4IL1A

Crystal structure of the rat calcineurin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
647
structure length
529
Chain Sequence
b'SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICFEEAKGLDRINERMPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, Calcineurin subunit B type 1, Serine/threonine-p
publication title Structural basis of calcineurin activation by calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 174
structure length 529
sequence length 647
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4il1A01
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4il1A02
3BUXB 4U8DA 1MF8A 4MOYA 4F0ZA 1S5GY 2B1UA 2LLTA 4GFTA 2BDXA 2TN4A 1WY9A 1K96A 2QPTA 1F55A 3AKAA 3EVRA 4YGCB 3T1IA 1RK9A 2MRDA 2L4IA 2VRGA 2L2EA 4MRYA 5AEQA 4O24A 3LCPC 2BECA 4M0VA 2ZNDA 1KQMB 3E3RA 3I5IB 1OI8A 2F3ZA 3WNXB 2OPOA 4MBEA 2AAOA 1WDCC 3NSOA 5AXIA 1HT9A 1ZMZA 2K7CA 2O60A 3SG6A 5DKRA 2Q8UA 2FCDA 1TOPA 4UT3B 2NCPA 1UF3A 2K2AA 4ZCVA 1TIZA 2IE4C 1Q80A 2LLUA 1KK7Z 1CM4A 1XFXO 2MA2A 4WQ2A 1QXPA 1WLZA 1FPWA 2MJWB 3I5FC 1AUIB 2QACA 2WDDA 1BR4B 5INBA 4YRUA 1K93D 1IWQA 3PFVA 1U5IB 1FI5A 1WARA 4O4KA 2MLFC 1B9AA 1KWOC 1BT6A 2YVTA 1XFVO 3I5HC 2EHBA 1LKJA 1IRJA 1PRWA 2M7LA 1G33A 1MF8B 1PULA 4GNKB 4F0ZB 4UT2A 5IOHA 4USLA 4XPNA 3AAJA 1J7QA 2BCAA 1K9KA 2BL0C 1SL7A 3H66A 3D0YA 3TGHA 2KFGA 1LVCD 2KI6C 2JTZA 1DT7B 1YRTB 2O5GA 3H61A 3EK7A 2HF5A 4C0KA 2Y5IA 3CZTX 3SG2A 2Y1MA 3LK1A 2NPPC 4XJKA 4DSYA 1V1FA 5DKNA 1BR1B 4HRGA 1L2OC 2G2BA 3AV0A 2BCBA 1Y0VH 2FCEA 4ICBA 3PN7C 2DFJA 4MZLA 2LMUA 1S6JA 1KFXL 3KEVA 2O8AA 1S3NA 3QFKA 2H61A 1IT6A 4DS7A 3CR2A 1XFZO 2LVVA 3CK2A 4WWLA 1A75A 1WLMA 2JXCA 1QIVA 2L4HA 4I5JA 2L51A 4PE1A 4YGBB 2JC2A 4V0XA 1W7JB 3CR4X 2Z06A 1L7ZA 3IQOA 3OP0A 1QV1A 2K7BA 1UHHA 1LA0A 2E6WA 1TNXA 3VRRA 4M2QA 5CSJA 3A4UB 3THNA 1OIDA 4H1SA 1K95A 3D0YB 3EKJA 2M49B 4UWQA 4QJ4B 3ZTVA 5I2QA 2BE4A 2IS9A 4A4CA 1TCFA 1CB1A 2KAXA 2P6BA 1EG4A 2BQ8X 2BKHB 1QX5B 3DVEA 1IG5A 5I2OA 3QFOA 4QJ5B 5D69A 3IQQA 3EVVA 1YR5A 2EGDA 1H8BA 1UWOA 4ZVZA 1QIWA 1W7IB 3SG7A 1NIWA 2ZN8A 4PE7A 3QRXA 1SBJA 1M45A 5HLOA 1K8UA 1MR8A 1OQPA 3HX4A 5AFPA 3BOWA 1TRFA 4CIDA 5I8NA 1CLBA 1EJ3A 2LMTA 2Y4QA 5IBWA 1A75B 1K90D 1Y1UA 2AMIA 1DJIA 1YRUB 4FBWA 5HPEA 1YVHA 3LL8A 2GJUA 2CV9A 1ALWA 1FJMA 4MZKA 4DCKA 1S3MA 2LP2A 1J1EA 5DKQA 1DGVA 1M63A 2OTGB 2KI6D 2RGIA 4JQ0D 4ZCUA 1B7TZ 2JT8A 5GQQC 3VRPA 5BPJA 1CMGA 4MSPA 3CR5X 2PASA 1CDLA 3JYFA 1YX7A 5ER4X 1G5BA 1KFUS 1XM7A 1XZWA 5FYXA 1NX2A 2COLB 4GBAA 1QV0A 1DJGA 1AVSA 4GAOA 4GGFC 3IVDA 1RFJA 3RL5A 1S3PA 1G8IA 2KYCA 1S6IA 1SR6B 1S5GZ 4GUKA 2G9BA 1B47A 1NPQA 2I2RE 2PSRA 3LK0A 3VGOA 2ZNEA 3EGHA 4Q7FA 1SCMB 1XYDA 3PM8A 1OSAA 2ZKMX 4M2OA 3IVEA 2JTTA 1SRAA 1XK4C 1DF0A 4C0LA 3BOWB 1QHWA 2LVKA 3H64A 3KHEA 4P2YB 2KAVA 5J28A 2F2OA 2BE6A 1DJHA 3ICBA 1ZUZA 1OE9B 3LL8B 3WXAA 2LVIA 2M1UA 1PVBA 5HKYA 1HQVA 4XYNA 4JA9A 1SY9A 3DW8C 2KBIA 3ZU0A 1J7OA 2M9GA 2WCBA 1BF5A 3TDUA 2LUCA 2LNKA 4A4BA 4D1EA 3PATA 4QJ3B 2NYLC 3H67A 3K7VC 1K94A 1OZSA 1QS7A 2ZRTA 4G9JA 1M46A 1TCOA 1UP5A 4H2BA 4CLNA 4MP0A 4CPVA 1WRKA 2JWWA 3I5FB 2KQ6A 1OMRA 1KCYA 4ORCA 5EQVA 1AP4A 4H2GA 3CLNA 4HREE 1QATA 1S8EA 2LLSA 1II7A 1KWOB 1SKTA 1XVJA 3RLZA 1GQMA 3I5HB 1IGVA 2HY1A 1FF1A 3NSLA 3EKHA 1BOCA 2WDCA 1DF0B 1F4QA 4OKHA 2LMVA 1CLMA 5JJTA 4DHLA 4N1GA 2A4JA 3CS1A 5D7FA 1WRLA 2O8GA 1KK8B 3I5IC 4UPGA 1T71A 2BL0B 4ORAA 1XFYO 4YI9A 2CTNA 3P71C 3KF9A 1RWYA 2LP3A 1NYAA 1MQ1A 1J7RA 3GOFA 4C0JA 2JRFA 3O6BA 3NSKA 4I5LC 5JPFA 2SASA 1CFPA 4BY4A 1J7PA 1S95A 5CSFA 1UHNA 1L2OB 3PN7B 1B1GA 4N5XA 2IAEC 4DIRA 2KAYA 1XO5A 1CLLA 2V53A 1D1OA 1YTZC 1H4BA 1WRZA 2BBNA 4JWQA 1B8LA 2ZN9A 1N0YA 2JNFA 3HCMA 3DF0A 4YGDB 4TNCA 4I5NC 4PHNA 2WDFA 5K89A 5CPVA 2WDEA 4V0WA 2NZ0A 2OS8C 1JF2A 1PK0D 1SYMA 3KPXA 1PVAA 4MOVA 2IE3C 4GGNA 3RQZA 3JTDC 2ISDA 4DT2A 5ER5A 1M39A 1QLSA 1DJXA 2WCFA 4PHMA 1KQVA 2Q4UA 2SCPA 4ORAB 2HPSA 5KU1A 1F70A 2NYMC 3DVKA 1GJYA 2Q91A 4NDBA 2AUCA 4CFQA 2LM5A 2F8PA 4HRHA 4GGFA 2K61A 1BU3A 3O2PA 3O4YA 1CFDA 2I18A 4MZJA 5B8IA 1QASA 1V73A 3K21A 1CDPA 4XJKB 2H2KA 2WOSA 1NWDA 1RTP1 2KI4C 4KKZA 1XK4A 1BLQA 1CFCA 1OIEA 1SPYA 2A22A 1CNPA 3IB8A 3PSOA 4AQJA 2NXQA 4FBQA 5AANA 4FCXA 3IF7A 2EC6C 1CDMA 2NXFA 4PDZA 3DF0B 2M8UA 5CSNA 2CXJA 4NDDA 5C1VA 4NZVA 1Y1XA 3TS5C 3H60A 5TNCA 3TUYB 5HKWA 1YUSA 1NP8A 2DOQA 2Z72A 2WNDA 1EL4A 2HYPA 1ZOTB 2KFFA 3KO0A 1C7VA 4AOMA 3AKBA 3EGGA 1NSHA 3PSNA 3O78A 3NXAA 5HYDA 4ORBA 1LXFC 5G08A 2MLEC 2LVJA 1IH0A 2GGMA 3SG4A 1R6PA 3FWBA 3BYAA 4LACC 2JOGA 3JVTC 1QVIY 2P6BB 2L0PA 5B8IB 1S36A 1S1EA 5JJGA 1OZOA 5F6TA 3DVJA 3QG5C 4PE4A 1QLKA 3ZNIA 2NLNA 1N65A 3BXKA 1JWDA 3H69A 4O5GA 2M29A 3OX6A 1BJFA 3F45A 3TZ1A 1NCYA 4FQOA 2L5XB 1BG1A 2JT3A 1QX2A 2KGBC 2CCMA 1LA3A 5F3WA 3PLFB 1DVIA 2K8MB 1UURA 3D10A 4OVNF 4TUIA 3FWCA 3VROA 4DUQA 1QFCA 1JUOA 3SG5A 4UT3A 2F3YA 1KSMA 2ZBMA 3SIBA 1B8RA 4DRWA 2HQWA 2LC5A 1K9PA 3PSRA 4MRXA 1WDCB 3BUNB 3CTNA 4YGEB 5HLVA 1M63B 2Y1NA 1CKKA 4BY5A 3NSIA 3FGAC 1B7TY 4O43A 1OMDA 2F33A 2R2IA 1AUIA 1DJZA 3BUMB 1JFKA 2K7DA 3E7AA 3K7WC 3QFMA 1QTXA 3RL4A 1PSBA 1ZACA 2K0JA 5CSIA 1C07A 1WAO1 3BUOB 1LINA 4LU9A 1RROA 3THOB 1KFUL 3OB2B 3VRNA 1A29A 5JOLA 4CFRA 3BUWB 1UHJA 4TUGA 1ZFSA 3DVMA 1AHRA 3EVUA 1A4PA 1JBAA 4YKEA 3I5GC 2KFHA 2QFPA 4J6OA 1MWNA 2HQ8A 3PALA 1BODA 1YUUA 4NQGA 1FBVA 2JQ6A 2LV7A 1TNPA 2PVBA 4PHJA 1CFFA 1ODBA 1IKUA 2D8NA 2FOTA 3GK1A 4FBKA 1YX8A 1B8CA 2JT0A 2JULA 2CBLA 5KTYA 1DGUA 1KQMC 2KDHA 3GK2A 2ZFDA 3ICFA 3TDIA 3KBPA 1S26D 3SG3A 4R1EA 1EXRA 1FW4A 4I5KA 3WHUB 3LLEA 5PALA 2LUXA 1DTLA 2KKNA 4ORCB 1KFXS 4I5LB 2AHDA 4YBHB 1HP1A 1JSAA 2JNXA 3V4YA 4IL1A 1NNWA 1TNQA 3C5WC 1SNLA 1QX7A 4PCWA 4B2OA 4H2FA 1CTRA 4MVFA 4YGAA 5JPEA 1UUSA 1NCXA 4JPZB 2LANA 2LE9B 4WRIA 1JFJA 1TCOB 2LCPA 1HPUA 1EG3A 3H63A 1S3LA 2JPTA 2M3WA 3DD4A 1F8HA 2K7OA 2PALA 1KK7Y 4I5NB 1JK7A 3RM1A 1SW8A 4OCIA 4WQ3A 3WHTB 1OOJA 1TN4A 1SL8A 3HVQA 5HKZA 3SIAA 3C1VA 2OS8B 1AK8A 1B4CA 1C7WA 2XMOA 2JU0A 2M0RA 1KK8C 1YUTA 2BKIB 1NX0A 3JTDB 1NX3A 3DSCA 2L50A 2JZIA 3EK4A 3C9FA 2I7AA 4ZX2A 1JF0A 1MXEA 3MSEB 1NUBA 3GVEA 4P5OE 1QJTA 2MAZA 3SJSA 4L9MA 1GGZA 1SL9A 1V1GA 2USHA 1NX1A 4H2IA 5GTUA 1XFWO 4OR9A 1F4OA 4PALA 1Y6WA 2MBXA 1R2UA 1AJ4A 1MUXA 3GK4X 1SCVA 3OX5A 1UHKA 1Y1AA 2KI4B 1GGWA 3E7BA 1F54A 1FI6A 1MXLC 2FJUB 3ZWHA 1J1DA 1Z2WA 1USHA 3FS7A 2EC6B 1VRKA 1K2HA 2QJCA 3AAKA 1K9UA 1IJ5A 3AUZA 5J3XA 1YURA 4OV2A 3IB7A 4N1FA 2KOTA 3TS5B 1TTXA 1TNWA 1SK6D 2M97A 3CGAA 4HSZA 2QFRA 2GV5A 2R17A 2PMYA 2ZRSA 1NCZA 3FIAA 4M2PA 2I94A 1OMVA 1S6CA 1QVIZ 1A2XA 3A8RA 3EK8A 2KHNA 4PE0A 4KBPA 1IQ3A 2Z1AA 1Z2XA 1X02A 3QFNA 2K2FA 1IQ5A 1YVLA 2CT9A 4YI8A 1XA5A 4Q04A 1UTEA 1DJYA 3M0WA 4GPLB 1EH2A 2E30A 3JVTB 2KYFA 2KNEA 4MEWA 4OR9B 1M31A 2BBMA 1DMOA 1A03A 1KBPA 3H62B 1N2DA 5I2LA 4MN0A 3VRQA 2NCOA 2KGRA 5KSZA 1E8AA 2MHHA 3RL3A 2H61C 1SU1A 4AQIA 1BMOA 1F71A 1PSRA 3TUYC 4JA7A 2L98A 3DSDA 1RECA 3TDZA 4H1YP 4PHKA 5AERA 2JXLA 4MLWA 1U32A 1J55A 2M7NA 2WCEA 1T70A 2BCXA 2M1KB 2OTGC 2LHLA 2BCDA 1HO5A 1IJ6A 4FTGA 1CDNA 1G4YR 3OB1B 4E68A 3N5UA 1XFUO 2CNPA 4ORBB 2LAPA 2LHIA 2HYOA 3BQ3A 4LTYA 4HD0A 4V0VA 1S70A 1W24A 1PALA 1KSOA 2KBMA 1ALVA 1RJVA 4NDCA 1JC2A 2PRUA 2WORA 1SR6C 2HETA 4ETOA 3H4SE 1U5IA 2WC8A 1SMGA 1CMFA 1AJ5A 1SCMC 3CWGA 4IYPC 1CM1A 3I5GB 3H68A 1DJWA 1UHIA 1MHOA 2GGZA 2JOJA 2KSPA 2KQYA 3OHMB 5DNYA 2F2PA
chains in the Genus database with same CATH superfamily
3BUXB 4U8DA 1MF8A 3S0FA 4MOYA 1S5GY 2B1UA 2LLTA 4GFTA 2BDXA 4F0ZA 2TN4A 1WY9A 1K96A 2QPTA 1F55A 2P70A 3AKAA 3EVRA 4YGCB 3T1IA 1RK9A 2MRDA 2L4IA 2VRGA 2L2EA 4MRYA 5AEQA 4O24A 3LCPC 2BECA 4M0VA 2ZNDA 1SSEB 2PYQA 1KQMB 3E3RA 3I5IB 1OI8A 2F3ZA 3WNXB 2OPOA 4MBEA 2AAOA 1WDCC 3NSOA 5AXIA 1HT9A 1ZMZA 2K7CA 2O60A 3SG6A 5DKRA 5HL1A 2Q8UA 2FCDA 1TOPA 4UT3B 2NCPA 1UF3A 2K2AA 1OOHA 4ZCVA 1TIZA 2IE4C 1Q80A 2LLUA 1KK7Z 1CM4A 1XFXO 2MA2A 4WQ2A 2YEQA 1QXPA 1WLZA 1FPWA 1OOFA 2MJWB 3I5FC 1AUIB 2QACA 2WDDA 1BR4B 5INBA 4YRUA 1K93D 1IWQA 3DY9A 1U5IB 1LS8A 3PFVA 1FI5A 2L5YA 1WARA 4O4KA 2MLFC 1B9AA 1KWOC 1BT6A 2YVTA 1XFVO 3I5HC 2EHBA 1LKJA 1IRJA 2QEBA 2QDIA 1PRWA 2K60A 2GTEA 2M7LA 1G33A 1MF8B 1PULA 4GNKB 4F0ZB 3RZSA 1TWOA 4UT2A 5IOHA 4USLA 4XPNA 3AAJA 1J7QA 2BCAA 1K9KA 2BL0C 1SL7A 3H66A 3D0YA 3TGHA 4IJ7A 2KFGA 1LVCD 2KI6C 2JTZA 1IIOA 1DT7B 1YRTB 2O5GA 3H61A 3EK7A 2HF5A 4C0KA 2Y5IA 3CZTX 3SG2A 2Y1MA 3LK1A 2NPPC 4XJKA 4DSYA 1V1FA 5DKNA 1BR1B 4HRGA 1L2OC 2G2BA 3AV0A 2BCBA 1Y0VH 2FCEA 4ICBA 3PN7C 2DFJA 4WWLA 4MZLA 2LMUA 1S6JA 1KFXL 3KEVA 2O8AA 1S3NA 3QFKA 3S0EA 2H61A 1IT6A 4DS7A 3CR2A 1XFZO 2LVVA 2DXLA 1TUJA 3CK2A 1A75A 1WLMA 2JXCA 1QIVA 2L4HA 4I5JA 2L51A 4PE1A 4YGBB 2JC2A 4V0XA 1W7JB 3CR4X 2Z06A 1DELA 1L7ZA 3NGVA 3IQOA 3OP0A 1QV1A 2K7BA 1UHHA 1LA0A 2E6WA 1DEKA 1TNXA 3VRRA 4M2QA 3D74A 5CSJA 3A4UB 3THNA 1OIDA 3BFBA 4H1SA 1K95A 3D0YB 3EKJA 2M49B 4UWQA 4QJ4B 3ZTVA 5I2QA 2BE4A 2IS9A 4A4CA 1TCFA 1CB1A 2KAXA 3FE8A 3CABA 3D76A 1EG4A 2BQ8X 2P6BA 2BKHB 1QX5B 3DVEA 1IG5A 5I2OA 3QFOA 4QJ5B 5D69A 1GM0A 3IQQA 3EVVA 1YR5A 2EGDA 1H8BA 1UWOA 4ZVZA 1QIWA 1W7IB 3SG7A 1NIWA 2ZN8A 4PE7A 1Z4HA 3QRXA 1SBJA 1M45A 5HLOA 1K8UA 1MR8A 1OQPA 3HX4A 5AFPA 3BOWA 1TRFA 4CIDA 5I8NA 1CLBA 1EJ3A 2LMTA 2Y4QA 3B87A 5IBWA 1A75B 1K90D 1Y1UA 2AMIA 1DJIA 1YRUB 4FBWA 5HPEA 1YVHA 3LL8A 2GJUA 2CV9A 1ALWA 1FJMA 2WCKA 4MZKA 4DCKA 1S3MA 2LP2A 1J1EA 5DKQA 1DGVA 1M63A 2OTGB 2KI6D 2KPHA 2RGIA 4JQ0D 1B7TZ 2JT8A 5GQQC 4ZCUA 3VRPA 5BPJA 4MSPA 1CMGA 3CR5X 2PASA 5EL2A 1CDLA 3JYFA 1YX7A 5ER4X 1G5BA 1KFUS 1XM7A 1OW4A 5FYXA 1XZWA 1NX2A 2COLB 4GBAA 1Z2CB 3SS5A 1QV0A 1DJGA 1AVSA 4FQTA 4GAOA 4GGFC 3IVDA 1RFJA 3RL5A 1S3PA 1G8IA 2KYCA 5I94A 1S6IA 1SR6B 1S5GZ 4GUKA 2G9BA 1B47A 1NPQA 2I2RE 2PSRA 3LK0A 3VGOA 2ZNEA 3EGHA 4Q7FA 1SCMB 1XYDA 3PM8A 4INXA 1OSAA 2ZKMX 4M2OA 3IVEA 1C3ZA 2JTTA 1SRAA 1XK4C 1DF0A 4C0LA 3BOWB 1QHWA 2LVKA 3H64A 3KHEA 3FE9A 4P2YB 2KAVA 5J28A 2F2OA 2BE6A 1DJHA 3ICBA 1ZUZA 1OE9B 3LL8B 3S0GA 2LVIA 2M1UA 1PVBA 3WXAA 5HKYA 1HQVA 4XYNA 4JA9A 1SY9A 3DW8C 2KBIA 2WCLA 3ZU0A 1J7OA 2M9GA 2WCBA 1BF5A 3TDUA 2LUCA 2LNKA 4A4BA 4D1EA 3PATA 4QJ3B 2NYLC 3H67A 3K7VC 1K94A 1OZSA 1QS7A 2ZRTA 4G9JA 1M46A 1TCOA 1UP5A 4H2BA 4PT1A 4CLNA 4CPVA 4MP0A 1WRKA 2JWWA 3I5FB 2KQ6A 1OMRA 1KCYA 4ORCA 5EQVA 1AP4A 4H2GA 3CLNA 4HREE 1QATA 1S8EA 2LLSA 1II7A 1KWOB 1SKTA 1XVJA 3RLZA 1GQMA 3I5HB 4F7FA 1IGVA 2HY1A 1FF1A 3NSLA 3EKHA 1BOCA 2WDCA 1DF0B 1F4QA 4OKHA 2LMVA 1CLMA 5JJTA 4DHLA 3B6XA 4N1GA 2A4JA 3CS1A 5D7FA 1WRLA 2O8GA 1KK8B 3I5IC 2WC6A 4UPGA 2BL0B 1T71A 4ORAA 1XFYO 4YI9A 2CTNA 3P71C 3KF9A 1RWYA 2LP3A 1NYAA 1MQ1A 1J7RA 3GOFA 3S0BA 4C0JA 2JRFA 3O6BA 3NSKA 4I5LC 5JPFA 2SASA 1CFPA 4BY4A 1J7PA 1S95A 5CSFA 1UHNA 1L2OB 3QMEA 2DXNA 3PN7B 1B1GA 4N5XA 2IAEC 4DIRA 2KAYA 1XO5A 1CLLA 3K1EA 2V53A 1D1OA 1YTZC 1H4BA 1WRZA 2BBNA 4JWQA 1B8LA 2ZN9A 1N0YA 2JNFA 3HCMA 3DF0A 4YGDB 4TNCA 4I5NC 4PHNA 2WDFA 3IVTA 5K89A 5CPVA 2WDEA 3CYZA 2NZ0A 4V0WA 2OS8C 1PK0D 1JF2A 1C3YA 1SYMA 3KPXA 1PVAA 4MOVA 2IE3C 4GGNA 3RQZA 3JTDC 3OBVA 2ISDA 4DT2A 5ER5A 1M39A 1QLSA 1DJXA 2WCFA 4PHMA 1KQVA 2Q4UA 2SCPA 4ORAB 2HPSA 3FE6A 5KU1A 1F70A 2NYMC 3DVKA 1GJYA 2Q91A 4NDBA 2AUCA 4CFQA 2LM5A 1ORGA 2F8PA 4HRHA 4GGFA 2K61A 1BU3A 3O2PA 3O4YA 3S0AA 1CFDA 2I18A 4MZJA 5B8IA 1QASA 1V73A 3K21A 1CDPA 4XJKB 2H2KA 2L2CA 2QEVA 1NWDA 2WOSA 3D75A 1RTP1 2KI4C 4KKZA 1XK4A 1BLQA 1CFCA 1OIEA 1SPYA 2A22A 3CDNA 1CNPA 3IB8A 4AQJA 2NXQA 3N7HA 5AANA 3PSOA 3IF7A 4FBQA 4FCXA 4OZDA 1TUZA 2EC6C 1CDMA 5D3OA 4PDZA 2NXFA 3DF0B 2M8UA 1XFRA 5CSNA 2CXJA 4NDDA 2PQLA 5C1VA 4NZVA 1Y1XA 3TS5C 3H60A 5TNCA 3TUYB 5HKWA 1YUSA 1NP8A 2DOQA 2Z72A 2WNDA 1EL4A 2HYPA 1ZOTB 2KFFA 3KO0A 1DC1A 4AOMA 1C7VA 3AKBA 3EGGA 1W9ZA 1NSHA 3PSNA 3O78A 3NXAA 5HYDA 4ORBA 1LXFC 5G08A 3D73A 3CZ2A 2MLEC 3V2LA 2FJYA 3B86A 2LVJA 1IH0A 2GGMA 2JPOA 3SG4A 1R6PA 3FWBA 5FI6A 3BYAA 4LACC 2JOGA 3JVTC 3L47A 1QVIY 2P6BB 2KLEA 2L0PA 5B8IB 1S36A 1S1EA 5JJGA 3UNWA 1OZOA 5F6TA 3DVJA 3QG5C 4PE4A 1QLKA 3ZNIA 2NLNA 1N65A 3BXKA 3DYEA 1JWDA 3H69A 4O5GA 2M29A 3OX6A 1BJFA 3F45A 2WCMA 3S0DA 3TZ1A 1NCYA 4FQOA 2L5XB 1BG1A 2JT3A 3PM2A 3UO9A 1QX2A 2KGBC 2CCMA 1LA3A 5F3WA 3PLFB 1DVIA 2K8MB 1UURA 3D10A 4OVNF 4TUIA 3FWCA 3VROA 4DUQA 1QFCA 1JUOA 3OHMB 3SG5A 4UT3A 2F3YA 1KSMA 2ZBMA 1QWVA 5FI2A 1B8RA 3SIBA 2HQWA 2LC5A 1K9PA 3PSRA 4MRXA 1WDCB 3BUNB 3CTNA 4YGEB 5HLVA 1M63B 2Y1NA 3DXLA 1CKKA 4DRWA 4BY5A 3NSIA 3FGAC 1B7TY 4O43A 3NHTA 1OMDA 2F33A 2R2IA 1AUIA 1DJZA 3BUMB 1JFKA 2K7DA 3VB1A 3E7AA 3K7WC 3QFMA 1QTXA 3RL4A 1PSBA 1ZACA 2K0JA 5CSIA 1C07A 3B7AA 3BUOB 1WAO1 1LINA 4LU9A 1RROA 3THOB 1KFUL 3OB2B 2P71A 3VRNA 1A29A 5JOLA 4CFRA 3BUWB 1UHJA 4TUGA 1ZFSA 3DVMA 1AHRA 3EVUA 1A4PA 3O4XA 2BNXA 3I5GC 2KFHA 1JBAA 2QFPA 4J6OA 4YKEA 1MWNA 2H8VA 2HQ8A 3PALA 1BODA 1YUUA 4NQGA 1FBVA 2JQ6A 2LV7A 1TNPA 2PVBA 4PHJA 1CFFA 1ODBA 1IKUA 2D8NA 2FOTA 3GK1A 4FBKA 1YX8A 1B8CA 2JT0A 1T14A 3BFAA 2JULA 2CBLA 5KTYA 1DGUA 1KQMC 2KDHA 3GK2A 2ZFDA 3ICFA 3TDIA 3KBPA 1S26D 3SG3A 4R1EA 1EXRA 3E0JA 1FW4A 4I5KA 3WHUB 3LLEA 5PALA 2LUXA 1DTLA 2KKNA 4ORCB 1KFXS 4I5LB 2AHDA 3FLOA 4YBHB 1HP1A 1JSAA 2JNXA 3V4YA 4IL1A 3D03A 1NNWA 1TNQA 3C5WC 1SNLA 1QX7A 4PCWA 4B2OA 4H2FA 1CTRA 4MVFA 4YGAA 5JPEA 2KLDA 1UUSA 1NCXA 4JPZB 2LANA 2LE9B 4WRIA 1JFJA 1TCOB 3BFHA 2LCPA 1HPUA 1EG3A 3R1PA 1S3LA 2ZO9B 3H63A 2JPTA 2M3WA 3DD4A 1F8HA 4INWA 2K7OA 2PALA 1KK7Y 4I5NB 1JK7A 3RM1A 1SW8A 4OCIA 4WQ3A 3WHTB 3BJHA 1OOJA 1TN4A 1SL8A 3HVQA 5HKZA 3SIAA 3C1VA 2OS8B 1AK8A 1B4CA 1C7WA 2XMOA 2JU0A 2M0RA 1KK8C 3D78A 1YUTA 2BKIB 1NX0A 3JTDB 1NX3A 3DSCA 2L50A 2JZIA 2QEOA 3EK4A 2I7AA 3C9FA 4ZX2A 1JF0A 1MXEA 2WC5A 3MSEB 1NUBA 3GVEA 1OOIX 4P5OE 3OGNA 1QJTA 2MAZA 2WCHA 3SJSA 3SS4A 4L9MA 2ERBA 1GGZA 1SL9A 1V1GA 2QEHA 2USHA 1NX1A 4H2IA 5GTUA 1XFWO 5FI7A 3R72A 4OR9A 1F4OA 4PALA 1Y6WA 2MBXA 1R2UA 3B88A 1AJ4A 1MUXA 3GK4X 1SCVA 3OX5A 1UHKA 1Y1AA 2KI4B 1GGWA 3E7BA 1F54A 1FI6A 1MXLC 2FJUB 3ZWHA 1J1DA 1Z2WA 4KYNA 1USHA 3FS7A 2EC6B 1VRKA 1K2HA 2QJCA 3AAKA 1K9UA 1IJ5A 3AUZA 5J3XA 1YURA 4OV2A 3IB7A 4N1FA 2KOTA 3PJIA 1TTXA 2WCJA 3TS5B 1TNWA 1SK6D 2M97A 3CGAA 4HSZA 2QFRA 2GV5A 2R17A 2PMYA 2ZOAA 2ZRSA 3SS3A 1NCZA 3FIAA 4M2PA 2I94A 1OMVA 1S6CA 1QVIZ 1A2XA 3A8RA 3EK8A 2KHNA 4PE0A 4KBPA 3NHIA 3L4LA 1IQ3A 2Z1AA 1Z2XA 1X02A 3QFNA 2K2FA 1IQ5A 1YVLA 2CT9A 3Q8IA 4YI8A 1XA5A 4Q04A 1UTEA 1DJYA 3M0WA 4GPLB 1EH2A 2E30A 3JVTB 5DICA 2KYFA 2KNEA 4MEWA 4OR9B 1M31A 2BBMA 1DMOA 1A03A 1KBPA 3H62B 1N2DA 2BAPA 4JKTA 1OOGA 3R1OA 5I2LA 4MN0A 3VRQA 2NCOA 2KGRA 5KSZA 1E8AA 2MHHA 3RL3A 2H61C 1SU1A 4AQIA 1BMOA 1F71A 1PSRA 3TUYC 4JA7A 2L98A 3DSDA 1RECA 1P28A 3D77A 3TDZA 4H1YP 4JD9A 3L4AA 4PHKA 5AERA 2JXLA 4MLWA 1U32A 1J55A 2M7NA 2WCEA 1T70A 2BCXA 2M1KB 2OTGC 2LHLA 2BCDA 1HO5A 1IJ6A 3DZTA 4FTGA 1CDNA 1G4YR 3OB1B 4E68A 3N5UA 1XFUO 2CNPA 3R1VA 4ORBB 2LAPA 2LHIA 2HYOA 3BQ3A 4LTYA 4HD0A 4V0VA 1S70A 1W24A 1PALA 1KSOA 2KBMA 1DQEA 1ALVA 1RJVA 4NDCA 1JC2A 2PRUA 2WORA 3EG5B 1SR6C 2HETA 2YGUA 4ETOA 3H4SE 1U5IA 2WC8A 1SMGA 1CMFA 3CZ0A 1AJ5A 1SCMC 3CWGA 4IYPC 1CM1A 3I5GB 3H68A 1DJWA 1UHIA 1MHOA 2GGZA 2JOJA 2KSPA 2KQYA 3CZ1A 5DNYA 2F2PA
chains in the Genus database with same CATH topology
3BUXB 4U8DA 1MF8A 4MOYA 4F0ZA 1S5GY 2B1UA 2LLTA 4GFTA 2BDXA 2TN4A 1WY9A 1K96A 2QPTA 1F55A 3AKAA 3EVRA 4YGCB 3T1IA 1RK9A 2MRDA 2L4IA 2VRGA 2L2EA 4MRYA 5AEQA 4O24A 3LCPC 2BECA 4M0VA 2ZNDA 1KQMB 3E3RA 3I5IB 1OI8A 2F3ZA 3WNXB 2OPOA 4MBEA 2AAOA 1WDCC 3NSOA 5AXIA 1HT9A 1ZMZA 2K7CA 2O60A 3SG6A 5DKRA 2Q8UA 2FCDA 1TOPA 4UT3B 2NCPA 1UF3A 2K2AA 4ZCVA 1TIZA 2IE4C 1Q80A 2LLUA 1KK7Z 1CM4A 1XFXO 2MA2A 4WQ2A 2YEQA 1QXPA 1WLZA 1FPWA 2MJWB 3I5FC 1AUIB 2QACA 2WDDA 1BR4B 5INBA 4YRUA 1K93D 1IWQA 3PFVA 1U5IB 1FI5A 1WARA 4O4KA 2MLFC 1B9AA 1KWOC 1BT6A 2YVTA 1XFVO 3I5HC 2EHBA 1LKJA 1IRJA 1PRWA 2M7LA 1G33A 1MF8B 1PULA 4GNKB 4F0ZB 4UT2A 5IOHA 4USLA 4XPNA 3AAJA 1J7QA 2BCAA 1K9KA 2BL0C 1SL7A 3H66A 3D0YA 3TGHA 2KFGA 1LVCD 2KI6C 2JTZA 1DT7B 1YRTB 2O5GA 3H61A 3EK7A 2HF5A 4C0KA 2Y5IA 3CZTX 3SG2A 2Y1MA 3LK1A 2NPPC 4XJKA 4DSYA 1V1FA 5DKNA 1BR1B 4HRGA 1L2OC 2G2BA 3AV0A 2BCBA 1Y0VH 2FCEA 4ICBA 3PN7C 2DFJA 4MZLA 2LMUA 1S6JA 1KFXL 3KEVA 2O8AA 1S3NA 3QFKA 2H61A 1IT6A 4DS7A 3CR2A 1XFZO 2LVVA 2DXLA 3CK2A 4WWLA 1A75A 1WLMA 2JXCA 1QIVA 2L4HA 4I5JA 2L51A 4PE1A 4YGBB 2JC2A 4V0XA 1W7JB 3CR4X 2Z06A 1L7ZA 3IQOA 3OP0A 1QV1A 2K7BA 1UHHA 1LA0A 2E6WA 1TNXA 3VRRA 4M2QA 5CSJA 3A4UB 3THNA 1OIDA 4H1SA 1K95A 3D0YB 3EKJA 2M49B 4UWQA 4QJ4B 3ZTVA 5I2QA 2BE4A 2IS9A 4A4CA 1TCFA 1CB1A 2KAXA 2P6BA 1EG4A 2BQ8X 2BKHB 1QX5B 3DVEA 1IG5A 5I2OA 3QFOA 4QJ5B 5D69A 3IQQA 3EVVA 1YR5A 2EGDA 1H8BA 1UWOA 4ZVZA 1QIWA 1W7IB 3SG7A 1NIWA 2ZN8A 4PE7A 3QRXA 1SBJA 1M45A 5HLOA 1K8UA 1MR8A 1OQPA 3HX4A 5AFPA 3BOWA 1TRFA 4CIDA 5I8NA 1CLBA 1EJ3A 2LMTA 2Y4QA 5IBWA 1A75B 1K90D 1Y1UA 2AMIA 1DJIA 1YRUB 4FBWA 5HPEA 1YVHA 3LL8A 2GJUA 2CV9A 1ALWA 1FJMA 4MZKA 4DCKA 1S3MA 2LP2A 1J1EA 5DKQA 1DGVA 1M63A 2OTGB 2KI6D 2RGIA 4JQ0D 4ZCUA 1B7TZ 2JT8A 5GQQC 3VRPA 5BPJA 1CMGA 4MSPA 3CR5X 2PASA 1CDLA 3JYFA 1YX7A 5ER4X 1G5BA 1KFUS 1XM7A 1XZWA 5FYXA 1NX2A 2COLB 4GBAA 1QV0A 1DJGA 1AVSA 4GAOA 4GGFC 3IVDA 1RFJA 3RL5A 1S3PA 1G8IA 2KYCA 1S6IA 1SR6B 1S5GZ 4GUKA 2G9BA 1B47A 1NPQA 2I2RE 2PSRA 3LK0A 3VGOA 2ZNEA 3EGHA 4Q7FA 1SCMB 1XYDA 3PM8A 1OSAA 2ZKMX 4M2OA 3IVEA 2JTTA 1SRAA 1XK4C 1DF0A 4C0LA 3BOWB 1QHWA 2LVKA 3H64A 3KHEA 4P2YB 2KAVA 5J28A 2F2OA 2BE6A 1DJHA 3ICBA 1ZUZA 1OE9B 3LL8B 3WXAA 2LVIA 2M1UA 1PVBA 5HKYA 1HQVA 4XYNA 4JA9A 1SY9A 3DW8C 2KBIA 3ZU0A 1J7OA 2M9GA 2WCBA 1BF5A 3TDUA 2LUCA 2LNKA 4A4BA 4D1EA 3PATA 4QJ3B 2NYLC 3H67A 3K7VC 1K94A 1OZSA 1QS7A 2ZRTA 4G9JA 1M46A 1TCOA 1UP5A 4H2BA 4CLNA 4MP0A 4CPVA 1WRKA 2JWWA 3I5FB 2KQ6A 1OMRA 1KCYA 4ORCA 5EQVA 1AP4A 4H2GA 3CLNA 4HREE 1QATA 1S8EA 2LLSA 1II7A 1KWOB 1SKTA 1XVJA 3RLZA 1GQMA 3I5HB 1IGVA 2HY1A 1FF1A 3NSLA 3EKHA 1BOCA 2WDCA 1DF0B 1F4QA 4OKHA 2LMVA 1CLMA 5JJTA 4DHLA 4N1GA 2A4JA 3CS1A 5D7FA 1WRLA 2O8GA 1KK8B 3I5IC 4UPGA 1T71A 2BL0B 4ORAA 1XFYO 4YI9A 2CTNA 3P71C 3KF9A 1RWYA 2LP3A 1NYAA 1MQ1A 1J7RA 3GOFA 4C0JA 2JRFA 3O6BA 3NSKA 4I5LC 5JPFA 2SASA 1CFPA 4BY4A 1J7PA 1S95A 5CSFA 1UHNA 1L2OB 2DXNA 3PN7B 1B1GA 4N5XA 2IAEC 4DIRA 2KAYA 1XO5A 1CLLA 2V53A 1D1OA 1YTZC 1H4BA 1WRZA 2BBNA 4JWQA 1B8LA 2ZN9A 1N0YA 2JNFA 3HCMA 3DF0A 4YGDB 4TNCA 4I5NC 4PHNA 2WDFA 5K89A 5CPVA 2WDEA 4V0WA 2NZ0A 2OS8C 1JF2A 1PK0D 1SYMA 3KPXA 1PVAA 4MOVA 2IE3C 4GGNA 3RQZA 3JTDC 2ISDA 4DT2A 5ER5A 1M39A 1QLSA 1DJXA 2WCFA 4PHMA 1KQVA 2Q4UA 2SCPA 4ORAB 2HPSA 5KU1A 1F70A 2NYMC 3DVKA 1GJYA 2Q91A 4NDBA 2AUCA 4CFQA 2LM5A 2F8PA 4HRHA 4GGFA 2K61A 1BU3A 3O2PA 3O4YA 1CFDA 2I18A 4MZJA 5B8IA 1QASA 1V73A 3K21A 1CDPA 4XJKB 2H2KA 2WOSA 1NWDA 1RTP1 2KI4C 4KKZA 1XK4A 1BLQA 1CFCA 1OIEA 1SPYA 2A22A 1CNPA 3IB8A 3PSOA 4AQJA 2NXQA 4FBQA 5AANA 4FCXA 3IF7A 2EC6C 1CDMA 2NXFA 4PDZA 3DF0B 2M8UA 5CSNA 2CXJA 4NDDA 5C1VA 4NZVA 1Y1XA 3TS5C 3H60A 5TNCA 3TUYB 5HKWA 1YUSA 1NP8A 2DOQA 2Z72A 2WNDA 1EL4A 2HYPA 1ZOTB 2KFFA 3KO0A 1C7VA 4AOMA 3AKBA 3EGGA 1NSHA 3PSNA 3O78A 3NXAA 5HYDA 4ORBA 1LXFC 5G08A 2MLEC 2LVJA 1IH0A 2GGMA 3SG4A 1R6PA 3FWBA 3BYAA 4LACC 2JOGA 3JVTC 1QVIY 2P6BB 2L0PA 5B8IB 1S36A 1S1EA 5JJGA 1OZOA 5F6TA 3DVJA 3QG5C 4PE4A 1QLKA 3ZNIA 2NLNA 1N65A 3BXKA 1JWDA 3H69A 4O5GA 2M29A 3OX6A 1BJFA 3F45A 3TZ1A 1NCYA 4FQOA 2L5XB 1BG1A 2JT3A 1QX2A 2KGBC 2CCMA 1LA3A 5F3WA 3PLFB 1DVIA 2K8MB 1UURA 3D10A 4OVNF 4TUIA 3FWCA 3VROA 4DUQA 1QFCA 1JUOA 3SG5A 4UT3A 2F3YA 1KSMA 2ZBMA 3SIBA 1B8RA 4DRWA 2HQWA 2LC5A 1K9PA 3PSRA 4MRXA 1WDCB 3BUNB 3CTNA 4YGEB 5HLVA 1M63B 2Y1NA 1CKKA 4BY5A 3NSIA 3FGAC 1B7TY 4O43A 1OMDA 2F33A 2R2IA 1AUIA 1DJZA 3BUMB 1JFKA 2K7DA 3E7AA 3K7WC 3QFMA 1QTXA 3RL4A 1PSBA 1ZACA 2K0JA 5CSIA 1C07A 1WAO1 3BUOB 1LINA 4LU9A 1RROA 3THOB 1KFUL 3OB2B 3VRNA 1A29A 5JOLA 4CFRA 3BUWB 1UHJA 4TUGA 1ZFSA 3DVMA 1AHRA 3EVUA 1A4PA 1JBAA 4YKEA 3I5GC 2KFHA 2QFPA 4J6OA 1MWNA 2HQ8A 3PALA 1BODA 1YUUA 4NQGA 1FBVA 2JQ6A 2LV7A 1TNPA 2PVBA 4PHJA 1CFFA 1ODBA 1IKUA 2D8NA 2FOTA 3GK1A 4FBKA 1YX8A 1B8CA 2JT0A 2JULA 2CBLA 5KTYA 1DGUA 1KQMC 2KDHA 3GK2A 2ZFDA 3ICFA 3TDIA 3KBPA 1S26D 3SG3A 4R1EA 1EXRA 3E0JA 1FW4A 4I5KA 3WHUB 3LLEA 5PALA 2LUXA 1DTLA 2KKNA 4ORCB 1KFXS 4I5LB 2AHDA 3FLOA 4YBHB 1HP1A 1JSAA 2JNXA 3V4YA 4IL1A 3D03A 1NNWA 1TNQA 3C5WC 1SNLA 1QX7A 4PCWA 4B2OA 4H2FA 1CTRA 4MVFA 4YGAA 5JPEA 1UUSA 1NCXA 4JPZB 2LANA 2LE9B 4WRIA 1JFJA 1TCOB 2LCPA 1HPUA 1EG3A 2ZO9B 1S3LA 3H63A 2JPTA 2M3WA 3DD4A 1F8HA 2K7OA 2PALA 1KK7Y 4I5NB 1JK7A 3RM1A 1SW8A 4OCIA 4WQ3A 3WHTB 1OOJA 1TN4A 1SL8A 3HVQA 5HKZA 3SIAA 3C1VA 2OS8B 1AK8A 1B4CA 1C7WA 2XMOA 2JU0A 2M0RA 1KK8C 1YUTA 2BKIB 1NX0A 3JTDB 1NX3A 3DSCA 2L50A 2JZIA 3EK4A 3C9FA 2I7AA 4ZX2A 1JF0A 1MXEA 3MSEB 1NUBA 3GVEA 4P5OE 1QJTA 2MAZA 3SJSA 4L9MA 1GGZA 1SL9A 1V1GA 2USHA 1NX1A 4H2IA 5GTUA 1XFWO 4OR9A 1F4OA 4PALA 1Y6WA 2MBXA 1R2UA 1AJ4A 1MUXA 3GK4X 1SCVA 3OX5A 1UHKA 1Y1AA 2KI4B 1GGWA 3E7BA 1F54A 1FI6A 1MXLC 2FJUB 3ZWHA 1J1DA 1Z2WA 1USHA 3FS7A 2EC6B 1VRKA 1K2HA 2QJCA 3AAKA 1K9UA 1IJ5A 3AUZA 5J3XA 1YURA 4OV2A 3IB7A 4N1FA 2KOTA 3TS5B 1TTXA 1TNWA 1SK6D 2M97A 3CGAA 4HSZA 2QFRA 2GV5A 2R17A 2PMYA 2ZOAA 2ZRSA 1NCZA 3FIAA 4M2PA 2I94A 1OMVA 1S6CA 1QVIZ 1A2XA 3A8RA 3EK8A 2KHNA 4PE0A 4KBPA 1IQ3A 2Z1AA 1Z2XA 1X02A 3QFNA 2K2FA 1IQ5A 1YVLA 2CT9A 4YI8A 1XA5A 4Q04A 1UTEA 1DJYA 3M0WA 4GPLB 1EH2A 2E30A 3JVTB 2KYFA 2KNEA 4MEWA 4OR9B 1M31A 2BBMA 1DMOA 1A03A 1KBPA 3H62B 1N2DA 5I2LA 4MN0A 3VRQA 2NCOA 2KGRA 5KSZA 1E8AA 2MHHA 3RL3A 2H61C 1SU1A 4AQIA 1BMOA 1F71A 1PSRA 3TUYC 4JA7A 2L98A 3DSDA 1RECA 3TDZA 4H1YP 4PHKA 5AERA 2JXLA 4MLWA 1U32A 1J55A 2M7NA 2WCEA 1T70A 2BCXA 2M1KB 2OTGC 2LHLA 2BCDA 1HO5A 1IJ6A 4FTGA 1CDNA 1G4YR 3OB1B 4E68A 3N5UA 1XFUO 2CNPA 4ORBB 2LAPA 2LHIA 2HYOA 3BQ3A 4LTYA 4HD0A 4V0VA 1S70A 1W24A 1PALA 1KSOA 2KBMA 1ALVA 1RJVA 4NDCA 1JC2A 2PRUA 2WORA 1SR6C 2HETA 4ETOA 3H4SE 1U5IA 2WC8A 1SMGA 1CMFA 1AJ5A 1SCMC 3CWGA 4IYPC 1CM1A 3I5GB 3H68A 1DJWA 1UHIA 1MHOA 2GGZA 2JOJA 2KSPA 2KQYA 3OHMB 5DNYA 2F2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUX B;  4U8D A;  1MF8 A;  4MOY A;  4F0Z A;  1S5G Y;  2B1U A;  2LLT A;  4GFT A;  2BDX A;  2TN4 A;  1WY9 A;  1K96 A;  2QPT A;  1F55 A;  3AKA A;  3EVR A;  4YGC B;  3T1I A;  1RK9 A;  2MRD A;  2L4I A;  2VRG A;  2L2E A;  4MRY A;  5AEQ A;  4O24 A;  3LCP C;  2BEC A;  4M0V A;  2ZND A;  1KQM B;  3E3R A;  3I5I B;  1OI8 A;  2F3Z A;  3WNX B;  2OPO A;  4MBE A;  2AAO A;  1WDC C;  3NSO A;  5AXI A;  1HT9 A;  1ZMZ A;  2K7C A;  2O60 A;  3SG6 A;  5DKR A;  2Q8U A;  2FCD A;  1TOP A;  4UT3 B;  2NCP A;  1UF3 A;  2K2A A;  4ZCV A;  1TIZ A;  2IE4 C;  1Q80 A;  2LLU A;  1KK7 Z;  1CM4 A;  1XFX O;  2MA2 A;  4WQ2 A;  1QXP A;  1WLZ A;  1FPW A;  2MJW B;  3I5F C;  1AUI B;  2QAC A;  2WDD A;  1BR4 B;  5INB A;  4YRU A;  1K93 D;  1IWQ A;  3PFV A;  1U5I B;  1FI5 A;  1WAR A;  4O4K A;  2MLF C;  1B9A A;  1KWO C;  1BT6 A;  2YVT A;  1XFV O;  3I5H C;  2EHB A;  1LKJ A;  1IRJ A;  1PRW A;  2M7L A;  1G33 A;  1MF8 B;  1PUL A;  4GNK B;  4F0Z B;  4UT2 A;  5IOH A;  4USL A;  4XPN A;  3AAJ A;  1J7Q A;  2BCA A;  1K9K A;  2BL0 C;  1SL7 A;  3H66 A;  3D0Y A;  3TGH A;  2KFG A;  1LVC D;  2KI6 C;  2JTZ A;  1DT7 B;  1YRT B;  2O5G A;  3H61 A;  3EK7 A;  2HF5 A;  4C0K A;  2Y5I A;  3CZT X;  3SG2 A;  2Y1M A;  3LK1 A;  2NPP C;  4XJK A;  4DSY A;  1V1F A;  5DKN A;  1BR1 B;  4HRG A;  1L2O C;  2G2B A;  3AV0 A;  2BCB A;  1Y0V H;  2FCE A;  4ICB A;  3PN7 C;  2DFJ A;  4MZL A;  2LMU A;  1S6J A;  1KFX L;  3KEV A;  2O8A A;  1S3N A;  3QFK A;  2H61 A;  1IT6 A;  4DS7 A;  3CR2 A;  1XFZ O;  2LVV A;  3CK2 A;  4WWL A;  1A75 A;  1WLM A;  2JXC A;  1QIV A;  2L4H A;  4I5J A;  2L51 A;  4PE1 A;  4YGB B;  2JC2 A;  4V0X A;  1W7J B;  3CR4 X;  2Z06 A;  1L7Z A;  3IQO A;  3OP0 A;  1QV1 A;  2K7B A;  1UHH A;  1LA0 A;  2E6W A;  1TNX A;  3VRR A;  4M2Q A;  5CSJ A;  3A4U B;  3THN A;  1OID A;  4H1S A;  1K95 A;  3D0Y B;  3EKJ A;  2M49 B;  4UWQ A;  4QJ4 B;  3ZTV A;  5I2Q A;  2BE4 A;  2IS9 A;  4A4C A;  1TCF A;  1CB1 A;  2KAX A;  2P6B A;  1EG4 A;  2BQ8 X;  2BKH B;  1QX5 B;  3DVE A;  1IG5 A;  5I2O A;  3QFO A;  4QJ5 B;  5D69 A;  3IQQ A;  3EVV A;  1YR5 A;  2EGD A;  1H8B A;  1UWO A;  4ZVZ A;  1QIW A;  1W7I B;  3SG7 A;  1NIW A;  2ZN8 A;  4PE7 A;  3QRX A;  1SBJ A;  1M45 A;  5HLO A;  1K8U A;  1MR8 A;  1OQP A;  3HX4 A;  5AFP A;  3BOW A;  1TRF A;  4CID A;  5I8N A;  1CLB A;  1EJ3 A;  2LMT A;  2Y4Q A;  5IBW A;  1A75 B;  1K90 D;  1Y1U A;  2AMI A;  1DJI A;  1YRU B;  4FBW A;  5HPE A;  1YVH A;  3LL8 A;  2GJU A;  2CV9 A;  1ALW A;  1FJM A;  4MZK A;  4DCK A;  1S3M A;  2LP2 A;  1J1E A;  5DKQ A;  1DGV A;  1M63 A;  2OTG B;  2KI6 D;  2RGI A;  4JQ0 D;  4ZCU A;  1B7T Z;  2JT8 A;  5GQQ C;  3VRP A;  5BPJ A;  1CMG A;  4MSP A;  3CR5 X;  2PAS A;  1CDL A;  3JYF A;  1YX7 A;  5ER4 X;  1G5B A;  1KFU S;  1XM7 A;  1XZW A;  5FYX A;  1NX2 A;  2COL B;  4GBA A;  1QV0 A;  1DJG A;  1AVS A;  4GAO A;  4GGF C;  3IVD A;  1RFJ A;  3RL5 A;  1S3P A;  1G8I A;  2KYC A;  1S6I A;  1SR6 B;  1S5G Z;  4GUK A;  2G9B A;  1B47 A;  1NPQ A;  2I2R E;  2PSR A;  3LK0 A;  3VGO A;  2ZNE A;  3EGH A;  4Q7F A;  1SCM B;  1XYD A;  3PM8 A;  1OSA A;  2ZKM X;  4M2O A;  3IVE A;  2JTT A;  1SRA A;  1XK4 C;  1DF0 A;  4C0L A;  3BOW B;  1QHW A;  2LVK A;  3H64 A;  3KHE A;  4P2Y B;  2KAV A;  5J28 A;  2F2O A;  2BE6 A;  1DJH A;  3ICB A;  1ZUZ A;  1OE9 B;  3LL8 B;  3WXA A;  2LVI A;  2M1U A;  1PVB A;  5HKY A;  1HQV A;  4XYN A;  4JA9 A;  1SY9 A;  3DW8 C;  2KBI A;  3ZU0 A;  1J7O A;  2M9G A;  2WCB A;  1BF5 A;  3TDU A;  2LUC A;  2LNK A;  4A4B A;  4D1E A;  3PAT A;  4QJ3 B;  2NYL C;  3H67 A;  3K7V C;  1K94 A;  1OZS A;  1QS7 A;  2ZRT A;  4G9J A;  1M46 A;  1TCO A;  1UP5 A;  4H2B A;  4CLN A;  4MP0 A;  4CPV A;  1WRK A;  2JWW A;  3I5F B;  2KQ6 A;  1OMR A;  1KCY A;  4ORC A;  5EQV A;  1AP4 A;  4H2G A;  3CLN A;  4HRE E;  1QAT A;  1S8E A;  2LLS A;  1II7 A;  1KWO B;  1SKT A;  1XVJ A;  3RLZ A;  1GQM A;  3I5H B;  1IGV A;  2HY1 A;  1FF1 A;  3NSL A;  3EKH A;  1BOC A;  2WDC A;  1DF0 B;  1F4Q A;  4OKH A;  2LMV A;  1CLM A;  5JJT A;  4DHL A;  4N1G A;  2A4J A;  3CS1 A;  5D7F A;  1WRL A;  2O8G A;  1KK8 B;  3I5I C;  4UPG A;  1T71 A;  2BL0 B;  4ORA A;  1XFY O;  4YI9 A;  2CTN A;  3P71 C;  3KF9 A;  1RWY A;  2LP3 A;  1NYA A;  1MQ1 A;  1J7R A;  3GOF A;  4C0J A;  2JRF A;  3O6B A;  3NSK A;  4I5L C;  5JPF A;  2SAS A;  1CFP A;  4BY4 A;  1J7P A;  1S95 A;  5CSF A;  1UHN A;  1L2O B;  3PN7 B;  1B1G A;  4N5X A;  2IAE C;  4DIR A;  2KAY A;  1XO5 A;  1CLL A;  2V53 A;  1D1O A;  1YTZ C;  1H4B A;  1WRZ A;  2BBN A;  4JWQ A;  1B8L A;  2ZN9 A;  1N0Y A;  2JNF A;  3HCM A;  3DF0 A;  4YGD B;  4TNC A;  4I5N C;  4PHN A;  2WDF A;  5K89 A;  5CPV A;  2WDE A;  4V0W A;  2NZ0 A;  2OS8 C;  1JF2 A;  1PK0 D;  1SYM A;  3KPX A;  1PVA A;  4MOV A;  2IE3 C;  4GGN A;  3RQZ A;  3JTD C;  2ISD A;  4DT2 A;  5ER5 A;  1M39 A;  1QLS A;  1DJX A;  2WCF A;  4PHM A;  1KQV A;  2Q4U A;  2SCP A;  4ORA B;  2HPS A;  5KU1 A;  1F70 A;  2NYM C;  3DVK A;  1GJY A;  2Q91 A;  4NDB A;  2AUC A;  4CFQ A;  2LM5 A;  2F8P A;  4HRH A;  4GGF A;  2K61 A;  1BU3 A;  3O2P A;  3O4Y A;  1CFD A;  2I18 A;  4MZJ A;  5B8I A;  1QAS A;  1V73 A;  3K21 A;  1CDP A;  4XJK B;  2H2K A;  2WOS A;  1NWD A;  1RTP 1;  2KI4 C;  4KKZ A;  1XK4 A;  1BLQ A;  1CFC A;  1OIE A;  1SPY A;  2A22 A;  1CNP A;  3IB8 A;  3PSO A;  4AQJ A;  2NXQ A;  4FBQ A;  5AAN A;  4FCX A;  3IF7 A;  2EC6 C;  1CDM A;  2NXF A;  4PDZ A;  3DF0 B;  2M8U A;  5CSN A;  2CXJ A;  4NDD A;  5C1V A;  4NZV A;  1Y1X A;  3TS5 C;  3H60 A;  5TNC A;  3TUY B;  5HKW A;  1YUS A;  1NP8 A;  2DOQ A;  2Z72 A;  2WND A;  1EL4 A;  2HYP A;  1ZOT B;  2KFF A;  3KO0 A;  1C7V A;  4AOM A;  3AKB A;  3EGG A;  1NSH A;  3PSN A;  3O78 A;  3NXA A;  5HYD A;  4ORB A;  1LXF C;  5G08 A;  2MLE C;  2LVJ A;  1IH0 A;  2GGM A;  3SG4 A;  1R6P A;  3FWB A;  3BYA A;  4LAC C;  2JOG A;  3JVT C;  1QVI Y;  2P6B B;  2L0P A;  5B8I B;  1S36 A;  1S1E A;  5JJG A;  1OZO A;  5F6T A;  3DVJ A;  3QG5 C;  4PE4 A;  1QLK A;  3ZNI A;  2NLN A;  1N65 A;  3BXK A;  1JWD A;  3H69 A;  4O5G A;  2M29 A;  3OX6 A;  1BJF A;  3F45 A;  3TZ1 A;  1NCY A;  4FQO A;  2L5X B;  1BG1 A;  2JT3 A;  1QX2 A;  2KGB C;  2CCM A;  1LA3 A;  5F3W A;  3PLF B;  1DVI A;  2K8M B;  1UUR A;  3D10 A;  4OVN F;  4TUI A;  3FWC A;  3VRO A;  4DUQ A;  1QFC A;  1JUO A;  3SG5 A;  4UT3 A;  2F3Y A;  1KSM A;  2ZBM A;  3SIB A;  1B8R A;  4DRW A;  2HQW A;  2LC5 A;  1K9P A;  3PSR A;  4MRX A;  1WDC B;  3BUN B;  3CTN A;  4YGE B;  5HLV A;  1M63 B;  2Y1N A;  1CKK A;  4BY5 A;  3NSI A;  3FGA C;  1B7T Y;  4O43 A;  1OMD A;  2F33 A;  2R2I A;  1AUI A;  1DJZ A;  3BUM B;  1JFK A;  2K7D A;  3E7A A;  3K7W C;  3QFM A;  1QTX A;  3RL4 A;  1PSB A;  1ZAC A;  2K0J A;  5CSI A;  1C07 A;  1WAO 1;  3BUO B;  1LIN A;  4LU9 A;  1RRO A;  3THO B;  1KFU L;  3OB2 B;  3VRN A;  1A29 A;  5JOL A;  4CFR A;  3BUW B;  1UHJ A;  4TUG A;  1ZFS A;  3DVM A;  1AHR A;  3EVU A;  1A4P A;  1JBA A;  4YKE A;  3I5G C;  2KFH A;  2QFP A;  4J6O A;  1MWN A;  2HQ8 A;  3PAL A;  1BOD A;  1YUU A;  4NQG A;  1FBV A;  2JQ6 A;  2LV7 A;  1TNP A;  2PVB A;  4PHJ A;  1CFF A;  1ODB A;  1IKU A;  2D8N A;  2FOT A;  3GK1 A;  4FBK A;  1YX8 A;  1B8C A;  2JT0 A;  2JUL A;  2CBL A;  5KTY A;  1DGU A;  1KQM C;  2KDH A;  3GK2 A;  2ZFD A;  3ICF A;  3TDI A;  3KBP A;  1S26 D;  3SG3 A;  4R1E A;  1EXR A;  1FW4 A;  4I5K A;  3WHU B;  3LLE A;  5PAL A;  2LUX A;  1DTL A;  2KKN A;  4ORC B;  1KFX S;  4I5L B;  2AHD A;  4YBH B;  1HP1 A;  1JSA A;  2JNX A;  3V4Y A;  4IL1 A;  1NNW A;  1TNQ A;  3C5W C;  1SNL A;  1QX7 A;  4PCW A;  4B2O A;  4H2F A;  1CTR A;  4MVF A;  4YGA A;  5JPE A;  1UUS A;  1NCX A;  4JPZ B;  2LAN A;  2LE9 B;  4WRI A;  1JFJ A;  1TCO B;  2LCP A;  1HPU A;  1EG3 A;  3H63 A;  1S3L A;  2JPT A;  2M3W A;  3DD4 A;  1F8H A;  2K7O A;  2PAL A;  1KK7 Y;  4I5N B;  1JK7 A;  3RM1 A;  1SW8 A;  4OCI A;  4WQ3 A;  3WHT B;  1OOJ A;  1TN4 A;  1SL8 A;  3HVQ A;  5HKZ A;  3SIA A;  3C1V A;  2OS8 B;  1AK8 A;  1B4C A;  1C7W A;  2XMO A;  2JU0 A;  2M0R A;  1KK8 C;  1YUT A;  2BKI B;  1NX0 A;  3JTD B;  1NX3 A;  3DSC A;  2L50 A;  2JZI A;  3EK4 A;  3C9F A;  2I7A A;  4ZX2 A;  1JF0 A;  1MXE A;  3MSE B;  1NUB A;  3GVE A;  4P5O E;  1QJT A;  2MAZ A;  3SJS A;  4L9M A;  1GGZ A;  1SL9 A;  1V1G A;  2USH A;  1NX1 A;  4H2I A;  5GTU A;  1XFW O;  4OR9 A;  1F4O A;  4PAL A;  1Y6W A;  2MBX A;  1R2U A;  1AJ4 A;  1MUX A;  3GK4 X;  1SCV A;  3OX5 A;  1UHK A;  1Y1A A;  2KI4 B;  1GGW A;  3E7B A;  1F54 A;  1FI6 A;  1MXL C;  2FJU B;  3ZWH A;  1J1D A;  1Z2W A;  1USH A;  3FS7 A;  2EC6 B;  1VRK A;  1K2H A;  2QJC A;  3AAK A;  1K9U A;  1IJ5 A;  3AUZ A;  5J3X A;  1YUR A;  4OV2 A;  3IB7 A;  4N1F A;  2KOT A;  3TS5 B;  1TTX A;  1TNW A;  1SK6 D;  2M97 A;  3CGA A;  4HSZ A;  2QFR A;  2GV5 A;  2R17 A;  2PMY A;  2ZRS A;  1NCZ A;  3FIA A;  4M2P A;  2I94 A;  1OMV A;  1S6C A;  1QVI Z;  1A2X A;  3A8R A;  3EK8 A;  2KHN A;  4PE0 A;  4KBP A;  1IQ3 A;  2Z1A A;  1Z2X A;  1X02 A;  3QFN A;  2K2F A;  1IQ5 A;  1YVL A;  2CT9 A;  4YI8 A;  1XA5 A;  4Q04 A;  1UTE A;  1DJY A;  3M0W A;  4GPL B;  1EH2 A;  2E30 A;  3JVT B;  2KYF A;  2KNE A;  4MEW A;  4OR9 B;  1M31 A;  2BBM A;  1DMO A;  1A03 A;  1KBP A;  3H62 B;  1N2D A;  5I2L A;  4MN0 A;  3VRQ A;  2NCO A;  2KGR A;  5KSZ A;  1E8A A;  2MHH A;  3RL3 A;  2H61 C;  1SU1 A;  4AQI A;  1BMO A;  1F71 A;  1PSR A;  3TUY C;  4JA7 A;  2L98 A;  3DSD A;  1REC A;  3TDZ A;  4H1Y P;  4PHK A;  5AER A;  2JXL A;  4MLW A;  1U32 A;  1J55 A;  2M7N A;  2WCE A;  1T70 A;  2BCX A;  2M1K B;  2OTG C;  2LHL A;  2BCD A;  1HO5 A;  1IJ6 A;  4FTG A;  1CDN A;  1G4Y R;  3OB1 B;  4E68 A;  3N5U A;  1XFU O;  2CNP A;  4ORB B;  2LAP A;  2LHI A;  2HYO A;  3BQ3 A;  4LTY A;  4HD0 A;  4V0V A;  1S70 A;  1W24 A;  1PAL A;  1KSO A;  2KBM A;  1ALV A;  1RJV A;  4NDC A;  1JC2 A;  2PRU A;  2WOR A;  1SR6 C;  2HET A;  4ETO A;  3H4S E;  1U5I A;  2WC8 A;  1SMG A;  1CMF A;  1AJ5 A;  1SCM C;  3CWG A;  4IYP C;  1CM1 A;  3I5G B;  3H68 A;  1DJW A;  1UHI A;  1MHO A;  2GGZ A;  2JOJ A;  2KSP A;  2KQY A;  3OHM B;  5DNY A;  2F2P A; 
#chains in the Genus database with same CATH topology
 3BUX B;  4U8D A;  1MF8 A;  3S0F A;  4MOY A;  1S5G Y;  2B1U A;  2LLT A;  4GFT A;  2BDX A;  4F0Z A;  2TN4 A;  1WY9 A;  1K96 A;  2QPT A;  1F55 A;  2P70 A;  3AKA A;  3EVR A;  4YGC B;  3T1I A;  1RK9 A;  2MRD A;  2L4I A;  2VRG A;  2L2E A;  4MRY A;  5AEQ A;  4O24 A;  3LCP C;  2BEC A;  4M0V A;  2ZND A;  1SSE B;  2PYQ A;  1KQM B;  3E3R A;  3I5I B;  1OI8 A;  2F3Z A;  3WNX B;  2OPO A;  4MBE A;  2AAO A;  1WDC C;  3NSO A;  5AXI A;  1HT9 A;  1ZMZ A;  2K7C A;  2O60 A;  3SG6 A;  5DKR A;  5HL1 A;  2Q8U A;  2FCD A;  1TOP A;  4UT3 B;  2NCP A;  1UF3 A;  2K2A A;  1OOH A;  4ZCV A;  1TIZ A;  2IE4 C;  1Q80 A;  2LLU A;  1KK7 Z;  1CM4 A;  1XFX O;  2MA2 A;  4WQ2 A;  2YEQ A;  1QXP A;  1WLZ A;  1FPW A;  1OOF A;  2MJW B;  3I5F C;  1AUI B;  2QAC A;  2WDD A;  1BR4 B;  5INB A;  4YRU A;  1K93 D;  1IWQ A;  3DY9 A;  1U5I B;  1LS8 A;  3PFV A;  1FI5 A;  2L5Y A;  1WAR A;  4O4K A;  2MLF C;  1B9A A;  1KWO C;  1BT6 A;  2YVT A;  1XFV O;  3I5H C;  2EHB A;  1LKJ A;  1IRJ A;  2QEB A;  2QDI A;  1PRW A;  2K60 A;  2GTE A;  2M7L A;  1G33 A;  1MF8 B;  1PUL A;  4GNK B;  4F0Z B;  3RZS A;  1TWO A;  4UT2 A;  5IOH A;  4USL A;  4XPN A;  3AAJ A;  1J7Q A;  2BCA A;  1K9K A;  2BL0 C;  1SL7 A;  3H66 A;  3D0Y A;  3TGH A;  4IJ7 A;  2KFG A;  1LVC D;  2KI6 C;  2JTZ A;  1IIO A;  1DT7 B;  1YRT B;  2O5G A;  3H61 A;  3EK7 A;  2HF5 A;  4C0K A;  2Y5I A;  3CZT X;  3SG2 A;  2Y1M A;  3LK1 A;  2NPP C;  4XJK A;  4DSY A;  1V1F A;  5DKN A;  1BR1 B;  4HRG A;  1L2O C;  2G2B A;  3AV0 A;  2BCB A;  1Y0V H;  2FCE A;  4ICB A;  3PN7 C;  2DFJ A;  4WWL A;  4MZL A;  2LMU A;  1S6J A;  1KFX L;  3KEV A;  2O8A A;  1S3N A;  3QFK A;  3S0E A;  2H61 A;  1IT6 A;  4DS7 A;  3CR2 A;  1XFZ O;  2LVV A;  2DXL A;  1TUJ A;  3CK2 A;  1A75 A;  1WLM A;  2JXC A;  1QIV A;  2L4H A;  4I5J A;  2L51 A;  4PE1 A;  4YGB B;  2JC2 A;  4V0X A;  1W7J B;  3CR4 X;  2Z06 A;  1DEL A;  1L7Z A;  3NGV A;  3IQO A;  3OP0 A;  1QV1 A;  2K7B A;  1UHH A;  1LA0 A;  2E6W A;  1DEK A;  1TNX A;  3VRR A;  4M2Q A;  3D74 A;  5CSJ A;  3A4U B;  3THN A;  1OID A;  3BFB A;  4H1S A;  1K95 A;  3D0Y B;  3EKJ A;  2M49 B;  4UWQ A;  4QJ4 B;  3ZTV A;  5I2Q A;  2BE4 A;  2IS9 A;  4A4C A;  1TCF A;  1CB1 A;  2KAX A;  3FE8 A;  3CAB A;  3D76 A;  1EG4 A;  2BQ8 X;  2P6B A;  2BKH B;  1QX5 B;  3DVE A;  1IG5 A;  5I2O A;  3QFO A;  4QJ5 B;  5D69 A;  1GM0 A;  3IQQ A;  3EVV A;  1YR5 A;  2EGD A;  1H8B A;  1UWO A;  4ZVZ A;  1QIW A;  1W7I B;  3SG7 A;  1NIW A;  2ZN8 A;  4PE7 A;  1Z4H A;  3QRX A;  1SBJ A;  1M45 A;  5HLO A;  1K8U A;  1MR8 A;  1OQP A;  3HX4 A;  5AFP A;  3BOW A;  1TRF A;  4CID A;  5I8N A;  1CLB A;  1EJ3 A;  2LMT A;  2Y4Q A;  3B87 A;  5IBW A;  1A75 B;  1K90 D;  1Y1U A;  2AMI A;  1DJI A;  1YRU B;  4FBW A;  5HPE A;  1YVH A;  3LL8 A;  2GJU A;  2CV9 A;  1ALW A;  1FJM A;  2WCK A;  4MZK A;  4DCK A;  1S3M A;  2LP2 A;  1J1E A;  5DKQ A;  1DGV A;  1M63 A;  2OTG B;  2KI6 D;  2KPH A;  2RGI A;  4JQ0 D;  1B7T Z;  2JT8 A;  5GQQ C;  4ZCU A;  3VRP A;  5BPJ A;  4MSP A;  1CMG A;  3CR5 X;  2PAS A;  5EL2 A;  1CDL A;  3JYF A;  1YX7 A;  5ER4 X;  1G5B A;  1KFU S;  1XM7 A;  1OW4 A;  5FYX A;  1XZW A;  1NX2 A;  2COL B;  4GBA A;  1Z2C B;  3SS5 A;  1QV0 A;  1DJG A;  1AVS A;  4FQT A;  4GAO A;  4GGF C;  3IVD A;  1RFJ A;  3RL5 A;  1S3P A;  1G8I A;  2KYC A;  5I94 A;  1S6I A;  1SR6 B;  1S5G Z;  4GUK A;  2G9B A;  1B47 A;  1NPQ A;  2I2R E;  2PSR A;  3LK0 A;  3VGO A;  2ZNE A;  3EGH A;  4Q7F A;  1SCM B;  1XYD A;  3PM8 A;  4INX A;  1OSA A;  2ZKM X;  4M2O A;  3IVE A;  1C3Z A;  2JTT A;  1SRA A;  1XK4 C;  1DF0 A;  4C0L A;  3BOW B;  1QHW A;  2LVK A;  3H64 A;  3KHE A;  3FE9 A;  4P2Y B;  2KAV A;  5J28 A;  2F2O A;  2BE6 A;  1DJH A;  3ICB A;  1ZUZ A;  1OE9 B;  3LL8 B;  3S0G A;  2LVI A;  2M1U A;  1PVB A;  3WXA A;  5HKY A;  1HQV A;  4XYN A;  4JA9 A;  1SY9 A;  3DW8 C;  2KBI A;  2WCL A;  3ZU0 A;  1J7O A;  2M9G A;  2WCB A;  1BF5 A;  3TDU A;  2LUC A;  2LNK A;  4A4B A;  4D1E A;  3PAT A;  4QJ3 B;  2NYL C;  3H67 A;  3K7V C;  1K94 A;  1OZS A;  1QS7 A;  2ZRT A;  4G9J A;  1M46 A;  1TCO A;  1UP5 A;  4H2B A;  4PT1 A;  4CLN A;  4CPV A;  4MP0 A;  1WRK A;  2JWW A;  3I5F B;  2KQ6 A;  1OMR A;  1KCY A;  4ORC A;  5EQV A;  1AP4 A;  4H2G A;  3CLN A;  4HRE E;  1QAT A;  1S8E A;  2LLS A;  1II7 A;  1KWO B;  1SKT A;  1XVJ A;  3RLZ A;  1GQM A;  3I5H B;  4F7F A;  1IGV A;  2HY1 A;  1FF1 A;  3NSL A;  3EKH A;  1BOC A;  2WDC A;  1DF0 B;  1F4Q A;  4OKH A;  2LMV A;  1CLM A;  5JJT A;  4DHL A;  3B6X A;  4N1G A;  2A4J A;  3CS1 A;  5D7F A;  1WRL A;  2O8G A;  1KK8 B;  3I5I C;  2WC6 A;  4UPG A;  2BL0 B;  1T71 A;  4ORA A;  1XFY O;  4YI9 A;  2CTN A;  3P71 C;  3KF9 A;  1RWY A;  2LP3 A;  1NYA A;  1MQ1 A;  1J7R A;  3GOF A;  3S0B A;  4C0J A;  2JRF A;  3O6B A;  3NSK A;  4I5L C;  5JPF A;  2SAS A;  1CFP A;  4BY4 A;  1J7P A;  1S95 A;  5CSF A;  1UHN A;  1L2O B;  3QME A;  2DXN A;  3PN7 B;  1B1G A;  4N5X A;  2IAE C;  4DIR A;  2KAY A;  1XO5 A;  1CLL A;  3K1E A;  2V53 A;  1D1O A;  1YTZ C;  1H4B A;  1WRZ A;  2BBN A;  4JWQ A;  1B8L A;  2ZN9 A;  1N0Y A;  2JNF A;  3HCM A;  3DF0 A;  4YGD B;  4TNC A;  4I5N C;  4PHN A;  2WDF A;  3IVT A;  5K89 A;  5CPV A;  2WDE A;  3CYZ A;  2NZ0 A;  4V0W A;  2OS8 C;  1PK0 D;  1JF2 A;  1C3Y A;  1SYM A;  3KPX A;  1PVA A;  4MOV A;  2IE3 C;  4GGN A;  3RQZ A;  3JTD C;  3OBV A;  2ISD A;  4DT2 A;  5ER5 A;  1M39 A;  1QLS A;  1DJX A;  2WCF A;  4PHM A;  1KQV A;  2Q4U A;  2SCP A;  4ORA B;  2HPS A;  3FE6 A;  5KU1 A;  1F70 A;  2NYM C;  3DVK A;  1GJY A;  2Q91 A;  4NDB A;  2AUC A;  4CFQ A;  2LM5 A;  1ORG A;  2F8P A;  4HRH A;  4GGF A;  2K61 A;  1BU3 A;  3O2P A;  3O4Y A;  3S0A A;  1CFD A;  2I18 A;  4MZJ A;  5B8I A;  1QAS A;  1V73 A;  3K21 A;  1CDP A;  4XJK B;  2H2K A;  2L2C A;  2QEV A;  1NWD A;  2WOS A;  3D75 A;  1RTP 1;  2KI4 C;  4KKZ A;  1XK4 A;  1BLQ A;  1CFC A;  1OIE A;  1SPY A;  2A22 A;  3CDN A;  1CNP A;  3IB8 A;  4AQJ A;  2NXQ A;  3N7H A;  5AAN A;  3PSO A;  3IF7 A;  4FBQ A;  4FCX A;  4OZD A;  1TUZ A;  2EC6 C;  1CDM A;  5D3O A;  4PDZ A;  2NXF A;  3DF0 B;  2M8U A;  1XFR A;  5CSN A;  2CXJ A;  4NDD A;  2PQL A;  5C1V A;  4NZV A;  1Y1X A;  3TS5 C;  3H60 A;  5TNC A;  3TUY B;  5HKW A;  1YUS A;  1NP8 A;  2DOQ A;  2Z72 A;  2WND A;  1EL4 A;  2HYP A;  1ZOT B;  2KFF A;  3KO0 A;  1DC1 A;  4AOM A;  1C7V A;  3AKB A;  3EGG A;  1W9Z A;  1NSH A;  3PSN A;  3O78 A;  3NXA A;  5HYD A;  4ORB A;  1LXF C;  5G08 A;  3D73 A;  3CZ2 A;  2MLE C;  3V2L A;  2FJY A;  3B86 A;  2LVJ A;  1IH0 A;  2GGM A;  2JPO A;  3SG4 A;  1R6P A;  3FWB A;  5FI6 A;  3BYA A;  4LAC C;  2JOG A;  3JVT C;  3L47 A;  1QVI Y;  2P6B B;  2KLE A;  2L0P A;  5B8I B;  1S36 A;  1S1E A;  5JJG A;  3UNW A;  1OZO A;  5F6T A;  3DVJ A;  3QG5 C;  4PE4 A;  1QLK A;  3ZNI A;  2NLN A;  1N65 A;  3BXK A;  3DYE A;  1JWD A;  3H69 A;  4O5G A;  2M29 A;  3OX6 A;  1BJF A;  3F45 A;  2WCM A;  3S0D A;  3TZ1 A;  1NCY A;  4FQO A;  2L5X B;  1BG1 A;  2JT3 A;  3PM2 A;  3UO9 A;  1QX2 A;  2KGB C;  2CCM A;  1LA3 A;  5F3W A;  3PLF B;  1DVI A;  2K8M B;  1UUR A;  3D10 A;  4OVN F;  4TUI A;  3FWC A;  3VRO A;  4DUQ A;  1QFC A;  1JUO A;  3OHM B;  3SG5 A;  4UT3 A;  2F3Y A;  1KSM A;  2ZBM A;  1QWV A;  5FI2 A;  1B8R A;  3SIB A;  2HQW A;  2LC5 A;  1K9P A;  3PSR A;  4MRX A;  1WDC B;  3BUN B;  3CTN A;  4YGE B;  5HLV A;  1M63 B;  2Y1N A;  3DXL A;  1CKK A;  4DRW A;  4BY5 A;  3NSI A;  3FGA C;  1B7T Y;  4O43 A;  3NHT A;  1OMD A;  2F33 A;  2R2I A;  1AUI A;  1DJZ A;  3BUM B;  1JFK A;  2K7D A;  3VB1 A;  3E7A A;  3K7W C;  3QFM A;  1QTX A;  3RL4 A;  1PSB A;  1ZAC A;  2K0J A;  5CSI A;  1C07 A;  3B7A A;  3BUO B;  1WAO 1;  1LIN A;  4LU9 A;  1RRO A;  3THO B;  1KFU L;  3OB2 B;  2P71 A;  3VRN A;  1A29 A;  5JOL A;  4CFR A;  3BUW B;  1UHJ A;  4TUG A;  1ZFS A;  3DVM A;  1AHR A;  3EVU A;  1A4P A;  3O4X A;  2BNX A;  3I5G C;  2KFH A;  1JBA A;  2QFP A;  4J6O A;  4YKE A;  1MWN A;  2H8V A;  2HQ8 A;  3PAL A;  1BOD A;  1YUU A;  4NQG A;  1FBV A;  2JQ6 A;  2LV7 A;  1TNP A;  2PVB A;  4PHJ A;  1CFF A;  1ODB A;  1IKU A;  2D8N A;  2FOT A;  3GK1 A;  4FBK A;  1YX8 A;  1B8C A;  2JT0 A;  1T14 A;  3BFA A;  2JUL A;  2CBL A;  5KTY A;  1DGU A;  1KQM C;  2KDH A;  3GK2 A;  2ZFD A;  3ICF A;  3TDI A;  3KBP A;  1S26 D;  3SG3 A;  4R1E A;  1EXR A;  3E0J A;  1FW4 A;  4I5K A;  3WHU B;  3LLE A;  5PAL A;  2LUX A;  1DTL A;  2KKN A;  4ORC B;  1KFX S;  4I5L B;  2AHD A;  3FLO A;  4YBH B;  1HP1 A;  1JSA A;  2JNX A;  3V4Y A;  4IL1 A;  3D03 A;  1NNW A;  1TNQ A;  3C5W C;  1SNL A;  1QX7 A;  4PCW A;  4B2O A;  4H2F A;  1CTR A;  4MVF A;  4YGA A;  5JPE A;  2KLD A;  1UUS A;  1NCX A;  4JPZ B;  2LAN A;  2LE9 B;  4WRI A;  1JFJ A;  1TCO B;  3BFH A;  2LCP A;  1HPU A;  1EG3 A;  3R1P A;  1S3L A;  2ZO9 B;  3H63 A;  2JPT A;  2M3W A;  3DD4 A;  1F8H A;  4INW A;  2K7O A;  2PAL A;  1KK7 Y;  4I5N B;  1JK7 A;  3RM1 A;  1SW8 A;  4OCI A;  4WQ3 A;  3WHT B;  3BJH A;  1OOJ A;  1TN4 A;  1SL8 A;  3HVQ A;  5HKZ A;  3SIA A;  3C1V A;  2OS8 B;  1AK8 A;  1B4C A;  1C7W A;  2XMO A;  2JU0 A;  2M0R A;  1KK8 C;  3D78 A;  1YUT A;  2BKI B;  1NX0 A;  3JTD B;  1NX3 A;  3DSC A;  2L50 A;  2JZI A;  2QEO A;  3EK4 A;  2I7A A;  3C9F A;  4ZX2 A;  1JF0 A;  1MXE A;  2WC5 A;  3MSE B;  1NUB A;  3GVE A;  1OOI X;  4P5O E;  3OGN A;  1QJT A;  2MAZ A;  2WCH A;  3SJS A;  3SS4 A;  4L9M A;  2ERB A;  1GGZ A;  1SL9 A;  1V1G A;  2QEH A;  2USH A;  1NX1 A;  4H2I A;  5GTU A;  1XFW O;  5FI7 A;  3R72 A;  4OR9 A;  1F4O A;  4PAL A;  1Y6W A;  2MBX A;  1R2U A;  3B88 A;  1AJ4 A;  1MUX A;  3GK4 X;  1SCV A;  3OX5 A;  1UHK A;  1Y1A A;  2KI4 B;  1GGW A;  3E7B A;  1F54 A;  1FI6 A;  1MXL C;  2FJU B;  3ZWH A;  1J1D A;  1Z2W A;  4KYN A;  1USH A;  3FS7 A;  2EC6 B;  1VRK A;  1K2H A;  2QJC A;  3AAK A;  1K9U A;  1IJ5 A;  3AUZ A;  5J3X A;  1YUR A;  4OV2 A;  3IB7 A;  4N1F A;  2KOT A;  3PJI A;  1TTX A;  2WCJ A;  3TS5 B;  1TNW A;  1SK6 D;  2M97 A;  3CGA A;  4HSZ A;  2QFR A;  2GV5 A;  2R17 A;  2PMY A;  2ZOA A;  2ZRS A;  3SS3 A;  1NCZ A;  3FIA A;  4M2P A;  2I94 A;  1OMV A;  1S6C A;  1QVI Z;  1A2X A;  3A8R A;  3EK8 A;  2KHN A;  4PE0 A;  4KBP A;  3NHI A;  3L4L A;  1IQ3 A;  2Z1A A;  1Z2X A;  1X02 A;  3QFN A;  2K2F A;  1IQ5 A;  1YVL A;  2CT9 A;  3Q8I A;  4YI8 A;  1XA5 A;  4Q04 A;  1UTE A;  1DJY A;  3M0W A;  4GPL B;  1EH2 A;  2E30 A;  3JVT B;  5DIC A;  2KYF A;  2KNE A;  4MEW A;  4OR9 B;  1M31 A;  2BBM A;  1DMO A;  1A03 A;  1KBP A;  3H62 B;  1N2D A;  2BAP A;  4JKT A;  1OOG A;  3R1O A;  5I2L A;  4MN0 A;  3VRQ A;  2NCO A;  2KGR A;  5KSZ A;  1E8A A;  2MHH A;  3RL3 A;  2H61 C;  1SU1 A;  4AQI A;  1BMO A;  1F71 A;  1PSR A;  3TUY C;  4JA7 A;  2L98 A;  3DSD A;  1REC A;  1P28 A;  3D77 A;  3TDZ A;  4H1Y P;  4JD9 A;  3L4A A;  4PHK A;  5AER A;  2JXL A;  4MLW A;  1U32 A;  1J55 A;  2M7N A;  2WCE A;  1T70 A;  2BCX A;  2M1K B;  2OTG C;  2LHL A;  2BCD A;  1HO5 A;  1IJ6 A;  3DZT A;  4FTG A;  1CDN A;  1G4Y R;  3OB1 B;  4E68 A;  3N5U A;  1XFU O;  2CNP A;  3R1V A;  4ORB B;  2LAP A;  2LHI A;  2HYO A;  3BQ3 A;  4LTY A;  4HD0 A;  4V0V A;  1S70 A;  1W24 A;  1PAL A;  1KSO A;  2KBM A;  1DQE A;  1ALV A;  1RJV A;  4NDC A;  1JC2 A;  2PRU A;  2WOR A;  3EG5 B;  1SR6 C;  2HET A;  2YGU A;  4ETO A;  3H4S E;  1U5I A;  2WC8 A;  1SMG A;  1CMF A;  3CZ0 A;  1AJ5 A;  1SCM C;  3CWG A;  4IYP C;  1CM1 A;  3I5G B;  3H68 A;  1DJW A;  1UHI A;  1MHO A;  2GGZ A;  2JOJ A;  2KSP A;  2KQY A;  3CZ1 A;  5DNY A;  2F2P A; 
#chains in the Genus database with same CATH homology
 3BUX B;  4U8D A;  1MF8 A;  4MOY A;  4F0Z A;  1S5G Y;  2B1U A;  2LLT A;  4GFT A;  2BDX A;  2TN4 A;  1WY9 A;  1K96 A;  2QPT A;  1F55 A;  3AKA A;  3EVR A;  4YGC B;  3T1I A;  1RK9 A;  2MRD A;  2L4I A;  2VRG A;  2L2E A;  4MRY A;  5AEQ A;  4O24 A;  3LCP C;  2BEC A;  4M0V A;  2ZND A;  1KQM B;  3E3R A;  3I5I B;  1OI8 A;  2F3Z A;  3WNX B;  2OPO A;  4MBE A;  2AAO A;  1WDC C;  3NSO A;  5AXI A;  1HT9 A;  1ZMZ A;  2K7C A;  2O60 A;  3SG6 A;  5DKR A;  2Q8U A;  2FCD A;  1TOP A;  4UT3 B;  2NCP A;  1UF3 A;  2K2A A;  4ZCV A;  1TIZ A;  2IE4 C;  1Q80 A;  2LLU A;  1KK7 Z;  1CM4 A;  1XFX O;  2MA2 A;  4WQ2 A;  2YEQ A;  1QXP A;  1WLZ A;  1FPW A;  2MJW B;  3I5F C;  1AUI B;  2QAC A;  2WDD A;  1BR4 B;  5INB A;  4YRU A;  1K93 D;  1IWQ A;  3PFV A;  1U5I B;  1FI5 A;  1WAR A;  4O4K A;  2MLF C;  1B9A A;  1KWO C;  1BT6 A;  2YVT A;  1XFV O;  3I5H C;  2EHB A;  1LKJ A;  1IRJ A;  1PRW A;  2M7L A;  1G33 A;  1MF8 B;  1PUL A;  4GNK B;  4F0Z B;  4UT2 A;  5IOH A;  4USL A;  4XPN A;  3AAJ A;  1J7Q A;  2BCA A;  1K9K A;  2BL0 C;  1SL7 A;  3H66 A;  3D0Y A;  3TGH A;  2KFG A;  1LVC D;  2KI6 C;  2JTZ A;  1DT7 B;  1YRT B;  2O5G A;  3H61 A;  3EK7 A;  2HF5 A;  4C0K A;  2Y5I A;  3CZT X;  3SG2 A;  2Y1M A;  3LK1 A;  2NPP C;  4XJK A;  4DSY A;  1V1F A;  5DKN A;  1BR1 B;  4HRG A;  1L2O C;  2G2B A;  3AV0 A;  2BCB A;  1Y0V H;  2FCE A;  4ICB A;  3PN7 C;  2DFJ A;  4MZL A;  2LMU A;  1S6J A;  1KFX L;  3KEV A;  2O8A A;  1S3N A;  3QFK A;  2H61 A;  1IT6 A;  4DS7 A;  3CR2 A;  1XFZ O;  2LVV A;  2DXL A;  3CK2 A;  4WWL A;  1A75 A;  1WLM A;  2JXC A;  1QIV A;  2L4H A;  4I5J A;  2L51 A;  4PE1 A;  4YGB B;  2JC2 A;  4V0X A;  1W7J B;  3CR4 X;  2Z06 A;  1L7Z A;  3IQO A;  3OP0 A;  1QV1 A;  2K7B A;  1UHH A;  1LA0 A;  2E6W A;  1TNX A;  3VRR A;  4M2Q A;  5CSJ A;  3A4U B;  3THN A;  1OID A;  4H1S A;  1K95 A;  3D0Y B;  3EKJ A;  2M49 B;  4UWQ A;  4QJ4 B;  3ZTV A;  5I2Q A;  2BE4 A;  2IS9 A;  4A4C A;  1TCF A;  1CB1 A;  2KAX A;  2P6B A;  1EG4 A;  2BQ8 X;  2BKH B;  1QX5 B;  3DVE A;  1IG5 A;  5I2O A;  3QFO A;  4QJ5 B;  5D69 A;  3IQQ A;  3EVV A;  1YR5 A;  2EGD A;  1H8B A;  1UWO A;  4ZVZ A;  1QIW A;  1W7I B;  3SG7 A;  1NIW A;  2ZN8 A;  4PE7 A;  3QRX A;  1SBJ A;  1M45 A;  5HLO A;  1K8U A;  1MR8 A;  1OQP A;  3HX4 A;  5AFP A;  3BOW A;  1TRF A;  4CID A;  5I8N A;  1CLB A;  1EJ3 A;  2LMT A;  2Y4Q A;  5IBW A;  1A75 B;  1K90 D;  1Y1U A;  2AMI A;  1DJI A;  1YRU B;  4FBW A;  5HPE A;  1YVH A;  3LL8 A;  2GJU A;  2CV9 A;  1ALW A;  1FJM A;  4MZK A;  4DCK A;  1S3M A;  2LP2 A;  1J1E A;  5DKQ A;  1DGV A;  1M63 A;  2OTG B;  2KI6 D;  2RGI A;  4JQ0 D;  4ZCU A;  1B7T Z;  2JT8 A;  5GQQ C;  3VRP A;  5BPJ A;  1CMG A;  4MSP A;  3CR5 X;  2PAS A;  1CDL A;  3JYF A;  1YX7 A;  5ER4 X;  1G5B A;  1KFU S;  1XM7 A;  1XZW A;  5FYX A;  1NX2 A;  2COL B;  4GBA A;  1QV0 A;  1DJG A;  1AVS A;  4GAO A;  4GGF C;  3IVD A;  1RFJ A;  3RL5 A;  1S3P A;  1G8I A;  2KYC A;  1S6I A;  1SR6 B;  1S5G Z;  4GUK A;  2G9B A;  1B47 A;  1NPQ A;  2I2R E;  2PSR A;  3LK0 A;  3VGO A;  2ZNE A;  3EGH A;  4Q7F A;  1SCM B;  1XYD A;  3PM8 A;  1OSA A;  2ZKM X;  4M2O A;  3IVE A;  2JTT A;  1SRA A;  1XK4 C;  1DF0 A;  4C0L A;  3BOW B;  1QHW A;  2LVK A;  3H64 A;  3KHE A;  4P2Y B;  2KAV A;  5J28 A;  2F2O A;  2BE6 A;  1DJH A;  3ICB A;  1ZUZ A;  1OE9 B;  3LL8 B;  3WXA A;  2LVI A;  2M1U A;  1PVB A;  5HKY A;  1HQV A;  4XYN A;  4JA9 A;  1SY9 A;  3DW8 C;  2KBI A;  3ZU0 A;  1J7O A;  2M9G A;  2WCB A;  1BF5 A;  3TDU A;  2LUC A;  2LNK A;  4A4B A;  4D1E A;  3PAT A;  4QJ3 B;  2NYL C;  3H67 A;  3K7V C;  1K94 A;  1OZS A;  1QS7 A;  2ZRT A;  4G9J A;  1M46 A;  1TCO A;  1UP5 A;  4H2B A;  4CLN A;  4MP0 A;  4CPV A;  1WRK A;  2JWW A;  3I5F B;  2KQ6 A;  1OMR A;  1KCY A;  4ORC A;  5EQV A;  1AP4 A;  4H2G A;  3CLN A;  4HRE E;  1QAT A;  1S8E A;  2LLS A;  1II7 A;  1KWO B;  1SKT A;  1XVJ A;  3RLZ A;  1GQM A;  3I5H B;  1IGV A;  2HY1 A;  1FF1 A;  3NSL A;  3EKH A;  1BOC A;  2WDC A;  1DF0 B;  1F4Q A;  4OKH A;  2LMV A;  1CLM A;  5JJT A;  4DHL A;  4N1G A;  2A4J A;  3CS1 A;  5D7F A;  1WRL A;  2O8G A;  1KK8 B;  3I5I C;  4UPG A;  1T71 A;  2BL0 B;  4ORA A;  1XFY O;  4YI9 A;  2CTN A;  3P71 C;  3KF9 A;  1RWY A;  2LP3 A;  1NYA A;  1MQ1 A;  1J7R A;  3GOF A;  4C0J A;  2JRF A;  3O6B A;  3NSK A;  4I5L C;  5JPF A;  2SAS A;  1CFP A;  4BY4 A;  1J7P A;  1S95 A;  5CSF A;  1UHN A;  1L2O B;  2DXN A;  3PN7 B;  1B1G A;  4N5X A;  2IAE C;  4DIR A;  2KAY A;  1XO5 A;  1CLL A;  2V53 A;  1D1O A;  1YTZ C;  1H4B A;  1WRZ A;  2BBN A;  4JWQ A;  1B8L A;  2ZN9 A;  1N0Y A;  2JNF A;  3HCM A;  3DF0 A;  4YGD B;  4TNC A;  4I5N C;  4PHN A;  2WDF A;  5K89 A;  5CPV A;  2WDE A;  4V0W A;  2NZ0 A;  2OS8 C;  1JF2 A;  1PK0 D;  1SYM A;  3KPX A;  1PVA A;  4MOV A;  2IE3 C;  4GGN A;  3RQZ A;  3JTD C;  2ISD A;  4DT2 A;  5ER5 A;  1M39 A;  1QLS A;  1DJX A;  2WCF A;  4PHM A;  1KQV A;  2Q4U A;  2SCP A;  4ORA B;  2HPS A;  5KU1 A;  1F70 A;  2NYM C;  3DVK A;  1GJY A;  2Q91 A;  4NDB A;  2AUC A;  4CFQ A;  2LM5 A;  2F8P A;  4HRH A;  4GGF A;  2K61 A;  1BU3 A;  3O2P A;  3O4Y A;  1CFD A;  2I18 A;  4MZJ A;  5B8I A;  1QAS A;  1V73 A;  3K21 A;  1CDP A;  4XJK B;  2H2K A;  2WOS A;  1NWD A;  1RTP 1;  2KI4 C;  4KKZ A;  1XK4 A;  1BLQ A;  1CFC A;  1OIE A;  1SPY A;  2A22 A;  1CNP A;  3IB8 A;  3PSO A;  4AQJ A;  2NXQ A;  4FBQ A;  5AAN A;  4FCX A;  3IF7 A;  2EC6 C;  1CDM A;  2NXF A;  4PDZ A;  3DF0 B;  2M8U A;  5CSN A;  2CXJ A;  4NDD A;  5C1V A;  4NZV A;  1Y1X A;  3TS5 C;  3H60 A;  5TNC A;  3TUY B;  5HKW A;  1YUS A;  1NP8 A;  2DOQ A;  2Z72 A;  2WND A;  1EL4 A;  2HYP A;  1ZOT B;  2KFF A;  3KO0 A;  1C7V A;  4AOM A;  3AKB A;  3EGG A;  1NSH A;  3PSN A;  3O78 A;  3NXA A;  5HYD A;  4ORB A;  1LXF C;  5G08 A;  2MLE C;  2LVJ A;  1IH0 A;  2GGM A;  3SG4 A;  1R6P A;  3FWB A;  3BYA A;  4LAC C;  2JOG A;  3JVT C;  1QVI Y;  2P6B B;  2L0P A;  5B8I B;  1S36 A;  1S1E A;  5JJG A;  1OZO A;  5F6T A;  3DVJ A;  3QG5 C;  4PE4 A;  1QLK A;  3ZNI A;  2NLN A;  1N65 A;  3BXK A;  1JWD A;  3H69 A;  4O5G A;  2M29 A;  3OX6 A;  1BJF A;  3F45 A;  3TZ1 A;  1NCY A;  4FQO A;  2L5X B;  1BG1 A;  2JT3 A;  1QX2 A;  2KGB C;  2CCM A;  1LA3 A;  5F3W A;  3PLF B;  1DVI A;  2K8M B;  1UUR A;  3D10 A;  4OVN F;  4TUI A;  3FWC A;  3VRO A;  4DUQ A;  1QFC A;  1JUO A;  3SG5 A;  4UT3 A;  2F3Y A;  1KSM A;  2ZBM A;  3SIB A;  1B8R A;  4DRW A;  2HQW A;  2LC5 A;  1K9P A;  3PSR A;  4MRX A;  1WDC B;  3BUN B;  3CTN A;  4YGE B;  5HLV A;  1M63 B;  2Y1N A;  1CKK A;  4BY5 A;  3NSI A;  3FGA C;  1B7T Y;  4O43 A;  1OMD A;  2F33 A;  2R2I A;  1AUI A;  1DJZ A;  3BUM B;  1JFK A;  2K7D A;  3E7A A;  3K7W C;  3QFM A;  1QTX A;  3RL4 A;  1PSB A;  1ZAC A;  2K0J A;  5CSI A;  1C07 A;  1WAO 1;  3BUO B;  1LIN A;  4LU9 A;  1RRO A;  3THO B;  1KFU L;  3OB2 B;  3VRN A;  1A29 A;  5JOL A;  4CFR A;  3BUW B;  1UHJ A;  4TUG A;  1ZFS A;  3DVM A;  1AHR A;  3EVU A;  1A4P A;  1JBA A;  4YKE A;  3I5G C;  2KFH A;  2QFP A;  4J6O A;  1MWN A;  2HQ8 A;  3PAL A;  1BOD A;  1YUU A;  4NQG A;  1FBV A;  2JQ6 A;  2LV7 A;  1TNP A;  2PVB A;  4PHJ A;  1CFF A;  1ODB A;  1IKU A;  2D8N A;  2FOT A;  3GK1 A;  4FBK A;  1YX8 A;  1B8C A;  2JT0 A;  2JUL A;  2CBL A;  5KTY A;  1DGU A;  1KQM C;  2KDH A;  3GK2 A;  2ZFD A;  3ICF A;  3TDI A;  3KBP A;  1S26 D;  3SG3 A;  4R1E A;  1EXR A;  3E0J A;  1FW4 A;  4I5K A;  3WHU B;  3LLE A;  5PAL A;  2LUX A;  1DTL A;  2KKN A;  4ORC B;  1KFX S;  4I5L B;  2AHD A;  3FLO A;  4YBH B;  1HP1 A;  1JSA A;  2JNX A;  3V4Y A;  4IL1 A;  3D03 A;  1NNW A;  1TNQ A;  3C5W C;  1SNL A;  1QX7 A;  4PCW A;  4B2O A;  4H2F A;  1CTR A;  4MVF A;  4YGA A;  5JPE A;  1UUS A;  1NCX A;  4JPZ B;  2LAN A;  2LE9 B;  4WRI A;  1JFJ A;  1TCO B;  2LCP A;  1HPU A;  1EG3 A;  2ZO9 B;  1S3L A;  3H63 A;  2JPT A;  2M3W A;  3DD4 A;  1F8H A;  2K7O A;  2PAL A;  1KK7 Y;  4I5N B;  1JK7 A;  3RM1 A;  1SW8 A;  4OCI A;  4WQ3 A;  3WHT B;  1OOJ A;  1TN4 A;  1SL8 A;  3HVQ A;  5HKZ A;  3SIA A;  3C1V A;  2OS8 B;  1AK8 A;  1B4C A;  1C7W A;  2XMO A;  2JU0 A;  2M0R A;  1KK8 C;  1YUT A;  2BKI B;  1NX0 A;  3JTD B;  1NX3 A;  3DSC A;  2L50 A;  2JZI A;  3EK4 A;  3C9F A;  2I7A A;  4ZX2 A;  1JF0 A;  1MXE A;  3MSE B;  1NUB A;  3GVE A;  4P5O E;  1QJT A;  2MAZ A;  3SJS A;  4L9M A;  1GGZ A;  1SL9 A;  1V1G A;  2USH A;  1NX1 A;  4H2I A;  5GTU A;  1XFW O;  4OR9 A;  1F4O A;  4PAL A;  1Y6W A;  2MBX A;  1R2U A;  1AJ4 A;  1MUX A;  3GK4 X;  1SCV A;  3OX5 A;  1UHK A;  1Y1A A;  2KI4 B;  1GGW A;  3E7B A;  1F54 A;  1FI6 A;  1MXL C;  2FJU B;  3ZWH A;  1J1D A;  1Z2W A;  1USH A;  3FS7 A;  2EC6 B;  1VRK A;  1K2H A;  2QJC A;  3AAK A;  1K9U A;  1IJ5 A;  3AUZ A;  5J3X A;  1YUR A;  4OV2 A;  3IB7 A;  4N1F A;  2KOT A;  3TS5 B;  1TTX A;  1TNW A;  1SK6 D;  2M97 A;  3CGA A;  4HSZ A;  2QFR A;  2GV5 A;  2R17 A;  2PMY A;  2ZOA A;  2ZRS A;  1NCZ A;  3FIA A;  4M2P A;  2I94 A;  1OMV A;  1S6C A;  1QVI Z;  1A2X A;  3A8R A;  3EK8 A;  2KHN A;  4PE0 A;  4KBP A;  1IQ3 A;  2Z1A A;  1Z2X A;  1X02 A;  3QFN A;  2K2F A;  1IQ5 A;  1YVL A;  2CT9 A;  4YI8 A;  1XA5 A;  4Q04 A;  1UTE A;  1DJY A;  3M0W A;  4GPL B;  1EH2 A;  2E30 A;  3JVT B;  2KYF A;  2KNE A;  4MEW A;  4OR9 B;  1M31 A;  2BBM A;  1DMO A;  1A03 A;  1KBP A;  3H62 B;  1N2D A;  5I2L A;  4MN0 A;  3VRQ A;  2NCO A;  2KGR A;  5KSZ A;  1E8A A;  2MHH A;  3RL3 A;  2H61 C;  1SU1 A;  4AQI A;  1BMO A;  1F71 A;  1PSR A;  3TUY C;  4JA7 A;  2L98 A;  3DSD A;  1REC A;  3TDZ A;  4H1Y P;  4PHK A;  5AER A;  2JXL A;  4MLW A;  1U32 A;  1J55 A;  2M7N A;  2WCE A;  1T70 A;  2BCX A;  2M1K B;  2OTG C;  2LHL A;  2BCD A;  1HO5 A;  1IJ6 A;  4FTG A;  1CDN A;  1G4Y R;  3OB1 B;  4E68 A;  3N5U A;  1XFU O;  2CNP A;  4ORB B;  2LAP A;  2LHI A;  2HYO A;  3BQ3 A;  4LTY A;  4HD0 A;  4V0V A;  1S70 A;  1W24 A;  1PAL A;  1KSO A;  2KBM A;  1ALV A;  1RJV A;  4NDC A;  1JC2 A;  2PRU A;  2WOR A;  1SR6 C;  2HET A;  4ETO A;  3H4S E;  1U5I A;  2WC8 A;  1SMG A;  1CMF A;  1AJ5 A;  1SCM C;  3CWG A;  4IYP C;  1CM1 A;  3I5G B;  3H68 A;  1DJW A;  1UHI A;  1MHO A;  2GGZ A;  2JOJ A;  2KSP A;  2KQY A;  3OHM B;  5DNY A;  2F2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...