4IL1A

Crystal structure of the rat calcineurin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
647
structure length
529
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICFEEAKGLDRINERMPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, Calcineurin subunit B type 1, Serine/threonine-p
publication title Structural basis of calcineurin activation by calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 174
structure length 529
sequence length 647
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4il1A01
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4il1A02
1YUUA 2JOJA 5K89A 1YX7A 1MF8A 1CFDA 1WY9A 1ZUZA 1HPUA 2KNEA 3I5GB 1JUOA 1V1FA 1SMGA 1A29A 3EVUA 2PRUA 5HPEA 4YGBB 4ORAA 4AQJA 5DKNA 2KFFA 4V0XA 1KFUL 5IBWA 1PULA 2L4IA 2ZNEA 1S1EA 1QVIZ 3GK2A 2PASA 3LLEA 3PATA 4CIDA 1NCZA 2Z06A 4YGAA 1FJMA 2H2KA 4FBWA 3T1IA 1PVBA 1SY9A 1NX2A 2JNFA 3JVTC 4M2QA 1F4QA 1OOJA 5CPVA 5D7FA 1B7TZ 1EXRA 1S36A 3FIAA 3OX6A 1DGUA 1JF2A 3CLNA 5JPFA 4I5NB 4TUGA 1YUSA 1CDLA 1LA0A 1CM4A 2NXQA 3JVTB 2IE3C 2OS8C 2QJCA 3NSLA 2WDDA 1M63A 1KK8C 1HQVA 4PE7A 4UWQA 2JXCA 3KO0A 1NP8A 3FWCA 3EVRA 2M3WA 2KBIA 3DF0B 4MRXA 2M49B 1R2UA 1XFWO 4PE1A 2WDEA 3IB8A 2HYPA 1N0YA 2MLEC 5PALA 2AAOA 3KPXA 1USHA 3LL8A 3H67A 4ORCA 3QRXA 3BXKA 4IL1A 2K7BA 2ISDA 1N2DA 1IT6A 1TCFA 2E30A 1L7ZA 2JC2A 1EH2A 4KBPA 4NQGA 1UUSA 1K93D 4MOYA 4HRGA 1HP1A 1TCOA 1YURA 5JOLA 1LA3A 3CWGA 4MZLA 3C5WC 3E7AA 2M7LA 4ZCVA 1RJVA 3E7BA 1CLLA 2GV5A 3ZU0A 3DSCA 2NCPA 2GGZA 2KYCA 2F8PA 2I18A 2L50A 1BF5A 2BQ8X 1IKUA 1WARA 1LINA 4GUKA 2BE6A 2OS8B 1ALVA 1FPWA 1QS7A 3IQOA 3P71C 3HCMA 1KK8B 4JA7A 1TN4A 1CFFA 1V73A 5TNCA 1YRTB 2YVTA 1QTXA 1TTXA 4PHNA 1HT9A 2MAZA 4NDDA 3LK1A 4JWQA 3H62B 1SCMC 2LP2A 1B9AA 2KI6D 1JFJA 1CMGA 2TN4A 5HKWA 2O5GA 1AP4A 5INBA 2QPTA 4U8DA 4WQ2A 2LVJA 1MR8A 3PN7C 3LL8B 3SJSA 2KDHA 2Y1NA 4L9MA 5AXIA 1S70A 1SL8A 1NPQA 1U5IA 2BECA 2KSPA 1TRFA 2MLFC 1NSHA 4PCWA 1T71A 1CKKA 2LLTA 1MWNA 2VRGA 1C7VA 1G5BA 1DJIA 2K2FA 1FW4A 1RK9A 3RM1A 4H2GA 4F0ZB 1NX3A 2GJUA 1U32A 1KSMA 1K8UA 2KAYA 2JNXA 2LHIA 1BJFA 1Y6WA 4PE0A 2PMYA 2Q4UA 3TDZA 1FF1A 4PHJA 3RL4A 4HRHA 1J1EA 2BKIB 1YVLA 2ZRSA 3D0YB 1SCMB 1AJ5A 4Q04A 2PSRA 1XO5A 3ICFA 3BQ3A 4YGCB 3N5UA 3NSIA 2V53A 1OZOA 1CDNA 5JJGA 3PN7B 1CDPA 1NWDA 1WDCC 1ZMZA 3RLZA 2KI4C 2M1KB 2USHA 4ZVZA 1J7QA 1T70A 3I5HC 1KQVA 1DVIA 2HQ8A 3NSOA 1QFCA 1OMVA 1Y1UA 2WC8A 3EVVA 2BCBA 1KK7Y 4GBAA 3EGHA 4LU9A 3BUNB 1SBJA 2F33A 2WCBA 3BUXB 2KGRA 4C0LA 4E68A 1RROA 1XA5A 4MEWA 3IVDA 1SRAA 2CBLA 4GNKB 5B8IB 3AV0A 2Q8UA 2JTTA 5HLOA 2LV7A 4WRIA 3ZWHA 1OZSA 2WOSA 3DF0A 4GGFA 1OE9B 3PSNA 4MZKA 1UF3A 3QFOA 3AUZA 2L51A 1MUXA 2WCEA 2JU0A 4M2OA 3CGAA 2Z1AA 4MOVA 1NX0A 1UHNA 4IYPC 2O8GA 4GGFC 4NZVA 2K7DA 1WDCB 2JT8A 5JPEA 2FCEA 2KI4B 4N1GA 4OCIA 5ER4X 4AOMA 5J28A 4ICBA 2LMVA 3H66A 1TOPA 2FCDA 1EL4A 5KU1A 4YKEA 1BR1B 1F71A 3CR4X 4ETOA 3I5HB 4H1YP 2LVVA 3VRRA 4XYNA 5G08A 2WDFA 3PSOA 1IG5A 1J1DA 4LACC 1A4PA 2JT0A 1MXEA 3O2PA 4J6OA 1DJYA 4HSZA 2BBMA 5CSFA 1WRZA 3H68A 2LLUA 2HPSA 2K7CA 1XFXO 1QHWA 1LXFC 1S8EA 2NYLC 5D69A 3SIBA 4A4BA 4QJ4B 4FCXA 4N1FA 3H61A 4D1EA 3M0WA 2JULA 2Y4QA 1SK6D 4M0VA 4YBHB 3HVQA 1H8BA 4N5XA 1S6IA 4ZCUA 2M29A 4MBEA 2NCOA 2KHNA 4C0JA 5HLVA 2L5XB 3NXAA 3CK2A 2Y5IA 3K7WC 3GOFA 1S6JA 1GGZA 1QX7A 1V1GA 2KQYA 3SG2A 5GQQC 5ER5A 4DRWA 1AVSA 1TIZA 3DVKA 1BODA 4FBQA 2AUCA 1AHRA 2LLSA 1H4BA 4R1EA 4H2IA 2COLB 4FQOA 1DF0B 3OB2B 3VRPA 2MRDA 1EG3A 1OI8A 1JBAA 4F0ZA 1OQPA 3CS1A 2R2IA 1X02A 1J7RA 3SG4A 2MHHA 1WLMA 1B8CA 3VGOA 3BOWB 3FS7A 1S3NA 2CXJA 2IE4C 3KHEA 4YI8A 3EK4A 2NLNA 3SG3A 2EHBA 4MSPA 2MBXA 4MZJA 1BU3A 2F2PA 3D0YA 3AKAA 3MSEB 4LTYA 1IH0A 1KFXL 2JRFA 2M8UA 4PHMA 5EQVA 3TDIA 2HETA 1R6PA 2QFRA 1W7IB 4TUIA 4C0KA 1CMFA 2KFGA 5AEQA 2A4JA 3EKJA 4GGNA 4XPNA 1CM1A 1TNPA 2M97A 3OX5A 1QLKA 2FJUB 1XZWA 2KFHA 1ZACA 3PFVA 2F3YA 2LHLA 1KK7Z 1DTLA 3EK7A 1AK8A 5KSZA 1DGVA 1VRKA 2AMIA 3FWBA 3QFKA 1S6CA 2AHDA 1YVHA 2BCAA 3EK8A 4OKHA 2Z72A 2O8AA 1B7TY 2BE4A 1KFUS 4WWLA 2K7OA 5B8IA 4HREE 1QASA 3V4YA 1PRWA 3DVJA 3WXAA 1A03A 5I2LA 1F8HA 1PVAA 1DJWA 1PK0D 2PVBA 2KKNA 2ZFDA 1IWQA 1CTRA 4DHLA 1Y0VH 1PSRA 4NDBA 4A4CA 1DJHA 2L0PA 2LVKA 4PALA 3WHUB 1IQ3A 3ZTVA 3OB1B 3C1VA 4UT2A 1K90D 1BR4B 2KAVA 4I5KA 2CT9A 2F2OA 1XFYO 3JYFA 1WRKA 1ZOTB 4JPZB 1JWDA 1OIEA 4CFQA 4YRUA 1KSOA 1UP5A 2BCDA 4O4KA 1AUIB 2CCMA 2ZN8A 1SW8A 4OR9A 2JTZA 4UPGA 3WHTB 5KTYA 1OSAA 4ORBB 5CSIA 4DIRA 3KF9A 2QACA 4TNCA 2LCPA 3QG5C 2NYMC 1NX1A 1MHOA 2I94A 2Q91A 3SG5A 1B8RA 1SCVA 1DT7B 1FBVA 3FGAC 2LC5A 1BMOA 2B1UA 3O6BA 2QFPA 1IJ6A 1DMOA 1J7PA 3LK0A 5F6TA 2SCPA 1XFZO 1K94A 1M45A 1G4YR 4GPLB 3BYAA 2LNKA 3OP0A 3TZ1A 4BY4A 1PALA 1BLQA 2M0RA 1XFUO 1B47A 3I5FC 2K0JA 3E3RA 3IB7A 2HYOA 2I7AA 3DVEA 3AAJA 3I5IC 2M9GA 1D1OA 4NDCA 3TDUA 2E6WA 1JC2A 2L2EA 3O4YA 1ZFSA 3CZTX 1CNPA 1KCYA 2JOGA 2KGBC 4H1SA 4JA9A 2OTGC 1E8AA 2EC6C 2WCFA 2DFJA 2R17A 4DS7A 1KBPA 1KQMC 2ZKMX 3EKHA 2A22A 2FOTA 1MXLC 2D8NA 4OVNF 5HYDA 5GTUA 2H61A 1L2OC 1QLSA 1A75B 4PE4A 1WAO1 1DF0A 1SR6C 2LUCA 2ZRTA 3A8RA 4MLWA 4USLA 5I2QA 2CV9A 4OR9B 4DCKA 3GK4X 4ZX2A 2Y1MA 1M39A 1S3MA 1QIWA 1WRLA 1SYMA 2H61C 4MP0A 5JJTA 2KQ6A 1M46A 3BOWA 5CSJA 2KAXA 2EGDA 2P6BB 3SG7A 4YI9A 4AQIA 3AKBA 1QV0A 1IQ5A 3CR5X 3I5FB 2BDXA 2KYFA 3K21A 4DSYA 1TNXA 3QFNA 2MJWB 3I5IB 4DUQA 1Y1AA 1CLMA 2G9BA 2HQWA 1RECA 1XM7A 1UHIA 5F3WA 2OTGB 1K9PA 2EC6B 1NYAA 1TNWA 1RWYA 2NZ0A 1Y1XA 1CB1A 2WDCA 1M31A 1KQMB 2F3ZA 1C07A 1S95A 4CLNA 1IJ5A 1NCYA 3O78A 1XYDA 1CDMA 5IOHA 4B2OA 1L2OB 1SPYA 2I2RE 1Z2XA 1UTEA 3QFMA 1SR6B 1RTP1 1B1GA 3BUMB 3KBPA 3PM8A 1B4CA 4I5LC 4O5GA 2ZBMA 1QATA 3TUYC 1C7WA 1KWOC 1S3LA 2KI6C 1WLZA 1JSAA 2BL0C 2IAEC 2JT3A 1S5GY 3DW8C 1F4OA 4UT3A 1K9KA 3C9FA 1XVJA 2NPPC 2JQ6A 1NNWA 1YR5A 2LMUA 1BT6A 1YRUB 3ZNIA 2CTNA 2PALA 3H69A 1K96A 4FTGA 3H64A 5AERA 1OMDA 3RL3A 1ODBA 1DJZA 1MF8B 1QJTA 5AANA 1W7JB 3THOB 3A4UB 4FBKA 3THNA 2XMOA 5AFPA 1NIWA 1UWOA 1Z2WA 4QJ5B 1RFJA 1CFPA 1FI5A 4ORAB 4V0VA 1DJGA 1AUIA 3BUOB 3TS5C 4G9JA 1UHJA 1QXPA 2LMTA 3VROA 2K61A 1K2HA 4ORBA 2LAPA 1QIVA 1YTZC 4CPVA 2BKHB 2O60A 5J3XA 1N65A 2NXFA 4I5LB 2LE9B 5DKQA 2ZN9A 1QV1A 1QVIY 1F54A 3LCPC 3SIAA 1Q80A 3TUYB 1KWOB 5I8NA 1W24A 2BL0B 1CLBA 2WORA 4PHKA 2LUXA 3AAKA 1QX5B 5HKYA 1IRJA 2GGMA 3KEVA 4V0WA 4KKZA 1PSBA 1ALWA 4P2YB 4UT3B 1M63B 1II7A 4YGDB 1J7OA 1OMRA 2JZIA 3CTNA 3JTDC 2LVIA 2BBNA 5FYXA 1F70A 1G33A 2LANA 1GQMA 4XJKA 2BCXA 4HD0A 1MQ1A 4ORCB 3TS5B 1BG1A 2WNDA 3WNXB 4PDZA 3SG6A 2OPOA 4BY5A 3OHMB 1A75A 2M1UA 1B8LA 2DOQA 1YX8A 1TCOB 1XK4A 5DKRA 1A2XA 1YUTA 3DD4A 3GK1A 4WQ3A 2MA2A 1AJ4A 4OV2A 1SL7A 5CSNA 3VRNA 1J55A 1OIDA 2JXLA 4O24A 1S3PA 1XK4C 1UURA 2HF5A 3H63A 4YGEB 1NCXA 3NSKA 1JK7A 2P6BA 1EG4A 1UHKA 2LM5A 1QX2A 2ZNDA 4I5JA 3EGGA 1TNQA 3RL5A 4GAOA 4H2FA 5BPJA 1DJXA 1EJ3A 2RGIA 3JTDB 2HY1A 1SKTA 5C1VA 3PSRA 1F55A 3PALA 2JWWA 2SASA 4P5OE 4QJ3B 3GVEA 2L98A 3TGHA 1UHHA 3I5GC 2CNPA 1G8IA 3DSDA 1IGVA 4CFRA 3PLFB 1BOCA 3CR2A 4XJKB 1SL9A 4MN0A 3ICBA 5DNYA 3IVEA 2M7NA 3DVMA 4MRYA 1GJYA 2KBMA 3IQQA 4M2PA 5HKZA 1KFXS 1U5IB 1LVCD 3D10A 3F45A 4MVFA 3IF7A 2KOTA 3K7VC 1K9UA 2LP3A 4Q7FA 1S5GZ 4DT2A 1HO5A 1FI6A 4O43A 1JF0A 3HX4A 3VRQA 4JQ0D 1GGWA 1XFVO 1SU1A 3BUWB 3H4SE 4GFTA 1JFKA 4H2BA 2K8MB 2K2AA 3RQZA 2JPTA 1LKJA 4I5NC 2IS9A 2G2BA 2L4HA 1CFCA 3H60A 1NUBA 5I2OA 1K95A 1SNLA 1S26D
chains in the Genus database with same CATH superfamily
1YUUA 2JOJA 5K89A 1YX7A 1MF8A 1CFDA 1WY9A 1ZUZA 1HPUA 2KNEA 3BFHA 3I5GB 1JUOA 1V1FA 1SMGA 1A29A 3EVUA 1OOIX 2PRUA 3QMEA 5HPEA 4YGBB 4ORAA 4AQJA 5DKNA 2KFFA 4V0XA 1KFUL 5IBWA 2YGUA 1PULA 2L4IA 2ZNEA 1S1EA 1QVIZ 3GK2A 2PASA 3LLEA 1C3YA 3PATA 4CIDA 1NCZA 2Z06A 4YGAA 1FJMA 2H2KA 4FBWA 3T1IA 1PVBA 1SY9A 1NX2A 2JNFA 3JVTC 4F7FA 4M2QA 1F4QA 1OOJA 5CPVA 1Z2CB 2WCMA 5D7FA 1B7TZ 1EXRA 1S36A 3D78A 3FIAA 3OX6A 1DGUA 1JF2A 3CLNA 5JPFA 3CZ2A 4I5NB 4TUGA 1YUSA 1CDLA 2QEOA 1LA0A 1CM4A 2NXQA 3JVTB 2IE3C 2OS8C 2QJCA 3NSLA 2WDDA 1M63A 1KK8C 1HQVA 4PE7A 4UWQA 2JXCA 3KO0A 1NP8A 3FWCA 3EVRA 2M3WA 2KBIA 3DF0B 2KPHA 3Q8IA 4MRXA 2M49B 1R2UA 1XFWO 4KYNA 4PE1A 3RZSA 2WDEA 3IB8A 2HYPA 1N0YA 2MLEC 5PALA 2AAOA 3KPXA 1USHA 3LL8A 3H67A 4ORCA 2WC6A 1IT6A 3QRXA 3BXKA 4IL1A 2K7BA 2ISDA 1N2DA 3BJHA 1TCFA 2E30A 1L7ZA 2JC2A 1EH2A 4KBPA 1DELA 4NQGA 1UUSA 1K93D 4MOYA 3B6XA 4HRGA 1HP1A 1TCOA 1YURA 5JOLA 1LA3A 2PQLA 3CWGA 4MZLA 3C5WC 2M7LA 4ZCVA 1RJVA 3E7AA 3E7BA 1CLLA 2GV5A 2PYQA 3ZU0A 3DSCA 2NCPA 2GGZA 2KYCA 2F8PA 2I18A 2L50A 1BF5A 2BQ8X 3D73A 1IKUA 1WARA 1LINA 4GUKA 2BE6A 2OS8B 1ALVA 1FPWA 1QS7A 3IQOA 3P71C 3HCMA 1KK8B 4JA7A 1TN4A 1CFFA 1V73A 5TNCA 1YRTB 2YVTA 3BFBA 1OOGA 3BFAA 1QTXA 1TTXA 4PHNA 1HT9A 2MAZA 4NDDA 3LK1A 4JWQA 3H62B 1SCMC 2LP2A 2DXNA 1B9AA 2KI6D 1JFJA 1CMGA 2TN4A 5D3OA 5HKWA 2O5GA 1AP4A 5INBA 2QPTA 4U8DA 4WQ2A 2LVJA 1MR8A 3B86A 3PN7C 3D76A 3LL8B 3SJSA 2KDHA 2Y1NA 4L9MA 5AXIA 1S70A 1SL8A 1NPQA 1U5IA 2BECA 2KSPA 1TRFA 2MLFC 1NSHA 4PCWA 3S0FA 1T71A 1CKKA 2LLTA 1MWNA 2ERBA 3S0DA 2VRGA 1C7VA 1G5BA 1DJIA 2K2FA 1FW4A 1RK9A 3RM1A 5FI7A 4F0ZB 1NX3A 2GJUA 4H2GA 1U32A 1KSMA 1K8UA 2KAYA 2JNXA 2L5YA 2LHIA 1BJFA 1Y6WA 4PE0A 2PMYA 2Q4UA 3TDZA 1DC1A 1FF1A 4PHJA 3RL4A 4HRHA 1J1EA 5FI2A 2BKIB 1YVLA 2ZRSA 3D0YB 1SCMB 1AJ5A 4Q04A 2PSRA 1XO5A 3CDNA 3BQ3A 4YGCB 3ICFA 3N5UA 3NSIA 2BNXA 1OZOA 2V53A 2QEVA 3PN7B 3VB1A 5JJGA 1CDPA 1CDNA 1NWDA 1WDCC 1ZMZA 3FE6A 2KI4C 2M1KB 3RLZA 2USHA 2BAPA 3CABA 4ZVZA 1J7QA 1T70A 3I5HC 1KQVA 1DVIA 2HQ8A 3NSOA 1QFCA 1OMVA 3IVTA 1Y1UA 2WC8A 3EVVA 2BCBA 1KK7Y 1W9ZA 3B7AA 4GBAA 3EGHA 4LU9A 1C3ZA 4INWA 3BUNB 1SBJA 2F33A 2WCBA 3BUXB 2KGRA 4C0LA 4E68A 1RROA 1XA5A 4MEWA 3IVDA 1SRAA 2CBLA 2WCHA 4GNKB 5B8IB 2GTEA 3O4XA 2Q8UA 3AV0A 2JTTA 5HLOA 2QEHA 2LV7A 4WRIA 3ZWHA 1OZSA 2KLEA 2WOSA 3DF0A 4GGFA 1OE9B 3PSNA 4MZKA 1UF3A 3R1PA 3QFOA 3AUZA 2L51A 1MUXA 2WCEA 1P28A 1TUJA 2JU0A 3CGAA 4M2OA 2Z1AA 4MOVA 1NX0A 1T14A 1UHNA 2WCJA 2O8GA 4GGFC 4IYPC 4NZVA 2K7DA 1WDCB 2JT8A 5JPEA 2FCEA 2KI4B 4N1GA 4OCIA 5ER4X 4AOMA 5J28A 4ICBA 2LMVA 3H66A 1TOPA 2FCDA 1EL4A 5KU1A 4YKEA 1BR1B 4JD9A 3CR4X 1F71A 4ETOA 3I5HB 4H1YP 2LVVA 3SS3A 4XYNA 5G08A 3VRRA 2WDFA 3PSOA 1ORGA 1IG5A 1J1DA 4LACC 3V2LA 1GM0A 1A4PA 2JT0A 1MXEA 3O2PA 4J6OA 1DJYA 4HSZA 3B88A 2BBMA 5CSFA 1WRZA 3H68A 2LLUA 2HPSA 2K7CA 1XFXO 1QHWA 1LXFC 1S8EA 3B87A 2NYLC 5D69A 3SIBA 4A4BA 4QJ4B 4FCXA 4N1FA 3H61A 4D1EA 3M0WA 2JULA 2Y4QA 1SK6D 3CYZA 4YBHB 4M0VA 3HVQA 1H8BA 4N5XA 1S6IA 4ZCUA 2M29A 4MBEA 2NCOA 2L2CA 2KHNA 3R1OA 4C0JA 4IJ7A 5HLVA 2L5XB 3CZ1A 3NXAA 3CK2A 2Y5IA 3K7WC 3GOFA 1S6JA 1GGZA 1QX7A 1V1GA 2KQYA 3SG2A 5GQQC 5ER5A 4DRWA 1AVSA 1TIZA 3DVKA 2WCLA 4JKTA 1BODA 4FBQA 2AUCA 1AHRA 2LLSA 1H4BA 4R1EA 4H2IA 2COLB 4FQOA 1DF0B 3OB2B 3VRPA 2MRDA 1EG3A 1OI8A 1JBAA 4F0ZA 1OQPA 3CS1A 2R2IA 1X02A 1J7RA 3SG4A 2KLDA 2MHHA 1WLMA 1B8CA 3VGOA 3BOWB 3FS7A 1S3NA 2CXJA 2IE4C 3KHEA 4YI8A 3EK4A 2NLNA 3SG3A 2EHBA 4MSPA 2MBXA 4MZJA 1BU3A 2F2PA 3D0YA 3AKAA 3MSEB 4LTYA 1IH0A 1KFXL 2JRFA 2M8UA 4PHMA 5EQVA 3TDIA 2HETA 1R6PA 2QFRA 1W7IB 4TUIA 4C0KA 1CMFA 2KFGA 5AEQA 2A4JA 3EKJA 4GGNA 4XPNA 1CM1A 1TNPA 2M97A 3OX5A 1QLKA 2FJUB 1XZWA 2KFHA 1ZACA 3PFVA 2F3YA 2LHLA 1KK7Z 3SS5A 1DTLA 3EK7A 1OW4A 1AK8A 5KSZA 3L4LA 1DGVA 1VRKA 2AMIA 3FWBA 3QFKA 1S6CA 2AHDA 1YVHA 5EL2A 2BCAA 3EK8A 4OKHA 2Z72A 2O8AA 1B7TY 2BE4A 1KFUS 4WWLA 2K7OA 5B8IA 4HREE 1QASA 3V4YA 1PRWA 3DVJA 3WXAA 1A03A 5I2LA 1F8HA 1PVAA 1DJWA 1PK0D 2PVBA 2KKNA 2ZFDA 3FE9A 1IWQA 1CTRA 4DHLA 3D74A 1Y0VH 1PSRA 4NDBA 4A4CA 1DJHA 2L0PA 2LVKA 3PM2A 4PALA 3WHUB 1IQ3A 3D03A 3ZTVA 3OB1B 3C1VA 4UT2A 1K90D 1BR4B 2KAVA 4I5KA 2CT9A 2F2OA 1XFYO 3NHTA 3FLOA 3JYFA 1WRKA 1ZOTB 4JPZB 1JWDA 1OIEA 4CFQA 4YRUA 1KSOA 1UP5A 2BCDA 4O4KA 3UO9A 1AUIB 2CCMA 2ZN8A 1OOHA 1SW8A 4OR9A 2JTZA 4UPGA 3WHTB 5KTYA 1OSAA 4ORBB 5CSIA 4DIRA 3KF9A 2QACA 4TNCA 3OGNA 2LCPA 3FE8A 3QG5C 3DXLA 2NYMC 1NX1A 1MHOA 2I94A 2Q91A 3SG5A 1B8RA 1SCVA 3S0EA 1DT7B 1FBVA 3FGAC 3D77A 5DICA 2LC5A 1BMOA 2B1UA 3O6BA 2QFPA 1IJ6A 1DMOA 1J7PA 3LK0A 5F6TA 2SCPA 1XFZO 1K94A 1M45A 1G4YR 4GPLB 3BYAA 2LNKA 3OP0A 3TZ1A 4BY4A 1PALA 1BLQA 2M0RA 1XFUO 3K1EA 1B47A 3I5FC 2K0JA 3E3RA 3IB7A 2HYOA 2I7AA 3DVEA 3AAJA 3I5IC 2M9GA 1D1OA 4NDCA 3TDUA 2E6WA 1JC2A 2L2EA 3O4YA 1ZFSA 3CZTX 1CNPA 1KCYA 2JOGA 2KGBC 4H1SA 4JA9A 2OTGC 1E8AA 2EC6C 2WCFA 2DFJA 2R17A 2YEQA 4DS7A 1KBPA 1KQMC 2ZKMX 3EKHA 2A22A 2FOTA 1MXLC 2D8NA 4OVNF 5HYDA 5GTUA 2H61A 1L2OC 1QLSA 1A75B 4PE4A 1WAO1 1DF0A 1SR6C 2LUCA 2ZRTA 3A8RA 3L4AA 4MLWA 4USLA 5I2QA 2CV9A 4OR9B 4DCKA 3GK4X 4ZX2A 2Y1MA 1M39A 1S3MA 1QIWA 1WRLA 1SYMA 2H61C 4MP0A 5JJTA 2KQ6A 1M46A 3BOWA 5CSJA 2KAXA 2EGDA 2P6BB 3SG7A 4YI9A 4AQIA 3AKBA 1QV0A 1IQ5A 3CR5X 3I5FB 2BDXA 2KYFA 3K21A 4DSYA 1TNXA 3QFNA 2MJWB 3I5IB 4DUQA 1Y1AA 1CLMA 2G9BA 2HQWA 1RECA 1LS8A 1XM7A 1UHIA 5F3WA 2OTGB 1K9PA 2EC6B 1NYAA 1TNWA 1RWYA 2NZ0A 1Y1XA 1CB1A 2WDCA 1M31A 1KQMB 2F3ZA 1C07A 1S95A 3CZ0A 4CLNA 1IJ5A 1NCYA 3O78A 1XYDA 1CDMA 2WC5A 5IOHA 4B2OA 1L2OB 1SPYA 2I2RE 1Z2XA 1UTEA 3QFMA 1SR6B 3N7HA 1RTP1 4OZDA 1B1GA 3DZTA 3BUMB 2FJYA 3KBPA 3PM8A 1B4CA 4I5LC 4O5GA 2ZBMA 1QATA 1OOFA 3TUYC 1C7WA 1KWOC 1S3LA 2KI6C 1WLZA 3D75A 2BL0C 1JSAA 2IAEC 1XFRA 2JT3A 1S5GY 3DW8C 1F4OA 4UT3A 1K9KA 3R1VA 5HL1A 3C9FA 1XVJA 2JPOA 2NPPC 2JQ6A 1NNWA 1YR5A 2LMUA 1BT6A 1YRUB 3ZNIA 5I94A 2CTNA 2P71A 1DQEA 1TUZA 2PALA 3H69A 1K96A 2P70A 4FTGA 5AERA 1OMDA 3H64A 3RL3A 1ODBA 1DJZA 1MF8B 1QJTA 4FQTA 5AANA 1W7JB 3R72A 3THOB 3A4UB 4FBKA 3THNA 2QDIA 3S0BA 5AFPA 2XMOA 1NIWA 1UWOA 1Z2WA 4QJ5B 1RFJA 1CFPA 1FI5A 4ORAB 4V0VA 1DJGA 1AUIA 3BUOB 3TS5C 4G9JA 1UHJA 1QXPA 2LMTA 3VROA 2K61A 3DY9A 1K2HA 4ORBA 2LAPA 1QIVA 1YTZC 4CPVA 2BKHB 2O60A 5J3XA 1N65A 2NXFA 4I5LB 2LE9B 5DKQA 2ZN9A 1QV1A 1QVIY 1F54A 3LCPC 3SIAA 1Q80A 3TUYB 3UNWA 1KWOB 5I8NA 1W24A 2BL0B 1CLBA 2WORA 3NHIA 4PHKA 2LUXA 2ZO9B 3AAKA 1QX5B 5HKYA 3S0AA 2ZOAA 1IRJA 2GGMA 3KEVA 4V0WA 4KKZA 1PSBA 1ALWA 4P2YB 4UT3B 1M63B 1II7A 4YGDB 1J7OA 1OMRA 2JZIA 3CTNA 3JTDC 2LVIA 2BBNA 5FYXA 3EG5B 1F70A 1G33A 2LANA 1GQMA 4XJKA 2BCXA 4HD0A 2H8VA 1MQ1A 4ORCB 3TS5B 1BG1A 2WNDA 4INXA 3WNXB 1IIOA 4PDZA 1SSEB 3SG6A 2OPOA 4BY5A 3OHMB 1A75A 4PT1A 2M1UA 1B8LA 2DOQA 1YX8A 1TCOB 1XK4A 5DKRA 1A2XA 1YUTA 3DD4A 3GK1A 4WQ3A 2MA2A 4O24A 1AJ4A 4OV2A 1SL7A 5CSNA 3VRNA 1J55A 1OIDA 2JXLA 3E0JA 1S3PA 1XK4C 1UURA 2HF5A 3H63A 2QEBA 4YGEB 1NCXA 3NSKA 3S0GA 1JK7A 2P6BA 1EG4A 1UHKA 2LM5A 1QX2A 2ZNDA 4I5JA 3EGGA 1TNQA 3L47A 3RL5A 4GAOA 4H2FA 5BPJA 1DJXA 1EJ3A 2RGIA 3DYEA 3JTDB 2HY1A 1SKTA 5C1VA 3PSRA 1F55A 3PALA 2JWWA 2SASA 4P5OE 4QJ3B 5FI6A 3GVEA 2L98A 3TGHA 1UHHA 3I5GC 2DXLA 2CNPA 1G8IA 1Z4HA 1IGVA 4CFRA 3DSDA 3PLFB 1BOCA 3CR2A 4XJKB 2K60A 1SL9A 4MN0A 3ICBA 5DNYA 3IVEA 3SS4A 2M7NA 3DVMA 4MRYA 1GJYA 2KBMA 3IQQA 4M2PA 5HKZA 1KFXS 1U5IB 1LVCD 3D10A 3F45A 4MVFA 2WCKA 2KOTA 3IF7A 3K7VC 1K9UA 2LP3A 4Q7FA 1S5GZ 3PJIA 4DT2A 1HO5A 1FI6A 4O43A 1JF0A 3HX4A 3OBVA 3NGVA 4JQ0D 1XFVO 3VRQA 3BUWB 3H4SE 4GFTA 1GGWA 1SU1A 1JFKA 4H2BA 2K8MB 2K2AA 3RQZA 2JPTA 1LKJA 4I5NC 2IS9A 2G2BA 2L4HA 1CFCA 3H60A 1TWOA 1NUBA 1QWVA 1K95A 1DEKA 5I2OA 1SNLA 1S26D
chains in the Genus database with same CATH topology
1YUUA 2JOJA 5K89A 1YX7A 1MF8A 1CFDA 1WY9A 1ZUZA 1HPUA 2KNEA 3I5GB 1JUOA 1V1FA 1SMGA 1A29A 3EVUA 2PRUA 5HPEA 4YGBB 4ORAA 4AQJA 5DKNA 2KFFA 4V0XA 1KFUL 5IBWA 1PULA 2L4IA 2ZNEA 1S1EA 1QVIZ 3GK2A 2PASA 3LLEA 3PATA 4CIDA 1NCZA 2Z06A 4YGAA 1FJMA 2H2KA 4FBWA 3T1IA 1PVBA 1SY9A 1NX2A 2JNFA 3JVTC 4M2QA 1F4QA 1OOJA 5CPVA 5D7FA 1B7TZ 1EXRA 1S36A 3FIAA 3OX6A 1DGUA 1JF2A 3CLNA 5JPFA 4I5NB 4TUGA 1YUSA 1CDLA 1LA0A 1CM4A 2NXQA 3JVTB 2IE3C 2OS8C 2QJCA 3NSLA 2WDDA 1M63A 1KK8C 1HQVA 4PE7A 4UWQA 2JXCA 3KO0A 1NP8A 3FWCA 3EVRA 2M3WA 2KBIA 3DF0B 4MRXA 2M49B 1R2UA 1XFWO 4PE1A 2WDEA 3IB8A 2HYPA 1N0YA 2MLEC 5PALA 2AAOA 3KPXA 1USHA 3LL8A 3H67A 4ORCA 3QRXA 3BXKA 4IL1A 2K7BA 2ISDA 1N2DA 1IT6A 1TCFA 2E30A 1L7ZA 2JC2A 1EH2A 4KBPA 4NQGA 1UUSA 1K93D 4MOYA 4HRGA 1HP1A 1TCOA 1YURA 5JOLA 1LA3A 3CWGA 4MZLA 3C5WC 3E7AA 2M7LA 4ZCVA 1RJVA 3E7BA 1CLLA 2GV5A 3ZU0A 3DSCA 2NCPA 2GGZA 2KYCA 2F8PA 2I18A 2L50A 1BF5A 2BQ8X 1IKUA 1WARA 1LINA 4GUKA 2BE6A 2OS8B 1ALVA 1FPWA 1QS7A 3IQOA 3P71C 3HCMA 1KK8B 4JA7A 1TN4A 1CFFA 1V73A 5TNCA 1YRTB 2YVTA 1QTXA 1TTXA 4PHNA 1HT9A 2MAZA 4NDDA 3LK1A 4JWQA 3H62B 1SCMC 2LP2A 2DXNA 1B9AA 2KI6D 1JFJA 1CMGA 2TN4A 5HKWA 2O5GA 1AP4A 5INBA 2QPTA 4U8DA 4WQ2A 2LVJA 1MR8A 3PN7C 3LL8B 3SJSA 2KDHA 2Y1NA 4L9MA 5AXIA 1S70A 1SL8A 1NPQA 1U5IA 2BECA 2KSPA 1TRFA 2MLFC 1NSHA 4PCWA 1T71A 1CKKA 2LLTA 1MWNA 2VRGA 1C7VA 1G5BA 1DJIA 2K2FA 1FW4A 1RK9A 3RM1A 4H2GA 4F0ZB 1NX3A 2GJUA 1U32A 1KSMA 1K8UA 2KAYA 2JNXA 2LHIA 1BJFA 1Y6WA 4PE0A 2PMYA 2Q4UA 3TDZA 1FF1A 4PHJA 3RL4A 4HRHA 1J1EA 2BKIB 1YVLA 2ZRSA 3D0YB 1SCMB 1AJ5A 4Q04A 2PSRA 1XO5A 3ICFA 3BQ3A 4YGCB 3N5UA 3NSIA 2V53A 1OZOA 1CDNA 5JJGA 3PN7B 1CDPA 1NWDA 1WDCC 1ZMZA 3RLZA 2KI4C 2M1KB 2USHA 4ZVZA 1J7QA 1T70A 3I5HC 1KQVA 1DVIA 2HQ8A 3NSOA 1QFCA 1OMVA 1Y1UA 2WC8A 3EVVA 2BCBA 1KK7Y 4GBAA 3EGHA 4LU9A 3BUNB 1SBJA 2F33A 2WCBA 3BUXB 2KGRA 4C0LA 4E68A 1RROA 1XA5A 4MEWA 3IVDA 1SRAA 2CBLA 4GNKB 5B8IB 3AV0A 2Q8UA 2JTTA 5HLOA 2LV7A 4WRIA 3ZWHA 1OZSA 2WOSA 3DF0A 4GGFA 1OE9B 3PSNA 4MZKA 1UF3A 3QFOA 3AUZA 2L51A 1MUXA 2WCEA 2JU0A 4M2OA 3CGAA 2Z1AA 4MOVA 1NX0A 1UHNA 4IYPC 2O8GA 4GGFC 4NZVA 2K7DA 1WDCB 2JT8A 5JPEA 2FCEA 2KI4B 4N1GA 4OCIA 5ER4X 4AOMA 5J28A 4ICBA 2LMVA 3H66A 1TOPA 2FCDA 1EL4A 5KU1A 4YKEA 1BR1B 1F71A 3CR4X 4ETOA 3I5HB 4H1YP 2LVVA 3VRRA 4XYNA 5G08A 2WDFA 3PSOA 1IG5A 1J1DA 4LACC 1A4PA 2JT0A 1MXEA 3O2PA 4J6OA 1DJYA 4HSZA 2BBMA 5CSFA 1WRZA 3H68A 2LLUA 2HPSA 2K7CA 1XFXO 1QHWA 1LXFC 1S8EA 2NYLC 5D69A 3SIBA 4A4BA 4QJ4B 4FCXA 4N1FA 3H61A 4D1EA 3M0WA 2JULA 2Y4QA 1SK6D 4M0VA 4YBHB 3HVQA 1H8BA 4N5XA 1S6IA 4ZCUA 2M29A 4MBEA 2NCOA 2KHNA 4C0JA 5HLVA 2L5XB 3NXAA 3CK2A 2Y5IA 3K7WC 3GOFA 1S6JA 1GGZA 1QX7A 1V1GA 2KQYA 3SG2A 5GQQC 5ER5A 4DRWA 1AVSA 1TIZA 3DVKA 1BODA 4FBQA 2AUCA 1AHRA 2LLSA 1H4BA 4R1EA 4H2IA 2COLB 4FQOA 1DF0B 3OB2B 3VRPA 2MRDA 1EG3A 1OI8A 1JBAA 4F0ZA 1OQPA 3CS1A 2R2IA 1X02A 1J7RA 3SG4A 2MHHA 1WLMA 1B8CA 3VGOA 3BOWB 3FS7A 1S3NA 2CXJA 2IE4C 3KHEA 4YI8A 3EK4A 2NLNA 3SG3A 2EHBA 4MSPA 2MBXA 4MZJA 1BU3A 2F2PA 3D0YA 3AKAA 3MSEB 4LTYA 1IH0A 1KFXL 2JRFA 2M8UA 4PHMA 5EQVA 3TDIA 2HETA 1R6PA 2QFRA 1W7IB 4TUIA 4C0KA 1CMFA 2KFGA 5AEQA 2A4JA 3EKJA 4GGNA 4XPNA 1CM1A 1TNPA 2M97A 3OX5A 1QLKA 2FJUB 1XZWA 2KFHA 1ZACA 3PFVA 2F3YA 2LHLA 1KK7Z 1DTLA 3EK7A 1AK8A 5KSZA 1DGVA 1VRKA 2AMIA 3FWBA 3QFKA 1S6CA 2AHDA 1YVHA 2BCAA 3EK8A 4OKHA 2Z72A 2O8AA 1B7TY 2BE4A 1KFUS 4WWLA 2K7OA 5B8IA 4HREE 1QASA 3V4YA 1PRWA 3DVJA 3WXAA 1A03A 5I2LA 1F8HA 1PVAA 1DJWA 1PK0D 2PVBA 2KKNA 2ZFDA 1IWQA 1CTRA 4DHLA 1Y0VH 1PSRA 4NDBA 4A4CA 1DJHA 2L0PA 2LVKA 4PALA 3WHUB 1IQ3A 3D03A 3ZTVA 3OB1B 3C1VA 4UT2A 1K90D 1BR4B 2KAVA 4I5KA 2CT9A 2F2OA 1XFYO 3FLOA 3JYFA 1WRKA 1ZOTB 4JPZB 1JWDA 1OIEA 4CFQA 4YRUA 1KSOA 1UP5A 2BCDA 4O4KA 1AUIB 2CCMA 2ZN8A 1SW8A 4OR9A 2JTZA 4UPGA 3WHTB 5KTYA 1OSAA 4ORBB 5CSIA 4DIRA 3KF9A 2QACA 4TNCA 2LCPA 3QG5C 2NYMC 1NX1A 1MHOA 2I94A 2Q91A 3SG5A 1B8RA 1SCVA 1DT7B 1FBVA 3FGAC 2LC5A 1BMOA 2B1UA 3O6BA 2QFPA 1IJ6A 1DMOA 1J7PA 3LK0A 5F6TA 2SCPA 1XFZO 1K94A 1M45A 1G4YR 4GPLB 3BYAA 2LNKA 3OP0A 3TZ1A 4BY4A 1PALA 1BLQA 2M0RA 1XFUO 1B47A 3I5FC 2K0JA 3E3RA 3IB7A 2HYOA 2I7AA 3DVEA 3AAJA 3I5IC 2M9GA 1D1OA 4NDCA 3TDUA 2E6WA 1JC2A 2L2EA 3O4YA 1ZFSA 3CZTX 1CNPA 1KCYA 2JOGA 2KGBC 4H1SA 4JA9A 2OTGC 1E8AA 2EC6C 2WCFA 2DFJA 2R17A 2YEQA 4DS7A 1KBPA 1KQMC 2ZKMX 3EKHA 2A22A 2FOTA 1MXLC 2D8NA 4OVNF 5HYDA 5GTUA 2H61A 1L2OC 1QLSA 1A75B 4PE4A 1WAO1 1DF0A 1SR6C 2LUCA 2ZRTA 3A8RA 4MLWA 4USLA 5I2QA 2CV9A 4OR9B 4DCKA 3GK4X 4ZX2A 2Y1MA 1M39A 1S3MA 1QIWA 1WRLA 1SYMA 2H61C 4MP0A 5JJTA 2KQ6A 1M46A 3BOWA 5CSJA 2KAXA 2EGDA 2P6BB 3SG7A 4YI9A 4AQIA 3AKBA 1QV0A 1IQ5A 3CR5X 3I5FB 2BDXA 2KYFA 3K21A 4DSYA 1TNXA 3QFNA 2MJWB 3I5IB 4DUQA 1Y1AA 1CLMA 2G9BA 2HQWA 1RECA 1XM7A 1UHIA 5F3WA 2OTGB 1K9PA 2EC6B 1NYAA 1TNWA 1RWYA 2NZ0A 1Y1XA 1CB1A 2WDCA 1M31A 1KQMB 2F3ZA 1C07A 1S95A 4CLNA 1IJ5A 1NCYA 3O78A 1XYDA 1CDMA 5IOHA 4B2OA 1L2OB 1SPYA 2I2RE 1Z2XA 1UTEA 3QFMA 1SR6B 1RTP1 1B1GA 3BUMB 3KBPA 3PM8A 1B4CA 4I5LC 4O5GA 2ZBMA 1QATA 3TUYC 1C7WA 1KWOC 1S3LA 2KI6C 1WLZA 1JSAA 2BL0C 2IAEC 2JT3A 1S5GY 3DW8C 1F4OA 4UT3A 1K9KA 3C9FA 1XVJA 2NPPC 2JQ6A 1NNWA 1YR5A 2LMUA 1BT6A 1YRUB 3ZNIA 2CTNA 2PALA 3H69A 1K96A 4FTGA 3H64A 5AERA 1OMDA 3RL3A 1ODBA 1DJZA 1MF8B 1QJTA 5AANA 1W7JB 3THOB 3A4UB 4FBKA 3THNA 2XMOA 5AFPA 1NIWA 1UWOA 1Z2WA 4QJ5B 1RFJA 1CFPA 1FI5A 4ORAB 4V0VA 1DJGA 1AUIA 3BUOB 3TS5C 4G9JA 1UHJA 1QXPA 2LMTA 3VROA 2K61A 1K2HA 4ORBA 2LAPA 1QIVA 1YTZC 4CPVA 2BKHB 2O60A 5J3XA 1N65A 2NXFA 4I5LB 2LE9B 5DKQA 2ZN9A 1QV1A 1QVIY 1F54A 3LCPC 3SIAA 1Q80A 3TUYB 1KWOB 5I8NA 1W24A 2BL0B 1CLBA 2WORA 4PHKA 2LUXA 2ZO9B 3AAKA 1QX5B 5HKYA 2ZOAA 1IRJA 2GGMA 3KEVA 4V0WA 4KKZA 1PSBA 1ALWA 4P2YB 4UT3B 1M63B 1II7A 4YGDB 1J7OA 1OMRA 2JZIA 3CTNA 3JTDC 2LVIA 2BBNA 5FYXA 1F70A 1G33A 2LANA 1GQMA 4XJKA 2BCXA 4HD0A 1MQ1A 4ORCB 3TS5B 1BG1A 2WNDA 3WNXB 4PDZA 3SG6A 2OPOA 4BY5A 3OHMB 1A75A 2M1UA 1B8LA 2DOQA 1YX8A 1TCOB 1XK4A 5DKRA 1A2XA 1YUTA 3DD4A 3GK1A 4WQ3A 2MA2A 4O24A 1AJ4A 4OV2A 1SL7A 5CSNA 3VRNA 1J55A 1OIDA 2JXLA 3E0JA 1S3PA 1XK4C 1UURA 2HF5A 3H63A 4YGEB 1NCXA 3NSKA 1JK7A 2P6BA 1EG4A 1UHKA 2LM5A 1QX2A 2ZNDA 4I5JA 3EGGA 1TNQA 3RL5A 4GAOA 4H2FA 5BPJA 1DJXA 1EJ3A 2RGIA 3JTDB 2HY1A 1SKTA 5C1VA 3PSRA 1F55A 3PALA 2JWWA 2SASA 4P5OE 4QJ3B 3GVEA 2L98A 3TGHA 1UHHA 3I5GC 2DXLA 2CNPA 1G8IA 3DSDA 1IGVA 4CFRA 3PLFB 1BOCA 3CR2A 4XJKB 1SL9A 4MN0A 3ICBA 5DNYA 3IVEA 2M7NA 3DVMA 4MRYA 1GJYA 2KBMA 3IQQA 4M2PA 5HKZA 1KFXS 1U5IB 1LVCD 3D10A 3F45A 4MVFA 3IF7A 2KOTA 3K7VC 1K9UA 2LP3A 4Q7FA 1S5GZ 4DT2A 1HO5A 1FI6A 4O43A 1JF0A 3HX4A 3VRQA 4JQ0D 1GGWA 1XFVO 1SU1A 3BUWB 3H4SE 4GFTA 1JFKA 4H2BA 2K8MB 2K2AA 3RQZA 2JPTA 1LKJA 4I5NC 2IS9A 2G2BA 2L4HA 1CFCA 3H60A 1NUBA 5I2OA 1K95A 1SNLA 1S26D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUU A;  2JOJ A;  5K89 A;  1YX7 A;  1MF8 A;  1CFD A;  1WY9 A;  1ZUZ A;  1HPU A;  2KNE A;  3I5G B;  1JUO A;  1V1F A;  1SMG A;  1A29 A;  3EVU A;  2PRU A;  5HPE A;  4YGB B;  4ORA A;  4AQJ A;  5DKN A;  2KFF A;  4V0X A;  1KFU L;  5IBW A;  1PUL A;  2L4I A;  2ZNE A;  1S1E A;  1QVI Z;  3GK2 A;  2PAS A;  3LLE A;  3PAT A;  4CID A;  1NCZ A;  2Z06 A;  4YGA A;  1FJM A;  2H2K A;  4FBW A;  3T1I A;  1PVB A;  1SY9 A;  1NX2 A;  2JNF A;  3JVT C;  4M2Q A;  1F4Q A;  1OOJ A;  5CPV A;  5D7F A;  1B7T Z;  1EXR A;  1S36 A;  3FIA A;  3OX6 A;  1DGU A;  1JF2 A;  3CLN A;  5JPF A;  4I5N B;  4TUG A;  1YUS A;  1CDL A;  1LA0 A;  1CM4 A;  2NXQ A;  3JVT B;  2IE3 C;  2OS8 C;  2QJC A;  3NSL A;  2WDD A;  1M63 A;  1KK8 C;  1HQV A;  4PE7 A;  4UWQ A;  2JXC A;  3KO0 A;  1NP8 A;  3FWC A;  3EVR A;  2M3W A;  2KBI A;  3DF0 B;  4MRX A;  2M49 B;  1R2U A;  1XFW O;  4PE1 A;  2WDE A;  3IB8 A;  2HYP A;  1N0Y A;  2MLE C;  5PAL A;  2AAO A;  3KPX A;  1USH A;  3LL8 A;  3H67 A;  4ORC A;  3QRX A;  3BXK A;  4IL1 A;  2K7B A;  2ISD A;  1N2D A;  1IT6 A;  1TCF A;  2E30 A;  1L7Z A;  2JC2 A;  1EH2 A;  4KBP A;  4NQG A;  1UUS A;  1K93 D;  4MOY A;  4HRG A;  1HP1 A;  1TCO A;  1YUR A;  5JOL A;  1LA3 A;  3CWG A;  4MZL A;  3C5W C;  3E7A A;  2M7L A;  4ZCV A;  1RJV A;  3E7B A;  1CLL A;  2GV5 A;  3ZU0 A;  3DSC A;  2NCP A;  2GGZ A;  2KYC A;  2F8P A;  2I18 A;  2L50 A;  1BF5 A;  2BQ8 X;  1IKU A;  1WAR A;  1LIN A;  4GUK A;  2BE6 A;  2OS8 B;  1ALV A;  1FPW A;  1QS7 A;  3IQO A;  3P71 C;  3HCM A;  1KK8 B;  4JA7 A;  1TN4 A;  1CFF A;  1V73 A;  5TNC A;  1YRT B;  2YVT A;  1QTX A;  1TTX A;  4PHN A;  1HT9 A;  2MAZ A;  4NDD A;  3LK1 A;  4JWQ A;  3H62 B;  1SCM C;  2LP2 A;  1B9A A;  2KI6 D;  1JFJ A;  1CMG A;  2TN4 A;  5HKW A;  2O5G A;  1AP4 A;  5INB A;  2QPT A;  4U8D A;  4WQ2 A;  2LVJ A;  1MR8 A;  3PN7 C;  3LL8 B;  3SJS A;  2KDH A;  2Y1N A;  4L9M A;  5AXI A;  1S70 A;  1SL8 A;  1NPQ A;  1U5I A;  2BEC A;  2KSP A;  1TRF A;  2MLF C;  1NSH A;  4PCW A;  1T71 A;  1CKK A;  2LLT A;  1MWN A;  2VRG A;  1C7V A;  1G5B A;  1DJI A;  2K2F A;  1FW4 A;  1RK9 A;  3RM1 A;  4H2G A;  4F0Z B;  1NX3 A;  2GJU A;  1U32 A;  1KSM A;  1K8U A;  2KAY A;  2JNX A;  2LHI A;  1BJF A;  1Y6W A;  4PE0 A;  2PMY A;  2Q4U A;  3TDZ A;  1FF1 A;  4PHJ A;  3RL4 A;  4HRH A;  1J1E A;  2BKI B;  1YVL A;  2ZRS A;  3D0Y B;  1SCM B;  1AJ5 A;  4Q04 A;  2PSR A;  1XO5 A;  3ICF A;  3BQ3 A;  4YGC B;  3N5U A;  3NSI A;  2V53 A;  1OZO A;  1CDN A;  5JJG A;  3PN7 B;  1CDP A;  1NWD A;  1WDC C;  1ZMZ A;  3RLZ A;  2KI4 C;  2M1K B;  2USH A;  4ZVZ A;  1J7Q A;  1T70 A;  3I5H C;  1KQV A;  1DVI A;  2HQ8 A;  3NSO A;  1QFC A;  1OMV A;  1Y1U A;  2WC8 A;  3EVV A;  2BCB A;  1KK7 Y;  4GBA A;  3EGH A;  4LU9 A;  3BUN B;  1SBJ A;  2F33 A;  2WCB A;  3BUX B;  2KGR A;  4C0L A;  4E68 A;  1RRO A;  1XA5 A;  4MEW A;  3IVD A;  1SRA A;  2CBL A;  4GNK B;  5B8I B;  3AV0 A;  2Q8U A;  2JTT A;  5HLO A;  2LV7 A;  4WRI A;  3ZWH A;  1OZS A;  2WOS A;  3DF0 A;  4GGF A;  1OE9 B;  3PSN A;  4MZK A;  1UF3 A;  3QFO A;  3AUZ A;  2L51 A;  1MUX A;  2WCE A;  2JU0 A;  4M2O A;  3CGA A;  2Z1A A;  4MOV A;  1NX0 A;  1UHN A;  4IYP C;  2O8G A;  4GGF C;  4NZV A;  2K7D A;  1WDC B;  2JT8 A;  5JPE A;  2FCE A;  2KI4 B;  4N1G A;  4OCI A;  5ER4 X;  4AOM A;  5J28 A;  4ICB A;  2LMV A;  3H66 A;  1TOP A;  2FCD A;  1EL4 A;  5KU1 A;  4YKE A;  1BR1 B;  1F71 A;  3CR4 X;  4ETO A;  3I5H B;  4H1Y P;  2LVV A;  3VRR A;  4XYN A;  5G08 A;  2WDF A;  3PSO A;  1IG5 A;  1J1D A;  4LAC C;  1A4P A;  2JT0 A;  1MXE A;  3O2P A;  4J6O A;  1DJY A;  4HSZ A;  2BBM A;  5CSF A;  1WRZ A;  3H68 A;  2LLU A;  2HPS A;  2K7C A;  1XFX O;  1QHW A;  1LXF C;  1S8E A;  2NYL C;  5D69 A;  3SIB A;  4A4B A;  4QJ4 B;  4FCX A;  4N1F A;  3H61 A;  4D1E A;  3M0W A;  2JUL A;  2Y4Q A;  1SK6 D;  4M0V A;  4YBH B;  3HVQ A;  1H8B A;  4N5X A;  1S6I A;  4ZCU A;  2M29 A;  4MBE A;  2NCO A;  2KHN A;  4C0J A;  5HLV A;  2L5X B;  3NXA A;  3CK2 A;  2Y5I A;  3K7W C;  3GOF A;  1S6J A;  1GGZ A;  1QX7 A;  1V1G A;  2KQY A;  3SG2 A;  5GQQ C;  5ER5 A;  4DRW A;  1AVS A;  1TIZ A;  3DVK A;  1BOD A;  4FBQ A;  2AUC A;  1AHR A;  2LLS A;  1H4B A;  4R1E A;  4H2I A;  2COL B;  4FQO A;  1DF0 B;  3OB2 B;  3VRP A;  2MRD A;  1EG3 A;  1OI8 A;  1JBA A;  4F0Z A;  1OQP A;  3CS1 A;  2R2I A;  1X02 A;  1J7R A;  3SG4 A;  2MHH A;  1WLM A;  1B8C A;  3VGO A;  3BOW B;  3FS7 A;  1S3N A;  2CXJ A;  2IE4 C;  3KHE A;  4YI8 A;  3EK4 A;  2NLN A;  3SG3 A;  2EHB A;  4MSP A;  2MBX A;  4MZJ A;  1BU3 A;  2F2P A;  3D0Y A;  3AKA A;  3MSE B;  4LTY A;  1IH0 A;  1KFX L;  2JRF A;  2M8U A;  4PHM A;  5EQV A;  3TDI A;  2HET A;  1R6P A;  2QFR A;  1W7I B;  4TUI A;  4C0K A;  1CMF A;  2KFG A;  5AEQ A;  2A4J A;  3EKJ A;  4GGN A;  4XPN A;  1CM1 A;  1TNP A;  2M97 A;  3OX5 A;  1QLK A;  2FJU B;  1XZW A;  2KFH A;  1ZAC A;  3PFV A;  2F3Y A;  2LHL A;  1KK7 Z;  1DTL A;  3EK7 A;  1AK8 A;  5KSZ A;  1DGV A;  1VRK A;  2AMI A;  3FWB A;  3QFK A;  1S6C A;  2AHD A;  1YVH A;  2BCA A;  3EK8 A;  4OKH A;  2Z72 A;  2O8A A;  1B7T Y;  2BE4 A;  1KFU S;  4WWL A;  2K7O A;  5B8I A;  4HRE E;  1QAS A;  3V4Y A;  1PRW A;  3DVJ A;  3WXA A;  1A03 A;  5I2L A;  1F8H A;  1PVA A;  1DJW A;  1PK0 D;  2PVB A;  2KKN A;  2ZFD A;  1IWQ A;  1CTR A;  4DHL A;  1Y0V H;  1PSR A;  4NDB A;  4A4C A;  1DJH A;  2L0P A;  2LVK A;  4PAL A;  3WHU B;  1IQ3 A;  3ZTV A;  3OB1 B;  3C1V A;  4UT2 A;  1K90 D;  1BR4 B;  2KAV A;  4I5K A;  2CT9 A;  2F2O A;  1XFY O;  3JYF A;  1WRK A;  1ZOT B;  4JPZ B;  1JWD A;  1OIE A;  4CFQ A;  4YRU A;  1KSO A;  1UP5 A;  2BCD A;  4O4K A;  1AUI B;  2CCM A;  2ZN8 A;  1SW8 A;  4OR9 A;  2JTZ A;  4UPG A;  3WHT B;  5KTY A;  1OSA A;  4ORB B;  5CSI A;  4DIR A;  3KF9 A;  2QAC A;  4TNC A;  2LCP A;  3QG5 C;  2NYM C;  1NX1 A;  1MHO A;  2I94 A;  2Q91 A;  3SG5 A;  1B8R A;  1SCV A;  1DT7 B;  1FBV A;  3FGA C;  2LC5 A;  1BMO A;  2B1U A;  3O6B A;  2QFP A;  1IJ6 A;  1DMO A;  1J7P A;  3LK0 A;  5F6T A;  2SCP A;  1XFZ O;  1K94 A;  1M45 A;  1G4Y R;  4GPL B;  3BYA A;  2LNK A;  3OP0 A;  3TZ1 A;  4BY4 A;  1PAL A;  1BLQ A;  2M0R A;  1XFU O;  1B47 A;  3I5F C;  2K0J A;  3E3R A;  3IB7 A;  2HYO A;  2I7A A;  3DVE A;  3AAJ A;  3I5I C;  2M9G A;  1D1O A;  4NDC A;  3TDU A;  2E6W A;  1JC2 A;  2L2E A;  3O4Y A;  1ZFS A;  3CZT X;  1CNP A;  1KCY A;  2JOG A;  2KGB C;  4H1S A;  4JA9 A;  2OTG C;  1E8A A;  2EC6 C;  2WCF A;  2DFJ A;  2R17 A;  4DS7 A;  1KBP A;  1KQM C;  2ZKM X;  3EKH A;  2A22 A;  2FOT A;  1MXL C;  2D8N A;  4OVN F;  5HYD A;  5GTU A;  2H61 A;  1L2O C;  1QLS A;  1A75 B;  4PE4 A;  1WAO 1;  1DF0 A;  1SR6 C;  2LUC A;  2ZRT A;  3A8R A;  4MLW A;  4USL A;  5I2Q A;  2CV9 A;  4OR9 B;  4DCK A;  3GK4 X;  4ZX2 A;  2Y1M A;  1M39 A;  1S3M A;  1QIW A;  1WRL A;  1SYM A;  2H61 C;  4MP0 A;  5JJT A;  2KQ6 A;  1M46 A;  3BOW A;  5CSJ A;  2KAX A;  2EGD A;  2P6B B;  3SG7 A;  4YI9 A;  4AQI A;  3AKB A;  1QV0 A;  1IQ5 A;  3CR5 X;  3I5F B;  2BDX A;  2KYF A;  3K21 A;  4DSY A;  1TNX A;  3QFN A;  2MJW B;  3I5I B;  4DUQ A;  1Y1A A;  1CLM A;  2G9B A;  2HQW A;  1REC A;  1XM7 A;  1UHI A;  5F3W A;  2OTG B;  1K9P A;  2EC6 B;  1NYA A;  1TNW A;  1RWY A;  2NZ0 A;  1Y1X A;  1CB1 A;  2WDC A;  1M31 A;  1KQM B;  2F3Z A;  1C07 A;  1S95 A;  4CLN A;  1IJ5 A;  1NCY A;  3O78 A;  1XYD A;  1CDM A;  5IOH A;  4B2O A;  1L2O B;  1SPY A;  2I2R E;  1Z2X A;  1UTE A;  3QFM A;  1SR6 B;  1RTP 1;  1B1G A;  3BUM B;  3KBP A;  3PM8 A;  1B4C A;  4I5L C;  4O5G A;  2ZBM A;  1QAT A;  3TUY C;  1C7W A;  1KWO C;  1S3L A;  2KI6 C;  1WLZ A;  1JSA A;  2BL0 C;  2IAE C;  2JT3 A;  1S5G Y;  3DW8 C;  1F4O A;  4UT3 A;  1K9K A;  3C9F A;  1XVJ A;  2NPP C;  2JQ6 A;  1NNW A;  1YR5 A;  2LMU A;  1BT6 A;  1YRU B;  3ZNI A;  2CTN A;  2PAL A;  3H69 A;  1K96 A;  4FTG A;  3H64 A;  5AER A;  1OMD A;  3RL3 A;  1ODB A;  1DJZ A;  1MF8 B;  1QJT A;  5AAN A;  1W7J B;  3THO B;  3A4U B;  4FBK A;  3THN A;  2XMO A;  5AFP A;  1NIW A;  1UWO A;  1Z2W A;  4QJ5 B;  1RFJ A;  1CFP A;  1FI5 A;  4ORA B;  4V0V A;  1DJG A;  1AUI A;  3BUO B;  3TS5 C;  4G9J A;  1UHJ A;  1QXP A;  2LMT A;  3VRO A;  2K61 A;  1K2H A;  4ORB A;  2LAP A;  1QIV A;  1YTZ C;  4CPV A;  2BKH B;  2O60 A;  5J3X A;  1N65 A;  2NXF A;  4I5L B;  2LE9 B;  5DKQ A;  2ZN9 A;  1QV1 A;  1QVI Y;  1F54 A;  3LCP C;  3SIA A;  1Q80 A;  3TUY B;  1KWO B;  5I8N A;  1W24 A;  2BL0 B;  1CLB A;  2WOR A;  4PHK A;  2LUX A;  3AAK A;  1QX5 B;  5HKY A;  1IRJ A;  2GGM A;  3KEV A;  4V0W A;  4KKZ A;  1PSB A;  1ALW A;  4P2Y B;  4UT3 B;  1M63 B;  1II7 A;  4YGD B;  1J7O A;  1OMR A;  2JZI A;  3CTN A;  3JTD C;  2LVI A;  2BBN A;  5FYX A;  1F70 A;  1G33 A;  2LAN A;  1GQM A;  4XJK A;  2BCX A;  4HD0 A;  1MQ1 A;  4ORC B;  3TS5 B;  1BG1 A;  2WND A;  3WNX B;  4PDZ A;  3SG6 A;  2OPO A;  4BY5 A;  3OHM B;  1A75 A;  2M1U A;  1B8L A;  2DOQ A;  1YX8 A;  1TCO B;  1XK4 A;  5DKR A;  1A2X A;  1YUT A;  3DD4 A;  3GK1 A;  4WQ3 A;  2MA2 A;  1AJ4 A;  4OV2 A;  1SL7 A;  5CSN A;  3VRN A;  1J55 A;  1OID A;  2JXL A;  4O24 A;  1S3P A;  1XK4 C;  1UUR A;  2HF5 A;  3H63 A;  4YGE B;  1NCX A;  3NSK A;  1JK7 A;  2P6B A;  1EG4 A;  1UHK A;  2LM5 A;  1QX2 A;  2ZND A;  4I5J A;  3EGG A;  1TNQ A;  3RL5 A;  4GAO A;  4H2F A;  5BPJ A;  1DJX A;  1EJ3 A;  2RGI A;  3JTD B;  2HY1 A;  1SKT A;  5C1V A;  3PSR A;  1F55 A;  3PAL A;  2JWW A;  2SAS A;  4P5O E;  4QJ3 B;  3GVE A;  2L98 A;  3TGH A;  1UHH A;  3I5G C;  2CNP A;  1G8I A;  3DSD A;  1IGV A;  4CFR A;  3PLF B;  1BOC A;  3CR2 A;  4XJK B;  1SL9 A;  4MN0 A;  3ICB A;  5DNY A;  3IVE A;  2M7N A;  3DVM A;  4MRY A;  1GJY A;  2KBM A;  3IQQ A;  4M2P A;  5HKZ A;  1KFX S;  1U5I B;  1LVC D;  3D10 A;  3F45 A;  4MVF A;  3IF7 A;  2KOT A;  3K7V C;  1K9U A;  2LP3 A;  4Q7F A;  1S5G Z;  4DT2 A;  1HO5 A;  1FI6 A;  4O43 A;  1JF0 A;  3HX4 A;  3VRQ A;  4JQ0 D;  1GGW A;  1XFV O;  1SU1 A;  3BUW B;  3H4S E;  4GFT A;  1JFK A;  4H2B A;  2K8M B;  2K2A A;  3RQZ A;  2JPT A;  1LKJ A;  4I5N C;  2IS9 A;  2G2B A;  2L4H A;  1CFC A;  3H60 A;  1NUB A;  5I2O A;  1K95 A;  1SNL A;  1S26 D; 
#chains in the Genus database with same CATH topology
 1YUU A;  2JOJ A;  5K89 A;  1YX7 A;  1MF8 A;  1CFD A;  1WY9 A;  1ZUZ A;  1HPU A;  2KNE A;  3BFH A;  3I5G B;  1JUO A;  1V1F A;  1SMG A;  1A29 A;  3EVU A;  1OOI X;  2PRU A;  3QME A;  5HPE A;  4YGB B;  4ORA A;  4AQJ A;  5DKN A;  2KFF A;  4V0X A;  1KFU L;  5IBW A;  2YGU A;  1PUL A;  2L4I A;  2ZNE A;  1S1E A;  1QVI Z;  3GK2 A;  2PAS A;  3LLE A;  1C3Y A;  3PAT A;  4CID A;  1NCZ A;  2Z06 A;  4YGA A;  1FJM A;  2H2K A;  4FBW A;  3T1I A;  1PVB A;  1SY9 A;  1NX2 A;  2JNF A;  3JVT C;  4F7F A;  4M2Q A;  1F4Q A;  1OOJ A;  5CPV A;  1Z2C B;  2WCM A;  5D7F A;  1B7T Z;  1EXR A;  1S36 A;  3D78 A;  3FIA A;  3OX6 A;  1DGU A;  1JF2 A;  3CLN A;  5JPF A;  3CZ2 A;  4I5N B;  4TUG A;  1YUS A;  1CDL A;  2QEO A;  1LA0 A;  1CM4 A;  2NXQ A;  3JVT B;  2IE3 C;  2OS8 C;  2QJC A;  3NSL A;  2WDD A;  1M63 A;  1KK8 C;  1HQV A;  4PE7 A;  4UWQ A;  2JXC A;  3KO0 A;  1NP8 A;  3FWC A;  3EVR A;  2M3W A;  2KBI A;  3DF0 B;  2KPH A;  3Q8I A;  4MRX A;  2M49 B;  1R2U A;  1XFW O;  4KYN A;  4PE1 A;  3RZS A;  2WDE A;  3IB8 A;  2HYP A;  1N0Y A;  2MLE C;  5PAL A;  2AAO A;  3KPX A;  1USH A;  3LL8 A;  3H67 A;  4ORC A;  2WC6 A;  1IT6 A;  3QRX A;  3BXK A;  4IL1 A;  2K7B A;  2ISD A;  1N2D A;  3BJH A;  1TCF A;  2E30 A;  1L7Z A;  2JC2 A;  1EH2 A;  4KBP A;  1DEL A;  4NQG A;  1UUS A;  1K93 D;  4MOY A;  3B6X A;  4HRG A;  1HP1 A;  1TCO A;  1YUR A;  5JOL A;  1LA3 A;  2PQL A;  3CWG A;  4MZL A;  3C5W C;  2M7L A;  4ZCV A;  1RJV A;  3E7A A;  3E7B A;  1CLL A;  2GV5 A;  2PYQ A;  3ZU0 A;  3DSC A;  2NCP A;  2GGZ A;  2KYC A;  2F8P A;  2I18 A;  2L50 A;  1BF5 A;  2BQ8 X;  3D73 A;  1IKU A;  1WAR A;  1LIN A;  4GUK A;  2BE6 A;  2OS8 B;  1ALV A;  1FPW A;  1QS7 A;  3IQO A;  3P71 C;  3HCM A;  1KK8 B;  4JA7 A;  1TN4 A;  1CFF A;  1V73 A;  5TNC A;  1YRT B;  2YVT A;  3BFB A;  1OOG A;  3BFA A;  1QTX A;  1TTX A;  4PHN A;  1HT9 A;  2MAZ A;  4NDD A;  3LK1 A;  4JWQ A;  3H62 B;  1SCM C;  2LP2 A;  2DXN A;  1B9A A;  2KI6 D;  1JFJ A;  1CMG A;  2TN4 A;  5D3O A;  5HKW A;  2O5G A;  1AP4 A;  5INB A;  2QPT A;  4U8D A;  4WQ2 A;  2LVJ A;  1MR8 A;  3B86 A;  3PN7 C;  3D76 A;  3LL8 B;  3SJS A;  2KDH A;  2Y1N A;  4L9M A;  5AXI A;  1S70 A;  1SL8 A;  1NPQ A;  1U5I A;  2BEC A;  2KSP A;  1TRF A;  2MLF C;  1NSH A;  4PCW A;  3S0F A;  1T71 A;  1CKK A;  2LLT A;  1MWN A;  2ERB A;  3S0D A;  2VRG A;  1C7V A;  1G5B A;  1DJI A;  2K2F A;  1FW4 A;  1RK9 A;  3RM1 A;  5FI7 A;  4F0Z B;  1NX3 A;  2GJU A;  4H2G A;  1U32 A;  1KSM A;  1K8U A;  2KAY A;  2JNX A;  2L5Y A;  2LHI A;  1BJF A;  1Y6W A;  4PE0 A;  2PMY A;  2Q4U A;  3TDZ A;  1DC1 A;  1FF1 A;  4PHJ A;  3RL4 A;  4HRH A;  1J1E A;  5FI2 A;  2BKI B;  1YVL A;  2ZRS A;  3D0Y B;  1SCM B;  1AJ5 A;  4Q04 A;  2PSR A;  1XO5 A;  3CDN A;  3BQ3 A;  4YGC B;  3ICF A;  3N5U A;  3NSI A;  2BNX A;  1OZO A;  2V53 A;  2QEV A;  3PN7 B;  3VB1 A;  5JJG A;  1CDP A;  1CDN A;  1NWD A;  1WDC C;  1ZMZ A;  3FE6 A;  2KI4 C;  2M1K B;  3RLZ A;  2USH A;  2BAP A;  3CAB A;  4ZVZ A;  1J7Q A;  1T70 A;  3I5H C;  1KQV A;  1DVI A;  2HQ8 A;  3NSO A;  1QFC A;  1OMV A;  3IVT A;  1Y1U A;  2WC8 A;  3EVV A;  2BCB A;  1KK7 Y;  1W9Z A;  3B7A A;  4GBA A;  3EGH A;  4LU9 A;  1C3Z A;  4INW A;  3BUN B;  1SBJ A;  2F33 A;  2WCB A;  3BUX B;  2KGR A;  4C0L A;  4E68 A;  1RRO A;  1XA5 A;  4MEW A;  3IVD A;  1SRA A;  2CBL A;  2WCH A;  4GNK B;  5B8I B;  2GTE A;  3O4X A;  2Q8U A;  3AV0 A;  2JTT A;  5HLO A;  2QEH A;  2LV7 A;  4WRI A;  3ZWH A;  1OZS A;  2KLE A;  2WOS A;  3DF0 A;  4GGF A;  1OE9 B;  3PSN A;  4MZK A;  1UF3 A;  3R1P A;  3QFO A;  3AUZ A;  2L51 A;  1MUX A;  2WCE A;  1P28 A;  1TUJ A;  2JU0 A;  3CGA A;  4M2O A;  2Z1A A;  4MOV A;  1NX0 A;  1T14 A;  1UHN A;  2WCJ A;  2O8G A;  4GGF C;  4IYP C;  4NZV A;  2K7D A;  1WDC B;  2JT8 A;  5JPE A;  2FCE A;  2KI4 B;  4N1G A;  4OCI A;  5ER4 X;  4AOM A;  5J28 A;  4ICB A;  2LMV A;  3H66 A;  1TOP A;  2FCD A;  1EL4 A;  5KU1 A;  4YKE A;  1BR1 B;  4JD9 A;  3CR4 X;  1F71 A;  4ETO A;  3I5H B;  4H1Y P;  2LVV A;  3SS3 A;  4XYN A;  5G08 A;  3VRR A;  2WDF A;  3PSO A;  1ORG A;  1IG5 A;  1J1D A;  4LAC C;  3V2L A;  1GM0 A;  1A4P A;  2JT0 A;  1MXE A;  3O2P A;  4J6O A;  1DJY A;  4HSZ A;  3B88 A;  2BBM A;  5CSF A;  1WRZ A;  3H68 A;  2LLU A;  2HPS A;  2K7C A;  1XFX O;  1QHW A;  1LXF C;  1S8E A;  3B87 A;  2NYL C;  5D69 A;  3SIB A;  4A4B A;  4QJ4 B;  4FCX A;  4N1F A;  3H61 A;  4D1E A;  3M0W A;  2JUL A;  2Y4Q A;  1SK6 D;  3CYZ A;  4YBH B;  4M0V A;  3HVQ A;  1H8B A;  4N5X A;  1S6I A;  4ZCU A;  2M29 A;  4MBE A;  2NCO A;  2L2C A;  2KHN A;  3R1O A;  4C0J A;  4IJ7 A;  5HLV A;  2L5X B;  3CZ1 A;  3NXA A;  3CK2 A;  2Y5I A;  3K7W C;  3GOF A;  1S6J A;  1GGZ A;  1QX7 A;  1V1G A;  2KQY A;  3SG2 A;  5GQQ C;  5ER5 A;  4DRW A;  1AVS A;  1TIZ A;  3DVK A;  2WCL A;  4JKT A;  1BOD A;  4FBQ A;  2AUC A;  1AHR A;  2LLS A;  1H4B A;  4R1E A;  4H2I A;  2COL B;  4FQO A;  1DF0 B;  3OB2 B;  3VRP A;  2MRD A;  1EG3 A;  1OI8 A;  1JBA A;  4F0Z A;  1OQP A;  3CS1 A;  2R2I A;  1X02 A;  1J7R A;  3SG4 A;  2KLD A;  2MHH A;  1WLM A;  1B8C A;  3VGO A;  3BOW B;  3FS7 A;  1S3N A;  2CXJ A;  2IE4 C;  3KHE A;  4YI8 A;  3EK4 A;  2NLN A;  3SG3 A;  2EHB A;  4MSP A;  2MBX A;  4MZJ A;  1BU3 A;  2F2P A;  3D0Y A;  3AKA A;  3MSE B;  4LTY A;  1IH0 A;  1KFX L;  2JRF A;  2M8U A;  4PHM A;  5EQV A;  3TDI A;  2HET A;  1R6P A;  2QFR A;  1W7I B;  4TUI A;  4C0K A;  1CMF A;  2KFG A;  5AEQ A;  2A4J A;  3EKJ A;  4GGN A;  4XPN A;  1CM1 A;  1TNP A;  2M97 A;  3OX5 A;  1QLK A;  2FJU B;  1XZW A;  2KFH A;  1ZAC A;  3PFV A;  2F3Y A;  2LHL A;  1KK7 Z;  3SS5 A;  1DTL A;  3EK7 A;  1OW4 A;  1AK8 A;  5KSZ A;  3L4L A;  1DGV A;  1VRK A;  2AMI A;  3FWB A;  3QFK A;  1S6C A;  2AHD A;  1YVH A;  5EL2 A;  2BCA A;  3EK8 A;  4OKH A;  2Z72 A;  2O8A A;  1B7T Y;  2BE4 A;  1KFU S;  4WWL A;  2K7O A;  5B8I A;  4HRE E;  1QAS A;  3V4Y A;  1PRW A;  3DVJ A;  3WXA A;  1A03 A;  5I2L A;  1F8H A;  1PVA A;  1DJW A;  1PK0 D;  2PVB A;  2KKN A;  2ZFD A;  3FE9 A;  1IWQ A;  1CTR A;  4DHL A;  3D74 A;  1Y0V H;  1PSR A;  4NDB A;  4A4C A;  1DJH A;  2L0P A;  2LVK A;  3PM2 A;  4PAL A;  3WHU B;  1IQ3 A;  3D03 A;  3ZTV A;  3OB1 B;  3C1V A;  4UT2 A;  1K90 D;  1BR4 B;  2KAV A;  4I5K A;  2CT9 A;  2F2O A;  1XFY O;  3NHT A;  3FLO A;  3JYF A;  1WRK A;  1ZOT B;  4JPZ B;  1JWD A;  1OIE A;  4CFQ A;  4YRU A;  1KSO A;  1UP5 A;  2BCD A;  4O4K A;  3UO9 A;  1AUI B;  2CCM A;  2ZN8 A;  1OOH A;  1SW8 A;  4OR9 A;  2JTZ A;  4UPG A;  3WHT B;  5KTY A;  1OSA A;  4ORB B;  5CSI A;  4DIR A;  3KF9 A;  2QAC A;  4TNC A;  3OGN A;  2LCP A;  3FE8 A;  3QG5 C;  3DXL A;  2NYM C;  1NX1 A;  1MHO A;  2I94 A;  2Q91 A;  3SG5 A;  1B8R A;  1SCV A;  3S0E A;  1DT7 B;  1FBV A;  3FGA C;  3D77 A;  5DIC A;  2LC5 A;  1BMO A;  2B1U A;  3O6B A;  2QFP A;  1IJ6 A;  1DMO A;  1J7P A;  3LK0 A;  5F6T A;  2SCP A;  1XFZ O;  1K94 A;  1M45 A;  1G4Y R;  4GPL B;  3BYA A;  2LNK A;  3OP0 A;  3TZ1 A;  4BY4 A;  1PAL A;  1BLQ A;  2M0R A;  1XFU O;  3K1E A;  1B47 A;  3I5F C;  2K0J A;  3E3R A;  3IB7 A;  2HYO A;  2I7A A;  3DVE A;  3AAJ A;  3I5I C;  2M9G A;  1D1O A;  4NDC A;  3TDU A;  2E6W A;  1JC2 A;  2L2E A;  3O4Y A;  1ZFS A;  3CZT X;  1CNP A;  1KCY A;  2JOG A;  2KGB C;  4H1S A;  4JA9 A;  2OTG C;  1E8A A;  2EC6 C;  2WCF A;  2DFJ A;  2R17 A;  2YEQ A;  4DS7 A;  1KBP A;  1KQM C;  2ZKM X;  3EKH A;  2A22 A;  2FOT A;  1MXL C;  2D8N A;  4OVN F;  5HYD A;  5GTU A;  2H61 A;  1L2O C;  1QLS A;  1A75 B;  4PE4 A;  1WAO 1;  1DF0 A;  1SR6 C;  2LUC A;  2ZRT A;  3A8R A;  3L4A A;  4MLW A;  4USL A;  5I2Q A;  2CV9 A;  4OR9 B;  4DCK A;  3GK4 X;  4ZX2 A;  2Y1M A;  1M39 A;  1S3M A;  1QIW A;  1WRL A;  1SYM A;  2H61 C;  4MP0 A;  5JJT A;  2KQ6 A;  1M46 A;  3BOW A;  5CSJ A;  2KAX A;  2EGD A;  2P6B B;  3SG7 A;  4YI9 A;  4AQI A;  3AKB A;  1QV0 A;  1IQ5 A;  3CR5 X;  3I5F B;  2BDX A;  2KYF A;  3K21 A;  4DSY A;  1TNX A;  3QFN A;  2MJW B;  3I5I B;  4DUQ A;  1Y1A A;  1CLM A;  2G9B A;  2HQW A;  1REC A;  1LS8 A;  1XM7 A;  1UHI A;  5F3W A;  2OTG B;  1K9P A;  2EC6 B;  1NYA A;  1TNW A;  1RWY A;  2NZ0 A;  1Y1X A;  1CB1 A;  2WDC A;  1M31 A;  1KQM B;  2F3Z A;  1C07 A;  1S95 A;  3CZ0 A;  4CLN A;  1IJ5 A;  1NCY A;  3O78 A;  1XYD A;  1CDM A;  2WC5 A;  5IOH A;  4B2O A;  1L2O B;  1SPY A;  2I2R E;  1Z2X A;  1UTE A;  3QFM A;  1SR6 B;  3N7H A;  1RTP 1;  4OZD A;  1B1G A;  3DZT A;  3BUM B;  2FJY A;  3KBP A;  3PM8 A;  1B4C A;  4I5L C;  4O5G A;  2ZBM A;  1QAT A;  1OOF A;  3TUY C;  1C7W A;  1KWO C;  1S3L A;  2KI6 C;  1WLZ A;  3D75 A;  2BL0 C;  1JSA A;  2IAE C;  1XFR A;  2JT3 A;  1S5G Y;  3DW8 C;  1F4O A;  4UT3 A;  1K9K A;  3R1V A;  5HL1 A;  3C9F A;  1XVJ A;  2JPO A;  2NPP C;  2JQ6 A;  1NNW A;  1YR5 A;  2LMU A;  1BT6 A;  1YRU B;  3ZNI A;  5I94 A;  2CTN A;  2P71 A;  1DQE A;  1TUZ A;  2PAL A;  3H69 A;  1K96 A;  2P70 A;  4FTG A;  5AER A;  1OMD A;  3H64 A;  3RL3 A;  1ODB A;  1DJZ A;  1MF8 B;  1QJT A;  4FQT A;  5AAN A;  1W7J B;  3R72 A;  3THO B;  3A4U B;  4FBK A;  3THN A;  2QDI A;  3S0B A;  5AFP A;  2XMO A;  1NIW A;  1UWO A;  1Z2W A;  4QJ5 B;  1RFJ A;  1CFP A;  1FI5 A;  4ORA B;  4V0V A;  1DJG A;  1AUI A;  3BUO B;  3TS5 C;  4G9J A;  1UHJ A;  1QXP A;  2LMT A;  3VRO A;  2K61 A;  3DY9 A;  1K2H A;  4ORB A;  2LAP A;  1QIV A;  1YTZ C;  4CPV A;  2BKH B;  2O60 A;  5J3X A;  1N65 A;  2NXF A;  4I5L B;  2LE9 B;  5DKQ A;  2ZN9 A;  1QV1 A;  1QVI Y;  1F54 A;  3LCP C;  3SIA A;  1Q80 A;  3TUY B;  3UNW A;  1KWO B;  5I8N A;  1W24 A;  2BL0 B;  1CLB A;  2WOR A;  3NHI A;  4PHK A;  2LUX A;  2ZO9 B;  3AAK A;  1QX5 B;  5HKY A;  3S0A A;  2ZOA A;  1IRJ A;  2GGM A;  3KEV A;  4V0W A;  4KKZ A;  1PSB A;  1ALW A;  4P2Y B;  4UT3 B;  1M63 B;  1II7 A;  4YGD B;  1J7O A;  1OMR A;  2JZI A;  3CTN A;  3JTD C;  2LVI A;  2BBN A;  5FYX A;  3EG5 B;  1F70 A;  1G33 A;  2LAN A;  1GQM A;  4XJK A;  2BCX A;  4HD0 A;  2H8V A;  1MQ1 A;  4ORC B;  3TS5 B;  1BG1 A;  2WND A;  4INX A;  3WNX B;  1IIO A;  4PDZ A;  1SSE B;  3SG6 A;  2OPO A;  4BY5 A;  3OHM B;  1A75 A;  4PT1 A;  2M1U A;  1B8L A;  2DOQ A;  1YX8 A;  1TCO B;  1XK4 A;  5DKR A;  1A2X A;  1YUT A;  3DD4 A;  3GK1 A;  4WQ3 A;  2MA2 A;  4O24 A;  1AJ4 A;  4OV2 A;  1SL7 A;  5CSN A;  3VRN A;  1J55 A;  1OID A;  2JXL A;  3E0J A;  1S3P A;  1XK4 C;  1UUR A;  2HF5 A;  3H63 A;  2QEB A;  4YGE B;  1NCX A;  3NSK A;  3S0G A;  1JK7 A;  2P6B A;  1EG4 A;  1UHK A;  2LM5 A;  1QX2 A;  2ZND A;  4I5J A;  3EGG A;  1TNQ A;  3L47 A;  3RL5 A;  4GAO A;  4H2F A;  5BPJ A;  1DJX A;  1EJ3 A;  2RGI A;  3DYE A;  3JTD B;  2HY1 A;  1SKT A;  5C1V A;  3PSR A;  1F55 A;  3PAL A;  2JWW A;  2SAS A;  4P5O E;  4QJ3 B;  5FI6 A;  3GVE A;  2L98 A;  3TGH A;  1UHH A;  3I5G C;  2DXL A;  2CNP A;  1G8I A;  1Z4H A;  1IGV A;  4CFR A;  3DSD A;  3PLF B;  1BOC A;  3CR2 A;  4XJK B;  2K60 A;  1SL9 A;  4MN0 A;  3ICB A;  5DNY A;  3IVE A;  3SS4 A;  2M7N A;  3DVM A;  4MRY A;  1GJY A;  2KBM A;  3IQQ A;  4M2P A;  5HKZ A;  1KFX S;  1U5I B;  1LVC D;  3D10 A;  3F45 A;  4MVF A;  2WCK A;  2KOT A;  3IF7 A;  3K7V C;  1K9U A;  2LP3 A;  4Q7F A;  1S5G Z;  3PJI A;  4DT2 A;  1HO5 A;  1FI6 A;  4O43 A;  1JF0 A;  3HX4 A;  3OBV A;  3NGV A;  4JQ0 D;  1XFV O;  3VRQ A;  3BUW B;  3H4S E;  4GFT A;  1GGW A;  1SU1 A;  1JFK A;  4H2B A;  2K8M B;  2K2A A;  3RQZ A;  2JPT A;  1LKJ A;  4I5N C;  2IS9 A;  2G2B A;  2L4H A;  1CFC A;  3H60 A;  1TWO A;  1NUB A;  1QWV A;  1K95 A;  1DEK A;  5I2O A;  1SNL A;  1S26 D; 
#chains in the Genus database with same CATH homology
 1YUU A;  2JOJ A;  5K89 A;  1YX7 A;  1MF8 A;  1CFD A;  1WY9 A;  1ZUZ A;  1HPU A;  2KNE A;  3I5G B;  1JUO A;  1V1F A;  1SMG A;  1A29 A;  3EVU A;  2PRU A;  5HPE A;  4YGB B;  4ORA A;  4AQJ A;  5DKN A;  2KFF A;  4V0X A;  1KFU L;  5IBW A;  1PUL A;  2L4I A;  2ZNE A;  1S1E A;  1QVI Z;  3GK2 A;  2PAS A;  3LLE A;  3PAT A;  4CID A;  1NCZ A;  2Z06 A;  4YGA A;  1FJM A;  2H2K A;  4FBW A;  3T1I A;  1PVB A;  1SY9 A;  1NX2 A;  2JNF A;  3JVT C;  4M2Q A;  1F4Q A;  1OOJ A;  5CPV A;  5D7F A;  1B7T Z;  1EXR A;  1S36 A;  3FIA A;  3OX6 A;  1DGU A;  1JF2 A;  3CLN A;  5JPF A;  4I5N B;  4TUG A;  1YUS A;  1CDL A;  1LA0 A;  1CM4 A;  2NXQ A;  3JVT B;  2IE3 C;  2OS8 C;  2QJC A;  3NSL A;  2WDD A;  1M63 A;  1KK8 C;  1HQV A;  4PE7 A;  4UWQ A;  2JXC A;  3KO0 A;  1NP8 A;  3FWC A;  3EVR A;  2M3W A;  2KBI A;  3DF0 B;  4MRX A;  2M49 B;  1R2U A;  1XFW O;  4PE1 A;  2WDE A;  3IB8 A;  2HYP A;  1N0Y A;  2MLE C;  5PAL A;  2AAO A;  3KPX A;  1USH A;  3LL8 A;  3H67 A;  4ORC A;  3QRX A;  3BXK A;  4IL1 A;  2K7B A;  2ISD A;  1N2D A;  1IT6 A;  1TCF A;  2E30 A;  1L7Z A;  2JC2 A;  1EH2 A;  4KBP A;  4NQG A;  1UUS A;  1K93 D;  4MOY A;  4HRG A;  1HP1 A;  1TCO A;  1YUR A;  5JOL A;  1LA3 A;  3CWG A;  4MZL A;  3C5W C;  3E7A A;  2M7L A;  4ZCV A;  1RJV A;  3E7B A;  1CLL A;  2GV5 A;  3ZU0 A;  3DSC A;  2NCP A;  2GGZ A;  2KYC A;  2F8P A;  2I18 A;  2L50 A;  1BF5 A;  2BQ8 X;  1IKU A;  1WAR A;  1LIN A;  4GUK A;  2BE6 A;  2OS8 B;  1ALV A;  1FPW A;  1QS7 A;  3IQO A;  3P71 C;  3HCM A;  1KK8 B;  4JA7 A;  1TN4 A;  1CFF A;  1V73 A;  5TNC A;  1YRT B;  2YVT A;  1QTX A;  1TTX A;  4PHN A;  1HT9 A;  2MAZ A;  4NDD A;  3LK1 A;  4JWQ A;  3H62 B;  1SCM C;  2LP2 A;  2DXN A;  1B9A A;  2KI6 D;  1JFJ A;  1CMG A;  2TN4 A;  5HKW A;  2O5G A;  1AP4 A;  5INB A;  2QPT A;  4U8D A;  4WQ2 A;  2LVJ A;  1MR8 A;  3PN7 C;  3LL8 B;  3SJS A;  2KDH A;  2Y1N A;  4L9M A;  5AXI A;  1S70 A;  1SL8 A;  1NPQ A;  1U5I A;  2BEC A;  2KSP A;  1TRF A;  2MLF C;  1NSH A;  4PCW A;  1T71 A;  1CKK A;  2LLT A;  1MWN A;  2VRG A;  1C7V A;  1G5B A;  1DJI A;  2K2F A;  1FW4 A;  1RK9 A;  3RM1 A;  4H2G A;  4F0Z B;  1NX3 A;  2GJU A;  1U32 A;  1KSM A;  1K8U A;  2KAY A;  2JNX A;  2LHI A;  1BJF A;  1Y6W A;  4PE0 A;  2PMY A;  2Q4U A;  3TDZ A;  1FF1 A;  4PHJ A;  3RL4 A;  4HRH A;  1J1E A;  2BKI B;  1YVL A;  2ZRS A;  3D0Y B;  1SCM B;  1AJ5 A;  4Q04 A;  2PSR A;  1XO5 A;  3ICF A;  3BQ3 A;  4YGC B;  3N5U A;  3NSI A;  2V53 A;  1OZO A;  1CDN A;  5JJG A;  3PN7 B;  1CDP A;  1NWD A;  1WDC C;  1ZMZ A;  3RLZ A;  2KI4 C;  2M1K B;  2USH A;  4ZVZ A;  1J7Q A;  1T70 A;  3I5H C;  1KQV A;  1DVI A;  2HQ8 A;  3NSO A;  1QFC A;  1OMV A;  1Y1U A;  2WC8 A;  3EVV A;  2BCB A;  1KK7 Y;  4GBA A;  3EGH A;  4LU9 A;  3BUN B;  1SBJ A;  2F33 A;  2WCB A;  3BUX B;  2KGR A;  4C0L A;  4E68 A;  1RRO A;  1XA5 A;  4MEW A;  3IVD A;  1SRA A;  2CBL A;  4GNK B;  5B8I B;  3AV0 A;  2Q8U A;  2JTT A;  5HLO A;  2LV7 A;  4WRI A;  3ZWH A;  1OZS A;  2WOS A;  3DF0 A;  4GGF A;  1OE9 B;  3PSN A;  4MZK A;  1UF3 A;  3QFO A;  3AUZ A;  2L51 A;  1MUX A;  2WCE A;  2JU0 A;  4M2O A;  3CGA A;  2Z1A A;  4MOV A;  1NX0 A;  1UHN A;  4IYP C;  2O8G A;  4GGF C;  4NZV A;  2K7D A;  1WDC B;  2JT8 A;  5JPE A;  2FCE A;  2KI4 B;  4N1G A;  4OCI A;  5ER4 X;  4AOM A;  5J28 A;  4ICB A;  2LMV A;  3H66 A;  1TOP A;  2FCD A;  1EL4 A;  5KU1 A;  4YKE A;  1BR1 B;  1F71 A;  3CR4 X;  4ETO A;  3I5H B;  4H1Y P;  2LVV A;  3VRR A;  4XYN A;  5G08 A;  2WDF A;  3PSO A;  1IG5 A;  1J1D A;  4LAC C;  1A4P A;  2JT0 A;  1MXE A;  3O2P A;  4J6O A;  1DJY A;  4HSZ A;  2BBM A;  5CSF A;  1WRZ A;  3H68 A;  2LLU A;  2HPS A;  2K7C A;  1XFX O;  1QHW A;  1LXF C;  1S8E A;  2NYL C;  5D69 A;  3SIB A;  4A4B A;  4QJ4 B;  4FCX A;  4N1F A;  3H61 A;  4D1E A;  3M0W A;  2JUL A;  2Y4Q A;  1SK6 D;  4M0V A;  4YBH B;  3HVQ A;  1H8B A;  4N5X A;  1S6I A;  4ZCU A;  2M29 A;  4MBE A;  2NCO A;  2KHN A;  4C0J A;  5HLV A;  2L5X B;  3NXA A;  3CK2 A;  2Y5I A;  3K7W C;  3GOF A;  1S6J A;  1GGZ A;  1QX7 A;  1V1G A;  2KQY A;  3SG2 A;  5GQQ C;  5ER5 A;  4DRW A;  1AVS A;  1TIZ A;  3DVK A;  1BOD A;  4FBQ A;  2AUC A;  1AHR A;  2LLS A;  1H4B A;  4R1E A;  4H2I A;  2COL B;  4FQO A;  1DF0 B;  3OB2 B;  3VRP A;  2MRD A;  1EG3 A;  1OI8 A;  1JBA A;  4F0Z A;  1OQP A;  3CS1 A;  2R2I A;  1X02 A;  1J7R A;  3SG4 A;  2MHH A;  1WLM A;  1B8C A;  3VGO A;  3BOW B;  3FS7 A;  1S3N A;  2CXJ A;  2IE4 C;  3KHE A;  4YI8 A;  3EK4 A;  2NLN A;  3SG3 A;  2EHB A;  4MSP A;  2MBX A;  4MZJ A;  1BU3 A;  2F2P A;  3D0Y A;  3AKA A;  3MSE B;  4LTY A;  1IH0 A;  1KFX L;  2JRF A;  2M8U A;  4PHM A;  5EQV A;  3TDI A;  2HET A;  1R6P A;  2QFR A;  1W7I B;  4TUI A;  4C0K A;  1CMF A;  2KFG A;  5AEQ A;  2A4J A;  3EKJ A;  4GGN A;  4XPN A;  1CM1 A;  1TNP A;  2M97 A;  3OX5 A;  1QLK A;  2FJU B;  1XZW A;  2KFH A;  1ZAC A;  3PFV A;  2F3Y A;  2LHL A;  1KK7 Z;  1DTL A;  3EK7 A;  1AK8 A;  5KSZ A;  1DGV A;  1VRK A;  2AMI A;  3FWB A;  3QFK A;  1S6C A;  2AHD A;  1YVH A;  2BCA A;  3EK8 A;  4OKH A;  2Z72 A;  2O8A A;  1B7T Y;  2BE4 A;  1KFU S;  4WWL A;  2K7O A;  5B8I A;  4HRE E;  1QAS A;  3V4Y A;  1PRW A;  3DVJ A;  3WXA A;  1A03 A;  5I2L A;  1F8H A;  1PVA A;  1DJW A;  1PK0 D;  2PVB A;  2KKN A;  2ZFD A;  1IWQ A;  1CTR A;  4DHL A;  1Y0V H;  1PSR A;  4NDB A;  4A4C A;  1DJH A;  2L0P A;  2LVK A;  4PAL A;  3WHU B;  1IQ3 A;  3D03 A;  3ZTV A;  3OB1 B;  3C1V A;  4UT2 A;  1K90 D;  1BR4 B;  2KAV A;  4I5K A;  2CT9 A;  2F2O A;  1XFY O;  3FLO A;  3JYF A;  1WRK A;  1ZOT B;  4JPZ B;  1JWD A;  1OIE A;  4CFQ A;  4YRU A;  1KSO A;  1UP5 A;  2BCD A;  4O4K A;  1AUI B;  2CCM A;  2ZN8 A;  1SW8 A;  4OR9 A;  2JTZ A;  4UPG A;  3WHT B;  5KTY A;  1OSA A;  4ORB B;  5CSI A;  4DIR A;  3KF9 A;  2QAC A;  4TNC A;  2LCP A;  3QG5 C;  2NYM C;  1NX1 A;  1MHO A;  2I94 A;  2Q91 A;  3SG5 A;  1B8R A;  1SCV A;  1DT7 B;  1FBV A;  3FGA C;  2LC5 A;  1BMO A;  2B1U A;  3O6B A;  2QFP A;  1IJ6 A;  1DMO A;  1J7P A;  3LK0 A;  5F6T A;  2SCP A;  1XFZ O;  1K94 A;  1M45 A;  1G4Y R;  4GPL B;  3BYA A;  2LNK A;  3OP0 A;  3TZ1 A;  4BY4 A;  1PAL A;  1BLQ A;  2M0R A;  1XFU O;  1B47 A;  3I5F C;  2K0J A;  3E3R A;  3IB7 A;  2HYO A;  2I7A A;  3DVE A;  3AAJ A;  3I5I C;  2M9G A;  1D1O A;  4NDC A;  3TDU A;  2E6W A;  1JC2 A;  2L2E A;  3O4Y A;  1ZFS A;  3CZT X;  1CNP A;  1KCY A;  2JOG A;  2KGB C;  4H1S A;  4JA9 A;  2OTG C;  1E8A A;  2EC6 C;  2WCF A;  2DFJ A;  2R17 A;  2YEQ A;  4DS7 A;  1KBP A;  1KQM C;  2ZKM X;  3EKH A;  2A22 A;  2FOT A;  1MXL C;  2D8N A;  4OVN F;  5HYD A;  5GTU A;  2H61 A;  1L2O C;  1QLS A;  1A75 B;  4PE4 A;  1WAO 1;  1DF0 A;  1SR6 C;  2LUC A;  2ZRT A;  3A8R A;  4MLW A;  4USL A;  5I2Q A;  2CV9 A;  4OR9 B;  4DCK A;  3GK4 X;  4ZX2 A;  2Y1M A;  1M39 A;  1S3M A;  1QIW A;  1WRL A;  1SYM A;  2H61 C;  4MP0 A;  5JJT A;  2KQ6 A;  1M46 A;  3BOW A;  5CSJ A;  2KAX A;  2EGD A;  2P6B B;  3SG7 A;  4YI9 A;  4AQI A;  3AKB A;  1QV0 A;  1IQ5 A;  3CR5 X;  3I5F B;  2BDX A;  2KYF A;  3K21 A;  4DSY A;  1TNX A;  3QFN A;  2MJW B;  3I5I B;  4DUQ A;  1Y1A A;  1CLM A;  2G9B A;  2HQW A;  1REC A;  1XM7 A;  1UHI A;  5F3W A;  2OTG B;  1K9P A;  2EC6 B;  1NYA A;  1TNW A;  1RWY A;  2NZ0 A;  1Y1X A;  1CB1 A;  2WDC A;  1M31 A;  1KQM B;  2F3Z A;  1C07 A;  1S95 A;  4CLN A;  1IJ5 A;  1NCY A;  3O78 A;  1XYD A;  1CDM A;  5IOH A;  4B2O A;  1L2O B;  1SPY A;  2I2R E;  1Z2X A;  1UTE A;  3QFM A;  1SR6 B;  1RTP 1;  1B1G A;  3BUM B;  3KBP A;  3PM8 A;  1B4C A;  4I5L C;  4O5G A;  2ZBM A;  1QAT A;  3TUY C;  1C7W A;  1KWO C;  1S3L A;  2KI6 C;  1WLZ A;  1JSA A;  2BL0 C;  2IAE C;  2JT3 A;  1S5G Y;  3DW8 C;  1F4O A;  4UT3 A;  1K9K A;  3C9F A;  1XVJ A;  2NPP C;  2JQ6 A;  1NNW A;  1YR5 A;  2LMU A;  1BT6 A;  1YRU B;  3ZNI A;  2CTN A;  2PAL A;  3H69 A;  1K96 A;  4FTG A;  3H64 A;  5AER A;  1OMD A;  3RL3 A;  1ODB A;  1DJZ A;  1MF8 B;  1QJT A;  5AAN A;  1W7J B;  3THO B;  3A4U B;  4FBK A;  3THN A;  2XMO A;  5AFP A;  1NIW A;  1UWO A;  1Z2W A;  4QJ5 B;  1RFJ A;  1CFP A;  1FI5 A;  4ORA B;  4V0V A;  1DJG A;  1AUI A;  3BUO B;  3TS5 C;  4G9J A;  1UHJ A;  1QXP A;  2LMT A;  3VRO A;  2K61 A;  1K2H A;  4ORB A;  2LAP A;  1QIV A;  1YTZ C;  4CPV A;  2BKH B;  2O60 A;  5J3X A;  1N65 A;  2NXF A;  4I5L B;  2LE9 B;  5DKQ A;  2ZN9 A;  1QV1 A;  1QVI Y;  1F54 A;  3LCP C;  3SIA A;  1Q80 A;  3TUY B;  1KWO B;  5I8N A;  1W24 A;  2BL0 B;  1CLB A;  2WOR A;  4PHK A;  2LUX A;  2ZO9 B;  3AAK A;  1QX5 B;  5HKY A;  2ZOA A;  1IRJ A;  2GGM A;  3KEV A;  4V0W A;  4KKZ A;  1PSB A;  1ALW A;  4P2Y B;  4UT3 B;  1M63 B;  1II7 A;  4YGD B;  1J7O A;  1OMR A;  2JZI A;  3CTN A;  3JTD C;  2LVI A;  2BBN A;  5FYX A;  1F70 A;  1G33 A;  2LAN A;  1GQM A;  4XJK A;  2BCX A;  4HD0 A;  1MQ1 A;  4ORC B;  3TS5 B;  1BG1 A;  2WND A;  3WNX B;  4PDZ A;  3SG6 A;  2OPO A;  4BY5 A;  3OHM B;  1A75 A;  2M1U A;  1B8L A;  2DOQ A;  1YX8 A;  1TCO B;  1XK4 A;  5DKR A;  1A2X A;  1YUT A;  3DD4 A;  3GK1 A;  4WQ3 A;  2MA2 A;  4O24 A;  1AJ4 A;  4OV2 A;  1SL7 A;  5CSN A;  3VRN A;  1J55 A;  1OID A;  2JXL A;  3E0J A;  1S3P A;  1XK4 C;  1UUR A;  2HF5 A;  3H63 A;  4YGE B;  1NCX A;  3NSK A;  1JK7 A;  2P6B A;  1EG4 A;  1UHK A;  2LM5 A;  1QX2 A;  2ZND A;  4I5J A;  3EGG A;  1TNQ A;  3RL5 A;  4GAO A;  4H2F A;  5BPJ A;  1DJX A;  1EJ3 A;  2RGI A;  3JTD B;  2HY1 A;  1SKT A;  5C1V A;  3PSR A;  1F55 A;  3PAL A;  2JWW A;  2SAS A;  4P5O E;  4QJ3 B;  3GVE A;  2L98 A;  3TGH A;  1UHH A;  3I5G C;  2DXL A;  2CNP A;  1G8I A;  3DSD A;  1IGV A;  4CFR A;  3PLF B;  1BOC A;  3CR2 A;  4XJK B;  1SL9 A;  4MN0 A;  3ICB A;  5DNY A;  3IVE A;  2M7N A;  3DVM A;  4MRY A;  1GJY A;  2KBM A;  3IQQ A;  4M2P A;  5HKZ A;  1KFX S;  1U5I B;  1LVC D;  3D10 A;  3F45 A;  4MVF A;  3IF7 A;  2KOT A;  3K7V C;  1K9U A;  2LP3 A;  4Q7F A;  1S5G Z;  4DT2 A;  1HO5 A;  1FI6 A;  4O43 A;  1JF0 A;  3HX4 A;  3VRQ A;  4JQ0 D;  1GGW A;  1XFV O;  1SU1 A;  3BUW B;  3H4S E;  4GFT A;  1JFK A;  4H2B A;  2K8M B;  2K2A A;  3RQZ A;  2JPT A;  1LKJ A;  4I5N C;  2IS9 A;  2G2B A;  2L4H A;  1CFC A;  3H60 A;  1NUB A;  5I2O A;  1K95 A;  1SNL A;  1S26 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...