1JK7A

Crystal structure of the tumor-promoter okadaic acid bound to protein phosphatase-1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
294
structure length
294
Chain Sequence
KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/toxin
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUB
publication title Crystal structure of the tumor-promoter okadaic acid bound to protein phosphatase-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 294
sequence length 294
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1jk7A00
4I5NC 1QHWA 4MP0A 4NZVA 3QFMA 1T71A 2DFJA 1UTEA 4FCXA 4IL1A 3DW8C 1HPUA 3P71C 4YKEA 1QFCA 3GVEA 4H2FA 1JK7A 2WDEA 4IYPC 2NXFA 5EQVA 3RL5A 3N5UA 2Z06A 2CV9A 3THNA 1S95A 1XZWA 1U32A 2A22A 2YVTA 4FBKA 3ICFA 3C9FA 3H62B 2Q8UA 2USHA 4O4KA 1Z2XA 2Z72A 2P6BA 4FBQA 3RL4A 3AUZA 1S3MA 4B2OA 4H2IA 3QFKA 4O43A 1S70A 3KBPA 1MF8A 2O8GA 4H1SA 4ZVZA 3H68A 1T70A 3THOB 1NNWA 3DSCA 4HD0A 1V73A 3DSDA 4ORCA 3FGAC 4V0VA 1OI8A 2JOGA 3AV0A 5F3WA 1XM7A 4H2BA 3T1IA 1IT6A 3EGHA 1G5BA 4M0VA 3K7WC 2R17A 4V0WA 4UT2A 4F0ZA 3ZTVA 3RQZA 3E7BA 2ZBMA 2GJUA 2QFRA 4JA7A 2WDDA 3TGHA 4O5GA 5GTUA 4H2GA 4O24A 1M63A 4MOVA 5JPEA 2XMOA 4J6OA 4DSYA 2BCDA 4G9JA 3QFNA 5C1VA 1SU1A 1II7A 1S3NA 2O8AA 2KKNA 3H64A 3IVDA 2HY1A 2Z1AA 3QFOA 4UT3B 1TCOA 2IE4C 2QFPA 3H66A 3IB8A 5IOHA 3IB7A 3QG5C 4LTYA 3PSOA 1HO5A 4KBPA 4V0XA 2NYMC 3LL8A 1OIEA 5J28A 4TUGA 5DNYA 1Z2WA 2BDXA 5JPFA 1WARA 2QJCA 3E7AA 3K7VC 4LU9A 3HVQA 4LACC 4Q7FA 2IE3C 4ORBA 4KKZA 1S8EA 4OR9A 3H69A 5B8IA 4DT2A 3PSNA 5JJTA 1W24A 1S3LA 1HP1A 2AHDA 3CK2A 1USHA 2IAEC 4FBWA 4MOYA 4WWLA 3IVEA 3JYFA 3V4YA 1UF3A 3EGGA 4XPNA 3H61A 2WDFA 3C5WC 4UWQA 2NPPC 3ZU0A 1WAO1 4JA9A 4TUIA 2HYPA 3H67A 1KBPA 4ORAA 3H60A 4I5LC 5HPEA 1FJMA 2BQ8X 3RL3A 1AUIA 2HYOA 4DHLA 1OIDA 5INBA 3H63A 4ZX2A 4UT3A 2WDCA 4H1YP 2NYLC
chains in the Genus database with same CATH superfamily
4I5NC 1QHWA 4MP0A 4NZVA 3QFMA 1T71A 2DFJA 1UTEA 4FCXA 4IL1A 3DW8C 1HPUA 3P71C 4YKEA 1QFCA 3GVEA 4H2FA 1JK7A 2WDEA 4IYPC 2NXFA 5EQVA 3RL5A 3N5UA 2Z06A 2CV9A 3THNA 1S95A 1XZWA 1U32A 2A22A 2YVTA 4FBKA 3ICFA 3C9FA 3H62B 2Q8UA 2USHA 4O4KA 1Z2XA 2Z72A 2P6BA 4FBQA 3RL4A 3AUZA 1S3MA 4B2OA 3E0JA 2DXNA 4H2IA 3QFKA 4O43A 1S70A 3KBPA 1MF8A 2O8GA 3D03A 4H1SA 4ZVZA 3H68A 1T70A 3THOB 2DXLA 1NNWA 3DSCA 4HD0A 1V73A 3DSDA 4ORCA 3FGAC 4V0VA 1OI8A 2JOGA 3AV0A 5F3WA 1XM7A 4H2BA 3T1IA 1IT6A 3EGHA 1G5BA 4M0VA 3K7WC 2R17A 2ZOAA 4V0WA 4UT2A 4F0ZA 3ZTVA 3RQZA 3E7BA 2ZBMA 2GJUA 2QFRA 4JA7A 2WDDA 3TGHA 4O5GA 5GTUA 4H2GA 2YEQA 4O24A 1M63A 4MOVA 5JPEA 2XMOA 4J6OA 4DSYA 2BCDA 4G9JA 3QFNA 5C1VA 1SU1A 1II7A 1S3NA 2O8AA 2KKNA 3H64A 3IVDA 2HY1A 2Z1AA 3QFOA 4UT3B 1TCOA 2IE4C 2QFPA 3H66A 3IB8A 5IOHA 3IB7A 3QG5C 4LTYA 3PSOA 1HO5A 4KBPA 4V0XA 2NYMC 3LL8A 1OIEA 5J28A 4TUGA 5DNYA 1Z2WA 2BDXA 5JPFA 1WARA 2QJCA 3E7AA 3K7VC 4LU9A 3HVQA 4LACC 4Q7FA 2IE3C 4ORBA 4KKZA 1S8EA 4OR9A 3H69A 5B8IA 4DT2A 3PSNA 5JJTA 3FLOA 1W24A 1S3LA 1HP1A 2ZO9B 2AHDA 3CK2A 1USHA 2IAEC 4FBWA 4MOYA 4WWLA 3IVEA 3JYFA 3V4YA 1UF3A 3EGGA 4XPNA 3H61A 2WDFA 3C5WC 4UWQA 2NPPC 3ZU0A 1WAO1 4JA9A 4TUIA 2HYPA 3H67A 1KBPA 4ORAA 3H60A 4I5LC 5HPEA 1FJMA 2BQ8X 3RL3A 1AUIA 2HYOA 4DHLA 1OIDA 5INBA 3H63A 4ZX2A 4UT3A 2WDCA 4H1YP 2NYLC
chains in the Genus database with same CATH topology
4I5NC 1QHWA 4MP0A 4NZVA 3QFMA 1T71A 2DFJA 1UTEA 4FCXA 4IL1A 3DW8C 1HPUA 3P71C 4YKEA 1QFCA 3GVEA 4H2FA 1JK7A 2WDEA 4IYPC 2NXFA 5EQVA 3RL5A 3N5UA 2Z06A 2CV9A 3THNA 1S95A 1XZWA 1U32A 2A22A 2YVTA 4FBKA 3ICFA 3C9FA 3H62B 2Q8UA 2USHA 4O4KA 1Z2XA 2Z72A 2P6BA 4FBQA 3RL4A 3AUZA 1S3MA 4B2OA 3E0JA 2DXNA 4H2IA 3QFKA 4O43A 1S70A 3KBPA 1MF8A 2O8GA 3D03A 4H1SA 4ZVZA 3H68A 1T70A 3THOB 2DXLA 1NNWA 3DSCA 4HD0A 1V73A 3DSDA 4ORCA 3FGAC 4V0VA 1OI8A 2JOGA 3AV0A 5F3WA 1XM7A 4H2BA 3T1IA 1IT6A 3EGHA 1G5BA 4M0VA 3K7WC 2R17A 2ZOAA 4V0WA 4UT2A 4F0ZA 3ZTVA 3RQZA 3E7BA 2ZBMA 2GJUA 2QFRA 4JA7A 2WDDA 3TGHA 4O5GA 5GTUA 4H2GA 2YEQA 4O24A 1M63A 4MOVA 5JPEA 2XMOA 4J6OA 4DSYA 2BCDA 4G9JA 3QFNA 5C1VA 1SU1A 1II7A 1S3NA 2O8AA 2KKNA 3H64A 3IVDA 2HY1A 2Z1AA 3QFOA 4UT3B 1TCOA 2IE4C 2QFPA 3H66A 3IB8A 5IOHA 3IB7A 3QG5C 4LTYA 3PSOA 1HO5A 4KBPA 4V0XA 2NYMC 3LL8A 1OIEA 5J28A 4TUGA 5DNYA 1Z2WA 2BDXA 5JPFA 1WARA 2QJCA 3E7AA 3K7VC 4LU9A 3HVQA 4LACC 4Q7FA 2IE3C 4ORBA 4KKZA 1S8EA 4OR9A 3H69A 5B8IA 4DT2A 3PSNA 5JJTA 3FLOA 1W24A 1S3LA 1HP1A 2ZO9B 2AHDA 3CK2A 1USHA 2IAEC 4FBWA 4MOYA 4WWLA 3IVEA 3JYFA 3V4YA 1UF3A 3EGGA 4XPNA 3H61A 2WDFA 3C5WC 4UWQA 2NPPC 3ZU0A 1WAO1 4JA9A 4TUIA 2HYPA 3H67A 1KBPA 4ORAA 3H60A 4I5LC 5HPEA 1FJMA 2BQ8X 3RL3A 1AUIA 2HYOA 4DHLA 1OIDA 5INBA 3H63A 4ZX2A 4UT3A 2WDCA 4H1YP 2NYLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5N C;  1QHW A;  4MP0 A;  4NZV A;  3QFM A;  1T71 A;  2DFJ A;  1UTE A;  4FCX A;  4IL1 A;  3DW8 C;  1HPU A;  3P71 C;  4YKE A;  1QFC A;  3GVE A;  4H2F A;  1JK7 A;  2WDE A;  4IYP C;  2NXF A;  5EQV A;  3RL5 A;  3N5U A;  2Z06 A;  2CV9 A;  3THN A;  1S95 A;  1XZW A;  1U32 A;  2A22 A;  2YVT A;  4FBK A;  3ICF A;  3C9F A;  3H62 B;  2Q8U A;  2USH A;  4O4K A;  1Z2X A;  2Z72 A;  2P6B A;  4FBQ A;  3RL4 A;  3AUZ A;  1S3M A;  4B2O A;  4H2I A;  3QFK A;  4O43 A;  1S70 A;  3KBP A;  1MF8 A;  2O8G A;  4H1S A;  4ZVZ A;  3H68 A;  1T70 A;  3THO B;  1NNW A;  3DSC A;  4HD0 A;  1V73 A;  3DSD A;  4ORC A;  3FGA C;  4V0V A;  1OI8 A;  2JOG A;  3AV0 A;  5F3W A;  1XM7 A;  4H2B A;  3T1I A;  1IT6 A;  3EGH A;  1G5B A;  4M0V A;  3K7W C;  2R17 A;  4V0W A;  4UT2 A;  4F0Z A;  3ZTV A;  3RQZ A;  3E7B A;  2ZBM A;  2GJU A;  2QFR A;  4JA7 A;  2WDD A;  3TGH A;  4O5G A;  5GTU A;  4H2G A;  4O24 A;  1M63 A;  4MOV A;  5JPE A;  2XMO A;  4J6O A;  4DSY A;  2BCD A;  4G9J A;  3QFN A;  5C1V A;  1SU1 A;  1II7 A;  1S3N A;  2O8A A;  2KKN A;  3H64 A;  3IVD A;  2HY1 A;  2Z1A A;  3QFO A;  4UT3 B;  1TCO A;  2IE4 C;  2QFP A;  3H66 A;  3IB8 A;  5IOH A;  3IB7 A;  3QG5 C;  4LTY A;  3PSO A;  1HO5 A;  4KBP A;  4V0X A;  2NYM C;  3LL8 A;  1OIE A;  5J28 A;  4TUG A;  5DNY A;  1Z2W A;  2BDX A;  5JPF A;  1WAR A;  2QJC A;  3E7A A;  3K7V C;  4LU9 A;  3HVQ A;  4LAC C;  4Q7F A;  2IE3 C;  4ORB A;  4KKZ A;  1S8E A;  4OR9 A;  3H69 A;  5B8I A;  4DT2 A;  3PSN A;  5JJT A;  1W24 A;  1S3L A;  1HP1 A;  2AHD A;  3CK2 A;  1USH A;  2IAE C;  4FBW A;  4MOY A;  4WWL A;  3IVE A;  3JYF A;  3V4Y A;  1UF3 A;  3EGG A;  4XPN A;  3H61 A;  2WDF A;  3C5W C;  4UWQ A;  2NPP C;  3ZU0 A;  1WAO 1;  4JA9 A;  4TUI A;  2HYP A;  3H67 A;  1KBP A;  4ORA A;  3H60 A;  4I5L C;  5HPE A;  1FJM A;  2BQ8 X;  3RL3 A;  1AUI A;  2HYO A;  4DHL A;  1OID A;  5INB A;  3H63 A;  4ZX2 A;  4UT3 A;  2WDC A;  4H1Y P;  2NYL C; 
#chains in the Genus database with same CATH topology
 4I5N C;  1QHW A;  4MP0 A;  4NZV A;  3QFM A;  1T71 A;  2DFJ A;  1UTE A;  4FCX A;  4IL1 A;  3DW8 C;  1HPU A;  3P71 C;  4YKE A;  1QFC A;  3GVE A;  4H2F A;  1JK7 A;  2WDE A;  4IYP C;  2NXF A;  5EQV A;  3RL5 A;  3N5U A;  2Z06 A;  2CV9 A;  3THN A;  1S95 A;  1XZW A;  1U32 A;  2A22 A;  2YVT A;  4FBK A;  3ICF A;  3C9F A;  3H62 B;  2Q8U A;  2USH A;  4O4K A;  1Z2X A;  2Z72 A;  2P6B A;  4FBQ A;  3RL4 A;  3AUZ A;  1S3M A;  4B2O A;  3E0J A;  2DXN A;  4H2I A;  3QFK A;  4O43 A;  1S70 A;  3KBP A;  1MF8 A;  2O8G A;  3D03 A;  4H1S A;  4ZVZ A;  3H68 A;  1T70 A;  3THO B;  2DXL A;  1NNW A;  3DSC A;  4HD0 A;  1V73 A;  3DSD A;  4ORC A;  3FGA C;  4V0V A;  1OI8 A;  2JOG A;  3AV0 A;  5F3W A;  1XM7 A;  4H2B A;  3T1I A;  1IT6 A;  3EGH A;  1G5B A;  4M0V A;  3K7W C;  2R17 A;  2ZOA A;  4V0W A;  4UT2 A;  4F0Z A;  3ZTV A;  3RQZ A;  3E7B A;  2ZBM A;  2GJU A;  2QFR A;  4JA7 A;  2WDD A;  3TGH A;  4O5G A;  5GTU A;  4H2G A;  2YEQ A;  4O24 A;  1M63 A;  4MOV A;  5JPE A;  2XMO A;  4J6O A;  4DSY A;  2BCD A;  4G9J A;  3QFN A;  5C1V A;  1SU1 A;  1II7 A;  1S3N A;  2O8A A;  2KKN A;  3H64 A;  3IVD A;  2HY1 A;  2Z1A A;  3QFO A;  4UT3 B;  1TCO A;  2IE4 C;  2QFP A;  3H66 A;  3IB8 A;  5IOH A;  3IB7 A;  3QG5 C;  4LTY A;  3PSO A;  1HO5 A;  4KBP A;  4V0X A;  2NYM C;  3LL8 A;  1OIE A;  5J28 A;  4TUG A;  5DNY A;  1Z2W A;  2BDX A;  5JPF A;  1WAR A;  2QJC A;  3E7A A;  3K7V C;  4LU9 A;  3HVQ A;  4LAC C;  4Q7F A;  2IE3 C;  4ORB A;  4KKZ A;  1S8E A;  4OR9 A;  3H69 A;  5B8I A;  4DT2 A;  3PSN A;  5JJT A;  3FLO A;  1W24 A;  1S3L A;  1HP1 A;  2ZO9 B;  2AHD A;  3CK2 A;  1USH A;  2IAE C;  4FBW A;  4MOY A;  4WWL A;  3IVE A;  3JYF A;  3V4Y A;  1UF3 A;  3EGG A;  4XPN A;  3H61 A;  2WDF A;  3C5W C;  4UWQ A;  2NPP C;  3ZU0 A;  1WAO 1;  4JA9 A;  4TUI A;  2HYP A;  3H67 A;  1KBP A;  4ORA A;  3H60 A;  4I5L C;  5HPE A;  1FJM A;  2BQ8 X;  3RL3 A;  1AUI A;  2HYO A;  4DHL A;  1OID A;  5INB A;  3H63 A;  4ZX2 A;  4UT3 A;  2WDC A;  4H1Y P;  2NYL C; 
#chains in the Genus database with same CATH homology
 4I5N C;  1QHW A;  4MP0 A;  4NZV A;  3QFM A;  1T71 A;  2DFJ A;  1UTE A;  4FCX A;  4IL1 A;  3DW8 C;  1HPU A;  3P71 C;  4YKE A;  1QFC A;  3GVE A;  4H2F A;  1JK7 A;  2WDE A;  4IYP C;  2NXF A;  5EQV A;  3RL5 A;  3N5U A;  2Z06 A;  2CV9 A;  3THN A;  1S95 A;  1XZW A;  1U32 A;  2A22 A;  2YVT A;  4FBK A;  3ICF A;  3C9F A;  3H62 B;  2Q8U A;  2USH A;  4O4K A;  1Z2X A;  2Z72 A;  2P6B A;  4FBQ A;  3RL4 A;  3AUZ A;  1S3M A;  4B2O A;  3E0J A;  2DXN A;  4H2I A;  3QFK A;  4O43 A;  1S70 A;  3KBP A;  1MF8 A;  2O8G A;  3D03 A;  4H1S A;  4ZVZ A;  3H68 A;  1T70 A;  3THO B;  2DXL A;  1NNW A;  3DSC A;  4HD0 A;  1V73 A;  3DSD A;  4ORC A;  3FGA C;  4V0V A;  1OI8 A;  2JOG A;  3AV0 A;  5F3W A;  1XM7 A;  4H2B A;  3T1I A;  1IT6 A;  3EGH A;  1G5B A;  4M0V A;  3K7W C;  2R17 A;  2ZOA A;  4V0W A;  4UT2 A;  4F0Z A;  3ZTV A;  3RQZ A;  3E7B A;  2ZBM A;  2GJU A;  2QFR A;  4JA7 A;  2WDD A;  3TGH A;  4O5G A;  5GTU A;  4H2G A;  2YEQ A;  4O24 A;  1M63 A;  4MOV A;  5JPE A;  2XMO A;  4J6O A;  4DSY A;  2BCD A;  4G9J A;  3QFN A;  5C1V A;  1SU1 A;  1II7 A;  1S3N A;  2O8A A;  2KKN A;  3H64 A;  3IVD A;  2HY1 A;  2Z1A A;  3QFO A;  4UT3 B;  1TCO A;  2IE4 C;  2QFP A;  3H66 A;  3IB8 A;  5IOH A;  3IB7 A;  3QG5 C;  4LTY A;  3PSO A;  1HO5 A;  4KBP A;  4V0X A;  2NYM C;  3LL8 A;  1OIE A;  5J28 A;  4TUG A;  5DNY A;  1Z2W A;  2BDX A;  5JPF A;  1WAR A;  2QJC A;  3E7A A;  3K7V C;  4LU9 A;  3HVQ A;  4LAC C;  4Q7F A;  2IE3 C;  4ORB A;  4KKZ A;  1S8E A;  4OR9 A;  3H69 A;  5B8I A;  4DT2 A;  3PSN A;  5JJT A;  3FLO A;  1W24 A;  1S3L A;  1HP1 A;  2ZO9 B;  2AHD A;  3CK2 A;  1USH A;  2IAE C;  4FBW A;  4MOY A;  4WWL A;  3IVE A;  3JYF A;  3V4Y A;  1UF3 A;  3EGG A;  4XPN A;  3H61 A;  2WDF A;  3C5W C;  4UWQ A;  2NPP C;  3ZU0 A;  1WAO 1;  4JA9 A;  4TUI A;  2HYP A;  3H67 A;  1KBP A;  4ORA A;  3H60 A;  4I5L C;  5HPE A;  1FJM A;  2BQ8 X;  3RL3 A;  1AUI A;  2HYO A;  4DHL A;  1OID A;  5INB A;  3H63 A;  4ZX2 A;  4UT3 A;  2WDC A;  4H1Y P;  2NYL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...