4Q04A 1B8CA 1G5BA 1TN4A 5F3WA 2WDFA 5J28A 4DIRA 5I8NA 4M2OA 4FQTA 2EC6B 2QEHA 4QJ3B 4WRIA 1J7QA 1YX7A 3LK0A 3T1IA 2KI6D 5HPEA 1J7OA 2K2FA 2P70A 3BUNB 2KAYA 2H61C 1BT6A 2LC5A 3LCPC 1J1DA 3CZ0A 1XA5A 3CZTX 1XFZO 1Y1UA 3DF0B 4UT3A 2M7LA 3SG4A 4GGFC 1DJWA 1D1OA 1TTXA 3LL8B 1ALWA 2BCXA 2OPOA 4FTGA 1EL4A 5IOHA 1YUTA 3OX5A 2JT3A 4MZJA 3FWBA 1DF0A 1B9AA 2FJUB 2QDIA 3TUYB 1YRUB 2L4HA 1DJZA 1PVAA 2JOJA 1NCZA 2EGDA 3I5HC 3NXAA 3ZWHA 1EH2A 1W7IB 4ETOA 1QVIZ 2HQ8A 2CTNA 5FI2A 2K7CA 2BQ8X 5JJGA 2ZKMX 4YGEB 3PALA 3UNWA 1WRLA 2ZRSA 1B8RA 4F0ZA 1UHKA 3QRXA 2H8VA 2LUXA 2M3WA 5F6TA 4LTYA 3IVEA 4L9MA 1CMGA 1KK8B 1S3NA 3D03A 4V0XA 3VRNA 1YVLA 1QLKA 1YUSA 1NYAA 4CPVA 5B8IB 2JU0A 4GPLB 2KKNA 1SW8A 2ZFDA 1YX8A 1JF0A 4DHLA 2LVVA 4PHNA 2QACA 2HPSA 2KBIA 3D10A 4AOMA 3TZ1A 3LL8A 4XYNA 1KQMB 2JPOA 1SRAA 1UF3A 4AQIA 3D74A 1PULA 1V1FA 2LHIA 1QLSA 2MBXA 3JVTB 1ALVA 5HYDA 2O5GA 3DD4A 2JT0A 4PALA 1USHA 2NZ0A 2QEVA 3BFHA 1SU1A 4UT3B 1A75B 5GQQC 2LV7A 1AVSA 1JWDA 1MXEA 3FIAA 4ZVZA 1KBPA 2AMIA 2PRUA 3TS5C 4C0KA 2JWWA 2PSRA 1ZFSA 4USLA 4YI9A 4YGCB 2AUCA 3S0BA 1B1GA 1QFCA 1NSHA 4BY4A 1PK0D 2Y5IA 3BUWB 1H8BA 3CZ2A 1CLLA 2Y1NA 4J6OA 2LP2A 1UHIA 1S36A 1QV1A 1SCVA 5AFPA 1S3MA 4CFQA 1MUXA 2NXQA 2ZRTA 2I94A 1S3PA 3THNA 4OV2A 1J7PA 4H1YP 3OHMB 2Y4QA 3I5FB 1EJ3A 1NX3A 1HP1A 4ICBA 1S5GY 1IJ6A 1SR6C 1GJYA 2KAVA 3TGHA 3ICFA 5JJTA 3K1EA 3SG7A 2HYOA 4JKTA 1PSBA 2CNPA 5D69A 3AKAA 4NDCA 2H2KA 1G4YR 3M0WA 3QFOA 5I2OA 1AP4A 2B1UA 1ZACA 4KBPA 1HO5A 1S26D 4U8DA 2ERBA 3BJHA 2LVKA 4F7FA 1OMDA 5KSZA 2L2CA 1CFFA 2WDDA 1C3ZA 4YBHB 2ZBMA 3CLNA 4DUQA 1OE9B 1IKUA 3SS4A 3SG6A 3LK1A 1MWNA 2BCBA 2WCFA 3GVEA 3NHIA 3CR5X 4I5JA 1JSAA 1UURA 1M31A 3PN7C 4JQ0D 2F33A 4F0ZB 2MAZA 1S95A 3FGAC 3VROA 1HT9A 1KK7Y 4H2FA 3EKJA 3OB1B 2GGZA 1II7A 5B8IA 1KQVA 1NUBA 2LMVA 1QX7A 3IF7A 1G8IA 3L47A 3O4YA 2H61A 1CDPA 1F4OA 1LXFC 2USHA 4DT2A 5D3OA 2QPTA 1AJ4A 1FW4A 1WRKA 3CABA 4N5XA 3DYEA 4GNKB 4IJ7A 2DXLA 3ZU0A 1C07A 1UHJA 2LVJA 3BUXB 3IB8A 4UWQA 4PE0A 3S0AA 1IRJA 4OVNF 3BFAA 4MZLA 3KHEA 4OR9B 4DRWA 4YGDB 4JA7A 1K9KA 1NNWA 4GUKA 2CXJA 4PE4A 1TOPA 2PYQA 1R6PA 3CDNA 1TRFA 3E3RA 2LLSA 1Y1AA 2VRGA 5JOLA 5BPJA 1A03A 1S8EA 1S5GZ 1OQPA 2LMTA 1T71A 1TNXA 2BECA 1L7ZA 1BOCA 4XPNA 2KI4C 3E7BA 2KSPA 1EXRA 3B88A 1XFWO 2L2EA 5TNCA 1SSEB 1KCYA 1L2OB 1JUOA 2WCJA 1JFJA 2A4JA 4O4KA 1F70A 2WDCA 5HKYA 3NHTA 2M29A 1C3YA 3SIBA 2LMUA 3I5GC 4O24A 3GK2A 3EGGA 2M97A 3S0GA 2KDHA 1K94A 3BUMB 3O6BA 1C7WA 3DW8C 4NZVA 3DVJA 1TCFA 1XVJA 1M45A 2WCLA 3R1PA 3AAJA 1DJHA 1B7TY 2LHLA 3HCMA 2IAEC 2PVBA 3D75A 4NDBA 5G08A 5JPFA 2ZOAA 1F71A 1K2HA 3K21A 4GFTA 4ZCUA 4CLNA 3ZTVA 1RTP1 4I5LB 1IT6A 3V4YA 1S3LA 3HVQA 2LM5A 5CSFA 1A29A 1OMVA 2Y1MA 4FCXA 3DVKA 2LLUA 2O8GA 2ZN8A 5EQVA 1N0YA 1M46A 2WCKA 4HRHA 4MLWA 3RLZA 3LLEA 1PSRA 4YRUA 2A22A 4IL1A 2JNXA 1KFXL 2K61A 2LE9B 1DELA 3TUYC 3PSNA 3PSOA 2ZN9A 1AUIB 2IE4C 2L5XB 3NSIA 1DVIA 2KNEA 5ER4X 4PHMA 3R1OA 1DC1A 2JULA 2JXCA 1F54A 3FWCA 1QTXA 1A4PA 2G9BA 3BQ3A 4N1FA 3SG3A 1IH0A 3Q8IA 1OIDA 2L5YA 1QHWA 1Y1XA 3NSOA 3GK1A 1MQ1A 1DTLA 2K7OA 2M1KB 4I5NC 3RL3A 3A8RA 1QJTA 1M39A 3D0YB 1P28A 3DVEA 3B6XA 4XJKB 2QFRA 2KI6C 3TDZA 2BE4A 3AKBA 2AHDA 1Z2XA 4LU9A 2BKIB 1GM0A 3BFBA 1YVHA 1CTRA 4MOYA 1JF2A 3V2LA 4GAOA 1CLBA 1KQMC 1XYDA 4PCWA 2G2BA 4MN0A 1A75A 1QVIY 1SL9A 3TDUA 2BE6A 3H60A 4OR9A 4P5OE 2BKHB 2WCEA 3JVTC 5DKRA 4C0JA 1DGVA 1S70A 1FBVA 3AV0A 1SPYA 3FE9A 3OB2B 4INXA 3WHTB 3CZ1A 1F8HA 1F55A 3NSLA 2R17A 2KFGA 2JTZA 4PE7A 4OKHA 1DJIA 4PHJA 1UHNA 2BBNA 2QEBA 2K8MB 2KGBC 4ZCVA 1OOHA 4CFRA 1XM7A 5KU1A 1MHOA 2KYCA 2LP3A 5K89A 1AUIA 1S6JA 3FS7A 3I5GB 3D0YA 1N2DA 1K95A 4ORBA 2F2PA 2L4IA 2FCDA 2OS8C 5ER5A 2K7BA 1QWVA 2JC2A 2BNXA 3H61A 3IVTA 3KBPA 2WOSA 2LUCA 1LVCD 2KFHA 1KWOB 2HY1A 4A4CA 2JNFA 2JXLA 1EG4A 4TNCA 1WLMA 2KPHA 2L51A 3GOFA 1SCMB 3I5HB 3RL5A 1ZUZA 1K96A 2L98A 1GGZA 1GGWA 1MF8A 4E68A 2L0PA 2CV9A 1MXLC 1RWYA 1DJYA 1QATA 3O2PA 5AANA 2QFPA 3TDIA 2MJWB 1UUSA 2HQWA 2M1UA 1AJ5A 2XMOA 1W7JB 1N65A 1CDNA 4INWA 3K7WC 3DXLA 3WNXB 1J1EA 2JT8A 2M9GA 4UPGA 2BL0C 2OTGC 2SASA 3PJIA 1DJXA 1TNPA 3O78A 3BUOB 3S0FA 2O8AA 1TIZA 2ZNEA 4YGAA 1J7RA 2M8UA 1C7VA 1LINA 3CR2A 5CPVA 1XFXO 2PMYA 3H68A 1QIVA 2IS9A 3E7AA 1QXPA 5D7FA 1WY9A 1Y6WA 2L50A 1HQVA 3CS1A 1KFUL 1K8UA 3RQZA 1CFDA 1BR4B 2WC8A 2EC6C 1VRKA 3CR4X 2WNDA 3H4SE 4OZDA 3S0DA 3JTDB 1AK8A 1OOIX 1SL8A 2KHNA 3H63A 3DSCA 3TS5B 4DS7A 4H2BA 1LKJA 2TN4A 3RZSA 1XFRA 1WARA 1S6CA 2F3YA 2KLDA 2MA2A 4OCIA 1T14A 2ISDA 1NCYA 4MBEA 2HYPA 3C5WC 4FBQA 4DCKA 1A2XA 4PHKA 2K0JA 3CTNA 1HPUA 4JD9A 3R72A 2WDEA 3K7VC 1MR8A 4Q7FA 1WRZA 3H64A 2MLEC 1SKTA 3D73A 3H67A 2BCDA 2MHHA 4M2QA 1TUJA 3PSRA 3VRQA 2K2AA 1Z2CB 4GGNA 1UWOA 3A4UB 3H66A 3QFKA 3I5FC 1UP5A 2EHBA 4MRYA 5GTUA 2V53A 5I94A 1OW4A 2CBLA 1M63B 4G9JA 2LLTA 1XK4C 2KQYA 1Z4HA 2ZO9B 4LACC 3FE6A 4CIDA 4B2OA 3I5IB 2JTTA 2GGMA 2HETA 3P71C 1IQ5A 2JPTA 3QFNA 1UTEA 5DICA 5HLVA 3EGHA 1BG1A 1CLMA 1PVBA 4MZKA 1TUZA 3SS3A 2WCMA 4UT2A 1CDMA 1FJMA 4P2YB 3D77A 2E6WA 1F4QA 2Q4UA 1BJFA 3NGVA 1E8AA 3OGNA 4KKZA 5HL1A 2KGRA 3EK8A 2MRDA 2I18A 1MF8B 3GK4X 4M2PA 3WHUB 2I7AA 2PASA 1J55A 1QX2A 5JPEA 1LA3A 3D78A 4R1EA 3KEVA 2M7NA 3PN7B 2CT9A 5I2QA 2RGIA 1BODA 3N7HA 2K60A 1T70A 1XO5A 3QFMA 1Y0VH 1M63A 2JZIA 2Z06A 1K93D 1H4BA 3H62B 3RL4A 1SK6D 2YEQA 3BOWB 3JTDC 1FI6A 3DY9A 4MRXA 1CKKA 1SBJA 2NLNA 1NCXA 1OZSA 2LCPA 1YTZC 3PM8A 1S1EA 1CMFA 3PLFB 3VB1A 1DEKA 1QX5B 3WXAA 1WDCC 1U32A 3PATA 1FI5A 3PM2A 4XJKA 5CSIA 3KPXA 4QJ4B 4PDZA 2COLB 3DZTA 3EVVA 1DF0B 2KYFA 3IQQA 1IG5A 1GQMA 1V1GA 4DSYA 1G33A 3UO9A 4PE1A 1OZOA 2M0RA 3EVUA 4MOVA 3EK4A 1KK8C 1B47A
chains in the Genus database with same CATH topology
1IJ5A 1BR1B 1YUUA 3F45A 1SNLA 3EKHA 1V73A 3FLOA 1LA0A 4FQOA 5DNYA 3ZNIA 4AQJA 1QS7A 1SY9A 2AAOA 2NXFA 2CCMA 2WORA 3BOWA 3OP0A 4I5NB 1DMOA 2DFJA 4I5KA 2FCEA 3I5IC 2NYMC 3IVDA 4FBKA 5CSNA 4MP0A 4TUGA 1OMRA 1CM1A 4FBWA 1UHHA 3BYAA 3EVRA 1SL7A 4JA9A 4O43A 5HKZA 2KFFA 1KSOA 1BF5A 2PALA 1JFKA 4GGFA 4ORBB 4NQGA 1X02A 1XFYO 5AEQA 2NCPA 3ICBA 2R2IA 4HRGA 4MVFA 2M49B 1NPQA 3VRPA 1YRTB 2FOTA 3SG2A 2P6BB 3EK7A 1JBAA 4A4BA 2OS8B 3QG5C 1CDLA 1QIWA 1OSAA 4BY5A 2GJUA 2Z72A 1WLZA 4WWLA 5IBWA 2JRFA 4ZX2A 1ZMZA 2KAXA 2LNKA 1TCOA 1KWOC 1CFCA 3NSKA 1FF1A 3E0JA 2BDXA 1EG3A 3CK2A 1NIWA 3DVMA 1KFXS 1U5IB 1RK9A 1SCMC 1XFVO 3DSDA 1S6IA 3IB7A 4H2GA 4ORCA 4JPZB 1CNPA 4HD0A 1NX1A 1NX2A 5I2LA 3VGOA 4YI8A 3C9FA 2NYLC 2LAPA 1SR6B 1CFPA 1FPWA 1IWQA 2Z1AA 1IGVA 2LVIA 1PRWA 1WDCB 2HF5A 3KF9A 4JWQA 4MSPA 3VRRA 1IQ3A 2DXNA 1RROA 4IYPC 5DKQA 4YKEA 3RM1A 1KK7Z 1WAO1 2P6BA 2BBMA 2K7DA 3THOB 1PALA 3IQOA 4WQ3A 3SIAA 1NWDA 3SJSA 1ZOTB 1K9PA 1K9UA 1CM4A 2KBMA 2JOGA 1RECA 2E30A 2Z06A 1OOJA 1R2UA 1YURA 2NPPC 1U5IA 2IE3C 1JC2A 1XFUO 3AUZA 1KFUS 1TNWA 5J3XA 2BL0B 2OTGB 4H1SA 4M0VA 1OI8A 1Z2WA 2ZNDA 2Q8UA 4ORAB 1TNQA 2SCPA 3OX6A 5AERA 2NCOA 3N5UA 1JK7A 1DJGA 1BLQA 2LANA 2GV5A 3JYFA 1B8LA 5HKWA 4D1EA 3C1VA 4HSZA 2MLFC 4ORCB 4HREE 5AXIA 1BMOA 5CSJA 4TUIA 1CB1A 5PALA 1XZWA 2KOTA 3CWGA 4C0LA 4V0VA 1B4CA 1RJVA 1YR5A 3DF0A 1Q80A 4MEWA 1DT7B 2QJCA 5C1VA 5FYXA 2BCAA 2Q91A 4QJ5B 2KI4B 2DOQA 2O60A 1W24A 2WCBA 3HX4A 2JQ6A 4YGBB 1KSMA 2DXLA 2F3ZA 3H68A 1QASA 1QV0A 3SG5A 1RFJA 4H2IA 1K90D 2YVTA 4O5GA 2F2OA 1SMGA 2I2RE 5HLOA 4GBAA 1BU3A 4NDDA 1SYMA 3AAKA 1B7TZ 4WQ2A 4ORAA 3MSEB 2F8PA 3KO0A 5KTYA 5DKNA 4V0WA 1NX0A 1TCOB 1AHRA 2KQ6A 1XK4A 1OIEA 3PFVA 1NP8A 1DGUA 3CGAA 3H69A 4N1GA 1ODBA 2D8NA 3BXKA 4I5LC 5INBA 1L2OC 4Q04A 1B8CA 1G5BA 1TN4A 5F3WA 2WDFA 5J28A 4DIRA 5I8NA 4M2OA 2EC6B 4WRIA 4QJ3B 1J7QA 1YX7A 3LK0A 3T1IA 2KI6D 5HPEA 1J7OA 2K2FA 3BUNB 2KAYA 2H61C 1BT6A 2LC5A 3LCPC 1J1DA 1XA5A 3CZTX 1XFZO 1Y1UA 3DF0B 4UT3A 2M7LA 3SG4A 4GGFC 1DJWA 1D1OA 1TTXA 3LL8B 1ALWA 2BCXA 2OPOA 4FTGA 1EL4A 5IOHA 1YUTA 3OX5A 2JT3A 4MZJA 3FWBA 1DF0A 1B9AA 2FJUB 3TUYB 1YRUB 2L4HA 1DJZA 1PVAA 2JOJA 1NCZA 2EGDA 3I5HC 3NXAA 3ZWHA 1EH2A 1W7IB 4ETOA 1QVIZ 2HQ8A 2CTNA 2K7CA 2BQ8X 5JJGA 2ZKMX 4YGEB 3PALA 1WRLA 2ZRSA 1B8RA 4F0ZA 1UHKA 3QRXA 2LUXA 2M3WA 5F6TA 4LTYA 3IVEA 4L9MA 1CMGA 1KK8B 1S3NA 3D03A 4V0XA 3VRNA 1YVLA 1QLKA 1YUSA 1NYAA 4CPVA 5B8IB 2JU0A 4GPLB 2KKNA 1SW8A 2ZFDA 1YX8A 1JF0A 4DHLA 2LVVA 4PHNA 2QACA 2HPSA 2KBIA 3D10A 4AOMA 3TZ1A 3LL8A 4XYNA 1KQMB 1SRAA 1UF3A 4AQIA 1PULA 1V1FA 2LHIA 1QLSA 2MBXA 3JVTB 1ALVA 5HYDA 2O5GA 3DD4A 2JT0A 4PALA 1USHA 2NZ0A 1SU1A 4UT3B 1A75B 5GQQC 2LV7A 1AVSA 1JWDA 1MXEA 3FIAA 4ZVZA 1KBPA 2AMIA 2PRUA 3TS5C 4C0KA 2JWWA 2PSRA 1ZFSA 4USLA 4YI9A 4YGCB 2AUCA 1B1GA 1QFCA 1NSHA 4BY4A 1PK0D 2Y5IA 3BUWB 1H8BA 1CLLA 2Y1NA 4J6OA 2LP2A 1UHIA 1S36A 1QV1A 1SCVA 5AFPA 1S3MA 4CFQA 1MUXA 2NXQA 2ZRTA 2I94A 1S3PA 3THNA 4OV2A 1J7PA 4H1YP 3OHMB 2Y4QA 3I5FB 1EJ3A 1NX3A 1HP1A 4ICBA 1S5GY 1IJ6A 1SR6C 1GJYA 2KAVA 3TGHA 3ICFA 5JJTA 3SG7A 2HYOA 1PSBA 2CNPA 5D69A 3AKAA 4NDCA 2H2KA 1G4YR 3M0WA 3QFOA 5I2OA 1AP4A 2B1UA 1ZACA 4KBPA 1HO5A 1S26D 4U8DA 2LVKA 1OMDA 5KSZA 1CFFA 2WDDA 4YBHB 2ZBMA 3CLNA 4DUQA 1OE9B 1IKUA 3SG6A 3LK1A 1MWNA 2BCBA 2WCFA 3GVEA 3CR5X 4I5JA 1JSAA 1UURA 1M31A 3PN7C 4JQ0D 2F33A 4F0ZB 2MAZA 1S95A 3FGAC 3VROA 1HT9A 1KK7Y 4H2FA 3EKJA 3OB1B 2GGZA 1II7A 5B8IA 1KQVA 1NUBA 2LMVA 1QX7A 3IF7A 1G8IA 3O4YA 2H61A 1CDPA 1F4OA 1LXFC 2USHA 4DT2A 2QPTA 1AJ4A 1FW4A 1WRKA 4N5XA 4GNKB 3ZU0A 1C07A 1UHJA 2LVJA 3BUXB 3IB8A 4UWQA 4PE0A 1IRJA 4OVNF 4MZLA 3KHEA 4OR9B 4DRWA 4YGDB 4JA7A 1K9KA 1NNWA 4GUKA 2CXJA 4PE4A 1TOPA 1R6PA 1TRFA 3E3RA 2LLSA 1Y1AA 2VRGA 5JOLA 5BPJA 1A03A 1S8EA 1S5GZ 1OQPA 2LMTA 1T71A 1TNXA 2BECA 1L7ZA 1BOCA 4XPNA 2KI4C 3E7BA 2KSPA 1EXRA 1XFWO 2L2EA 5TNCA 1KCYA 1L2OB 1JUOA 1JFJA 2A4JA 4O4KA 1F70A 2WDCA 5HKYA 2M29A 3SIBA 2LMUA 3I5GC 4O24A 3GK2A 3EGGA 2M97A 2KDHA 1K94A 3BUMB 3O6BA 1C7WA 3DW8C 4NZVA 3DVJA 1TCFA 1XVJA 1M45A 3AAJA 1DJHA 1B7TY 2LHLA 3HCMA 2IAEC 2PVBA 4NDBA 5G08A 5JPFA 2ZOAA 1F71A 1K2HA 3K21A 4GFTA 4ZCUA 4CLNA 3ZTVA 1RTP1 4I5LB 1IT6A 3V4YA 1S3LA 3HVQA 2LM5A 5CSFA 1A29A 1OMVA 2Y1MA 4FCXA 3DVKA 2LLUA 2O8GA 2ZN8A 5EQVA 1N0YA 1M46A 4HRHA 4YRUA 4MLWA 3RLZA 3LLEA 1PSRA 2A22A 4IL1A 2JNXA 1KFXL 2K61A 2LE9B 3PSNA 3TUYC 3PSOA 2ZN9A 1AUIB 2IE4C 2L5XB 3NSIA 1DVIA 2KNEA 5ER4X 4PHMA 2JULA 2JXCA 1F54A 3FWCA 1QTXA 1A4PA 2G9BA 3BQ3A 4N1FA 3SG3A 1IH0A 1OIDA 1QHWA 1Y1XA 3NSOA 3GK1A 1MQ1A 1DTLA 2K7OA 2M1KB 4I5NC 3RL3A 3A8RA 1QJTA 1M39A 3D0YB 3DVEA 4XJKB 2QFRA 2KI6C 3TDZA 2BE4A 3AKBA 2AHDA 1Z2XA 4LU9A 2BKIB 1YVHA 1CTRA 4MOYA 1JF2A 4GAOA 1CLBA 1KQMC 1XYDA 4PCWA 2G2BA 4MN0A 1A75A 1QVIY 1SL9A 3TDUA 2BE6A 3H60A 4OR9A 4P5OE 2BKHB 2WCEA 3JVTC 5DKRA 4C0JA 1DGVA 1S70A 1FBVA 3AV0A 1SPYA 3OB2B 3WHTB 2R17A 1F8HA 1F55A 3NSLA 2KFGA 2JTZA 4PE7A 4OKHA 1DJIA 4PHJA 1UHNA 2BBNA 4ZCVA 2K8MB 2KGBC 1XM7A 4CFRA 5KU1A 1MHOA 2KYCA 2LP3A 5K89A 1AUIA 1S6JA 3FS7A 3I5GB 3D0YA 1N2DA 1K95A 4ORBA 2F2PA 2L4IA 2FCDA 2OS8C 5ER5A 2K7BA 2JC2A 3H61A 3KBPA 2WOSA 2LUCA 1LVCD 2KFHA 1KWOB 2HY1A 4A4CA 2JNFA 2JXLA 1EG4A 4TNCA 1WLMA 3I5HB 2L51A 3GOFA 1SCMB 3RL5A 1ZUZA 1K96A 2L98A 1GGZA 1GGWA 1MF8A 4E68A 2L0PA 2CV9A 1MXLC 1RWYA 1DJYA 1QATA 3O2PA 5AANA 2QFPA 3TDIA 2MJWB 1UUSA 2HQWA 2M1UA 1AJ5A 2XMOA 1W7JB 1N65A 1CDNA 3K7WC 3WNXB 1J1EA 2JT8A 2M9GA 4UPGA 2BL0C 2OTGC 2SASA 1DJXA 1TNPA 3O78A 3BUOB 2O8AA 1TIZA 2ZNEA 4YGAA 1J7RA 2M8UA 1C7VA 1LINA 3CR2A 5CPVA 1XFXO 2PMYA 1QIVA 2IS9A 3E7AA 1QXPA 5D7FA 1WY9A 1Y6WA 2L50A 1HQVA 3CS1A 1KFUL 1K8UA 3RQZA 1CFDA 1BR4B 2WC8A 2EC6C 1VRKA 3CR4X 2WNDA 3H4SE 3JTDB 1AK8A 2KHNA 1SL8A 3H63A 3DSCA 3TS5B 4DS7A 4H2BA 1LKJA 2TN4A 1WARA 1S6CA 2F3YA 2MA2A 4OCIA 2ISDA 1NCYA 4MBEA 2HYPA 3C5WC 4FBQA 4DCKA 1A2XA 4PHKA 2K0JA 3CTNA 1HPUA 2WDEA 3K7VC 1MR8A 4Q7FA 1WRZA 3H64A 2MLEC 1SKTA 3H67A 2BCDA 2MHHA 4M2QA 3PSRA 3VRQA 2K2AA 3H66A 4GGNA 1UWOA 3A4UB 3QFKA 3I5FC 1UP5A 2EHBA 4MRYA 5GTUA 2V53A 2CBLA 1M63B 4G9JA 2LLTA 1XK4C 2KQYA 2ZO9B 4LACC 4CIDA 4B2OA 3I5IB 2JTTA 2GGMA 2HETA 3P71C 1IQ5A 2JPTA 3QFNA 1UTEA 5HLVA 3EGHA 1BG1A 1CLMA 1PVBA 4MZKA 4UT2A 1CDMA 1FJMA 4P2YB 2E6WA 1F4QA 2Q4UA 1BJFA 1E8AA 4KKZA 2KGRA 3EK8A 2MRDA 2I18A 1MF8B 3GK4X 4M2PA 3WHUB 2I7AA 2PASA 1J55A 1QX2A 5JPEA 1LA3A 4R1EA 3KEVA 2M7NA 3PN7B 2CT9A 5I2QA 2RGIA 1BODA 1T70A 1XO5A 3QFMA 1Y0VH 1M63A 2JZIA 3H62B 1K93D 1H4BA 3RL4A 1SK6D 2YEQA 3BOWB 3JTDC 1FI6A 4MRXA 1CKKA 1SBJA 2NLNA 1NCXA 1OZSA 2LCPA 1YTZC 3PM8A 1S1EA 1CMFA 3PLFB 1QX5B 3WXAA 1WDCC 1U32A 3PATA 1FI5A 4XJKA 5CSIA 3KPXA 4QJ4B 4PDZA 2COLB 3EVVA 1DF0B 2KYFA 3IQQA 1IG5A 1GQMA 1V1GA 4DSYA 1G33A 4PE1A 1OZOA 2M0RA 3EVUA 4MOVA 3EK4A 1KK8C 1B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  1BR1 B;  1YUU A;  3F45 A;  1SNL A;  3EKH A;  1V73 A;  5DNY A;  1LA0 A;  4FQO A;  3ZNI A;  4AQJ A;  1QS7 A;  1SY9 A;  2AAO A;  2NXF A;  2CCM A;  2WOR A;  3BOW A;  3OP0 A;  4I5N B;  1DMO A;  2DFJ A;  4I5K A;  2FCE A;  3I5I C;  2NYM C;  3IVD A;  4FBK A;  5CSN A;  4MP0 A;  4TUG A;  1OMR A;  1CM1 A;  4FBW A;  1UHH A;  3BYA A;  3EVR A;  1SL7 A;  4JA9 A;  4O43 A;  5HKZ A;  2KFF A;  1KSO A;  1BF5 A;  2PAL A;  1JFK A;  4GGF A;  4ORB B;  4NQG A;  1X02 A;  1XFY O;  5AEQ A;  2NCP A;  3ICB A;  2R2I A;  4HRG A;  4MVF A;  2M49 B;  1NPQ A;  3VRP A;  1YRT B;  2FOT A;  3SG2 A;  2P6B B;  3EK7 A;  1JBA A;  4A4B A;  2OS8 B;  3QG5 C;  1CDL A;  1QIW A;  1OSA A;  4BY5 A;  2GJU A;  2Z72 A;  1WLZ A;  4WWL A;  5IBW A;  2JRF A;  4ZX2 A;  1ZMZ A;  2KAX A;  2LNK A;  1TCO A;  1KWO C;  1CFC A;  3NSK A;  1FF1 A;  2BDX A;  1EG3 A;  3CK2 A;  1NIW A;  3DVM A;  1KFX S;  1U5I B;  1RK9 A;  1SCM C;  1XFV O;  3DSD A;  1S6I A;  3IB7 A;  4H2G A;  4ORC A;  4JPZ B;  1CNP A;  4HD0 A;  1NX1 A;  1NX2 A;  5I2L A;  3VGO A;  4YI8 A;  3C9F A;  2NYL C;  2LAP A;  1SR6 B;  1CFP A;  1FPW A;  1IWQ A;  2Z1A A;  1IGV A;  2LVI A;  1PRW A;  1WDC B;  2HF5 A;  3KF9 A;  4JWQ A;  4MSP A;  3VRR A;  1IQ3 A;  4IYP C;  1RRO A;  5DKQ A;  4YKE A;  3RM1 A;  1KK7 Z;  1WAO 1;  2P6B A;  2BBM A;  2K7D A;  3THO B;  1PAL A;  3IQO A;  4WQ3 A;  3SIA A;  1NWD A;  3SJS A;  1ZOT B;  1K9P A;  1K9U A;  1CM4 A;  2KBM A;  2JOG A;  1REC A;  2E30 A;  2Z06 A;  1OOJ A;  1R2U A;  1YUR A;  2NPP C;  1U5I A;  2IE3 C;  1JC2 A;  1XFU O;  3AUZ A;  1KFU S;  1TNW A;  5J3X A;  2BL0 B;  2OTG B;  4H1S A;  4M0V A;  1OI8 A;  1Z2W A;  2ZND A;  2Q8U A;  4ORA B;  1TNQ A;  2SCP A;  3OX6 A;  5AER A;  2NCO A;  3N5U A;  1JK7 A;  1DJG A;  1BLQ A;  2LAN A;  2GV5 A;  3JYF A;  1B8L A;  5HKW A;  4D1E A;  3C1V A;  4HSZ A;  2MLF C;  4ORC B;  4HRE E;  5AXI A;  1BMO A;  5CSJ A;  4TUI A;  1CB1 A;  5PAL A;  1XZW A;  2KOT A;  3CWG A;  4C0L A;  4V0V A;  1B4C A;  1RJV A;  1YR5 A;  3DF0 A;  1Q80 A;  4MEW A;  1DT7 B;  2QJC A;  5C1V A;  5FYX A;  2BCA A;  2Q91 A;  4QJ5 B;  2KI4 B;  2DOQ A;  2O60 A;  1W24 A;  2WCB A;  3HX4 A;  2JQ6 A;  4YGB B;  1KSM A;  3H68 A;  2F3Z A;  4H2I A;  1QAS A;  1QV0 A;  3SG5 A;  1RFJ A;  1K90 D;  2YVT A;  4O5G A;  2F2O A;  1SMG A;  2I2R E;  5HLO A;  4GBA A;  1BU3 A;  4NDD A;  1SYM A;  3AAK A;  1B7T Z;  4WQ2 A;  4ORA A;  3MSE B;  2F8P A;  3KO0 A;  5KTY A;  5DKN A;  4V0W A;  1NX0 A;  1TCO B;  1AHR A;  2KQ6 A;  1XK4 A;  1OIE A;  3PFV A;  1NP8 A;  1DGU A;  3CGA A;  3H69 A;  4N1G A;  1ODB A;  2D8N A;  3BXK A;  4I5L C;  5INB A;  1L2O C;  4Q04 A;  1B8C A;  1G5B A;  1TN4 A;  5F3W A;  2WDF A;  5J28 A;  4DIR A;  5I8N A;  4M2O A;  2EC6 B;  4WRI A;  4QJ3 B;  1J7Q A;  1YX7 A;  3LK0 A;  3T1I A;  2KI6 D;  5HPE A;  1J7O A;  2K2F A;  3BUN B;  2KAY A;  2H61 C;  1BT6 A;  2LC5 A;  3LCP C;  1J1D A;  1XA5 A;  3CZT X;  1XFZ O;  1Y1U A;  3DF0 B;  4UT3 A;  2M7L A;  3SG4 A;  4GGF C;  1DJW A;  1D1O A;  1TTX A;  3LL8 B;  1ALW A;  2BCX A;  2OPO A;  4FTG A;  1EL4 A;  5IOH A;  1YUT A;  3OX5 A;  2JT3 A;  4MZJ A;  3FWB A;  1DF0 A;  1B9A A;  2FJU B;  3TUY B;  1YRU B;  2L4H A;  1DJZ A;  1PVA A;  2JOJ A;  1NCZ A;  2EGD A;  3I5H C;  3NXA A;  3ZWH A;  1EH2 A;  1W7I B;  4ETO A;  1QVI Z;  2HQ8 A;  2CTN A;  2K7C A;  2BQ8 X;  5JJG A;  2ZKM X;  4YGE B;  3PAL A;  1WRL A;  2ZRS A;  1B8R A;  4F0Z A;  1UHK A;  3QRX A;  2LUX A;  2M3W A;  5F6T A;  4LTY A;  3IVE A;  4L9M A;  1CMG A;  1KK8 B;  1S3N A;  4V0X A;  3VRN A;  1YVL A;  1QLK A;  1YUS A;  1NYA A;  4CPV A;  5B8I B;  2JU0 A;  4GPL B;  2KKN A;  1SW8 A;  2ZFD A;  1YX8 A;  1JF0 A;  4DHL A;  2LVV A;  4PHN A;  2QAC A;  2HPS A;  2KBI A;  3D10 A;  4AOM A;  3TZ1 A;  3LL8 A;  4XYN A;  1KQM B;  1SRA A;  1UF3 A;  4AQI A;  1PUL A;  1V1F A;  2LHI A;  1QLS A;  2MBX A;  3JVT B;  1ALV A;  5HYD A;  2O5G A;  3DD4 A;  2JT0 A;  4PAL A;  1USH A;  2NZ0 A;  1SU1 A;  4UT3 B;  1A75 B;  5GQQ C;  2LV7 A;  1AVS A;  1JWD A;  1MXE A;  3FIA A;  4ZVZ A;  1KBP A;  2AMI A;  2PRU A;  3TS5 C;  4C0K A;  2JWW A;  2PSR A;  1ZFS A;  4USL A;  4YI9 A;  4YGC B;  2AUC A;  1B1G A;  1QFC A;  1NSH A;  4BY4 A;  1PK0 D;  2Y5I A;  3BUW B;  1H8B A;  1CLL A;  2Y1N A;  4J6O A;  2LP2 A;  1UHI A;  1S36 A;  1QV1 A;  1SCV A;  5AFP A;  1S3M A;  4CFQ A;  1MUX A;  2NXQ A;  2ZRT A;  2I94 A;  1S3P A;  3THN A;  4OV2 A;  1J7P A;  4H1Y P;  3OHM B;  2Y4Q A;  3I5F B;  1EJ3 A;  1NX3 A;  1HP1 A;  4ICB A;  1S5G Y;  1IJ6 A;  1SR6 C;  1GJY A;  2KAV A;  3TGH A;  3ICF A;  5JJT A;  3SG7 A;  2HYO A;  1PSB A;  2CNP A;  5D69 A;  3AKA A;  4NDC A;  2H2K A;  1G4Y R;  3M0W A;  3QFO A;  5I2O A;  1AP4 A;  2B1U A;  1ZAC A;  4KBP A;  1HO5 A;  1S26 D;  4U8D A;  2LVK A;  1OMD A;  5KSZ A;  1CFF A;  2WDD A;  4YBH B;  2ZBM A;  3CLN A;  4DUQ A;  1OE9 B;  1IKU A;  3SG6 A;  3LK1 A;  1MWN A;  2BCB A;  2WCF A;  3GVE A;  3CR5 X;  4I5J A;  1JSA A;  1UUR A;  1M31 A;  3PN7 C;  4JQ0 D;  2F33 A;  4F0Z B;  2MAZ A;  1S95 A;  3FGA C;  3VRO A;  1HT9 A;  1KK7 Y;  4H2F A;  3EKJ A;  3OB1 B;  2GGZ A;  1II7 A;  5B8I A;  1KQV A;  1NUB A;  2LMV A;  1QX7 A;  3IF7 A;  1G8I A;  3O4Y A;  2H61 A;  1CDP A;  1F4O A;  1LXF C;  2USH A;  4DT2 A;  2QPT A;  1AJ4 A;  1FW4 A;  1WRK A;  4N5X A;  4GNK B;  3ZU0 A;  1C07 A;  1UHJ A;  2LVJ A;  3BUX B;  3IB8 A;  4UWQ A;  4PE0 A;  1IRJ A;  4OVN F;  4MZL A;  3KHE A;  4OR9 B;  4DRW A;  4YGD B;  4JA7 A;  1K9K A;  1NNW A;  4GUK A;  2CXJ A;  4PE4 A;  1TOP A;  1R6P A;  1TRF A;  3E3R A;  2LLS A;  1Y1A A;  2VRG A;  5JOL A;  5BPJ A;  1A03 A;  1S8E A;  1S5G Z;  1OQP A;  2LMT A;  1T71 A;  1TNX A;  2BEC A;  1L7Z A;  1BOC A;  4XPN A;  2KI4 C;  3E7B A;  2KSP A;  1EXR A;  1XFW O;  2L2E A;  5TNC A;  1KCY A;  1L2O B;  1JUO A;  1JFJ A;  2A4J A;  4O4K A;  1F70 A;  2WDC A;  5HKY A;  2M29 A;  3SIB A;  2LMU A;  3I5G C;  4O24 A;  3GK2 A;  3EGG A;  2M97 A;  2KDH A;  1K94 A;  3BUM B;  3O6B A;  1C7W A;  3DW8 C;  4NZV A;  3DVJ A;  1TCF A;  1XVJ A;  1M45 A;  3AAJ A;  1DJH A;  1B7T Y;  2LHL A;  3HCM A;  2IAE C;  2PVB A;  4NDB A;  5G08 A;  5JPF A;  1F71 A;  1K2H A;  3K21 A;  4GFT A;  4ZCU A;  4CLN A;  3ZTV A;  1RTP 1;  4I5L B;  1IT6 A;  3V4Y A;  1S3L A;  3HVQ A;  2LM5 A;  5CSF A;  1A29 A;  1OMV A;  2Y1M A;  4FCX A;  3DVK A;  2LLU A;  2O8G A;  2ZN8 A;  5EQV A;  1N0Y A;  1M46 A;  4HRH A;  4YRU A;  4MLW A;  3RLZ A;  3LLE A;  1PSR A;  2A22 A;  4IL1 A;  2JNX A;  1KFX L;  2K61 A;  2LE9 B;  3PSN A;  3TUY C;  3PSO A;  2ZN9 A;  1AUI B;  2IE4 C;  2L5X B;  3NSI A;  1DVI A;  2KNE A;  5ER4 X;  4PHM A;  2JUL A;  2JXC A;  1F54 A;  3FWC A;  1QTX A;  1A4P A;  2G9B A;  3BQ3 A;  4N1F A;  3SG3 A;  1IH0 A;  1OID A;  1QHW A;  1Y1X A;  3NSO A;  3GK1 A;  1MQ1 A;  1DTL A;  2K7O A;  2M1K B;  4I5N C;  3RL3 A;  3A8R A;  1QJT A;  1M39 A;  3D0Y B;  3DVE A;  4XJK B;  2QFR A;  2KI6 C;  3TDZ A;  2BE4 A;  3AKB A;  2AHD A;  1Z2X A;  4LU9 A;  2BKI B;  1YVH A;  1CTR A;  4MOY A;  1JF2 A;  4GAO A;  1CLB A;  1KQM C;  1XYD A;  4PCW A;  2G2B A;  4MN0 A;  1A75 A;  1QVI Y;  1SL9 A;  3TDU A;  2BE6 A;  3H60 A;  4OR9 A;  4P5O E;  2BKH B;  2WCE A;  3JVT C;  5DKR A;  4C0J A;  1DGV A;  1S70 A;  1FBV A;  3AV0 A;  1SPY A;  3OB2 B;  3WHT B;  2R17 A;  1F8H A;  1F55 A;  3NSL A;  2KFG A;  2JTZ A;  4PE7 A;  4OKH A;  1DJI A;  4PHJ A;  1UHN A;  2BBN A;  4ZCV A;  2K8M B;  2KGB C;  1XM7 A;  4CFR A;  5KU1 A;  1MHO A;  2KYC A;  2LP3 A;  5K89 A;  1AUI A;  1S6J A;  3FS7 A;  3I5G B;  3D0Y A;  1N2D A;  1K95 A;  4ORB A;  2F2P A;  2L4I A;  2FCD A;  2OS8 C;  5ER5 A;  2K7B A;  2JC2 A;  3H61 A;  3KBP A;  2WOS A;  2LUC A;  1LVC D;  2KFH A;  1KWO B;  2HY1 A;  4A4C A;  2JNF A;  2JXL A;  1EG4 A;  4TNC A;  1WLM A;  3I5H B;  2L51 A;  3GOF A;  1SCM B;  3RL5 A;  1ZUZ A;  1K96 A;  2L98 A;  1GGZ A;  1GGW A;  1MF8 A;  4E68 A;  2L0P A;  2CV9 A;  1MXL C;  1RWY A;  1DJY A;  1QAT A;  3O2P A;  5AAN A;  2QFP A;  3TDI A;  2MJW B;  1UUS A;  2HQW A;  2M1U A;  1AJ5 A;  2XMO A;  1W7J B;  1N65 A;  1CDN A;  3K7W C;  3WNX B;  1J1E A;  2JT8 A;  2M9G A;  4UPG A;  2BL0 C;  2OTG C;  2SAS A;  1DJX A;  1TNP A;  3O78 A;  3BUO B;  2O8A A;  1TIZ A;  2ZNE A;  4YGA A;  1J7R A;  2M8U A;  1C7V A;  1LIN A;  3CR2 A;  5CPV A;  1XFX O;  2PMY A;  1QIV A;  2IS9 A;  3E7A A;  1QXP A;  5D7F A;  1WY9 A;  1Y6W A;  2L50 A;  1HQV A;  3CS1 A;  1KFU L;  1K8U A;  3RQZ A;  1CFD A;  1BR4 B;  2WC8 A;  2EC6 C;  1VRK A;  3CR4 X;  2WND A;  3H4S E;  3JTD B;  1AK8 A;  2KHN A;  1SL8 A;  3H63 A;  3DSC A;  3TS5 B;  4DS7 A;  4H2B A;  1LKJ A;  2TN4 A;  1WAR A;  1S6C A;  2F3Y A;  2MA2 A;  4OCI A;  2ISD A;  1NCY A;  4MBE A;  2HYP A;  3C5W C;  4FBQ A;  4DCK A;  1A2X A;  4PHK A;  2K0J A;  3CTN A;  1HPU A;  2WDE A;  3K7V C;  1MR8 A;  4Q7F A;  1WRZ A;  3H64 A;  2MLE C;  1SKT A;  3H67 A;  2BCD A;  2MHH A;  4M2Q A;  3PSR A;  3VRQ A;  2K2A A;  3H66 A;  4GGN A;  1UWO A;  3A4U B;  3QFK A;  3I5F C;  1UP5 A;  2EHB A;  4MRY A;  5GTU A;  2V53 A;  2CBL A;  1M63 B;  4G9J A;  2LLT A;  1XK4 C;  2KQY A;  4LAC C;  4CID A;  4B2O A;  3I5I B;  2JTT A;  2GGM A;  2HET A;  3P71 C;  1IQ5 A;  2JPT A;  3QFN A;  1UTE A;  5HLV A;  3EGH A;  1BG1 A;  1CLM A;  1PVB A;  4MZK A;  4UT2 A;  1CDM A;  1FJM A;  4P2Y B;  2E6W A;  1F4Q A;  2Q4U A;  1BJF A;  1E8A A;  4KKZ A;  2KGR A;  3EK8 A;  2MRD A;  2I18 A;  1MF8 B;  3GK4 X;  4M2P A;  3WHU B;  2I7A A;  2PAS A;  1J55 A;  1QX2 A;  5JPE A;  1LA3 A;  4R1E A;  3KEV A;  2M7N A;  3PN7 B;  2CT9 A;  5I2Q A;  2RGI A;  1BOD A;  1T70 A;  1XO5 A;  3QFM A;  1Y0V H;  1M63 A;  2JZI A;  3H62 B;  1K93 D;  1H4B A;  3RL4 A;  1SK6 D;  3BOW B;  3JTD C;  1FI6 A;  4MRX A;  1CKK A;  1SBJ A;  2NLN A;  1NCX A;  1OZS A;  2LCP A;  1YTZ C;  3PM8 A;  1S1E A;  1CMF A;  3PLF B;  1QX5 B;  3WXA A;  1WDC C;  1U32 A;  3PAT A;  1FI5 A;  4XJK A;  5CSI A;  3KPX A;  4QJ4 B;  4PDZ A;  2COL B;  3EVV A;  1DF0 B;  2KYF A;  3IQQ A;  1IG5 A;  1GQM A;  1V1G A;  4DSY A;  1G33 A;  4PE1 A;  1OZO A;  2M0R A;  3EVU A;  4MOV A;  3EK4 A;  1KK8 C;  1B47 A; 
#chains in the Genus database with same CATH topology
 1IJ5 A;  1BR1 B;  2GTE A;  1YUU A;  3F45 A;  1SNL A;  3L4L A;  3EKH A;  1V73 A;  3FLO A;  1LA0 A;  4FQO A;  5DNY A;  3ZNI A;  4AQJ A;  1QS7 A;  1SY9 A;  2AAO A;  2YGU A;  2NXF A;  2CCM A;  2WOR A;  3BOW A;  3OP0 A;  4I5N B;  1DMO A;  2DFJ A;  4I5K A;  2FCE A;  3I5I C;  2NYM C;  3IVD A;  4FBK A;  5CSN A;  4MP0 A;  4TUG A;  3FE8 A;  1OMR A;  1CM1 A;  4FBW A;  1UHH A;  2WC6 A;  3BYA A;  1SL7 A;  3EVR A;  4JA9 A;  4O43 A;  5HKZ A;  2KFF A;  1KSO A;  1BF5 A;  2PAL A;  1JFK A;  4GGF A;  4ORB B;  5FI7 A;  4NQG A;  1X02 A;  1XFY O;  5AEQ A;  2NCP A;  3ICB A;  2R2I A;  4HRG A;  1TWO A;  1DQE A;  1NPQ A;  2M49 B;  4MVF A;  1YRT B;  1ORG A;  2FOT A;  3SG2 A;  3VRP A;  2P6B B;  3EK7 A;  1JBA A;  4A4B A;  2OS8 B;  3QG5 C;  1CDL A;  1QIW A;  1OSA A;  4BY5 A;  2GJU A;  2Z72 A;  1WLZ A;  4WWL A;  5IBW A;  2JRF A;  4ZX2 A;  1ZMZ A;  2KAX A;  2LNK A;  3OBV A;  1TCO A;  1KWO C;  1CFC A;  3NSK A;  1FF1 A;  3E0J A;  2BDX A;  1EG3 A;  3CK2 A;  1NIW A;  3DVM A;  1KFX S;  1U5I B;  1RK9 A;  1SCM C;  1XFV O;  3DSD A;  1S6I A;  3IB7 A;  5EL2 A;  4H2G A;  3B86 A;  4ORC A;  4JPZ B;  1CNP A;  4HD0 A;  1NX1 A;  1NX2 A;  2PQL A;  5I2L A;  3VGO A;  4YI8 A;  3C9F A;  2NYL C;  2LAP A;  3S0E A;  1SR6 B;  1CFP A;  3QME A;  1FPW A;  1IWQ A;  2Z1A A;  1IGV A;  2LVI A;  1PRW A;  1WDC B;  2HF5 A;  3KF9 A;  4JWQ A;  4MSP A;  3VRR A;  1IQ3 A;  2DXN A;  1RRO A;  4IYP C;  5DKQ A;  4YKE A;  3RM1 A;  1KK7 Z;  1WAO 1;  2P6B A;  2BBM A;  2K7D A;  3SS5 A;  3THO B;  1PAL A;  3IQO A;  4WQ3 A;  3SIA A;  1NWD A;  3SJS A;  1ZOT B;  4PT1 A;  1K9P A;  1K9U A;  1CM4 A;  2KBM A;  2P71 A;  1REC A;  2E30 A;  2JOG A;  1OOJ A;  1R2U A;  1YUR A;  3O4X A;  2NPP C;  1U5I A;  2IE3 C;  1JC2 A;  1XFU O;  3AUZ A;  3EG5 B;  1KFU S;  1TNW A;  5J3X A;  2BL0 B;  2OTG B;  4H1S A;  2FJY A;  4M0V A;  1OI8 A;  1Z2W A;  4KYN A;  2ZND A;  2Q8U A;  4ORA B;  1TNQ A;  2SCP A;  3OX6 A;  5AER A;  2NCO A;  3N5U A;  1JK7 A;  1DJG A;  1BLQ A;  2LAN A;  2GV5 A;  3B7A A;  3D76 A;  1B8L A;  5HKW A;  3JYF A;  4D1E A;  3C1V A;  4HSZ A;  2MLF C;  4ORC B;  4HRE E;  1W9Z A;  1BMO A;  5CSJ A;  5AXI A;  4TUI A;  1CB1 A;  5PAL A;  1XZW A;  2KOT A;  3CWG A;  3R1V A;  4C0L A;  4V0V A;  1B4C A;  1RJV A;  1YR5 A;  3DF0 A;  1Q80 A;  4MEW A;  1DT7 B;  2QJC A;  5C1V A;  5FYX A;  2BCA A;  2Q91 A;  4QJ5 B;  2KI4 B;  2DOQ A;  2O60 A;  2QEO A;  3CYZ A;  2WCH A;  1W24 A;  1IIO A;  3L4A A;  2WCB A;  3HX4 A;  2BAP A;  2JQ6 A;  1KSM A;  4YGB B;  2F3Z A;  2WC5 A;  1QAS A;  1QV0 A;  3B87 A;  1RFJ A;  3SG5 A;  4H2I A;  1K90 D;  1OOF A;  2YVT A;  4O5G A;  2F2O A;  1SMG A;  2I2R E;  5HLO A;  4GBA A;  1BU3 A;  4NDD A;  1SYM A;  3AAK A;  1B7T Z;  4WQ2 A;  5FI6 A;  4ORA A;  3MSE B;  2F8P A;  3KO0 A;  5KTY A;  5DKN A;  4V0W A;  1NX0 A;  1LS8 A;  1TCO B;  2KLE A;  1AHR A;  1OOG A;  2KQ6 A;  1XK4 A;  1OIE A;  3PFV A;  1NP8 A;  1DGU A;  3CGA A;  3H69 A;  4N1G A;  1ODB A;  2D8N A;  3BXK A;  4I5L C;  5INB A;  1L2O C;  4Q04 A;  1B8C A;  1G5B A;  1TN4 A;  5F3W A;  2WDF A;  5J28 A;  4DIR A;  5I8N A;  4M2O A;  4FQT A;  2EC6 B;  2QEH A;  4QJ3 B;  4WRI A;  1J7Q A;  1YX7 A;  3LK0 A;  3T1I A;  2KI6 D;  5HPE A;  1J7O A;  2K2F A;  2P70 A;  3BUN B;  2KAY A;  2H61 C;  1BT6 A;  2LC5 A;  3LCP C;  1J1D A;  3CZ0 A;  1XA5 A;  3CZT X;  1XFZ O;  1Y1U A;  3DF0 B;  4UT3 A;  2M7L A;  3SG4 A;  4GGF C;  1DJW A;  1D1O A;  1TTX A;  3LL8 B;  1ALW A;  2BCX A;  2OPO A;  4FTG A;  1EL4 A;  5IOH A;  1YUT A;  3OX5 A;  2JT3 A;  4MZJ A;  3FWB A;  1DF0 A;  1B9A A;  2FJU B;  2QDI A;  3TUY B;  1YRU B;  2L4H A;  1DJZ A;  1PVA A;  2JOJ A;  1NCZ A;  2EGD A;  3I5H C;  3NXA A;  3ZWH A;  1EH2 A;  1W7I B;  4ETO A;  1QVI Z;  2HQ8 A;  2CTN A;  5FI2 A;  2K7C A;  2BQ8 X;  5JJG A;  2ZKM X;  4YGE B;  3PAL A;  3UNW A;  1WRL A;  2ZRS A;  1B8R A;  4F0Z A;  1UHK A;  3QRX A;  2H8V A;  2LUX A;  2M3W A;  5F6T A;  4LTY A;  3IVE A;  4L9M A;  1CMG A;  1KK8 B;  1S3N A;  3D03 A;  4V0X A;  3VRN A;  1YVL A;  1QLK A;  1YUS A;  1NYA A;  4CPV A;  5B8I B;  2JU0 A;  4GPL B;  2KKN A;  1SW8 A;  2ZFD A;  1YX8 A;  1JF0 A;  4DHL A;  2LVV A;  4PHN A;  2QAC A;  2HPS A;  2KBI A;  3D10 A;  4AOM A;  3TZ1 A;  3LL8 A;  4XYN A;  1KQM B;  2JPO A;  1SRA A;  1UF3 A;  4AQI A;  3D74 A;  1PUL A;  1V1F A;  2LHI A;  1QLS A;  2MBX A;  3JVT B;  1ALV A;  5HYD A;  2O5G A;  3DD4 A;  2JT0 A;  4PAL A;  1USH A;  2NZ0 A;  2QEV A;  3BFH A;  1SU1 A;  4UT3 B;  1A75 B;  5GQQ C;  2LV7 A;  1AVS A;  1JWD A;  1MXE A;  3FIA A;  4ZVZ A;  1KBP A;  2AMI A;  2PRU A;  3TS5 C;  4C0K A;  2JWW A;  2PSR A;  1ZFS A;  4USL A;  4YI9 A;  4YGC B;  2AUC A;  3S0B A;  1B1G A;  1QFC A;  1NSH A;  4BY4 A;  1PK0 D;  2Y5I A;  3BUW B;  1H8B A;  3CZ2 A;  1CLL A;  2Y1N A;  4J6O A;  2LP2 A;  1UHI A;  1S36 A;  1QV1 A;  1SCV A;  5AFP A;  1S3M A;  4CFQ A;  1MUX A;  2NXQ A;  2ZRT A;  2I94 A;  1S3P A;  3THN A;  4OV2 A;  1J7P A;  4H1Y P;  3OHM B;  2Y4Q A;  3I5F B;  1EJ3 A;  1NX3 A;  1HP1 A;  4ICB A;  1S5G Y;  1IJ6 A;  1SR6 C;  1GJY A;  2KAV A;  3TGH A;  3ICF A;  5JJT A;  3K1E A;  3SG7 A;  2HYO A;  4JKT A;  1PSB A;  2CNP A;  5D69 A;  3AKA A;  4NDC A;  2H2K A;  1G4Y R;  3M0W A;  3QFO A;  5I2O A;  1AP4 A;  2B1U A;  1ZAC A;  4KBP A;  1HO5 A;  1S26 D;  4U8D A;  2ERB A;  3BJH A;  2LVK A;  4F7F A;  1OMD A;  5KSZ A;  2L2C A;  1CFF A;  2WDD A;  1C3Z A;  4YBH B;  2ZBM A;  3CLN A;  4DUQ A;  1OE9 B;  1IKU A;  3SS4 A;  3SG6 A;  3LK1 A;  1MWN A;  2BCB A;  2WCF A;  3GVE A;  3NHI A;  3CR5 X;  4I5J A;  1JSA A;  1UUR A;  1M31 A;  3PN7 C;  4JQ0 D;  2F33 A;  4F0Z B;  2MAZ A;  1S95 A;  3FGA C;  3VRO A;  1HT9 A;  1KK7 Y;  4H2F A;  3EKJ A;  3OB1 B;  2GGZ A;  1II7 A;  5B8I A;  1KQV A;  1NUB A;  2LMV A;  1QX7 A;  3IF7 A;  1G8I A;  3L47 A;  3O4Y A;  2H61 A;  1CDP A;  1F4O A;  1LXF C;  2USH A;  4DT2 A;  5D3O A;  2QPT A;  1AJ4 A;  1FW4 A;  1WRK A;  3CAB A;  4N5X A;  3DYE A;  4GNK B;  4IJ7 A;  2DXL A;  3ZU0 A;  1C07 A;  1UHJ A;  2LVJ A;  3BUX B;  3IB8 A;  4UWQ A;  4PE0 A;  3S0A A;  1IRJ A;  4OVN F;  3BFA A;  4MZL A;  3KHE A;  4OR9 B;  4DRW A;  4YGD B;  4JA7 A;  1K9K A;  1NNW A;  4GUK A;  2CXJ A;  4PE4 A;  1TOP A;  2PYQ A;  1R6P A;  3CDN A;  1TRF A;  3E3R A;  2LLS A;  1Y1A A;  2VRG A;  5JOL A;  5BPJ A;  1A03 A;  1S8E A;  1S5G Z;  1OQP A;  2LMT A;  1T71 A;  1TNX A;  2BEC A;  1L7Z A;  1BOC A;  4XPN A;  2KI4 C;  3E7B A;  2KSP A;  1EXR A;  3B88 A;  1XFW O;  2L2E A;  5TNC A;  1SSE B;  1KCY A;  1L2O B;  1JUO A;  2WCJ A;  1JFJ A;  2A4J A;  4O4K A;  1F70 A;  2WDC A;  5HKY A;  3NHT A;  2M29 A;  1C3Y A;  3SIB A;  2LMU A;  3I5G C;  4O24 A;  3GK2 A;  3EGG A;  2M97 A;  3S0G A;  2KDH A;  1K94 A;  3BUM B;  3O6B A;  1C7W A;  3DW8 C;  4NZV A;  3DVJ A;  1TCF A;  1XVJ A;  1M45 A;  2WCL A;  3R1P A;  3AAJ A;  1DJH A;  1B7T Y;  2LHL A;  3HCM A;  2IAE C;  2PVB A;  3D75 A;  4NDB A;  5G08 A;  5JPF A;  2ZOA A;  1F71 A;  1K2H A;  3K21 A;  4GFT A;  4ZCU A;  4CLN A;  3ZTV A;  1RTP 1;  4I5L B;  1IT6 A;  3V4Y A;  1S3L A;  3HVQ A;  2LM5 A;  5CSF A;  1A29 A;  1OMV A;  2Y1M A;  4FCX A;  3DVK A;  2LLU A;  2O8G A;  2ZN8 A;  5EQV A;  1N0Y A;  1M46 A;  2WCK A;  4HRH A;  4MLW A;  3RLZ A;  3LLE A;  1PSR A;  4YRU A;  2A22 A;  4IL1 A;  2JNX A;  1KFX L;  2K61 A;  2LE9 B;  1DEL A;  3TUY C;  3PSN A;  3PSO A;  2ZN9 A;  1AUI B;  2IE4 C;  2L5X B;  3NSI A;  1DVI A;  2KNE A;  5ER4 X;  4PHM A;  3R1O A;  1DC1 A;  2JUL A;  2JXC A;  1F54 A;  3FWC A;  1QTX A;  1A4P A;  2G9B A;  3BQ3 A;  4N1F A;  3SG3 A;  1IH0 A;  3Q8I A;  1OID A;  2L5Y A;  1QHW A;  1Y1X A;  3NSO A;  3GK1 A;  1MQ1 A;  1DTL A;  2K7O A;  2M1K B;  4I5N C;  3RL3 A;  3A8R A;  1QJT A;  1M39 A;  3D0Y B;  1P28 A;  3DVE A;  3B6X A;  4XJK B;  2QFR A;  2KI6 C;  3TDZ A;  2BE4 A;  3AKB A;  2AHD A;  1Z2X A;  4LU9 A;  2BKI B;  1GM0 A;  3BFB A;  1YVH A;  1CTR A;  4MOY A;  1JF2 A;  3V2L A;  4GAO A;  1CLB A;  1KQM C;  1XYD A;  4PCW A;  2G2B A;  4MN0 A;  1A75 A;  1QVI Y;  1SL9 A;  3TDU A;  2BE6 A;  3H60 A;  4OR9 A;  4P5O E;  2BKH B;  2WCE A;  3JVT C;  5DKR A;  4C0J A;  1DGV A;  1S70 A;  1FBV A;  3AV0 A;  1SPY A;  3FE9 A;  3OB2 B;  4INX A;  3WHT B;  3CZ1 A;  1F8H A;  1F55 A;  3NSL A;  2R17 A;  2KFG A;  2JTZ A;  4PE7 A;  4OKH A;  1DJI A;  4PHJ A;  1UHN A;  2BBN A;  2QEB A;  2K8M B;  2KGB C;  4ZCV A;  1OOH A;  4CFR A;  1XM7 A;  5KU1 A;  1MHO A;  2KYC A;  2LP3 A;  5K89 A;  1AUI A;  1S6J A;  3FS7 A;  3I5G B;  3D0Y A;  1N2D A;  1K95 A;  4ORB A;  2F2P A;  2L4I A;  2FCD A;  2OS8 C;  5ER5 A;  2K7B A;  1QWV A;  2JC2 A;  2BNX A;  3H61 A;  3IVT A;  3KBP A;  2WOS A;  2LUC A;  1LVC D;  2KFH A;  1KWO B;  2HY1 A;  4A4C A;  2JNF A;  2JXL A;  1EG4 A;  4TNC A;  1WLM A;  2KPH A;  2L51 A;  3GOF A;  1SCM B;  3I5H B;  3RL5 A;  1ZUZ A;  1K96 A;  2L98 A;  1GGZ A;  1GGW A;  1MF8 A;  4E68 A;  2L0P A;  2CV9 A;  1MXL C;  1RWY A;  1DJY A;  1QAT A;  3O2P A;  5AAN A;  2QFP A;  3TDI A;  2MJW B;  1UUS A;  2HQW A;  2M1U A;  1AJ5 A;  2XMO A;  1W7J B;  1N65 A;  1CDN A;  4INW A;  3K7W C;  3DXL A;  3WNX B;  1J1E A;  2JT8 A;  2M9G A;  4UPG A;  2BL0 C;  2OTG C;  2SAS A;  3PJI A;  1DJX A;  1TNP A;  3O78 A;  3BUO B;  3S0F A;  2O8A A;  1TIZ A;  2ZNE A;  4YGA A;  1J7R A;  2M8U A;  1C7V A;  1LIN A;  3CR2 A;  5CPV A;  1XFX O;  2PMY A;  3H68 A;  1QIV A;  2IS9 A;  3E7A A;  1QXP A;  5D7F A;  1WY9 A;  1Y6W A;  2L50 A;  1HQV A;  3CS1 A;  1KFU L;  1K8U A;  3RQZ A;  1CFD A;  1BR4 B;  2WC8 A;  2EC6 C;  1VRK A;  3CR4 X;  2WND A;  3H4S E;  4OZD A;  3S0D A;  3JTD B;  1AK8 A;  1OOI X;  1SL8 A;  2KHN A;  3H63 A;  3DSC A;  3TS5 B;  4DS7 A;  4H2B A;  1LKJ A;  2TN4 A;  3RZS A;  1XFR A;  1WAR A;  1S6C A;  2F3Y A;  2KLD A;  2MA2 A;  4OCI A;  1T14 A;  2ISD A;  1NCY A;  4MBE A;  2HYP A;  3C5W C;  4FBQ A;  4DCK A;  1A2X A;  4PHK A;  2K0J A;  3CTN A;  1HPU A;  4JD9 A;  3R72 A;  2WDE A;  3K7V C;  1MR8 A;  4Q7F A;  1WRZ A;  3H64 A;  2MLE C;  1SKT A;  3D73 A;  3H67 A;  2BCD A;  2MHH A;  4M2Q A;  1TUJ A;  3PSR A;  3VRQ A;  2K2A A;  1Z2C B;  4GGN A;  1UWO A;  3A4U B;  3H66 A;  3QFK A;  3I5F C;  1UP5 A;  2EHB A;  4MRY A;  5GTU A;  2V53 A;  5I94 A;  1OW4 A;  2CBL A;  1M63 B;  4G9J A;  2LLT A;  1XK4 C;  2KQY A;  1Z4H A;  2ZO9 B;  4LAC C;  3FE6 A;  4CID A;  4B2O A;  3I5I B;  2JTT A;  2GGM A;  2HET A;  3P71 C;  1IQ5 A;  2JPT A;  3QFN A;  1UTE A;  5DIC A;  5HLV A;  3EGH A;  1BG1 A;  1CLM A;  1PVB A;  4MZK A;  1TUZ A;  3SS3 A;  2WCM A;  4UT2 A;  1CDM A;  1FJM A;  4P2Y B;  3D77 A;  2E6W A;  1F4Q A;  2Q4U A;  1BJF A;  3NGV A;  1E8A A;  3OGN A;  4KKZ A;  5HL1 A;  2KGR A;  3EK8 A;  2MRD A;  2I18 A;  1MF8 B;  3GK4 X;  4M2P A;  3WHU B;  2I7A A;  2PAS A;  1J55 A;  1QX2 A;  5JPE A;  1LA3 A;  3D78 A;  4R1E A;  3KEV A;  2M7N A;  3PN7 B;  2CT9 A;  5I2Q A;  2RGI A;  1BOD A;  3N7H A;  2K60 A;  1T70 A;  1XO5 A;  3QFM A;  1Y0V H;  1M63 A;  2JZI A;  2Z06 A;  1K93 D;  1H4B A;  3H62 B;  3RL4 A;  1SK6 D;  2YEQ A;  3BOW B;  3JTD C;  1FI6 A;  3DY9 A;  4MRX A;  1CKK A;  1SBJ A;  2NLN A;  1NCX A;  1OZS A;  2LCP A;  1YTZ C;  3PM8 A;  1S1E A;  1CMF A;  3PLF B;  3VB1 A;  1DEK A;  1QX5 B;  3WXA A;  1WDC C;  1U32 A;  3PAT A;  1FI5 A;  3PM2 A;  4XJK A;  5CSI A;  3KPX A;  4QJ4 B;  4PDZ A;  2COL B;  3DZT A;  3EVV A;  1DF0 B;  2KYF A;  3IQQ A;  1IG5 A;  1GQM A;  1V1G A;  4DSY A;  1G33 A;  3UO9 A;  4PE1 A;  1OZO A;  2M0R A;  3EVU A;  4MOV A;  3EK4 A;  1KK8 C;  1B47 A; 
#chains in the Genus database with same CATH homology
 1IJ5 A;  1BR1 B;  1YUU A;  3F45 A;  1SNL A;  3EKH A;  1V73 A;  3FLO A;  1LA0 A;  4FQO A;  5DNY A;  3ZNI A;  4AQJ A;  1QS7 A;  1SY9 A;  2AAO A;  2NXF A;  2CCM A;  2WOR A;  3BOW A;  3OP0 A;  4I5N B;  1DMO A;  2DFJ A;  4I5K A;  2FCE A;  3I5I C;  2NYM C;  3IVD A;  4FBK A;  5CSN A;  4MP0 A;  4TUG A;  1OMR A;  1CM1 A;  4FBW A;  1UHH A;  3BYA A;  3EVR A;  1SL7 A;  4JA9 A;  4O43 A;  5HKZ A;  2KFF A;  1KSO A;  1BF5 A;  2PAL A;  1JFK A;  4GGF A;  4ORB B;  4NQG A;  1X02 A;  1XFY O;  5AEQ A;  2NCP A;  3ICB A;  2R2I A;  4HRG A;  4MVF A;  2M49 B;  1NPQ A;  3VRP A;  1YRT B;  2FOT A;  3SG2 A;  2P6B B;  3EK7 A;  1JBA A;  4A4B A;  2OS8 B;  3QG5 C;  1CDL A;  1QIW A;  1OSA A;  4BY5 A;  2GJU A;  2Z72 A;  1WLZ A;  4WWL A;  5IBW A;  2JRF A;  4ZX2 A;  1ZMZ A;  2KAX A;  2LNK A;  1TCO A;  1KWO C;  1CFC A;  3NSK A;  1FF1 A;  3E0J A;  2BDX A;  1EG3 A;  3CK2 A;  1NIW A;  3DVM A;  1KFX S;  1U5I B;  1RK9 A;  1SCM C;  1XFV O;  3DSD A;  1S6I A;  3IB7 A;  4H2G A;  4ORC A;  4JPZ B;  1CNP A;  4HD0 A;  1NX1 A;  1NX2 A;  5I2L A;  3VGO A;  4YI8 A;  3C9F A;  2NYL C;  2LAP A;  1SR6 B;  1CFP A;  1FPW A;  1IWQ A;  2Z1A A;  1IGV A;  2LVI A;  1PRW A;  1WDC B;  2HF5 A;  3KF9 A;  4JWQ A;  4MSP A;  3VRR A;  1IQ3 A;  2DXN A;  1RRO A;  4IYP C;  5DKQ A;  4YKE A;  3RM1 A;  1KK7 Z;  1WAO 1;  2P6B A;  2BBM A;  2K7D A;  3THO B;  1PAL A;  3IQO A;  4WQ3 A;  3SIA A;  1NWD A;  3SJS A;  1ZOT B;  1K9P A;  1K9U A;  1CM4 A;  2KBM A;  2JOG A;  1REC A;  2E30 A;  2Z06 A;  1OOJ A;  1R2U A;  1YUR A;  2NPP C;  1U5I A;  2IE3 C;  1JC2 A;  1XFU O;  3AUZ A;  1KFU S;  1TNW A;  5J3X A;  2BL0 B;  2OTG B;  4H1S A;  4M0V A;  1OI8 A;  1Z2W A;  2ZND A;  2Q8U A;  4ORA B;  1TNQ A;  2SCP A;  3OX6 A;  5AER A;  2NCO A;  3N5U A;  1JK7 A;  1DJG A;  1BLQ A;  2LAN A;  2GV5 A;  3JYF A;  1B8L A;  5HKW A;  4D1E A;  3C1V A;  4HSZ A;  2MLF C;  4ORC B;  4HRE E;  5AXI A;  1BMO A;  5CSJ A;  4TUI A;  1CB1 A;  5PAL A;  1XZW A;  2KOT A;  3CWG A;  4C0L A;  4V0V A;  1B4C A;  1RJV A;  1YR5 A;  3DF0 A;  1Q80 A;  4MEW A;  1DT7 B;  2QJC A;  5C1V A;  5FYX A;  2BCA A;  2Q91 A;  4QJ5 B;  2KI4 B;  2DOQ A;  2O60 A;  1W24 A;  2WCB A;  3HX4 A;  2JQ6 A;  4YGB B;  1KSM A;  2DXL A;  2F3Z A;  3H68 A;  1QAS A;  1QV0 A;  3SG5 A;  1RFJ A;  4H2I A;  1K90 D;  2YVT A;  4O5G A;  2F2O A;  1SMG A;  2I2R E;  5HLO A;  4GBA A;  1BU3 A;  4NDD A;  1SYM A;  3AAK A;  1B7T Z;  4WQ2 A;  4ORA A;  3MSE B;  2F8P A;  3KO0 A;  5KTY A;  5DKN A;  4V0W A;  1NX0 A;  1TCO B;  1AHR A;  2KQ6 A;  1XK4 A;  1OIE A;  3PFV A;  1NP8 A;  1DGU A;  3CGA A;  3H69 A;  4N1G A;  1ODB A;  2D8N A;  3BXK A;  4I5L C;  5INB A;  1L2O C;  4Q04 A;  1B8C A;  1G5B A;  1TN4 A;  5F3W A;  2WDF A;  5J28 A;  4DIR A;  5I8N A;  4M2O A;  2EC6 B;  4WRI A;  4QJ3 B;  1J7Q A;  1YX7 A;  3LK0 A;  3T1I A;  2KI6 D;  5HPE A;  1J7O A;  2K2F A;  3BUN B;  2KAY A;  2H61 C;  1BT6 A;  2LC5 A;  3LCP C;  1J1D A;  1XA5 A;  3CZT X;  1XFZ O;  1Y1U A;  3DF0 B;  4UT3 A;  2M7L A;  3SG4 A;  4GGF C;  1DJW A;  1D1O A;  1TTX A;  3LL8 B;  1ALW A;  2BCX A;  2OPO A;  4FTG A;  1EL4 A;  5IOH A;  1YUT A;  3OX5 A;  2JT3 A;  4MZJ A;  3FWB A;  1DF0 A;  1B9A A;  2FJU B;  3TUY B;  1YRU B;  2L4H A;  1DJZ A;  1PVA A;  2JOJ A;  1NCZ A;  2EGD A;  3I5H C;  3NXA A;  3ZWH A;  1EH2 A;  1W7I B;  4ETO A;  1QVI Z;  2HQ8 A;  2CTN A;  2K7C A;  2BQ8 X;  5JJG A;  2ZKM X;  4YGE B;  3PAL A;  1WRL A;  2ZRS A;  1B8R A;  4F0Z A;  1UHK A;  3QRX A;  2LUX A;  2M3W A;  5F6T A;  4LTY A;  3IVE A;  4L9M A;  1CMG A;  1KK8 B;  1S3N A;  3D03 A;  4V0X A;  3VRN A;  1YVL A;  1QLK A;  1YUS A;  1NYA A;  4CPV A;  5B8I B;  2JU0 A;  4GPL B;  2KKN A;  1SW8 A;  2ZFD A;  1YX8 A;  1JF0 A;  4DHL A;  2LVV A;  4PHN A;  2QAC A;  2HPS A;  2KBI A;  3D10 A;  4AOM A;  3TZ1 A;  3LL8 A;  4XYN A;  1KQM B;  1SRA A;  1UF3 A;  4AQI A;  1PUL A;  1V1F A;  2LHI A;  1QLS A;  2MBX A;  3JVT B;  1ALV A;  5HYD A;  2O5G A;  3DD4 A;  2JT0 A;  4PAL A;  1USH A;  2NZ0 A;  1SU1 A;  4UT3 B;  1A75 B;  5GQQ C;  2LV7 A;  1AVS A;  1JWD A;  1MXE A;  3FIA A;  4ZVZ A;  1KBP A;  2AMI A;  2PRU A;  3TS5 C;  4C0K A;  2JWW A;  2PSR A;  1ZFS A;  4USL A;  4YI9 A;  4YGC B;  2AUC A;  1B1G A;  1QFC A;  1NSH A;  4BY4 A;  1PK0 D;  2Y5I A;  3BUW B;  1H8B A;  1CLL A;  2Y1N A;  4J6O A;  2LP2 A;  1UHI A;  1S36 A;  1QV1 A;  1SCV A;  5AFP A;  1S3M A;  4CFQ A;  1MUX A;  2NXQ A;  2ZRT A;  2I94 A;  1S3P A;  3THN A;  4OV2 A;  1J7P A;  4H1Y P;  3OHM B;  2Y4Q A;  3I5F B;  1EJ3 A;  1NX3 A;  1HP1 A;  4ICB A;  1S5G Y;  1IJ6 A;  1SR6 C;  1GJY A;  2KAV A;  3TGH A;  3ICF A;  5JJT A;  3SG7 A;  2HYO A;  1PSB A;  2CNP A;  5D69 A;  3AKA A;  4NDC A;  2H2K A;  1G4Y R;  3M0W A;  3QFO A;  5I2O A;  1AP4 A;  2B1U A;  1ZAC A;  4KBP A;  1HO5 A;  1S26 D;  4U8D A;  2LVK A;  1OMD A;  5KSZ A;  1CFF A;  2WDD A;  4YBH B;  2ZBM A;  3CLN A;  4DUQ A;  1OE9 B;  1IKU A;  3SG6 A;  3LK1 A;  1MWN A;  2BCB A;  2WCF A;  3GVE A;  3CR5 X;  4I5J A;  1JSA A;  1UUR A;  1M31 A;  3PN7 C;  4JQ0 D;  2F33 A;  4F0Z B;  2MAZ A;  1S95 A;  3FGA C;  3VRO A;  1HT9 A;  1KK7 Y;  4H2F A;  3EKJ A;  3OB1 B;  2GGZ A;  1II7 A;  5B8I A;  1KQV A;  1NUB A;  2LMV A;  1QX7 A;  3IF7 A;  1G8I A;  3O4Y A;  2H61 A;  1CDP A;  1F4O A;  1LXF C;  2USH A;  4DT2 A;  2QPT A;  1AJ4 A;  1FW4 A;  1WRK A;  4N5X A;  4GNK B;  3ZU0 A;  1C07 A;  1UHJ A;  2LVJ A;  3BUX B;  3IB8 A;  4UWQ A;  4PE0 A;  1IRJ A;  4OVN F;  4MZL A;  3KHE A;  4OR9 B;  4DRW A;  4YGD B;  4JA7 A;  1K9K A;  1NNW A;  4GUK A;  2CXJ A;  4PE4 A;  1TOP A;  1R6P A;  1TRF A;  3E3R A;  2LLS A;  1Y1A A;  2VRG A;  5JOL A;  5BPJ A;  1A03 A;  1S8E A;  1S5G Z;  1OQP A;  2LMT A;  1T71 A;  1TNX A;  2BEC A;  1L7Z A;  1BOC A;  4XPN A;  2KI4 C;  3E7B A;  2KSP A;  1EXR A;  1XFW O;  2L2E A;  5TNC A;  1KCY A;  1L2O B;  1JUO A;  1JFJ A;  2A4J A;  4O4K A;  1F70 A;  2WDC A;  5HKY A;  2M29 A;  3SIB A;  2LMU A;  3I5G C;  4O24 A;  3GK2 A;  3EGG A;  2M97 A;  2KDH A;  1K94 A;  3BUM B;  3O6B A;  1C7W A;  3DW8 C;  4NZV A;  3DVJ A;  1TCF A;  1XVJ A;  1M45 A;  3AAJ A;  1DJH A;  1B7T Y;  2LHL A;  3HCM A;  2IAE C;  2PVB A;  4NDB A;  5G08 A;  5JPF A;  2ZOA A;  1F71 A;  1K2H A;  3K21 A;  4GFT A;  4ZCU A;  4CLN A;  3ZTV A;  1RTP 1;  4I5L B;  1IT6 A;  3V4Y A;  1S3L A;  3HVQ A;  2LM5 A;  5CSF A;  1A29 A;  1OMV A;  2Y1M A;  4FCX A;  3DVK A;  2LLU A;  2O8G A;  2ZN8 A;  5EQV A;  1N0Y A;  1M46 A;  4HRH A;  4YRU A;  4MLW A;  3RLZ A;  3LLE A;  1PSR A;  2A22 A;  4IL1 A;  2JNX A;  1KFX L;  2K61 A;  2LE9 B;  3PSN A;  3TUY C;  3PSO A;  2ZN9 A;  1AUI B;  2IE4 C;  2L5X B;  3NSI A;  1DVI A;  2KNE A;  5ER4 X;  4PHM A;  2JUL A;  2JXC A;  1F54 A;  3FWC A;  1QTX A;  1A4P A;  2G9B A;  3BQ3 A;  4N1F A;  3SG3 A;  1IH0 A;  1OID A;  1QHW A;  1Y1X A;  3NSO A;  3GK1 A;  1MQ1 A;  1DTL A;  2K7O A;  2M1K B;  4I5N C;  3RL3 A;  3A8R A;  1QJT A;  1M39 A;  3D0Y B;  3DVE A;  4XJK B;  2QFR A;  2KI6 C;  3TDZ A;  2BE4 A;  3AKB A;  2AHD A;  1Z2X A;  4LU9 A;  2BKI B;  1YVH A;  1CTR A;  4MOY A;  1JF2 A;  4GAO A;  1CLB A;  1KQM C;  1XYD A;  4PCW A;  2G2B A;  4MN0 A;  1A75 A;  1QVI Y;  1SL9 A;  3TDU A;  2BE6 A;  3H60 A;  4OR9 A;  4P5O E;  2BKH B;  2WCE A;  3JVT C;  5DKR A;  4C0J A;  1DGV A;  1S70 A;  1FBV A;  3AV0 A;  1SPY A;  3OB2 B;  3WHT B;  2R17 A;  1F8H A;  1F55 A;  3NSL A;  2KFG A;  2JTZ A;  4PE7 A;  4OKH A;  1DJI A;  4PHJ A;  1UHN A;  2BBN A;  4ZCV A;  2K8M B;  2KGB C;  1XM7 A;  4CFR A;  5KU1 A;  1MHO A;  2KYC A;  2LP3 A;  5K89 A;  1AUI A;  1S6J A;  3FS7 A;  3I5G B;  3D0Y A;  1N2D A;  1K95 A;  4ORB A;  2F2P A;  2L4I A;  2FCD A;  2OS8 C;  5ER5 A;  2K7B A;  2JC2 A;  3H61 A;  3KBP A;  2WOS A;  2LUC A;  1LVC D;  2KFH A;  1KWO B;  2HY1 A;  4A4C A;  2JNF A;  2JXL A;  1EG4 A;  4TNC A;  1WLM A;  3I5H B;  2L51 A;  3GOF A;  1SCM B;  3RL5 A;  1ZUZ A;  1K96 A;  2L98 A;  1GGZ A;  1GGW A;  1MF8 A;  4E68 A;  2L0P A;  2CV9 A;  1MXL C;  1RWY A;  1DJY A;  1QAT A;  3O2P A;  5AAN A;  2QFP A;  3TDI A;  2MJW B;  1UUS A;  2HQW A;  2M1U A;  1AJ5 A;  2XMO A;  1W7J B;  1N65 A;  1CDN A;  3K7W C;  3WNX B;  1J1E A;  2JT8 A;  2M9G A;  4UPG A;  2BL0 C;  2OTG C;  2SAS A;  1DJX A;  1TNP A;  3O78 A;  3BUO B;  2O8A A;  1TIZ A;  2ZNE A;  4YGA A;  1J7R A;  2M8U A;  1C7V A;  1LIN A;  3CR2 A;  5CPV A;  1XFX O;  2PMY A;  1QIV A;  2IS9 A;  3E7A A;  1QXP A;  5D7F A;  1WY9 A;  1Y6W A;  2L50 A;  1HQV A;  3CS1 A;  1KFU L;  1K8U A;  3RQZ A;  1CFD A;  1BR4 B;  2WC8 A;  2EC6 C;  1VRK A;  3CR4 X;  2WND A;  3H4S E;  3JTD B;  1AK8 A;  2KHN A;  1SL8 A;  3H63 A;  3DSC A;  3TS5 B;  4DS7 A;  4H2B A;  1LKJ A;  2TN4 A;  1WAR A;  1S6C A;  2F3Y A;  2MA2 A;  4OCI A;  2ISD A;  1NCY A;  4MBE A;  2HYP A;  3C5W C;  4FBQ A;  4DCK A;  1A2X A;  4PHK A;  2K0J A;  3CTN A;  1HPU A;  2WDE A;  3K7V C;  1MR8 A;  4Q7F A;  1WRZ A;  3H64 A;  2MLE C;  1SKT A;  3H67 A;  2BCD A;  2MHH A;  4M2Q A;  3PSR A;  3VRQ A;  2K2A A;  3H66 A;  4GGN A;  1UWO A;  3A4U B;  3QFK A;  3I5F C;  1UP5 A;  2EHB A;  4MRY A;  5GTU A;  2V53 A;  2CBL A;  1M63 B;  4G9J A;  2LLT A;  1XK4 C;  2KQY A;  2ZO9 B;  4LAC C;  4CID A;  4B2O A;  3I5I B;  2JTT A;  2GGM A;  2HET A;  3P71 C;  1IQ5 A;  2JPT A;  3QFN A;  1UTE A;  5HLV A;  3EGH A;  1BG1 A;  1CLM A;  1PVB A;  4MZK A;  4UT2 A;  1CDM A;  1FJM A;  4P2Y B;  2E6W A;  1F4Q A;  2Q4U A;  1BJF A;  1E8A A;  4KKZ A;  2KGR A;  3EK8 A;  2MRD A;  2I18 A;  1MF8 B;  3GK4 X;  4M2P A;  3WHU B;  2I7A A;  2PAS A;  1J55 A;  1QX2 A;  5JPE A;  1LA3 A;  4R1E A;  3KEV A;  2M7N A;  3PN7 B;  2CT9 A;  5I2Q A;  2RGI A;  1BOD A;  1T70 A;  1XO5 A;  3QFM A;  1Y0V H;  1M63 A;  2JZI A;  3H62 B;  1K93 D;  1H4B A;  3RL4 A;  1SK6 D;  2YEQ A;  3BOW B;  3JTD C;  1FI6 A;  4MRX A;  1CKK A;  1SBJ A;  2NLN A;  1NCX A;  1OZS A;  2LCP A;  1YTZ C;  3PM8 A;  1S1E A;  1CMF A;  3PLF B;  1QX5 B;  3WXA A;  1WDC C;  1U32 A;  3PAT A;  1FI5 A;  4XJK A;  5CSI A;  3KPX A;  4QJ4 B;  4PDZ A;  2COL B;  3EVV A;  1DF0 B;  2KYF A;  3IQQ A;  1IG5 A;  1GQM A;  1V1G A;  4DSY A;  1G33 A;  4PE1 A;  1OZO A;  2M0R A;  3EVU A;  4MOV A;  3EK4 A;  1KK8 C;  1B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...