4IL1A

Crystal structure of the rat calcineurin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
647
structure length
529
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICFEEAKGLDRINERMPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, Calcineurin subunit B type 1, Serine/threonine-p
publication title Structural basis of calcineurin activation by calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 174
structure length 529
sequence length 647
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4il1A01
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4il1A02
5HKWA 1BODA 4IYPC 4OCIA 2NLNA 4N1FA 2NYLC 3D0YB 1VRKA 4BY5A 1CDNA 1PVBA 3DF0A 3I5HB 5JOLA 1KQVA 1OZOA 3DSCA 2M3WA 4JA7A 1S3NA 1BG1A 3I5FB 1IKUA 1ZMZA 2BE6A 3OX5A 3D10A 1SL9A 3VRNA 3VGOA 3THOB 1YVHA 1FF1A 4H2FA 3H62B 1SCVA 3PALA 1CTRA 2WDCA 3E7BA 1NSHA 2K7DA 3LLEA 1U5IA 3BUOB 1GQMA 2KYCA 2KI6C 4B2OA 1L2OC 1XFUO 2CCMA 3IQQA 3I5FC 2L51A 3QRXA 2GJUA 1LA0A 4GGFC 4JQ0D 2QFRA 3C9FA 4FBQA 4OR9A 1B8CA 4OKHA 1TOPA 2KI4B 4CFRA 3D0YA 1RWYA 1SPYA 3K7VC 3BUXB 4I5KA 2ZRTA 2JT3A 4PHMA 1M31A 3EVUA 1A03A 2QFPA 2LM5A 3HVQA 1PVAA 1DJHA 1XFYO 5I2LA 4TUGA 3WHUB 1F8HA 4V0VA 5CPVA 1J1EA 3BUMB 1C7VA 1YRTB 3AUZA 1MXLC 2ZN9A 2KI4C 4DHLA 1KCYA 1LINA 2AUCA 5KSZA 1BJFA 2K2FA 1B1GA 2KAXA 1UWOA 3E7AA 1UHKA 1KK7Y 1L7ZA 4U8DA 2HYPA 2LVIA 1S6JA 4C0KA 1YURA 2K7CA 4ORBB 1EH2A 2WDDA 1NPQA 3BUNB 4ZVZA 5HYDA 2QJCA 1XVJA 2FCDA 5B8IB 4MOYA 4PE1A 3OHMB 2M97A 1K95A 4YGDB 1KFUL 2FOTA 4MSPA 1K96A 2L2EA 2PALA 1M46A 5IOHA 2LMUA 1B8RA 3EK7A 3EKJA 5DKQA 4HD0A 2KQ6A 3M0WA 1DMOA 4O5GA 4XJKB 1CFPA 1A2XA 1J7QA 4DSYA 3PSNA 2JULA 1CDLA 1DGVA 2M49B 5F6TA 3DVKA 4NDCA 5KTYA 4AQIA 2KOTA 3AV0A 1NX0A 2M1UA 1YUSA 1TNPA 4PCWA 3WNXB 1SU1A 2Z72A 1M45A 2KBIA 3H61A 3DVJA 3ICFA 3OB1B 3SG3A 1SCMB 3LK0A 1J7OA 1ALVA 1JWDA 4KKZA 2SASA 1KSMA 4O4KA 1QATA 2V53A 4H2GA 1SBJA 1XFWO 5B8IA 3BXKA 3TUYB 1QIVA 1JF2A 3V4YA 1D1OA 5HKZA 3FGAC 2M7NA 1LVCD 4PHNA 4HRHA 2BKHB 4A4CA 2USHA 1KSOA 3SG6A 4YKEA 1SCMC 4XJKA 3IB7A 2KFHA 4O43A 2OPOA 5AEQA 3ZTVA 1QV0A 1F70A 1CM4A 1BMOA 2IE3C 4MZLA 4DCKA 3GK4X 1YRUB 2ZNDA 5JPFA 1RECA 1GGWA 2Z06A 3NSOA 2PSRA 4MRXA 1DJYA 2JXLA 1CFDA 1MR8A 3KEVA 2WOSA 1LXFC 3LCPC 4GGNA 4Q7FA 2G9BA 1KK7Z 1BF5A 1SK6D 4AQJA 2A4JA 4YGCB 3VRPA 1J7PA 1DJWA 3JTDB 3NXAA 4PE0A 2LVKA 5J3XA 4KBPA 4MRYA 1DJGA 4OVNF 4C0LA 2QACA 4JPZB 1JF0A 3IVDA 3BQ3A 1JSAA 4UWQA 3KHEA 1QXPA 5C1VA 1GJYA 2BCDA 4V0WA 1Y1UA 5CSJA 5HLOA 2BDXA 4XPNA 4HSZA 2QPTA 4AOMA 2JQ6A 1HP1A 4Q04A 3H69A 3H66A 1TNQA 1H8BA 4FCXA 3C5WC 1Y6WA 2M0RA 5HLVA 1K93D 1MWNA 2F3YA 3BYAA 1USHA 4LTYA 2L0PA 2KBMA 4OV2A 1W7IB 3SIAA 3I5IC 1UHNA 2GV5A 4O24A 1IT6A 4BY4A 1UP5A 2L4HA 4I5NB 3IQOA 3LL8B 4CFQA 1YTZC 3RLZA 3H67A 1K2HA 4H2IA 3ZU0A 1XA5A 5I8NA 5DKNA 5INBA 1OMDA 1CB1A 2AHDA 5J28A 1A75B 1TN4A 2BCBA 1PALA 4QJ5B 4ZX2A 4DIRA 1FPWA 2I7AA 4I5NC 1Q80A 2MA2A 1CFFA 2WC8A 3ZNIA 1S5GY 1YUUA 4P5OE 2MRDA 1N2DA 3GK1A 5G08A 2KFGA 4H1YP 4LU9A 4MZKA 2WNDA 1WLZA 2BL0B 3I5HC 3O2PA 1B4CA 2O8AA 4WWLA 2EC6B 1SR6B 2MLFC 3LL8A 1S6IA 1SL7A 3PSRA 4MLWA 2AAOA 3EVRA 4DUQA 1ZOTB 3NSIA 3TZ1A 1PRWA 1YX7A 2LE9B 1MF8B 2IS9A 4M2PA 1HQVA 1W24A 3KPXA 1SY9A 3CLNA 2BL0C 1IJ5A 1A75A 1EXRA 3O6BA 2EC6C 2KDHA 3N5UA 1QHWA 1WLMA 3CWGA 1SR6C 1N0YA 3FWCA 3EK4A 4P2YB 1DJZA 1QX2A 1SW8A 4E68A 1V73A 1KFXS 1S3LA 2CT9A 2LHIA 5JJGA 2DFJA 4UT2A 2FCEA 2OS8B 2P6BB 4NZVA 3GOFA 3TGHA 1ODBA 2LMTA 3GK2A 1C07A 2LLUA 5CSFA 3BUWB 4PE4A 1XFZO 1X02A 2BE4A 4JA9A 1G4YR 1E8AA 4PDZA 4QJ4B 2E30A 2NYMC 1UHJA 5HKYA 5GTUA 2K0JA 1FJMA 1B9AA 1MF8A 1TRFA 1S6CA 2OS8C 4QJ3B 1UTEA 2GGMA 1OSAA 4TNCA 1NCZA 4L9MA 4ORAB 1QJTA 1CM1A 1BR1B 1QFCA 3AKBA 5GQQC 5EQVA 4FBKA 2ZN8A 2KKNA 2BBMA 1HT9A 1TCFA 3DSDA 2EGDA 2EHBA 4GBAA 2PASA 4I5JA 1EL4A 2P6BA 1IGVA 1CMFA 5IBWA 3PLFB 3BOWB 2JT0A 2JTZA 2Y1NA 1QS7A 1XFVO 2ZFDA 3CGAA 3HX4A 5D7FA 4GUKA 3AAKA 4C0JA 2LMVA 3PN7B 1WRZA 5I2OA 3VROA 1EG3A 3I5GB 3PATA 1BR4B 2K61A 1M63B 3CR4X 1IG5A 3KO0A 4TUIA 1J1DA 4MEWA 1QVIY 1QTXA 1S26D 3OP0A 1K9UA 1OE9B 3RL4A 2MJWB 2Y1MA 4WQ2A 1R6PA 1XK4A 2BCAA 4ORAA 2LANA 5K89A 1NX1A 2WDEA 2KSPA 2NZ0A 3DD4A 4UPGA 4G9JA 2MHHA 4V0XA 2M9GA 2JWWA 1MXEA 1NWDA 4ZCVA 2BBNA 2BKIB 2LAPA 1RK9A 1TCOB 4MN0A 3BOWA 5F3WA 1XO5A 3TUYC 2L5XB 1B47A 2Y4QA 1OOJA 1DVIA 1RTP1 3TDIA 1KFUS 3WHTB 1NYAA 1F4OA 1QX7A 1NCXA 5AANA 1M63A 4ICBA 3HCMA 3H64A 4UT3B 3T1IA 3QFKA 2LP3A 4FTGA 1CNPA 4DRWA 4I5LB 1QIWA 3O78A 1JFKA 1S3MA 4A4BA 2I94A 3CZTX 4GPLB 1NX3A 2LV7A 3TS5B 3RM1A 2I2RE 2IAEC 2M7LA 1CDMA 2WCEA 2KAYA 2B1UA 2O5GA 3QFNA 1FI5A 1TCOA 3H60A 4XYNA 2JU0A 3VRRA 2KAVA 3DVMA 4I5LC 3JTDC 2LVJA 1DF0B 1WDCB 3O4YA 3GVEA 1YR5A 3JVTB 3PFVA 1BLQA 2F2OA 2F2PA 3TS5C 5HPEA 4FBWA 4UT3A 2JTTA 4MVFA 3NSLA 1NCYA 1WRLA 2NXFA 1PSBA 4ZCUA 1AUIB 3RL5A 2RGIA 1TIZA 1ALWA 1S70A 1QVIZ 3ZWHA 3A8RA 3C1VA 1F4QA 2NCPA 1Y1AA 1F71A 1GGZA 1MHOA 2LC5A 1CFCA 3JVTC 3THNA 3EGHA 1SYMA 2HQWA 1S8EA 4YGEB 1AHRA 4YI8A 1QX5B 1HPUA 4ETOA 2KQYA 2SCPA 1KK8B 1JBAA 2M29A 1AK8A 5JJTA 4M2OA 4HRGA 4PE7A 2K7BA 1DF0A 2BECA 1MUXA 1QLSA 2JPTA 2MLEC 2Q4UA 3SG4A 3CK2A 2H61C 2YVTA 3FWBA 3DW8C 2M1KB 4PALA 3FS7A 2HYOA 4ORCB 2WDFA 1NP8A 4USLA 2NXQA 1AUIA 2JC2A 4CPVA 1KK8C 3NSKA 2KHNA 4YBHB 2HY1A 2HETA 1ZFSA 2JOGA 5AXIA 2H61A 1WY9A 1IJ6A 1CMGA 2PVBA 1SNLA 1HO5A 2NCOA 1S1EA 5DNYA 1KWOB 1BU3A 1SL8A 2LLTA 1S36A 5KU1A 1L2OB 2F3ZA 3H63A 4CLNA 2HF5A 2LLSA 1Y0VH 4M2QA 4F0ZB 1CKKA 1UHIA 1J7RA 1CLLA 1SMGA 1XFXO 5DKRA 3H68A 4H2BA 1ZUZA 1OMVA 1OMRA 2R2IA 2K8MB 2LP2A 3A4UB 1UF3A 2KYFA 1PK0D 2CV9A 4ORCA 1TNXA 5AERA 2Q8UA 1KWOC 1CDPA 4CIDA 2JXCA 2CXJA 2KI6D 2OTGB 3JYFA 1IRJA 4NDBA 1M39A 3KF9A 1B7TY 5JPEA 1LA3A 3SJSA 1PULA 1DJXA 4MZJA 1XZWA 2O8GA 2LVVA 1XYDA 1UUSA 1K9KA 2ZKMX 4IL1A 3EGGA 5CSNA 2LUXA 1AP4A 1JFJA 2LUCA 3EVVA 4F0ZA 2OTGC 3VRQA 1QLKA 3OX6A 3AAJA 3KBPA 1S95A 1TNWA 2JNXA 1DT7B 4LACC 1FW4A 1R2UA 4GGFA 1WARA 4WRIA 2ZNEA 3CS1A 5CSIA 4GFTA 1V1FA 2L4IA 1Z2WA 2ISDA 1S5GZ 2CBLA 1C7WA 1J55A 2K7OA 1OIDA 2R17A 1XK4C 2LNKA 2CNPA 4MBEA 2XMOA 3LK1A 3CR5X 2KGBC 1F54A 3AKAA 1KBPA 1WAO1 4J6OA 3EK8A 1W7JB 2F33A 5ER5A 1IQ5A 1V1GA 3TDUA 2Z1AA 3IVEA 3F45A 1B8LA 2Q91A 2KNEA 3SG2A 1PSRA 4N1GA 1G5BA 3PN7C 3RQZA 1TTXA 5TNCA 1BT6A 1JK7A 1K9PA 1LKJA 3I5GC 2WCBA 3QFMA 1FI6A 3E3RA 1OQPA 4GAOA 3PSOA 1JC2A 1BOCA 1DTLA 4YGBB 3RL3A 1AJ5A 1FBVA 2LCPA 2ZBMA 1RROA 2E6WA 1EG4A 2GGZA 2FJUB 2A22A 1Z2XA 1CLMA 1T70A 1DGUA 4FQOA 4M0VA 4JWQA 1B7TZ 5PALA 1KQMB 4ORBA 1AVSA 1YX8A 2IE4C 1WRKA 1OZSA 5D69A 2Y5IA 1CLBA 2KFFA 2BQ8X 1EJ3A 1QASA 2O60A 1UHHA 4NQGA 4WQ3A 3MSEB 2F8PA 4R1EA 2JOJA 2L50A 5BPJA 4NDDA 1II7A 4MP0A 2JNFA 1UURA 1KQMC 4GNKB 3SG5A 2TN4A 2MBXA 1N65A 1YUTA 1U32A 1A4PA 1OIEA 4YGAA 3FIAA 3QG5C 3CTNA 1DJIA 4DT2A 3QFOA 2COLB 2I18A 3ICBA 2HPSA 2PRUA 2CTNA 1IWQA 5FYXA 1OI8A 3SG7A 4MOVA 3K7WC 2K2AA 2PMYA 1NNWA 1T71A 1RJVA 1K90D 2D8NA 1A29A 2DOQA 3CR2A 3H4SE 2BCXA 2JT8A 2M8UA 4PHKA 2KGRA 1WDCC 5AFPA 1G33A 1K94A 1MQ1A 1QV1A 1ZACA 3OB2B 1G8IA 1IQ3A 4N5XA 3EKHA 3I5IB 3DF0B 4PHJA 2LHLA 2AMIA 3IF7A 2JRFA 4D1EA 5I2QA 3IB8A 3P71C 4YRUA 1S3PA 4DS7A 2ZRSA 3PM8A 3WXAA 2G2BA 1F55A 2NPPC 3DVEA 1IH0A 3SIBA 2H2KA 1K8UA 1SKTA 1NX2A 1NIWA 2L98A 1YVLA 4YI9A 1SRAA 2MAZA 3K21A 3TDZA 1U5IB 2HQ8A 5ER4X 2JZIA 1Y1XA 1AJ4A 2WORA 1NUBA 1XM7A 1RFJA 2WCFA 2VRGA 1JUOA 1KFXL 1H4BA 4H1SA 4OR9B 4HREE
chains in the Genus database with same CATH superfamily
5HKWA 1BODA 4IYPC 4OCIA 2NLNA 4N1FA 2NYLC 3D0YB 1VRKA 3VB1A 4BY5A 1CDNA 1PVBA 3DF0A 3I5HB 5JOLA 1KQVA 1OZOA 3DSCA 2M3WA 3FE9A 4JA7A 1S3NA 1BG1A 3I5FB 3R1OA 1ZMZA 2BE6A 3OX5A 3PM2A 1IKUA 3D10A 1SL9A 3VRNA 3VGOA 3THOB 1YVHA 1FF1A 4H2FA 3H62B 1SCVA 3PALA 1CTRA 2WDCA 3E7BA 1NSHA 2K7DA 2L5YA 3LLEA 1U5IA 3BUOB 1GQMA 2KYCA 2KI6C 4B2OA 1L2OC 1XFUO 1QWVA 2CCMA 3IQQA 3SS3A 3I5FC 2L51A 3QRXA 2GJUA 1OOFA 1LA0A 1TWOA 2L2CA 4GGFC 4JQ0D 2QFRA 3C9FA 4FBQA 4OR9A 1B8CA 4OKHA 1TOPA 2KI4B 4CFRA 3D0YA 1RWYA 1SPYA 3D77A 3BUXB 4I5KA 2ZRTA 1W9ZA 2JT3A 1M31A 3EVUA 4PHMA 1A03A 2LM5A 3D78A 1PVAA 1DJHA 2QFPA 1XFYO 5I2LA 3HVQA 4TUGA 3WHUB 1F8HA 4V0VA 5CPVA 1J1EA 3BUMB 1C7VA 1YRTB 3AUZA 1MXLC 2ZN9A 2KI4C 4DHLA 1KCYA 1LINA 2AUCA 5KSZA 1BJFA 2K2FA 1B1GA 2KAXA 1UWOA 3E7AA 1UHKA 1KK7Y 1L7ZA 4U8DA 2HYPA 2LVIA 1S6JA 4C0KA 1YURA 2K7CA 2WCLA 4ORBB 1EH2A 2WDDA 1NPQA 3BUNB 3CZ1A 5HYDA 2QJCA 1XVJA 2FCDA 5B8IB 4MOYA 4ZVZA 4PE1A 3OHMB 2M97A 1K95A 4YGDB 1KFUL 2FOTA 4MSPA 1K96A 2L2EA 2PALA 1M46A 5IOHA 2LMUA 1B8RA 3EK7A 3EKJA 5DKQA 4HD0A 2KQ6A 3M0WA 1DMOA 4O5GA 4XJKB 1CFPA 1A2XA 1J7QA 4DSYA 3PSNA 2JULA 1CDLA 1DGVA 2M49B 5F6TA 3DVKA 4NDCA 5KTYA 4AQIA 2KOTA 3AV0A 1NX0A 2M1UA 1YUSA 1TNPA 2WCKA 4PCWA 3WNXB 1SU1A 2Z72A 1M45A 1DEKA 2KBIA 3H61A 3DVJA 2H8VA 3ICFA 3OB1B 4OZDA 3SG3A 1SCMB 3LK0A 1J7OA 1ALVA 1JWDA 4KKZA 2SASA 2ZOAA 1KSMA 4O4KA 1QATA 2V53A 4H2GA 1SBJA 1SSEB 1XFWO 3BXKA 3TUYB 1QIVA 5B8IA 1JF2A 3V4YA 1D1OA 5HKZA 3FGAC 2M7NA 3L47A 1LVCD 4PHNA 4HRHA 2BKHB 4A4CA 2USHA 1KSOA 4INWA 1ORGA 3SG6A 4YKEA 1SCMC 4XJKA 3IB7A 3SS4A 2KFHA 4O43A 2OPOA 5AEQA 3DYEA 3ZTVA 1QV0A 1F70A 1CM4A 1BMOA 2IE3C 4MZLA 4DCKA 3GK4X 1YRUB 2ZNDA 5JPFA 1P28A 1RECA 2GTEA 1GGWA 3R1PA 3NSOA 2KLEA 2Z06A 2PSRA 3CDNA 4MRXA 1DJYA 2JXLA 1CFDA 1MR8A 3KEVA 2WOSA 1LXFC 1C3ZA 3LCPC 4GGNA 4Q7FA 2G9BA 1KK7Z 1BF5A 2ZO9B 1SK6D 4AQJA 2A4JA 4YGCB 3VRPA 1J7PA 1DJWA 3JTDB 3NXAA 4PE0A 2LVKA 5J3XA 4KBPA 4MRYA 1DJGA 4OVNF 4C0LA 2QACA 4JPZB 1JF0A 5D3OA 3BQ3A 3DZTA 1JSAA 3IVDA 4UWQA 3KHEA 1QXPA 5C1VA 3SS5A 1GJYA 3D74A 3NHTA 2BCDA 4V0WA 1Y1UA 1XFRA 5CSJA 5HLOA 2BDXA 4XPNA 4HSZA 2QPTA 4AOMA 2JQ6A 1HP1A 4Q04A 3H69A 3H66A 1TNQA 1H8BA 2YEQA 5DICA 4FCXA 3C5WC 1Y6WA 3B88A 2M0RA 5HLVA 1K93D 1MWNA 2F3YA 3BYAA 1USHA 4LTYA 2L0PA 2KBMA 4OV2A 1W7IB 3SIAA 3RZSA 3I5IC 1UHNA 2GV5A 4O24A 1IT6A 4BY4A 1UP5A 2KLDA 2L4HA 4I5NB 3IQOA 3LL8B 4CFQA 1YTZC 3RLZA 3H67A 3NGVA 1K2HA 4H2IA 3ZU0A 1XA5A 5I8NA 5DKNA 5INBA 1OMDA 1CB1A 2AHDA 3R1VA 2QDIA 5J28A 1A75B 1TN4A 2BCBA 1PALA 4QJ5B 4ZX2A 4DIRA 1FPWA 2I7AA 5HL1A 4I5NC 2WC6A 2WC5A 1TUJA 1Q80A 2MA2A 1CFFA 2WC8A 3B87A 3ZNIA 1S5GY 1YUUA 4P5OE 2MRDA 1N2DA 2WCMA 3GK1A 5G08A 2KFGA 4H1YP 4LU9A 4MZKA 2WNDA 1WLZA 2BL0B 3I5HC 3O2PA 1B4CA 2O8AA 3L4LA 4WWLA 2EC6B 3S0BA 1SR6B 2MLFC 3LL8A 1S6IA 1SL7A 3PSRA 4MLWA 2AAOA 3EVRA 4DUQA 1ZOTB 3NSIA 3NHIA 3TZ1A 1PRWA 1YX7A 2LE9B 1MF8B 2IS9A 4M2PA 2PQLA 1HQVA 1W24A 2JPOA 1SY9A 3CLNA 2BL0C 1IJ5A 1A75A 3KPXA 1EXRA 3IVTA 3O6BA 4F7FA 2EC6C 2KDHA 3N5UA 1QHWA 1WLMA 3CWGA 1SR6C 1N0YA 3FWCA 3EK4A 4P2YB 5FI6A 1DJZA 1QX2A 1SW8A 4E68A 1V73A 1KFXS 1S3LA 2CT9A 2LHIA 5JJGA 2DFJA 4UT2A 2FCEA 2OS8B 2P6BB 4JD9A 3N7HA 4NZVA 3GOFA 3TGHA 1ODBA 2LMTA 3GK2A 1C07A 2LLUA 5CSFA 3BUWB 4PE4A 1XFZO 4JKTA 1X02A 2BE4A 4JA9A 1G4YR 1E8AA 4PDZA 4QJ4B 2YGUA 2E30A 2NYMC 1UHJA 1Z4HA 5HKYA 5GTUA 2K0JA 1FJMA 1B9AA 2DXLA 1MF8A 1TRFA 1S6CA 2OS8C 4QJ3B 1UTEA 2GGMA 1OSAA 4TNCA 1NCZA 4L9MA 4ORAB 1QJTA 1CM1A 1BR1B 1QFCA 3AKBA 5GQQC 5EQVA 4FBKA 2ZN8A 2KKNA 2BBMA 1HT9A 2BAPA 1TCFA 3DSDA 2EGDA 2EHBA 4GBAA 2PASA 3D73A 4I5JA 1EL4A 1GM0A 1IGVA 2P6BA 1CMFA 5IBWA 1DQEA 3BOWB 3PLFB 2JT0A 2JTZA 2Y1NA 1QS7A 1XFVO 2ZFDA 3CGAA 2QEOA 3HX4A 4GUKA 3AAKA 5D7FA 2LMVA 3PN7B 1WRZA 4C0JA 5I2OA 5EL2A 3VROA 1EG3A 3I5GB 3PATA 1BR4B 2K61A 1M63B 3CR4X 1IG5A 3KO0A 4TUIA 1J1DA 4MEWA 1QVIY 1QTXA 1S26D 1T14A 1K9UA 1OE9B 3OP0A 2P71A 3RL4A 2MJWB 2Y1MA 4WQ2A 1R6PA 1XK4A 3DXLA 2BCAA 4ORAA 2LANA 2DXNA 5K89A 1NX1A 2WDEA 2KSPA 2NZ0A 3DD4A 4UPGA 4G9JA 2MHHA 4V0XA 2M9GA 2JWWA 1MXEA 4IJ7A 1NWDA 2QEHA 4ZCVA 2BBNA 2BKIB 2LAPA 1RK9A 1TCOB 4MN0A 3BOWA 5F3WA 1XO5A 3TUYC 2L5XB 1B47A 2Y4QA 1OOJA 1DVIA 1RTP1 3TDIA 1KFUS 3WHTB 1NYAA 1F4OA 1OOIX 1NCXA 1QX7A 5AANA 4ICBA 3HCMA 1M63A 3H64A 3P71C 3T1IA 1IIOA 2K60A 3QFKA 2LP3A 4FTGA 1CNPA 4DRWA 4I5LB 1QIWA 3O78A 3DW8C 1JFKA 1S3MA 4A4BA 2I94A 3CZTX 4GPLB 1NX3A 2LV7A 3TS5B 3RM1A 2I2RE 2IAEC 2M7LA 1CDMA 2WCEA 2KAYA 2B1UA 2O5GA 3QFNA 1FI5A 1TCOA 3H60A 4XYNA 1OOHA 2JU0A 2KAVA 3DVMA 3VRRA 4I5LC 1OOGA 3JTDC 2LVJA 1DF0B 1WDCB 3O4YA 5I94A 3GVEA 1YR5A 3JVTB 3O4XA 3K7VC 3PFVA 1BLQA 2F2OA 2F2PA 3TS5C 5HPEA 4FBWA 4UT3A 2JTTA 4MVFA 3NSLA 1NCYA 1WRLA 2NXFA 1PSBA 4ZCUA 1AUIB 3RL5A 2RGIA 1TIZA 1ALWA 3FE8A 1S70A 1QVIZ 3CYZA 3DY9A 3ZWHA 3A8RA 3C1VA 1F4QA 2NCPA 1Y1AA 1F71A 1GGZA 1MHOA 2LC5A 1CFCA 1TUZA 3JVTC 3THNA 3EGHA 1SYMA 2HQWA 1S8EA 4YGEB 1AHRA 4YI8A 1QX5B 1HPUA 4ETOA 2KQYA 3PJIA 2SCPA 1KK8B 3UNWA 1JBAA 2PYQA 2M29A 1AK8A 5JJTA 4M2OA 4HRGA 4PE7A 2K7BA 1DF0A 2BECA 1MUXA 1QLSA 2JPTA 2MLEC 2P70A 2Q4UA 3SG4A 2H61C 2YVTA 3FWBA 3CK2A 2M1KB 4PALA 3FS7A 2HYOA 4ORCB 2WDFA 1NP8A 4USLA 2NXQA 1AUIA 2JC2A 4CPVA 1KK8C 3NSKA 2KHNA 4YBHB 2HY1A 2HETA 1ZFSA 3B7AA 2JOGA 5AXIA 2H61A 3UO9A 1WY9A 1IJ6A 2BNXA 1CMGA 2PVBA 1SNLA 1HO5A 2NCOA 1S1EA 5DNYA 1KWOB 1BU3A 1SL8A 2LLTA 1S36A 5KU1A 1L2OB 2F3ZA 3H63A 4CLNA 2HF5A 2LLSA 1Y0VH 4M2QA 4F0ZB 1CKKA 1UHIA 5FI7A 1J7RA 1CLLA 1SMGA 1XFXO 5DKRA 3H68A 4H2BA 1LS8A 1ZUZA 1OMVA 1OMRA 2R2IA 2K8MB 2LP2A 3A4UB 1UF3A 2KYFA 1PK0D 2CV9A 4ORCA 1TNXA 5AERA 2Q8UA 1KWOC 1CDPA 1DELA 4CIDA 2JXCA 2CXJA 2KI6D 3BJHA 2OTGB 3JYFA 1IRJA 4NDBA 1M39A 3KF9A 1B7TY 5JPEA 1LA3A 3SJSA 3R72A 1PULA 1DJXA 4MZJA 1XZWA 2O8GA 2LVVA 1XYDA 1UUSA 1K9KA 2ZKMX 4IL1A 3EGGA 5CSNA 2LUXA 1AP4A 1JFJA 4INXA 2LUCA 3EVVA 3K1EA 4F0ZA 2OTGC 3VRQA 1QLKA 3OX6A 3AAJA 3E0JA 1S95A 1TNWA 2JNXA 1DT7B 3KBPA 1FW4A 1R2UA 4GGFA 4LACC 1WARA 4WRIA 2ZNEA 3CS1A 5CSIA 3S0DA 3EG5B 4GFTA 1V1FA 2L4IA 1Z2WA 2ISDA 1S5GZ 2CBLA 1C7WA 1J55A 2K7OA 1OIDA 2R17A 1XK4C 2LNKA 2CNPA 4MBEA 2XMOA 3LK1A 3CR5X 2KGBC 3FLOA 1F54A 3AKAA 1KBPA 1WAO1 4J6OA 3EK8A 1W7JB 2F33A 4KYNA 5ER5A 1DC1A 1IQ5A 1V1GA 3TDUA 2Z1AA 3IVEA 3F45A 3FE6A 1B8LA 2Q91A 2KNEA 3SG2A 1PSRA 4N1GA 1G5BA 3PN7C 3RQZA 1TTXA 3D75A 5TNCA 1BT6A 2WCHA 1K9PA 1LKJA 2WCJA 2WCBA 3I5GC 1JK7A 3QFMA 4FQTA 1FI6A 3E3RA 1OQPA 4GAOA 3PSOA 1JC2A 1BOCA 1DTLA 4YGBB 3RL3A 1AJ5A 1FBVA 2KPHA 2LCPA 3S0GA 2ZBMA 1RROA 2E6WA 1EG4A 2GGZA 2FJUB 3S0AA 2A22A 1C3YA 1Z2XA 1CLMA 1T70A 1DGUA 4FQOA 3S0FA 3B86A 4JWQA 1B7TZ 5PALA 1KQMB 4M0VA 4ORBA 1AVSA 1YX8A 2IE4C 1WRKA 1OZSA 3CABA 5D69A 1OW4A 2Y5IA 2KFFA 3OBVA 1CLBA 1EJ3A 2ERBA 1QASA 4PT1A 2BQ8X 2O60A 1UHHA 4NQGA 4WQ3A 3MSEB 2F8PA 4R1EA 2JOJA 2L50A 5BPJA 4NDDA 1II7A 4MP0A 2JNFA 3QMEA 5FI2A 1UURA 1KQMC 4GNKB 3SG5A 2TN4A 2MBXA 1N65A 1YUTA 1U32A 3D03A 1A4PA 2QEVA 1OIEA 4UT3B 4YGAA 3L4AA 3FIAA 3QG5C 3CTNA 1DJIA 4DT2A 3QFOA 2COLB 2I18A 3ICBA 2HPSA 2PRUA 2CTNA 1IWQA 3Q8IA 5FYXA 1OI8A 2FJYA 3SG7A 4MOVA 3K7WC 2K2AA 2PMYA 1NNWA 1T71A 3CZ2A 1RJVA 1K90D 2D8NA 1A29A 2DOQA 3CR2A 3H4SE 2BCXA 2JT8A 2M8UA 4PHKA 2KGRA 1WDCC 5AFPA 1G33A 1K94A 1MQ1A 1QV1A 1ZACA 3OB2B 1G8IA 1IQ3A 4N5XA 3EKHA 3I5IB 3DF0B 4PHJA 2LHLA 2AMIA 3IF7A 2JRFA 3OGNA 3S0EA 4D1EA 5I2QA 3IB8A 4YRUA 1S3PA 4DS7A 2ZRSA 3PM8A 3WXAA 3B6XA 2G2BA 1F55A 2NPPC 3BFBA 3DVEA 1IH0A 3SIBA 2H2KA 1K8UA 1SKTA 1NX2A 3BFHA 1NIWA 2L98A 1YVLA 3CZ0A 1SRAA 2MAZA 3K21A 4YI9A 1U5IB 3TDZA 3BFAA 2HQ8A 5ER4X 2QEBA 3V2LA 2JZIA 1Y1XA 1AJ4A 2WORA 1NUBA 1XM7A 1RFJA 2WCFA 3D76A 1Z2CB 2VRGA 1JUOA 1KFXL 1H4BA 4H1SA 4OR9B 4HREE
chains in the Genus database with same CATH topology
5HKWA 1BODA 4IYPC 4OCIA 2NLNA 4N1FA 2NYLC 3D0YB 1VRKA 4BY5A 1CDNA 1PVBA 3DF0A 3I5HB 5JOLA 1KQVA 1OZOA 3DSCA 2M3WA 4JA7A 1S3NA 1BG1A 3I5FB 1IKUA 1ZMZA 2BE6A 3OX5A 3D10A 1SL9A 3VRNA 3VGOA 3THOB 1YVHA 1FF1A 4H2FA 3H62B 1SCVA 3PALA 1CTRA 2WDCA 3E7BA 1NSHA 2K7DA 3LLEA 1U5IA 3BUOB 1GQMA 2KYCA 2KI6C 4B2OA 1L2OC 1XFUO 2CCMA 3IQQA 3I5FC 2L51A 3QRXA 2GJUA 1LA0A 4GGFC 4JQ0D 2QFRA 3C9FA 4FBQA 4OR9A 1B8CA 4OKHA 1TOPA 2KI4B 4CFRA 3D0YA 1RWYA 1SPYA 3K7VC 3BUXB 4I5KA 2ZRTA 2JT3A 4PHMA 1M31A 3EVUA 1A03A 2QFPA 2LM5A 3HVQA 1PVAA 1DJHA 1XFYO 5I2LA 4TUGA 3WHUB 1F8HA 4V0VA 5CPVA 1J1EA 3BUMB 1C7VA 1YRTB 3AUZA 1MXLC 2ZN9A 2KI4C 4DHLA 1KCYA 1LINA 2AUCA 5KSZA 1BJFA 2K2FA 1B1GA 2KAXA 1UWOA 3E7AA 1UHKA 1KK7Y 1L7ZA 4U8DA 2HYPA 2LVIA 1S6JA 4C0KA 1YURA 2K7CA 4ORBB 1EH2A 2WDDA 1NPQA 3BUNB 4ZVZA 5HYDA 2QJCA 1XVJA 2FCDA 5B8IB 4MOYA 4PE1A 3OHMB 2M97A 1K95A 4YGDB 1KFUL 2FOTA 4MSPA 1K96A 2L2EA 2PALA 1M46A 5IOHA 2LMUA 1B8RA 3EK7A 3EKJA 5DKQA 4HD0A 2KQ6A 3M0WA 1DMOA 4O5GA 4XJKB 1CFPA 1A2XA 1J7QA 4DSYA 3PSNA 2JULA 1CDLA 1DGVA 2M49B 5F6TA 3DVKA 4NDCA 5KTYA 4AQIA 2KOTA 3AV0A 1NX0A 2M1UA 1YUSA 1TNPA 4PCWA 3WNXB 1SU1A 2Z72A 1M45A 2KBIA 3H61A 3DVJA 3ICFA 3OB1B 3SG3A 1SCMB 3LK0A 1J7OA 1ALVA 1JWDA 4KKZA 2SASA 2ZOAA 1KSMA 4O4KA 1QATA 2V53A 4H2GA 1SBJA 1XFWO 5B8IA 3BXKA 3TUYB 1QIVA 1JF2A 3V4YA 1D1OA 5HKZA 3FGAC 2M7NA 1LVCD 4PHNA 4HRHA 2BKHB 4A4CA 2USHA 1KSOA 3SG6A 4YKEA 1SCMC 4XJKA 3IB7A 2KFHA 4O43A 2OPOA 5AEQA 3ZTVA 1QV0A 1F70A 1CM4A 1BMOA 2IE3C 4MZLA 4DCKA 3GK4X 1YRUB 2ZNDA 5JPFA 1RECA 1GGWA 2Z06A 3NSOA 2PSRA 4MRXA 1DJYA 2JXLA 1CFDA 1MR8A 3KEVA 2WOSA 1LXFC 3LCPC 4GGNA 4Q7FA 2G9BA 1KK7Z 1BF5A 2ZO9B 1SK6D 4AQJA 2A4JA 4YGCB 3VRPA 1J7PA 1DJWA 3JTDB 3NXAA 4PE0A 2LVKA 5J3XA 4KBPA 4MRYA 1DJGA 4OVNF 4C0LA 2QACA 4JPZB 1JF0A 3IVDA 3BQ3A 1JSAA 4UWQA 3KHEA 1QXPA 5C1VA 1GJYA 2BCDA 4V0WA 1Y1UA 5CSJA 5HLOA 2BDXA 4XPNA 4HSZA 2QPTA 4AOMA 2JQ6A 1HP1A 4Q04A 3H69A 3H66A 1TNQA 1H8BA 2YEQA 4FCXA 3C5WC 1Y6WA 2M0RA 5HLVA 1K93D 1MWNA 2F3YA 3BYAA 1USHA 4LTYA 2L0PA 2KBMA 4OV2A 1W7IB 3SIAA 3I5IC 1UHNA 2GV5A 4O24A 1IT6A 4BY4A 1UP5A 2L4HA 4I5NB 3IQOA 3LL8B 4CFQA 1YTZC 3RLZA 3H67A 1K2HA 4H2IA 3ZU0A 1XA5A 5I8NA 5DKNA 5INBA 1OMDA 1CB1A 2AHDA 5J28A 1A75B 1TN4A 2BCBA 1PALA 4QJ5B 4ZX2A 4DIRA 1FPWA 2I7AA 4I5NC 1Q80A 2MA2A 1CFFA 2WC8A 3ZNIA 1S5GY 1YUUA 4P5OE 2MRDA 1N2DA 3GK1A 5G08A 2KFGA 4H1YP 4LU9A 4MZKA 2WNDA 1WLZA 2BL0B 3I5HC 3O2PA 1B4CA 2O8AA 4WWLA 2EC6B 1SR6B 2MLFC 3LL8A 1S6IA 1SL7A 3PSRA 4MLWA 2AAOA 3EVRA 4DUQA 1ZOTB 3NSIA 3TZ1A 1PRWA 1YX7A 2LE9B 1MF8B 2IS9A 4M2PA 1HQVA 1W24A 3KPXA 1SY9A 3CLNA 2BL0C 1IJ5A 1A75A 1EXRA 3O6BA 2EC6C 2KDHA 3N5UA 1QHWA 1WLMA 3CWGA 1SR6C 1N0YA 3FWCA 3EK4A 4P2YB 1DJZA 1QX2A 1SW8A 4E68A 1V73A 1KFXS 1S3LA 2CT9A 2LHIA 5JJGA 2DFJA 4UT2A 2FCEA 2OS8B 2P6BB 4NZVA 3GOFA 3TGHA 1ODBA 2LMTA 3GK2A 1C07A 2LLUA 5CSFA 3BUWB 4PE4A 1XFZO 1X02A 2BE4A 4JA9A 1G4YR 1E8AA 4PDZA 4QJ4B 2E30A 2NYMC 1UHJA 5HKYA 5GTUA 2K0JA 1FJMA 1B9AA 2DXLA 1MF8A 1TRFA 1S6CA 2OS8C 4QJ3B 1UTEA 2GGMA 1OSAA 4TNCA 1NCZA 4L9MA 4ORAB 1QJTA 1CM1A 1BR1B 1QFCA 3AKBA 5GQQC 5EQVA 4FBKA 2ZN8A 2KKNA 2BBMA 1HT9A 1TCFA 3DSDA 2EGDA 2EHBA 4GBAA 2PASA 4I5JA 1EL4A 2P6BA 1IGVA 1CMFA 5IBWA 3PLFB 3BOWB 2JT0A 2JTZA 2Y1NA 1QS7A 1XFVO 2ZFDA 3CGAA 3HX4A 5D7FA 4GUKA 3AAKA 4C0JA 2LMVA 3PN7B 1WRZA 5I2OA 3VROA 1EG3A 3I5GB 3PATA 1BR4B 2K61A 1M63B 3CR4X 1IG5A 3KO0A 4TUIA 1J1DA 4MEWA 1QVIY 1QTXA 1S26D 3OP0A 1K9UA 1OE9B 3RL4A 2MJWB 2Y1MA 4WQ2A 1R6PA 1XK4A 2BCAA 4ORAA 2LANA 2DXNA 5K89A 1NX1A 2WDEA 2KSPA 2NZ0A 3DD4A 4UPGA 4G9JA 2MHHA 4V0XA 2M9GA 2JWWA 1MXEA 1NWDA 4ZCVA 2BBNA 2BKIB 2LAPA 1RK9A 1TCOB 4MN0A 3BOWA 5F3WA 1XO5A 3TUYC 2L5XB 1B47A 2Y4QA 1OOJA 1DVIA 1RTP1 3TDIA 1KFUS 3WHTB 1NYAA 1F4OA 1QX7A 1NCXA 5AANA 1M63A 4ICBA 3HCMA 3H64A 4UT3B 3T1IA 3QFKA 2LP3A 4FTGA 1CNPA 4DRWA 4I5LB 1QIWA 3O78A 1JFKA 1S3MA 4A4BA 2I94A 3CZTX 4GPLB 1NX3A 2LV7A 3TS5B 3RM1A 2I2RE 2IAEC 2M7LA 1CDMA 2WCEA 2KAYA 2B1UA 2O5GA 3QFNA 1FI5A 1TCOA 3H60A 4XYNA 2JU0A 3VRRA 2KAVA 3DVMA 4I5LC 3JTDC 2LVJA 1DF0B 1WDCB 3O4YA 3GVEA 1YR5A 3JVTB 3PFVA 1BLQA 2F2OA 2F2PA 3TS5C 5HPEA 4FBWA 4UT3A 2JTTA 4MVFA 3NSLA 1NCYA 1WRLA 2NXFA 1PSBA 4ZCUA 1AUIB 3RL5A 2RGIA 1TIZA 1ALWA 1S70A 1QVIZ 3ZWHA 3A8RA 3C1VA 1F4QA 2NCPA 1Y1AA 1F71A 1GGZA 1MHOA 2LC5A 1CFCA 3JVTC 3THNA 3EGHA 1SYMA 2HQWA 1S8EA 4YGEB 1AHRA 4YI8A 1QX5B 1HPUA 4ETOA 2KQYA 2SCPA 1KK8B 1JBAA 2M29A 1AK8A 5JJTA 4M2OA 4HRGA 4PE7A 2K7BA 1DF0A 2BECA 1MUXA 1QLSA 2JPTA 2MLEC 2Q4UA 3SG4A 3CK2A 2H61C 2YVTA 3FWBA 3DW8C 2M1KB 4PALA 3FS7A 2HYOA 4ORCB 2WDFA 1NP8A 4USLA 2NXQA 1AUIA 2JC2A 4CPVA 1KK8C 3NSKA 2KHNA 4YBHB 2HY1A 2HETA 1ZFSA 2JOGA 5AXIA 2H61A 1WY9A 1IJ6A 1CMGA 2PVBA 1SNLA 1HO5A 2NCOA 1S1EA 5DNYA 1KWOB 1BU3A 1SL8A 2LLTA 1S36A 5KU1A 1L2OB 2F3ZA 3H63A 4CLNA 2HF5A 2LLSA 1Y0VH 4M2QA 4F0ZB 1CKKA 1UHIA 1J7RA 1CLLA 1SMGA 1XFXO 5DKRA 3H68A 4H2BA 1ZUZA 1OMVA 1OMRA 2R2IA 2K8MB 2LP2A 3A4UB 1UF3A 2KYFA 1PK0D 2CV9A 4ORCA 1TNXA 5AERA 2Q8UA 1KWOC 1CDPA 4CIDA 2JXCA 2CXJA 2KI6D 2OTGB 3JYFA 1IRJA 4NDBA 1M39A 3KF9A 1B7TY 5JPEA 1LA3A 3SJSA 1PULA 1DJXA 4MZJA 1XZWA 2O8GA 2LVVA 1XYDA 1UUSA 1K9KA 2ZKMX 4IL1A 3EGGA 5CSNA 2LUXA 1AP4A 1JFJA 2LUCA 3EVVA 4F0ZA 2OTGC 3VRQA 1QLKA 3OX6A 3AAJA 3E0JA 1S95A 1TNWA 2JNXA 1DT7B 3KBPA 1FW4A 1R2UA 4GGFA 4LACC 1WARA 4WRIA 2ZNEA 3CS1A 5CSIA 4GFTA 1V1FA 2L4IA 1Z2WA 2ISDA 1S5GZ 2CBLA 1C7WA 1J55A 2K7OA 1OIDA 2R17A 1XK4C 2LNKA 2CNPA 4MBEA 2XMOA 3LK1A 3CR5X 2KGBC 3FLOA 1F54A 3AKAA 1KBPA 1WAO1 4J6OA 3EK8A 1W7JB 2F33A 5ER5A 1IQ5A 1V1GA 3TDUA 2Z1AA 3IVEA 3F45A 1B8LA 2Q91A 2KNEA 3SG2A 1PSRA 4N1GA 1G5BA 3PN7C 3RQZA 1TTXA 5TNCA 1BT6A 1JK7A 1K9PA 1LKJA 3I5GC 2WCBA 3QFMA 1FI6A 3E3RA 1OQPA 4GAOA 3PSOA 1JC2A 1BOCA 1DTLA 4YGBB 3RL3A 1AJ5A 1FBVA 2LCPA 2ZBMA 1RROA 2E6WA 1EG4A 2GGZA 2FJUB 2A22A 1Z2XA 1CLMA 1T70A 1DGUA 4FQOA 4M0VA 4JWQA 1B7TZ 5PALA 1KQMB 4ORBA 1AVSA 1YX8A 2IE4C 1WRKA 1OZSA 5D69A 2Y5IA 1CLBA 2KFFA 2BQ8X 1EJ3A 1QASA 2O60A 1UHHA 4NQGA 4WQ3A 3MSEB 2F8PA 4R1EA 2JOJA 2L50A 5BPJA 4NDDA 1II7A 4MP0A 2JNFA 1UURA 1KQMC 4GNKB 3SG5A 2TN4A 2MBXA 1N65A 1YUTA 1U32A 3D03A 1A4PA 1OIEA 4YGAA 3FIAA 3QG5C 3CTNA 1DJIA 4DT2A 3QFOA 2COLB 2I18A 3ICBA 2HPSA 2PRUA 2CTNA 1IWQA 5FYXA 1OI8A 3SG7A 4MOVA 3K7WC 2K2AA 2PMYA 1NNWA 1T71A 1RJVA 1K90D 2D8NA 1A29A 2DOQA 3CR2A 3H4SE 2BCXA 2JT8A 2M8UA 4PHKA 2KGRA 1WDCC 5AFPA 1G33A 1K94A 1MQ1A 1QV1A 1ZACA 3OB2B 1G8IA 1IQ3A 4N5XA 3EKHA 3I5IB 3DF0B 4PHJA 2LHLA 2AMIA 3IF7A 2JRFA 4D1EA 5I2QA 3IB8A 3P71C 4YRUA 1S3PA 4DS7A 2ZRSA 3PM8A 3WXAA 2G2BA 1F55A 2NPPC 3DVEA 1IH0A 3SIBA 2H2KA 1K8UA 1SKTA 1NX2A 1NIWA 2L98A 1YVLA 4YI9A 1SRAA 2MAZA 3K21A 3TDZA 1U5IB 2HQ8A 5ER4X 2JZIA 1Y1XA 1AJ4A 2WORA 1NUBA 1XM7A 1RFJA 2WCFA 2VRGA 1JUOA 1KFXL 1H4BA 4H1SA 4OR9B 4HREE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKW A;  1BOD A;  4IYP C;  4OCI A;  2NLN A;  4N1F A;  2NYL C;  3D0Y B;  1VRK A;  4BY5 A;  1CDN A;  1PVB A;  3DF0 A;  3I5H B;  5JOL A;  1KQV A;  1OZO A;  3DSC A;  2M3W A;  4JA7 A;  1S3N A;  1BG1 A;  3I5F B;  1IKU A;  1ZMZ A;  2BE6 A;  3OX5 A;  3D10 A;  1SL9 A;  3VRN A;  3VGO A;  3THO B;  1YVH A;  1FF1 A;  4H2F A;  3H62 B;  1SCV A;  3PAL A;  1CTR A;  2WDC A;  3E7B A;  1NSH A;  2K7D A;  3LLE A;  1U5I A;  3BUO B;  1GQM A;  2KYC A;  2KI6 C;  4B2O A;  1L2O C;  1XFU O;  2CCM A;  3IQQ A;  3I5F C;  2L51 A;  3QRX A;  2GJU A;  1LA0 A;  4GGF C;  4JQ0 D;  2QFR A;  3C9F A;  4FBQ A;  4OR9 A;  1B8C A;  4OKH A;  1TOP A;  2KI4 B;  4CFR A;  3D0Y A;  1RWY A;  1SPY A;  3K7V C;  3BUX B;  4I5K A;  2ZRT A;  2JT3 A;  4PHM A;  1M31 A;  3EVU A;  1A03 A;  2QFP A;  2LM5 A;  3HVQ A;  1PVA A;  1DJH A;  1XFY O;  5I2L A;  4TUG A;  3WHU B;  1F8H A;  4V0V A;  5CPV A;  1J1E A;  3BUM B;  1C7V A;  1YRT B;  3AUZ A;  1MXL C;  2ZN9 A;  2KI4 C;  4DHL A;  1KCY A;  1LIN A;  2AUC A;  5KSZ A;  1BJF A;  2K2F A;  1B1G A;  2KAX A;  1UWO A;  3E7A A;  1UHK A;  1KK7 Y;  1L7Z A;  4U8D A;  2HYP A;  2LVI A;  1S6J A;  4C0K A;  1YUR A;  2K7C A;  4ORB B;  1EH2 A;  2WDD A;  1NPQ A;  3BUN B;  4ZVZ A;  5HYD A;  2QJC A;  1XVJ A;  2FCD A;  5B8I B;  4MOY A;  4PE1 A;  3OHM B;  2M97 A;  1K95 A;  4YGD B;  1KFU L;  2FOT A;  4MSP A;  1K96 A;  2L2E A;  2PAL A;  1M46 A;  5IOH A;  2LMU A;  1B8R A;  3EK7 A;  3EKJ A;  5DKQ A;  4HD0 A;  2KQ6 A;  3M0W A;  1DMO A;  4O5G A;  4XJK B;  1CFP A;  1A2X A;  1J7Q A;  4DSY A;  3PSN A;  2JUL A;  1CDL A;  1DGV A;  2M49 B;  5F6T A;  3DVK A;  4NDC A;  5KTY A;  4AQI A;  2KOT A;  3AV0 A;  1NX0 A;  2M1U A;  1YUS A;  1TNP A;  4PCW A;  3WNX B;  1SU1 A;  2Z72 A;  1M45 A;  2KBI A;  3H61 A;  3DVJ A;  3ICF A;  3OB1 B;  3SG3 A;  1SCM B;  3LK0 A;  1J7O A;  1ALV A;  1JWD A;  4KKZ A;  2SAS A;  1KSM A;  4O4K A;  1QAT A;  2V53 A;  4H2G A;  1SBJ A;  1XFW O;  5B8I A;  3BXK A;  3TUY B;  1QIV A;  1JF2 A;  3V4Y A;  1D1O A;  5HKZ A;  3FGA C;  2M7N A;  1LVC D;  4PHN A;  4HRH A;  2BKH B;  4A4C A;  2USH A;  1KSO A;  3SG6 A;  4YKE A;  1SCM C;  4XJK A;  3IB7 A;  2KFH A;  4O43 A;  2OPO A;  5AEQ A;  3ZTV A;  1QV0 A;  1F70 A;  1CM4 A;  1BMO A;  2IE3 C;  4MZL A;  4DCK A;  3GK4 X;  1YRU B;  2ZND A;  5JPF A;  1REC A;  1GGW A;  2Z06 A;  3NSO A;  2PSR A;  4MRX A;  1DJY A;  2JXL A;  1CFD A;  1MR8 A;  3KEV A;  2WOS A;  1LXF C;  3LCP C;  4GGN A;  4Q7F A;  2G9B A;  1KK7 Z;  1BF5 A;  1SK6 D;  4AQJ A;  2A4J A;  4YGC B;  3VRP A;  1J7P A;  1DJW A;  3JTD B;  3NXA A;  4PE0 A;  2LVK A;  5J3X A;  4KBP A;  4MRY A;  1DJG A;  4OVN F;  4C0L A;  2QAC A;  4JPZ B;  1JF0 A;  3IVD A;  3BQ3 A;  1JSA A;  4UWQ A;  3KHE A;  1QXP A;  5C1V A;  1GJY A;  2BCD A;  4V0W A;  1Y1U A;  5CSJ A;  5HLO A;  2BDX A;  4XPN A;  4HSZ A;  2QPT A;  4AOM A;  2JQ6 A;  1HP1 A;  4Q04 A;  3H69 A;  3H66 A;  1TNQ A;  1H8B A;  4FCX A;  3C5W C;  1Y6W A;  2M0R A;  5HLV A;  1K93 D;  1MWN A;  2F3Y A;  3BYA A;  1USH A;  4LTY A;  2L0P A;  2KBM A;  4OV2 A;  1W7I B;  3SIA A;  3I5I C;  1UHN A;  2GV5 A;  4O24 A;  1IT6 A;  4BY4 A;  1UP5 A;  2L4H A;  4I5N B;  3IQO A;  3LL8 B;  4CFQ A;  1YTZ C;  3RLZ A;  3H67 A;  1K2H A;  4H2I A;  3ZU0 A;  1XA5 A;  5I8N A;  5DKN A;  5INB A;  1OMD A;  1CB1 A;  2AHD A;  5J28 A;  1A75 B;  1TN4 A;  2BCB A;  1PAL A;  4QJ5 B;  4ZX2 A;  4DIR A;  1FPW A;  2I7A A;  4I5N C;  1Q80 A;  2MA2 A;  1CFF A;  2WC8 A;  3ZNI A;  1S5G Y;  1YUU A;  4P5O E;  2MRD A;  1N2D A;  3GK1 A;  5G08 A;  2KFG A;  4H1Y P;  4LU9 A;  4MZK A;  2WND A;  1WLZ A;  2BL0 B;  3I5H C;  3O2P A;  1B4C A;  2O8A A;  4WWL A;  2EC6 B;  1SR6 B;  2MLF C;  3LL8 A;  1S6I A;  1SL7 A;  3PSR A;  4MLW A;  2AAO A;  3EVR A;  4DUQ A;  1ZOT B;  3NSI A;  3TZ1 A;  1PRW A;  1YX7 A;  2LE9 B;  1MF8 B;  2IS9 A;  4M2P A;  1HQV A;  1W24 A;  3KPX A;  1SY9 A;  3CLN A;  2BL0 C;  1IJ5 A;  1A75 A;  1EXR A;  3O6B A;  2EC6 C;  2KDH A;  3N5U A;  1QHW A;  1WLM A;  3CWG A;  1SR6 C;  1N0Y A;  3FWC A;  3EK4 A;  4P2Y B;  1DJZ A;  1QX2 A;  1SW8 A;  4E68 A;  1V73 A;  1KFX S;  1S3L A;  2CT9 A;  2LHI A;  5JJG A;  2DFJ A;  4UT2 A;  2FCE A;  2OS8 B;  2P6B B;  4NZV A;  3GOF A;  3TGH A;  1ODB A;  2LMT A;  3GK2 A;  1C07 A;  2LLU A;  5CSF A;  3BUW B;  4PE4 A;  1XFZ O;  1X02 A;  2BE4 A;  4JA9 A;  1G4Y R;  1E8A A;  4PDZ A;  4QJ4 B;  2E30 A;  2NYM C;  1UHJ A;  5HKY A;  5GTU A;  2K0J A;  1FJM A;  1B9A A;  1MF8 A;  1TRF A;  1S6C A;  2OS8 C;  4QJ3 B;  1UTE A;  2GGM A;  1OSA A;  4TNC A;  1NCZ A;  4L9M A;  4ORA B;  1QJT A;  1CM1 A;  1BR1 B;  1QFC A;  3AKB A;  5GQQ C;  5EQV A;  4FBK A;  2ZN8 A;  2KKN A;  2BBM A;  1HT9 A;  1TCF A;  3DSD A;  2EGD A;  2EHB A;  4GBA A;  2PAS A;  4I5J A;  1EL4 A;  2P6B A;  1IGV A;  1CMF A;  5IBW A;  3PLF B;  3BOW B;  2JT0 A;  2JTZ A;  2Y1N A;  1QS7 A;  1XFV O;  2ZFD A;  3CGA A;  3HX4 A;  5D7F A;  4GUK A;  3AAK A;  4C0J A;  2LMV A;  3PN7 B;  1WRZ A;  5I2O A;  3VRO A;  1EG3 A;  3I5G B;  3PAT A;  1BR4 B;  2K61 A;  1M63 B;  3CR4 X;  1IG5 A;  3KO0 A;  4TUI A;  1J1D A;  4MEW A;  1QVI Y;  1QTX A;  1S26 D;  3OP0 A;  1K9U A;  1OE9 B;  3RL4 A;  2MJW B;  2Y1M A;  4WQ2 A;  1R6P A;  1XK4 A;  2BCA A;  4ORA A;  2LAN A;  5K89 A;  1NX1 A;  2WDE A;  2KSP A;  2NZ0 A;  3DD4 A;  4UPG A;  4G9J A;  2MHH A;  4V0X A;  2M9G A;  2JWW A;  1MXE A;  1NWD A;  4ZCV A;  2BBN A;  2BKI B;  2LAP A;  1RK9 A;  1TCO B;  4MN0 A;  3BOW A;  5F3W A;  1XO5 A;  3TUY C;  2L5X B;  1B47 A;  2Y4Q A;  1OOJ A;  1DVI A;  1RTP 1;  3TDI A;  1KFU S;  3WHT B;  1NYA A;  1F4O A;  1QX7 A;  1NCX A;  5AAN A;  1M63 A;  4ICB A;  3HCM A;  3H64 A;  4UT3 B;  3T1I A;  3QFK A;  2LP3 A;  4FTG A;  1CNP A;  4DRW A;  4I5L B;  1QIW A;  3O78 A;  1JFK A;  1S3M A;  4A4B A;  2I94 A;  3CZT X;  4GPL B;  1NX3 A;  2LV7 A;  3TS5 B;  3RM1 A;  2I2R E;  2IAE C;  2M7L A;  1CDM A;  2WCE A;  2KAY A;  2B1U A;  2O5G A;  3QFN A;  1FI5 A;  1TCO A;  3H60 A;  4XYN A;  2JU0 A;  3VRR A;  2KAV A;  3DVM A;  4I5L C;  3JTD C;  2LVJ A;  1DF0 B;  1WDC B;  3O4Y A;  3GVE A;  1YR5 A;  3JVT B;  3PFV A;  1BLQ A;  2F2O A;  2F2P A;  3TS5 C;  5HPE A;  4FBW A;  4UT3 A;  2JTT A;  4MVF A;  3NSL A;  1NCY A;  1WRL A;  2NXF A;  1PSB A;  4ZCU A;  1AUI B;  3RL5 A;  2RGI A;  1TIZ A;  1ALW A;  1S70 A;  1QVI Z;  3ZWH A;  3A8R A;  3C1V A;  1F4Q A;  2NCP A;  1Y1A A;  1F71 A;  1GGZ A;  1MHO A;  2LC5 A;  1CFC A;  3JVT C;  3THN A;  3EGH A;  1SYM A;  2HQW A;  1S8E A;  4YGE B;  1AHR A;  4YI8 A;  1QX5 B;  1HPU A;  4ETO A;  2KQY A;  2SCP A;  1KK8 B;  1JBA A;  2M29 A;  1AK8 A;  5JJT A;  4M2O A;  4HRG A;  4PE7 A;  2K7B A;  1DF0 A;  2BEC A;  1MUX A;  1QLS A;  2JPT A;  2MLE C;  2Q4U A;  3SG4 A;  3CK2 A;  2H61 C;  2YVT A;  3FWB A;  3DW8 C;  2M1K B;  4PAL A;  3FS7 A;  2HYO A;  4ORC B;  2WDF A;  1NP8 A;  4USL A;  2NXQ A;  1AUI A;  2JC2 A;  4CPV A;  1KK8 C;  3NSK A;  2KHN A;  4YBH B;  2HY1 A;  2HET A;  1ZFS A;  2JOG A;  5AXI A;  2H61 A;  1WY9 A;  1IJ6 A;  1CMG A;  2PVB A;  1SNL A;  1HO5 A;  2NCO A;  1S1E A;  5DNY A;  1KWO B;  1BU3 A;  1SL8 A;  2LLT A;  1S36 A;  5KU1 A;  1L2O B;  2F3Z A;  3H63 A;  4CLN A;  2HF5 A;  2LLS A;  1Y0V H;  4M2Q A;  4F0Z B;  1CKK A;  1UHI A;  1J7R A;  1CLL A;  1SMG A;  1XFX O;  5DKR A;  3H68 A;  4H2B A;  1ZUZ A;  1OMV A;  1OMR A;  2R2I A;  2K8M B;  2LP2 A;  3A4U B;  1UF3 A;  2KYF A;  1PK0 D;  2CV9 A;  4ORC A;  1TNX A;  5AER A;  2Q8U A;  1KWO C;  1CDP A;  4CID A;  2JXC A;  2CXJ A;  2KI6 D;  2OTG B;  3JYF A;  1IRJ A;  4NDB A;  1M39 A;  3KF9 A;  1B7T Y;  5JPE A;  1LA3 A;  3SJS A;  1PUL A;  1DJX A;  4MZJ A;  1XZW A;  2O8G A;  2LVV A;  1XYD A;  1UUS A;  1K9K A;  2ZKM X;  4IL1 A;  3EGG A;  5CSN A;  2LUX A;  1AP4 A;  1JFJ A;  2LUC A;  3EVV A;  4F0Z A;  2OTG C;  3VRQ A;  1QLK A;  3OX6 A;  3AAJ A;  3KBP A;  1S95 A;  1TNW A;  2JNX A;  1DT7 B;  4LAC C;  1FW4 A;  1R2U A;  4GGF A;  1WAR A;  4WRI A;  2ZNE A;  3CS1 A;  5CSI A;  4GFT A;  1V1F A;  2L4I A;  1Z2W A;  2ISD A;  1S5G Z;  2CBL A;  1C7W A;  1J55 A;  2K7O A;  1OID A;  2R17 A;  1XK4 C;  2LNK A;  2CNP A;  4MBE A;  2XMO A;  3LK1 A;  3CR5 X;  2KGB C;  1F54 A;  3AKA A;  1KBP A;  1WAO 1;  4J6O A;  3EK8 A;  1W7J B;  2F33 A;  5ER5 A;  1IQ5 A;  1V1G A;  3TDU A;  2Z1A A;  3IVE A;  3F45 A;  1B8L A;  2Q91 A;  2KNE A;  3SG2 A;  1PSR A;  4N1G A;  1G5B A;  3PN7 C;  3RQZ A;  1TTX A;  5TNC A;  1BT6 A;  1JK7 A;  1K9P A;  1LKJ A;  3I5G C;  2WCB A;  3QFM A;  1FI6 A;  3E3R A;  1OQP A;  4GAO A;  3PSO A;  1JC2 A;  1BOC A;  1DTL A;  4YGB B;  3RL3 A;  1AJ5 A;  1FBV A;  2LCP A;  2ZBM A;  1RRO A;  2E6W A;  1EG4 A;  2GGZ A;  2FJU B;  2A22 A;  1Z2X A;  1CLM A;  1T70 A;  1DGU A;  4FQO A;  4M0V A;  4JWQ A;  1B7T Z;  5PAL A;  1KQM B;  4ORB A;  1AVS A;  1YX8 A;  2IE4 C;  1WRK A;  1OZS A;  5D69 A;  2Y5I A;  1CLB A;  2KFF A;  2BQ8 X;  1EJ3 A;  1QAS A;  2O60 A;  1UHH A;  4NQG A;  4WQ3 A;  3MSE B;  2F8P A;  4R1E A;  2JOJ A;  2L50 A;  5BPJ A;  4NDD A;  1II7 A;  4MP0 A;  2JNF A;  1UUR A;  1KQM C;  4GNK B;  3SG5 A;  2TN4 A;  2MBX A;  1N65 A;  1YUT A;  1U32 A;  1A4P A;  1OIE A;  4YGA A;  3FIA A;  3QG5 C;  3CTN A;  1DJI A;  4DT2 A;  3QFO A;  2COL B;  2I18 A;  3ICB A;  2HPS A;  2PRU A;  2CTN A;  1IWQ A;  5FYX A;  1OI8 A;  3SG7 A;  4MOV A;  3K7W C;  2K2A A;  2PMY A;  1NNW A;  1T71 A;  1RJV A;  1K90 D;  2D8N A;  1A29 A;  2DOQ A;  3CR2 A;  3H4S E;  2BCX A;  2JT8 A;  2M8U A;  4PHK A;  2KGR A;  1WDC C;  5AFP A;  1G33 A;  1K94 A;  1MQ1 A;  1QV1 A;  1ZAC A;  3OB2 B;  1G8I A;  1IQ3 A;  4N5X A;  3EKH A;  3I5I B;  3DF0 B;  4PHJ A;  2LHL A;  2AMI A;  3IF7 A;  2JRF A;  4D1E A;  5I2Q A;  3IB8 A;  3P71 C;  4YRU A;  1S3P A;  4DS7 A;  2ZRS A;  3PM8 A;  3WXA A;  2G2B A;  1F55 A;  2NPP C;  3DVE A;  1IH0 A;  3SIB A;  2H2K A;  1K8U A;  1SKT A;  1NX2 A;  1NIW A;  2L98 A;  1YVL A;  4YI9 A;  1SRA A;  2MAZ A;  3K21 A;  3TDZ A;  1U5I B;  2HQ8 A;  5ER4 X;  2JZI A;  1Y1X A;  1AJ4 A;  2WOR A;  1NUB A;  1XM7 A;  1RFJ A;  2WCF A;  2VRG A;  1JUO A;  1KFX L;  1H4B A;  4H1S A;  4OR9 B;  4HRE E; 
#chains in the Genus database with same CATH topology
 5HKW A;  1BOD A;  4IYP C;  4OCI A;  2NLN A;  4N1F A;  2NYL C;  3D0Y B;  1VRK A;  3VB1 A;  4BY5 A;  1CDN A;  1PVB A;  3DF0 A;  3I5H B;  5JOL A;  1KQV A;  1OZO A;  3DSC A;  2M3W A;  3FE9 A;  4JA7 A;  1S3N A;  1BG1 A;  3I5F B;  3R1O A;  1ZMZ A;  2BE6 A;  3OX5 A;  3PM2 A;  1IKU A;  3D10 A;  1SL9 A;  3VRN A;  3VGO A;  3THO B;  1YVH A;  1FF1 A;  4H2F A;  3H62 B;  1SCV A;  3PAL A;  1CTR A;  2WDC A;  3E7B A;  1NSH A;  2K7D A;  2L5Y A;  3LLE A;  1U5I A;  3BUO B;  1GQM A;  2KYC A;  2KI6 C;  4B2O A;  1L2O C;  1XFU O;  1QWV A;  2CCM A;  3IQQ A;  3SS3 A;  3I5F C;  2L51 A;  3QRX A;  2GJU A;  1OOF A;  1LA0 A;  1TWO A;  2L2C A;  4GGF C;  4JQ0 D;  2QFR A;  3C9F A;  4FBQ A;  4OR9 A;  1B8C A;  4OKH A;  1TOP A;  2KI4 B;  4CFR A;  3D0Y A;  1RWY A;  1SPY A;  3D77 A;  3BUX B;  4I5K A;  2ZRT A;  1W9Z A;  2JT3 A;  1M31 A;  3EVU A;  4PHM A;  1A03 A;  2LM5 A;  3D78 A;  1PVA A;  1DJH A;  2QFP A;  1XFY O;  5I2L A;  3HVQ A;  4TUG A;  3WHU B;  1F8H A;  4V0V A;  5CPV A;  1J1E A;  3BUM B;  1C7V A;  1YRT B;  3AUZ A;  1MXL C;  2ZN9 A;  2KI4 C;  4DHL A;  1KCY A;  1LIN A;  2AUC A;  5KSZ A;  1BJF A;  2K2F A;  1B1G A;  2KAX A;  1UWO A;  3E7A A;  1UHK A;  1KK7 Y;  1L7Z A;  4U8D A;  2HYP A;  2LVI A;  1S6J A;  4C0K A;  1YUR A;  2K7C A;  2WCL A;  4ORB B;  1EH2 A;  2WDD A;  1NPQ A;  3BUN B;  3CZ1 A;  5HYD A;  2QJC A;  1XVJ A;  2FCD A;  5B8I B;  4MOY A;  4ZVZ A;  4PE1 A;  3OHM B;  2M97 A;  1K95 A;  4YGD B;  1KFU L;  2FOT A;  4MSP A;  1K96 A;  2L2E A;  2PAL A;  1M46 A;  5IOH A;  2LMU A;  1B8R A;  3EK7 A;  3EKJ A;  5DKQ A;  4HD0 A;  2KQ6 A;  3M0W A;  1DMO A;  4O5G A;  4XJK B;  1CFP A;  1A2X A;  1J7Q A;  4DSY A;  3PSN A;  2JUL A;  1CDL A;  1DGV A;  2M49 B;  5F6T A;  3DVK A;  4NDC A;  5KTY A;  4AQI A;  2KOT A;  3AV0 A;  1NX0 A;  2M1U A;  1YUS A;  1TNP A;  2WCK A;  4PCW A;  3WNX B;  1SU1 A;  2Z72 A;  1M45 A;  1DEK A;  2KBI A;  3H61 A;  3DVJ A;  2H8V A;  3ICF A;  3OB1 B;  4OZD A;  3SG3 A;  1SCM B;  3LK0 A;  1J7O A;  1ALV A;  1JWD A;  4KKZ A;  2SAS A;  2ZOA A;  1KSM A;  4O4K A;  1QAT A;  2V53 A;  4H2G A;  1SBJ A;  1SSE B;  1XFW O;  3BXK A;  3TUY B;  1QIV A;  5B8I A;  1JF2 A;  3V4Y A;  1D1O A;  5HKZ A;  3FGA C;  2M7N A;  3L47 A;  1LVC D;  4PHN A;  4HRH A;  2BKH B;  4A4C A;  2USH A;  1KSO A;  4INW A;  1ORG A;  3SG6 A;  4YKE A;  1SCM C;  4XJK A;  3IB7 A;  3SS4 A;  2KFH A;  4O43 A;  2OPO A;  5AEQ A;  3DYE A;  3ZTV A;  1QV0 A;  1F70 A;  1CM4 A;  1BMO A;  2IE3 C;  4MZL A;  4DCK A;  3GK4 X;  1YRU B;  2ZND A;  5JPF A;  1P28 A;  1REC A;  2GTE A;  1GGW A;  3R1P A;  3NSO A;  2KLE A;  2Z06 A;  2PSR A;  3CDN A;  4MRX A;  1DJY A;  2JXL A;  1CFD A;  1MR8 A;  3KEV A;  2WOS A;  1LXF C;  1C3Z A;  3LCP C;  4GGN A;  4Q7F A;  2G9B A;  1KK7 Z;  1BF5 A;  2ZO9 B;  1SK6 D;  4AQJ A;  2A4J A;  4YGC B;  3VRP A;  1J7P A;  1DJW A;  3JTD B;  3NXA A;  4PE0 A;  2LVK A;  5J3X A;  4KBP A;  4MRY A;  1DJG A;  4OVN F;  4C0L A;  2QAC A;  4JPZ B;  1JF0 A;  5D3O A;  3BQ3 A;  3DZT A;  1JSA A;  3IVD A;  4UWQ A;  3KHE A;  1QXP A;  5C1V A;  3SS5 A;  1GJY A;  3D74 A;  3NHT A;  2BCD A;  4V0W A;  1Y1U A;  1XFR A;  5CSJ A;  5HLO A;  2BDX A;  4XPN A;  4HSZ A;  2QPT A;  4AOM A;  2JQ6 A;  1HP1 A;  4Q04 A;  3H69 A;  3H66 A;  1TNQ A;  1H8B A;  2YEQ A;  5DIC A;  4FCX A;  3C5W C;  1Y6W A;  3B88 A;  2M0R A;  5HLV A;  1K93 D;  1MWN A;  2F3Y A;  3BYA A;  1USH A;  4LTY A;  2L0P A;  2KBM A;  4OV2 A;  1W7I B;  3SIA A;  3RZS A;  3I5I C;  1UHN A;  2GV5 A;  4O24 A;  1IT6 A;  4BY4 A;  1UP5 A;  2KLD A;  2L4H A;  4I5N B;  3IQO A;  3LL8 B;  4CFQ A;  1YTZ C;  3RLZ A;  3H67 A;  3NGV A;  1K2H A;  4H2I A;  3ZU0 A;  1XA5 A;  5I8N A;  5DKN A;  5INB A;  1OMD A;  1CB1 A;  2AHD A;  3R1V A;  2QDI A;  5J28 A;  1A75 B;  1TN4 A;  2BCB A;  1PAL A;  4QJ5 B;  4ZX2 A;  4DIR A;  1FPW A;  2I7A A;  5HL1 A;  4I5N C;  2WC6 A;  2WC5 A;  1TUJ A;  1Q80 A;  2MA2 A;  1CFF A;  2WC8 A;  3B87 A;  3ZNI A;  1S5G Y;  1YUU A;  4P5O E;  2MRD A;  1N2D A;  2WCM A;  3GK1 A;  5G08 A;  2KFG A;  4H1Y P;  4LU9 A;  4MZK A;  2WND A;  1WLZ A;  2BL0 B;  3I5H C;  3O2P A;  1B4C A;  2O8A A;  3L4L A;  4WWL A;  2EC6 B;  3S0B A;  1SR6 B;  2MLF C;  3LL8 A;  1S6I A;  1SL7 A;  3PSR A;  4MLW A;  2AAO A;  3EVR A;  4DUQ A;  1ZOT B;  3NSI A;  3NHI A;  3TZ1 A;  1PRW A;  1YX7 A;  2LE9 B;  1MF8 B;  2IS9 A;  4M2P A;  2PQL A;  1HQV A;  1W24 A;  2JPO A;  1SY9 A;  3CLN A;  2BL0 C;  1IJ5 A;  1A75 A;  3KPX A;  1EXR A;  3IVT A;  3O6B A;  4F7F A;  2EC6 C;  2KDH A;  3N5U A;  1QHW A;  1WLM A;  3CWG A;  1SR6 C;  1N0Y A;  3FWC A;  3EK4 A;  4P2Y B;  5FI6 A;  1DJZ A;  1QX2 A;  1SW8 A;  4E68 A;  1V73 A;  1KFX S;  1S3L A;  2CT9 A;  2LHI A;  5JJG A;  2DFJ A;  4UT2 A;  2FCE A;  2OS8 B;  2P6B B;  4JD9 A;  3N7H A;  4NZV A;  3GOF A;  3TGH A;  1ODB A;  2LMT A;  3GK2 A;  1C07 A;  2LLU A;  5CSF A;  3BUW B;  4PE4 A;  1XFZ O;  4JKT A;  1X02 A;  2BE4 A;  4JA9 A;  1G4Y R;  1E8A A;  4PDZ A;  4QJ4 B;  2YGU A;  2E30 A;  2NYM C;  1UHJ A;  1Z4H A;  5HKY A;  5GTU A;  2K0J A;  1FJM A;  1B9A A;  2DXL A;  1MF8 A;  1TRF A;  1S6C A;  2OS8 C;  4QJ3 B;  1UTE A;  2GGM A;  1OSA A;  4TNC A;  1NCZ A;  4L9M A;  4ORA B;  1QJT A;  1CM1 A;  1BR1 B;  1QFC A;  3AKB A;  5GQQ C;  5EQV A;  4FBK A;  2ZN8 A;  2KKN A;  2BBM A;  1HT9 A;  2BAP A;  1TCF A;  3DSD A;  2EGD A;  2EHB A;  4GBA A;  2PAS A;  3D73 A;  4I5J A;  1EL4 A;  1GM0 A;  1IGV A;  2P6B A;  1CMF A;  5IBW A;  1DQE A;  3BOW B;  3PLF B;  2JT0 A;  2JTZ A;  2Y1N A;  1QS7 A;  1XFV O;  2ZFD A;  3CGA A;  2QEO A;  3HX4 A;  4GUK A;  3AAK A;  5D7F A;  2LMV A;  3PN7 B;  1WRZ A;  4C0J A;  5I2O A;  5EL2 A;  3VRO A;  1EG3 A;  3I5G B;  3PAT A;  1BR4 B;  2K61 A;  1M63 B;  3CR4 X;  1IG5 A;  3KO0 A;  4TUI A;  1J1D A;  4MEW A;  1QVI Y;  1QTX A;  1S26 D;  1T14 A;  1K9U A;  1OE9 B;  3OP0 A;  2P71 A;  3RL4 A;  2MJW B;  2Y1M A;  4WQ2 A;  1R6P A;  1XK4 A;  3DXL A;  2BCA A;  4ORA A;  2LAN A;  2DXN A;  5K89 A;  1NX1 A;  2WDE A;  2KSP A;  2NZ0 A;  3DD4 A;  4UPG A;  4G9J A;  2MHH A;  4V0X A;  2M9G A;  2JWW A;  1MXE A;  4IJ7 A;  1NWD A;  2QEH A;  4ZCV A;  2BBN A;  2BKI B;  2LAP A;  1RK9 A;  1TCO B;  4MN0 A;  3BOW A;  5F3W A;  1XO5 A;  3TUY C;  2L5X B;  1B47 A;  2Y4Q A;  1OOJ A;  1DVI A;  1RTP 1;  3TDI A;  1KFU S;  3WHT B;  1NYA A;  1F4O A;  1OOI X;  1NCX A;  1QX7 A;  5AAN A;  4ICB A;  3HCM A;  1M63 A;  3H64 A;  3P71 C;  3T1I A;  1IIO A;  2K60 A;  3QFK A;  2LP3 A;  4FTG A;  1CNP A;  4DRW A;  4I5L B;  1QIW A;  3O78 A;  3DW8 C;  1JFK A;  1S3M A;  4A4B A;  2I94 A;  3CZT X;  4GPL B;  1NX3 A;  2LV7 A;  3TS5 B;  3RM1 A;  2I2R E;  2IAE C;  2M7L A;  1CDM A;  2WCE A;  2KAY A;  2B1U A;  2O5G A;  3QFN A;  1FI5 A;  1TCO A;  3H60 A;  4XYN A;  1OOH A;  2JU0 A;  2KAV A;  3DVM A;  3VRR A;  4I5L C;  1OOG A;  3JTD C;  2LVJ A;  1DF0 B;  1WDC B;  3O4Y A;  5I94 A;  3GVE A;  1YR5 A;  3JVT B;  3O4X A;  3K7V C;  3PFV A;  1BLQ A;  2F2O A;  2F2P A;  3TS5 C;  5HPE A;  4FBW A;  4UT3 A;  2JTT A;  4MVF A;  3NSL A;  1NCY A;  1WRL A;  2NXF A;  1PSB A;  4ZCU A;  1AUI B;  3RL5 A;  2RGI A;  1TIZ A;  1ALW A;  3FE8 A;  1S70 A;  1QVI Z;  3CYZ A;  3DY9 A;  3ZWH A;  3A8R A;  3C1V A;  1F4Q A;  2NCP A;  1Y1A A;  1F71 A;  1GGZ A;  1MHO A;  2LC5 A;  1CFC A;  1TUZ A;  3JVT C;  3THN A;  3EGH A;  1SYM A;  2HQW A;  1S8E A;  4YGE B;  1AHR A;  4YI8 A;  1QX5 B;  1HPU A;  4ETO A;  2KQY A;  3PJI A;  2SCP A;  1KK8 B;  3UNW A;  1JBA A;  2PYQ A;  2M29 A;  1AK8 A;  5JJT A;  4M2O A;  4HRG A;  4PE7 A;  2K7B A;  1DF0 A;  2BEC A;  1MUX A;  1QLS A;  2JPT A;  2MLE C;  2P70 A;  2Q4U A;  3SG4 A;  2H61 C;  2YVT A;  3FWB A;  3CK2 A;  2M1K B;  4PAL A;  3FS7 A;  2HYO A;  4ORC B;  2WDF A;  1NP8 A;  4USL A;  2NXQ A;  1AUI A;  2JC2 A;  4CPV A;  1KK8 C;  3NSK A;  2KHN A;  4YBH B;  2HY1 A;  2HET A;  1ZFS A;  3B7A A;  2JOG A;  5AXI A;  2H61 A;  3UO9 A;  1WY9 A;  1IJ6 A;  2BNX A;  1CMG A;  2PVB A;  1SNL A;  1HO5 A;  2NCO A;  1S1E A;  5DNY A;  1KWO B;  1BU3 A;  1SL8 A;  2LLT A;  1S36 A;  5KU1 A;  1L2O B;  2F3Z A;  3H63 A;  4CLN A;  2HF5 A;  2LLS A;  1Y0V H;  4M2Q A;  4F0Z B;  1CKK A;  1UHI A;  5FI7 A;  1J7R A;  1CLL A;  1SMG A;  1XFX O;  5DKR A;  3H68 A;  4H2B A;  1LS8 A;  1ZUZ A;  1OMV A;  1OMR A;  2R2I A;  2K8M B;  2LP2 A;  3A4U B;  1UF3 A;  2KYF A;  1PK0 D;  2CV9 A;  4ORC A;  1TNX A;  5AER A;  2Q8U A;  1KWO C;  1CDP A;  1DEL A;  4CID A;  2JXC A;  2CXJ A;  2KI6 D;  3BJH A;  2OTG B;  3JYF A;  1IRJ A;  4NDB A;  1M39 A;  3KF9 A;  1B7T Y;  5JPE A;  1LA3 A;  3SJS A;  3R72 A;  1PUL A;  1DJX A;  4MZJ A;  1XZW A;  2O8G A;  2LVV A;  1XYD A;  1UUS A;  1K9K A;  2ZKM X;  4IL1 A;  3EGG A;  5CSN A;  2LUX A;  1AP4 A;  1JFJ A;  4INX A;  2LUC A;  3EVV A;  3K1E A;  4F0Z A;  2OTG C;  3VRQ A;  1QLK A;  3OX6 A;  3AAJ A;  3E0J A;  1S95 A;  1TNW A;  2JNX A;  1DT7 B;  3KBP A;  1FW4 A;  1R2U A;  4GGF A;  4LAC C;  1WAR A;  4WRI A;  2ZNE A;  3CS1 A;  5CSI A;  3S0D A;  3EG5 B;  4GFT A;  1V1F A;  2L4I A;  1Z2W A;  2ISD A;  1S5G Z;  2CBL A;  1C7W A;  1J55 A;  2K7O A;  1OID A;  2R17 A;  1XK4 C;  2LNK A;  2CNP A;  4MBE A;  2XMO A;  3LK1 A;  3CR5 X;  2KGB C;  3FLO A;  1F54 A;  3AKA A;  1KBP A;  1WAO 1;  4J6O A;  3EK8 A;  1W7J B;  2F33 A;  4KYN A;  5ER5 A;  1DC1 A;  1IQ5 A;  1V1G A;  3TDU A;  2Z1A A;  3IVE A;  3F45 A;  3FE6 A;  1B8L A;  2Q91 A;  2KNE A;  3SG2 A;  1PSR A;  4N1G A;  1G5B A;  3PN7 C;  3RQZ A;  1TTX A;  3D75 A;  5TNC A;  1BT6 A;  2WCH A;  1K9P A;  1LKJ A;  2WCJ A;  2WCB A;  3I5G C;  1JK7 A;  3QFM A;  4FQT A;  1FI6 A;  3E3R A;  1OQP A;  4GAO A;  3PSO A;  1JC2 A;  1BOC A;  1DTL A;  4YGB B;  3RL3 A;  1AJ5 A;  1FBV A;  2KPH A;  2LCP A;  3S0G A;  2ZBM A;  1RRO A;  2E6W A;  1EG4 A;  2GGZ A;  2FJU B;  3S0A A;  2A22 A;  1C3Y A;  1Z2X A;  1CLM A;  1T70 A;  1DGU A;  4FQO A;  3S0F A;  3B86 A;  4JWQ A;  1B7T Z;  5PAL A;  1KQM B;  4M0V A;  4ORB A;  1AVS A;  1YX8 A;  2IE4 C;  1WRK A;  1OZS A;  3CAB A;  5D69 A;  1OW4 A;  2Y5I A;  2KFF A;  3OBV A;  1CLB A;  1EJ3 A;  2ERB A;  1QAS A;  4PT1 A;  2BQ8 X;  2O60 A;  1UHH A;  4NQG A;  4WQ3 A;  3MSE B;  2F8P A;  4R1E A;  2JOJ A;  2L50 A;  5BPJ A;  4NDD A;  1II7 A;  4MP0 A;  2JNF A;  3QME A;  5FI2 A;  1UUR A;  1KQM C;  4GNK B;  3SG5 A;  2TN4 A;  2MBX A;  1N65 A;  1YUT A;  1U32 A;  3D03 A;  1A4P A;  2QEV A;  1OIE A;  4UT3 B;  4YGA A;  3L4A A;  3FIA A;  3QG5 C;  3CTN A;  1DJI A;  4DT2 A;  3QFO A;  2COL B;  2I18 A;  3ICB A;  2HPS A;  2PRU A;  2CTN A;  1IWQ A;  3Q8I A;  5FYX A;  1OI8 A;  2FJY A;  3SG7 A;  4MOV A;  3K7W C;  2K2A A;  2PMY A;  1NNW A;  1T71 A;  3CZ2 A;  1RJV A;  1K90 D;  2D8N A;  1A29 A;  2DOQ A;  3CR2 A;  3H4S E;  2BCX A;  2JT8 A;  2M8U A;  4PHK A;  2KGR A;  1WDC C;  5AFP A;  1G33 A;  1K94 A;  1MQ1 A;  1QV1 A;  1ZAC A;  3OB2 B;  1G8I A;  1IQ3 A;  4N5X A;  3EKH A;  3I5I B;  3DF0 B;  4PHJ A;  2LHL A;  2AMI A;  3IF7 A;  2JRF A;  3OGN A;  3S0E A;  4D1E A;  5I2Q A;  3IB8 A;  4YRU A;  1S3P A;  4DS7 A;  2ZRS A;  3PM8 A;  3WXA A;  3B6X A;  2G2B A;  1F55 A;  2NPP C;  3BFB A;  3DVE A;  1IH0 A;  3SIB A;  2H2K A;  1K8U A;  1SKT A;  1NX2 A;  3BFH A;  1NIW A;  2L98 A;  1YVL A;  3CZ0 A;  1SRA A;  2MAZ A;  3K21 A;  4YI9 A;  1U5I B;  3TDZ A;  3BFA A;  2HQ8 A;  5ER4 X;  2QEB A;  3V2L A;  2JZI A;  1Y1X A;  1AJ4 A;  2WOR A;  1NUB A;  1XM7 A;  1RFJ A;  2WCF A;  3D76 A;  1Z2C B;  2VRG A;  1JUO A;  1KFX L;  1H4B A;  4H1S A;  4OR9 B;  4HRE E; 
#chains in the Genus database with same CATH homology
 5HKW A;  1BOD A;  4IYP C;  4OCI A;  2NLN A;  4N1F A;  2NYL C;  3D0Y B;  1VRK A;  4BY5 A;  1CDN A;  1PVB A;  3DF0 A;  3I5H B;  5JOL A;  1KQV A;  1OZO A;  3DSC A;  2M3W A;  4JA7 A;  1S3N A;  1BG1 A;  3I5F B;  1IKU A;  1ZMZ A;  2BE6 A;  3OX5 A;  3D10 A;  1SL9 A;  3VRN A;  3VGO A;  3THO B;  1YVH A;  1FF1 A;  4H2F A;  3H62 B;  1SCV A;  3PAL A;  1CTR A;  2WDC A;  3E7B A;  1NSH A;  2K7D A;  3LLE A;  1U5I A;  3BUO B;  1GQM A;  2KYC A;  2KI6 C;  4B2O A;  1L2O C;  1XFU O;  2CCM A;  3IQQ A;  3I5F C;  2L51 A;  3QRX A;  2GJU A;  1LA0 A;  4GGF C;  4JQ0 D;  2QFR A;  3C9F A;  4FBQ A;  4OR9 A;  1B8C A;  4OKH A;  1TOP A;  2KI4 B;  4CFR A;  3D0Y A;  1RWY A;  1SPY A;  3K7V C;  3BUX B;  4I5K A;  2ZRT A;  2JT3 A;  4PHM A;  1M31 A;  3EVU A;  1A03 A;  2QFP A;  2LM5 A;  3HVQ A;  1PVA A;  1DJH A;  1XFY O;  5I2L A;  4TUG A;  3WHU B;  1F8H A;  4V0V A;  5CPV A;  1J1E A;  3BUM B;  1C7V A;  1YRT B;  3AUZ A;  1MXL C;  2ZN9 A;  2KI4 C;  4DHL A;  1KCY A;  1LIN A;  2AUC A;  5KSZ A;  1BJF A;  2K2F A;  1B1G A;  2KAX A;  1UWO A;  3E7A A;  1UHK A;  1KK7 Y;  1L7Z A;  4U8D A;  2HYP A;  2LVI A;  1S6J A;  4C0K A;  1YUR A;  2K7C A;  4ORB B;  1EH2 A;  2WDD A;  1NPQ A;  3BUN B;  4ZVZ A;  5HYD A;  2QJC A;  1XVJ A;  2FCD A;  5B8I B;  4MOY A;  4PE1 A;  3OHM B;  2M97 A;  1K95 A;  4YGD B;  1KFU L;  2FOT A;  4MSP A;  1K96 A;  2L2E A;  2PAL A;  1M46 A;  5IOH A;  2LMU A;  1B8R A;  3EK7 A;  3EKJ A;  5DKQ A;  4HD0 A;  2KQ6 A;  3M0W A;  1DMO A;  4O5G A;  4XJK B;  1CFP A;  1A2X A;  1J7Q A;  4DSY A;  3PSN A;  2JUL A;  1CDL A;  1DGV A;  2M49 B;  5F6T A;  3DVK A;  4NDC A;  5KTY A;  4AQI A;  2KOT A;  3AV0 A;  1NX0 A;  2M1U A;  1YUS A;  1TNP A;  4PCW A;  3WNX B;  1SU1 A;  2Z72 A;  1M45 A;  2KBI A;  3H61 A;  3DVJ A;  3ICF A;  3OB1 B;  3SG3 A;  1SCM B;  3LK0 A;  1J7O A;  1ALV A;  1JWD A;  4KKZ A;  2SAS A;  2ZOA A;  1KSM A;  4O4K A;  1QAT A;  2V53 A;  4H2G A;  1SBJ A;  1XFW O;  5B8I A;  3BXK A;  3TUY B;  1QIV A;  1JF2 A;  3V4Y A;  1D1O A;  5HKZ A;  3FGA C;  2M7N A;  1LVC D;  4PHN A;  4HRH A;  2BKH B;  4A4C A;  2USH A;  1KSO A;  3SG6 A;  4YKE A;  1SCM C;  4XJK A;  3IB7 A;  2KFH A;  4O43 A;  2OPO A;  5AEQ A;  3ZTV A;  1QV0 A;  1F70 A;  1CM4 A;  1BMO A;  2IE3 C;  4MZL A;  4DCK A;  3GK4 X;  1YRU B;  2ZND A;  5JPF A;  1REC A;  1GGW A;  2Z06 A;  3NSO A;  2PSR A;  4MRX A;  1DJY A;  2JXL A;  1CFD A;  1MR8 A;  3KEV A;  2WOS A;  1LXF C;  3LCP C;  4GGN A;  4Q7F A;  2G9B A;  1KK7 Z;  1BF5 A;  2ZO9 B;  1SK6 D;  4AQJ A;  2A4J A;  4YGC B;  3VRP A;  1J7P A;  1DJW A;  3JTD B;  3NXA A;  4PE0 A;  2LVK A;  5J3X A;  4KBP A;  4MRY A;  1DJG A;  4OVN F;  4C0L A;  2QAC A;  4JPZ B;  1JF0 A;  3IVD A;  3BQ3 A;  1JSA A;  4UWQ A;  3KHE A;  1QXP A;  5C1V A;  1GJY A;  2BCD A;  4V0W A;  1Y1U A;  5CSJ A;  5HLO A;  2BDX A;  4XPN A;  4HSZ A;  2QPT A;  4AOM A;  2JQ6 A;  1HP1 A;  4Q04 A;  3H69 A;  3H66 A;  1TNQ A;  1H8B A;  2YEQ A;  4FCX A;  3C5W C;  1Y6W A;  2M0R A;  5HLV A;  1K93 D;  1MWN A;  2F3Y A;  3BYA A;  1USH A;  4LTY A;  2L0P A;  2KBM A;  4OV2 A;  1W7I B;  3SIA A;  3I5I C;  1UHN A;  2GV5 A;  4O24 A;  1IT6 A;  4BY4 A;  1UP5 A;  2L4H A;  4I5N B;  3IQO A;  3LL8 B;  4CFQ A;  1YTZ C;  3RLZ A;  3H67 A;  1K2H A;  4H2I A;  3ZU0 A;  1XA5 A;  5I8N A;  5DKN A;  5INB A;  1OMD A;  1CB1 A;  2AHD A;  5J28 A;  1A75 B;  1TN4 A;  2BCB A;  1PAL A;  4QJ5 B;  4ZX2 A;  4DIR A;  1FPW A;  2I7A A;  4I5N C;  1Q80 A;  2MA2 A;  1CFF A;  2WC8 A;  3ZNI A;  1S5G Y;  1YUU A;  4P5O E;  2MRD A;  1N2D A;  3GK1 A;  5G08 A;  2KFG A;  4H1Y P;  4LU9 A;  4MZK A;  2WND A;  1WLZ A;  2BL0 B;  3I5H C;  3O2P A;  1B4C A;  2O8A A;  4WWL A;  2EC6 B;  1SR6 B;  2MLF C;  3LL8 A;  1S6I A;  1SL7 A;  3PSR A;  4MLW A;  2AAO A;  3EVR A;  4DUQ A;  1ZOT B;  3NSI A;  3TZ1 A;  1PRW A;  1YX7 A;  2LE9 B;  1MF8 B;  2IS9 A;  4M2P A;  1HQV A;  1W24 A;  3KPX A;  1SY9 A;  3CLN A;  2BL0 C;  1IJ5 A;  1A75 A;  1EXR A;  3O6B A;  2EC6 C;  2KDH A;  3N5U A;  1QHW A;  1WLM A;  3CWG A;  1SR6 C;  1N0Y A;  3FWC A;  3EK4 A;  4P2Y B;  1DJZ A;  1QX2 A;  1SW8 A;  4E68 A;  1V73 A;  1KFX S;  1S3L A;  2CT9 A;  2LHI A;  5JJG A;  2DFJ A;  4UT2 A;  2FCE A;  2OS8 B;  2P6B B;  4NZV A;  3GOF A;  3TGH A;  1ODB A;  2LMT A;  3GK2 A;  1C07 A;  2LLU A;  5CSF A;  3BUW B;  4PE4 A;  1XFZ O;  1X02 A;  2BE4 A;  4JA9 A;  1G4Y R;  1E8A A;  4PDZ A;  4QJ4 B;  2E30 A;  2NYM C;  1UHJ A;  5HKY A;  5GTU A;  2K0J A;  1FJM A;  1B9A A;  2DXL A;  1MF8 A;  1TRF A;  1S6C A;  2OS8 C;  4QJ3 B;  1UTE A;  2GGM A;  1OSA A;  4TNC A;  1NCZ A;  4L9M A;  4ORA B;  1QJT A;  1CM1 A;  1BR1 B;  1QFC A;  3AKB A;  5GQQ C;  5EQV A;  4FBK A;  2ZN8 A;  2KKN A;  2BBM A;  1HT9 A;  1TCF A;  3DSD A;  2EGD A;  2EHB A;  4GBA A;  2PAS A;  4I5J A;  1EL4 A;  2P6B A;  1IGV A;  1CMF A;  5IBW A;  3PLF B;  3BOW B;  2JT0 A;  2JTZ A;  2Y1N A;  1QS7 A;  1XFV O;  2ZFD A;  3CGA A;  3HX4 A;  5D7F A;  4GUK A;  3AAK A;  4C0J A;  2LMV A;  3PN7 B;  1WRZ A;  5I2O A;  3VRO A;  1EG3 A;  3I5G B;  3PAT A;  1BR4 B;  2K61 A;  1M63 B;  3CR4 X;  1IG5 A;  3KO0 A;  4TUI A;  1J1D A;  4MEW A;  1QVI Y;  1QTX A;  1S26 D;  3OP0 A;  1K9U A;  1OE9 B;  3RL4 A;  2MJW B;  2Y1M A;  4WQ2 A;  1R6P A;  1XK4 A;  2BCA A;  4ORA A;  2LAN A;  2DXN A;  5K89 A;  1NX1 A;  2WDE A;  2KSP A;  2NZ0 A;  3DD4 A;  4UPG A;  4G9J A;  2MHH A;  4V0X A;  2M9G A;  2JWW A;  1MXE A;  1NWD A;  4ZCV A;  2BBN A;  2BKI B;  2LAP A;  1RK9 A;  1TCO B;  4MN0 A;  3BOW A;  5F3W A;  1XO5 A;  3TUY C;  2L5X B;  1B47 A;  2Y4Q A;  1OOJ A;  1DVI A;  1RTP 1;  3TDI A;  1KFU S;  3WHT B;  1NYA A;  1F4O A;  1QX7 A;  1NCX A;  5AAN A;  1M63 A;  4ICB A;  3HCM A;  3H64 A;  4UT3 B;  3T1I A;  3QFK A;  2LP3 A;  4FTG A;  1CNP A;  4DRW A;  4I5L B;  1QIW A;  3O78 A;  1JFK A;  1S3M A;  4A4B A;  2I94 A;  3CZT X;  4GPL B;  1NX3 A;  2LV7 A;  3TS5 B;  3RM1 A;  2I2R E;  2IAE C;  2M7L A;  1CDM A;  2WCE A;  2KAY A;  2B1U A;  2O5G A;  3QFN A;  1FI5 A;  1TCO A;  3H60 A;  4XYN A;  2JU0 A;  3VRR A;  2KAV A;  3DVM A;  4I5L C;  3JTD C;  2LVJ A;  1DF0 B;  1WDC B;  3O4Y A;  3GVE A;  1YR5 A;  3JVT B;  3PFV A;  1BLQ A;  2F2O A;  2F2P A;  3TS5 C;  5HPE A;  4FBW A;  4UT3 A;  2JTT A;  4MVF A;  3NSL A;  1NCY A;  1WRL A;  2NXF A;  1PSB A;  4ZCU A;  1AUI B;  3RL5 A;  2RGI A;  1TIZ A;  1ALW A;  1S70 A;  1QVI Z;  3ZWH A;  3A8R A;  3C1V A;  1F4Q A;  2NCP A;  1Y1A A;  1F71 A;  1GGZ A;  1MHO A;  2LC5 A;  1CFC A;  3JVT C;  3THN A;  3EGH A;  1SYM A;  2HQW A;  1S8E A;  4YGE B;  1AHR A;  4YI8 A;  1QX5 B;  1HPU A;  4ETO A;  2KQY A;  2SCP A;  1KK8 B;  1JBA A;  2M29 A;  1AK8 A;  5JJT A;  4M2O A;  4HRG A;  4PE7 A;  2K7B A;  1DF0 A;  2BEC A;  1MUX A;  1QLS A;  2JPT A;  2MLE C;  2Q4U A;  3SG4 A;  3CK2 A;  2H61 C;  2YVT A;  3FWB A;  3DW8 C;  2M1K B;  4PAL A;  3FS7 A;  2HYO A;  4ORC B;  2WDF A;  1NP8 A;  4USL A;  2NXQ A;  1AUI A;  2JC2 A;  4CPV A;  1KK8 C;  3NSK A;  2KHN A;  4YBH B;  2HY1 A;  2HET A;  1ZFS A;  2JOG A;  5AXI A;  2H61 A;  1WY9 A;  1IJ6 A;  1CMG A;  2PVB A;  1SNL A;  1HO5 A;  2NCO A;  1S1E A;  5DNY A;  1KWO B;  1BU3 A;  1SL8 A;  2LLT A;  1S36 A;  5KU1 A;  1L2O B;  2F3Z A;  3H63 A;  4CLN A;  2HF5 A;  2LLS A;  1Y0V H;  4M2Q A;  4F0Z B;  1CKK A;  1UHI A;  1J7R A;  1CLL A;  1SMG A;  1XFX O;  5DKR A;  3H68 A;  4H2B A;  1ZUZ A;  1OMV A;  1OMR A;  2R2I A;  2K8M B;  2LP2 A;  3A4U B;  1UF3 A;  2KYF A;  1PK0 D;  2CV9 A;  4ORC A;  1TNX A;  5AER A;  2Q8U A;  1KWO C;  1CDP A;  4CID A;  2JXC A;  2CXJ A;  2KI6 D;  2OTG B;  3JYF A;  1IRJ A;  4NDB A;  1M39 A;  3KF9 A;  1B7T Y;  5JPE A;  1LA3 A;  3SJS A;  1PUL A;  1DJX A;  4MZJ A;  1XZW A;  2O8G A;  2LVV A;  1XYD A;  1UUS A;  1K9K A;  2ZKM X;  4IL1 A;  3EGG A;  5CSN A;  2LUX A;  1AP4 A;  1JFJ A;  2LUC A;  3EVV A;  4F0Z A;  2OTG C;  3VRQ A;  1QLK A;  3OX6 A;  3AAJ A;  3E0J A;  1S95 A;  1TNW A;  2JNX A;  1DT7 B;  3KBP A;  1FW4 A;  1R2U A;  4GGF A;  4LAC C;  1WAR A;  4WRI A;  2ZNE A;  3CS1 A;  5CSI A;  4GFT A;  1V1F A;  2L4I A;  1Z2W A;  2ISD A;  1S5G Z;  2CBL A;  1C7W A;  1J55 A;  2K7O A;  1OID A;  2R17 A;  1XK4 C;  2LNK A;  2CNP A;  4MBE A;  2XMO A;  3LK1 A;  3CR5 X;  2KGB C;  3FLO A;  1F54 A;  3AKA A;  1KBP A;  1WAO 1;  4J6O A;  3EK8 A;  1W7J B;  2F33 A;  5ER5 A;  1IQ5 A;  1V1G A;  3TDU A;  2Z1A A;  3IVE A;  3F45 A;  1B8L A;  2Q91 A;  2KNE A;  3SG2 A;  1PSR A;  4N1G A;  1G5B A;  3PN7 C;  3RQZ A;  1TTX A;  5TNC A;  1BT6 A;  1JK7 A;  1K9P A;  1LKJ A;  3I5G C;  2WCB A;  3QFM A;  1FI6 A;  3E3R A;  1OQP A;  4GAO A;  3PSO A;  1JC2 A;  1BOC A;  1DTL A;  4YGB B;  3RL3 A;  1AJ5 A;  1FBV A;  2LCP A;  2ZBM A;  1RRO A;  2E6W A;  1EG4 A;  2GGZ A;  2FJU B;  2A22 A;  1Z2X A;  1CLM A;  1T70 A;  1DGU A;  4FQO A;  4M0V A;  4JWQ A;  1B7T Z;  5PAL A;  1KQM B;  4ORB A;  1AVS A;  1YX8 A;  2IE4 C;  1WRK A;  1OZS A;  5D69 A;  2Y5I A;  1CLB A;  2KFF A;  2BQ8 X;  1EJ3 A;  1QAS A;  2O60 A;  1UHH A;  4NQG A;  4WQ3 A;  3MSE B;  2F8P A;  4R1E A;  2JOJ A;  2L50 A;  5BPJ A;  4NDD A;  1II7 A;  4MP0 A;  2JNF A;  1UUR A;  1KQM C;  4GNK B;  3SG5 A;  2TN4 A;  2MBX A;  1N65 A;  1YUT A;  1U32 A;  3D03 A;  1A4P A;  1OIE A;  4YGA A;  3FIA A;  3QG5 C;  3CTN A;  1DJI A;  4DT2 A;  3QFO A;  2COL B;  2I18 A;  3ICB A;  2HPS A;  2PRU A;  2CTN A;  1IWQ A;  5FYX A;  1OI8 A;  3SG7 A;  4MOV A;  3K7W C;  2K2A A;  2PMY A;  1NNW A;  1T71 A;  1RJV A;  1K90 D;  2D8N A;  1A29 A;  2DOQ A;  3CR2 A;  3H4S E;  2BCX A;  2JT8 A;  2M8U A;  4PHK A;  2KGR A;  1WDC C;  5AFP A;  1G33 A;  1K94 A;  1MQ1 A;  1QV1 A;  1ZAC A;  3OB2 B;  1G8I A;  1IQ3 A;  4N5X A;  3EKH A;  3I5I B;  3DF0 B;  4PHJ A;  2LHL A;  2AMI A;  3IF7 A;  2JRF A;  4D1E A;  5I2Q A;  3IB8 A;  3P71 C;  4YRU A;  1S3P A;  4DS7 A;  2ZRS A;  3PM8 A;  3WXA A;  2G2B A;  1F55 A;  2NPP C;  3DVE A;  1IH0 A;  3SIB A;  2H2K A;  1K8U A;  1SKT A;  1NX2 A;  1NIW A;  2L98 A;  1YVL A;  4YI9 A;  1SRA A;  2MAZ A;  3K21 A;  3TDZ A;  1U5I B;  2HQ8 A;  5ER4 X;  2JZI A;  1Y1X A;  1AJ4 A;  2WOR A;  1NUB A;  1XM7 A;  1RFJ A;  2WCF A;  2VRG A;  1JUO A;  1KFX L;  1H4B A;  4H1S A;  4OR9 B;  4HRE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...