3JYFA

The crystal structure of a 2,3-cyclic nucleotide 2-phosphodiesterase/3-nucleotidase bifunctional periplasmic precursor protein from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
AATVDLRIMETTDLHSNMMDFDYYKDAATEKFGLVRTASLIEQARAEVKNSVLVDNGDVIQGSPLGDYMAAKGLKEGDVHPVYKAMNTLNYAVGNLGNHEFNYGLDFLHKALAGAKFPYVNANIIDAKTGKPMFTPYLIQDTRVVDSDGQIHTLRIGYIGFVPPQIMTWDKANLNGKVTVNDITETARKYIPEMRAKGADVVVVVAHSGLSADPYQAMAENSVYYLSQVPGVDAIMFGHAHAVFPGKDFANIKGADIAKGTLNGVPAVMPGMWGDHLGVVDLVLNNDSGKWQVTQSKAEARPIYDAVAKKSLAAEDGKLVSVLKADHDATREFVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a 2,3-cyclic nucleotide 2-phosphodiesterase/3-nucleotidase bifunctional periplasmic precursor protein from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase
molecule keywords 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase
total genus 91
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3jyfA00
5C1VA 5INBA 3H69A 4H2IA 1QFCA 4OR9A 3V4YA 4ZX2A 1USHA 5F3WA 3IB8A 1Z2WA 1S3LA 3QFMA 4LU9A 4TUIA 1Z2XA 4UT2A 4V0WA 1OIDA 2IE4C 3H67A 4JA9A 1G5BA 1WAO1 3IVDA 5HPEA 1IT6A 3ICFA 4O24A 2AHDA 1MF8A 2WDFA 1S3NA 1UTEA 3DW8C 4M0VA 3DSDA 1S3MA 4H2FA 1SU1A 4ORBA 5JJTA 4XPNA 2WDDA 1XM7A 2GJUA 1U32A 2NPPC 3N5UA 1W24A 4V0VA 3H61A 3T1IA 3C5WC 2P6BA 3QFNA 5DNYA 2WDCA 1FJMA 2QFRA 2IE3C 4J6OA 3H68A 2DFJA 3H60A 3EGGA 1II7A 4UWQA 3PSNA 2Z06A 1HPUA 3QG5C 4F0ZA 3H64A 5EQVA 4MOVA 3EGHA 3E7AA 1XZWA 3IB7A 4O4KA 5J28A 2BCDA 2Z1AA 3DSCA 3K7VC 5GTUA 4H1YP 1TCOA 3H66A 3CK2A 4KBPA 2XMOA 1AUIA 4ORAA 2JOGA 1UF3A 2NXFA 4I5NC 4HD0A 1JK7A 1S95A 3C9FA 3QFOA 5JPEA 4NZVA 2WDEA 4ZVZA 1WARA 2IAEC 3PSOA 3RL4A 4DT2A 2NYMC 4IYPC 4FCXA 4H1SA 5IOHA 3KBPA 1QHWA 2QFPA 2Z72A 3K7WC 2A22A 1T71A 4FBQA 4O5GA 2Q8UA 2R17A 3E7BA 4I5LC 4MOYA 3P71C 4ORCA 1KBPA 1M63A 4YKEA 4UT3A 4Q7FA 3THOB 3QFKA 1NNWA 3FGAC 3JYFA 4LTYA 4KKZA 3RL3A 4WWLA 1S70A 3LL8A 4O43A 3ZU0A 2ZBMA 4DHLA 1HP1A 2HYOA 2NYLC 1T70A 4IL1A 3IVEA 3ZTVA 3H63A 4V0XA 4B2OA 1HO5A 4G9JA 3RL5A 2O8GA 2KKNA 3H62B 2HY1A 1V73A 4MP0A 2CV9A 2BQ8X 4LACC 4DSYA 1OI8A 2HYPA 2BDXA 1OIEA 5B8IA 4FBKA 2O8AA 3TGHA 3RQZA 3GVEA 3THNA 3AUZA 4H2BA 2USHA 4UT3B 4FBWA 2YVTA 3AV0A 4H2GA 5JPFA 2QJCA 1S8EA 4TUGA 4JA7A 3HVQA
chains in the Genus database with same CATH superfamily
5C1VA 5INBA 3H69A 4H2IA 1QFCA 4OR9A 3V4YA 4ZX2A 1USHA 5F3WA 3IB8A 1Z2WA 1S3LA 3QFMA 4LU9A 4TUIA 1Z2XA 4UT2A 4V0WA 1OIDA 2IE4C 3H67A 4JA9A 1G5BA 1WAO1 3IVDA 5HPEA 1IT6A 3ICFA 4O24A 2AHDA 1MF8A 2WDFA 1S3NA 1UTEA 3DW8C 4M0VA 3DSDA 1S3MA 4H2FA 1SU1A 4ORBA 5JJTA 4XPNA 2WDDA 1XM7A 2GJUA 1U32A 2NPPC 3N5UA 2ZOAA 2DXLA 1W24A 4V0VA 3H61A 3T1IA 3C5WC 2P6BA 3QFNA 5DNYA 2WDCA 1FJMA 2QFRA 2IE3C 4J6OA 3H68A 2DFJA 3H60A 3EGGA 1II7A 4UWQA 3PSNA 2Z06A 1HPUA 3QG5C 4F0ZA 3H64A 5EQVA 4MOVA 3EGHA 3E7AA 1XZWA 3IB7A 4O4KA 5J28A 2BCDA 2Z1AA 3DSCA 3K7VC 5GTUA 4H1YP 1TCOA 3H66A 3CK2A 4KBPA 2XMOA 1AUIA 4ORAA 2JOGA 1UF3A 2NXFA 4I5NC 3D03A 4HD0A 1JK7A 1S95A 3C9FA 3QFOA 5JPEA 4NZVA 2WDEA 4ZVZA 1WARA 2IAEC 3PSOA 3RL4A 4DT2A 2NYMC 4IYPC 4FCXA 4H1SA 5IOHA 3KBPA 1QHWA 2QFPA 2Z72A 3K7WC 2A22A 1T71A 4FBQA 4O5GA 2Q8UA 2R17A 3E7BA 4I5LC 4MOYA 3P71C 4ORCA 1KBPA 1M63A 4YKEA 4UT3A 4Q7FA 3THOB 3QFKA 1NNWA 3FGAC 2YEQA 3JYFA 4LTYA 4KKZA 3RL3A 4WWLA 1S70A 3LL8A 4O43A 3ZU0A 2ZBMA 4DHLA 1HP1A 2HYOA 2NYLC 1T70A 4IL1A 3IVEA 3ZTVA 3H63A 4V0XA 4B2OA 1HO5A 4G9JA 3RL5A 2O8GA 3E0JA 2KKNA 3H62B 2ZO9B 2HY1A 1V73A 4MP0A 2CV9A 2BQ8X 4LACC 4DSYA 1OI8A 2HYPA 2BDXA 1OIEA 5B8IA 4FBKA 2O8AA 3TGHA 3RQZA 3GVEA 3THNA 2DXNA 3AUZA 4H2BA 2USHA 4UT3B 4FBWA 2YVTA 3AV0A 4H2GA 5JPFA 2QJCA 3FLOA 1S8EA 4TUGA 4JA7A 3HVQA
chains in the Genus database with same CATH topology
5C1VA 5INBA 3H69A 4H2IA 1QFCA 4OR9A 3V4YA 4ZX2A 1USHA 5F3WA 3IB8A 1Z2WA 1S3LA 3QFMA 4LU9A 4TUIA 1Z2XA 4UT2A 4V0WA 1OIDA 2IE4C 3H67A 4JA9A 1G5BA 1WAO1 3IVDA 5HPEA 1IT6A 3ICFA 4O24A 2AHDA 1MF8A 2WDFA 1S3NA 1UTEA 3DW8C 4M0VA 3DSDA 1S3MA 4H2FA 1SU1A 4ORBA 5JJTA 4XPNA 2WDDA 1XM7A 2GJUA 1U32A 2NPPC 3N5UA 2ZOAA 2DXLA 1W24A 4V0VA 3H61A 3T1IA 3C5WC 2P6BA 3QFNA 5DNYA 2WDCA 1FJMA 2QFRA 2IE3C 4J6OA 3H68A 2DFJA 3H60A 3EGGA 1II7A 4UWQA 3PSNA 2Z06A 1HPUA 3QG5C 4F0ZA 3H64A 5EQVA 4MOVA 3EGHA 3E7AA 1XZWA 3IB7A 4O4KA 5J28A 2BCDA 2Z1AA 3DSCA 3K7VC 5GTUA 4H1YP 1TCOA 3H66A 3CK2A 4KBPA 2XMOA 1AUIA 4ORAA 2JOGA 1UF3A 2NXFA 4I5NC 3D03A 4HD0A 1JK7A 1S95A 3C9FA 3QFOA 5JPEA 4NZVA 2WDEA 4ZVZA 1WARA 2IAEC 3PSOA 3RL4A 4DT2A 2NYMC 4IYPC 4FCXA 4H1SA 5IOHA 3KBPA 1QHWA 2QFPA 2Z72A 3K7WC 2A22A 1T71A 4FBQA 4O5GA 2Q8UA 2R17A 3E7BA 4I5LC 4MOYA 3P71C 4ORCA 1KBPA 1M63A 4YKEA 4UT3A 4Q7FA 3THOB 3QFKA 1NNWA 3FGAC 2YEQA 3JYFA 4LTYA 4KKZA 3RL3A 4WWLA 1S70A 3LL8A 4O43A 3ZU0A 2ZBMA 4DHLA 1HP1A 2HYOA 2NYLC 1T70A 4IL1A 3IVEA 3ZTVA 3H63A 4V0XA 4B2OA 1HO5A 4G9JA 3RL5A 2O8GA 3E0JA 2KKNA 3H62B 2ZO9B 2HY1A 1V73A 4MP0A 2CV9A 2BQ8X 4LACC 4DSYA 1OI8A 2HYPA 2BDXA 1OIEA 5B8IA 4FBKA 2O8AA 3TGHA 3RQZA 3GVEA 3THNA 2DXNA 3AUZA 4H2BA 2USHA 4UT3B 4FBWA 2YVTA 3AV0A 4H2GA 5JPFA 2QJCA 3FLOA 1S8EA 4TUGA 4JA7A 3HVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1V A;  5INB A;  3H69 A;  4H2I A;  1QFC A;  4OR9 A;  3V4Y A;  4ZX2 A;  1USH A;  5F3W A;  3IB8 A;  1Z2W A;  1S3L A;  3QFM A;  4LU9 A;  4TUI A;  1Z2X A;  4UT2 A;  4V0W A;  1OID A;  2IE4 C;  3H67 A;  4JA9 A;  1G5B A;  1WAO 1;  3IVD A;  5HPE A;  1IT6 A;  3ICF A;  4O24 A;  2AHD A;  1MF8 A;  2WDF A;  1S3N A;  1UTE A;  3DW8 C;  4M0V A;  3DSD A;  1S3M A;  4H2F A;  1SU1 A;  4ORB A;  5JJT A;  4XPN A;  2WDD A;  1XM7 A;  2GJU A;  1U32 A;  2NPP C;  3N5U A;  1W24 A;  4V0V A;  3H61 A;  3T1I A;  3C5W C;  2P6B A;  3QFN A;  5DNY A;  2WDC A;  1FJM A;  2QFR A;  2IE3 C;  4J6O A;  3H68 A;  2DFJ A;  3H60 A;  3EGG A;  1II7 A;  4UWQ A;  3PSN A;  2Z06 A;  1HPU A;  3QG5 C;  4F0Z A;  3H64 A;  5EQV A;  4MOV A;  3EGH A;  3E7A A;  1XZW A;  3IB7 A;  4O4K A;  5J28 A;  2BCD A;  2Z1A A;  3DSC A;  3K7V C;  5GTU A;  4H1Y P;  1TCO A;  3H66 A;  3CK2 A;  4KBP A;  2XMO A;  1AUI A;  4ORA A;  2JOG A;  1UF3 A;  2NXF A;  4I5N C;  4HD0 A;  1JK7 A;  1S95 A;  3C9F A;  3QFO A;  5JPE A;  4NZV A;  2WDE A;  4ZVZ A;  1WAR A;  2IAE C;  3PSO A;  3RL4 A;  4DT2 A;  2NYM C;  4IYP C;  4FCX A;  4H1S A;  5IOH A;  3KBP A;  1QHW A;  2QFP A;  2Z72 A;  3K7W C;  2A22 A;  1T71 A;  4FBQ A;  4O5G A;  2Q8U A;  2R17 A;  3E7B A;  4I5L C;  4MOY A;  3P71 C;  4ORC A;  1KBP A;  1M63 A;  4YKE A;  4UT3 A;  4Q7F A;  3THO B;  3QFK A;  1NNW A;  3FGA C;  3JYF A;  4LTY A;  4KKZ A;  3RL3 A;  4WWL A;  1S70 A;  3LL8 A;  4O43 A;  3ZU0 A;  2ZBM A;  4DHL A;  1HP1 A;  2HYO A;  2NYL C;  1T70 A;  4IL1 A;  3IVE A;  3ZTV A;  3H63 A;  4V0X A;  4B2O A;  1HO5 A;  4G9J A;  3RL5 A;  2O8G A;  2KKN A;  3H62 B;  2HY1 A;  1V73 A;  4MP0 A;  2CV9 A;  2BQ8 X;  4LAC C;  4DSY A;  1OI8 A;  2HYP A;  2BDX A;  1OIE A;  5B8I A;  4FBK A;  2O8A A;  3TGH A;  3RQZ A;  3GVE A;  3THN A;  3AUZ A;  4H2B A;  2USH A;  4UT3 B;  4FBW A;  2YVT A;  3AV0 A;  4H2G A;  5JPF A;  2QJC A;  1S8E A;  4TUG A;  4JA7 A;  3HVQ A; 
#chains in the Genus database with same CATH topology
 5C1V A;  5INB A;  3H69 A;  4H2I A;  1QFC A;  4OR9 A;  3V4Y A;  4ZX2 A;  1USH A;  5F3W A;  3IB8 A;  1Z2W A;  1S3L A;  3QFM A;  4LU9 A;  4TUI A;  1Z2X A;  4UT2 A;  4V0W A;  1OID A;  2IE4 C;  3H67 A;  4JA9 A;  1G5B A;  1WAO 1;  3IVD A;  5HPE A;  1IT6 A;  3ICF A;  4O24 A;  2AHD A;  1MF8 A;  2WDF A;  1S3N A;  1UTE A;  3DW8 C;  4M0V A;  3DSD A;  1S3M A;  4H2F A;  1SU1 A;  4ORB A;  5JJT A;  4XPN A;  2WDD A;  1XM7 A;  2GJU A;  1U32 A;  2NPP C;  3N5U A;  2ZOA A;  2DXL A;  1W24 A;  4V0V A;  3H61 A;  3T1I A;  3C5W C;  2P6B A;  3QFN A;  5DNY A;  2WDC A;  1FJM A;  2QFR A;  2IE3 C;  4J6O A;  3H68 A;  2DFJ A;  3H60 A;  3EGG A;  1II7 A;  4UWQ A;  3PSN A;  2Z06 A;  1HPU A;  3QG5 C;  4F0Z A;  3H64 A;  5EQV A;  4MOV A;  3EGH A;  3E7A A;  1XZW A;  3IB7 A;  4O4K A;  5J28 A;  2BCD A;  2Z1A A;  3DSC A;  3K7V C;  5GTU A;  4H1Y P;  1TCO A;  3H66 A;  3CK2 A;  4KBP A;  2XMO A;  1AUI A;  4ORA A;  2JOG A;  1UF3 A;  2NXF A;  4I5N C;  3D03 A;  4HD0 A;  1JK7 A;  1S95 A;  3C9F A;  3QFO A;  5JPE A;  4NZV A;  2WDE A;  4ZVZ A;  1WAR A;  2IAE C;  3PSO A;  3RL4 A;  4DT2 A;  2NYM C;  4IYP C;  4FCX A;  4H1S A;  5IOH A;  3KBP A;  1QHW A;  2QFP A;  2Z72 A;  3K7W C;  2A22 A;  1T71 A;  4FBQ A;  4O5G A;  2Q8U A;  2R17 A;  3E7B A;  4I5L C;  4MOY A;  3P71 C;  4ORC A;  1KBP A;  1M63 A;  4YKE A;  4UT3 A;  4Q7F A;  3THO B;  3QFK A;  1NNW A;  3FGA C;  2YEQ A;  3JYF A;  4LTY A;  4KKZ A;  3RL3 A;  4WWL A;  1S70 A;  3LL8 A;  4O43 A;  3ZU0 A;  2ZBM A;  4DHL A;  1HP1 A;  2HYO A;  2NYL C;  1T70 A;  4IL1 A;  3IVE A;  3ZTV A;  3H63 A;  4V0X A;  4B2O A;  1HO5 A;  4G9J A;  3RL5 A;  2O8G A;  3E0J A;  2KKN A;  3H62 B;  2ZO9 B;  2HY1 A;  1V73 A;  4MP0 A;  2CV9 A;  2BQ8 X;  4LAC C;  4DSY A;  1OI8 A;  2HYP A;  2BDX A;  1OIE A;  5B8I A;  4FBK A;  2O8A A;  3TGH A;  3RQZ A;  3GVE A;  3THN A;  2DXN A;  3AUZ A;  4H2B A;  2USH A;  4UT3 B;  4FBW A;  2YVT A;  3AV0 A;  4H2G A;  5JPF A;  2QJC A;  3FLO A;  1S8E A;  4TUG A;  4JA7 A;  3HVQ A; 
#chains in the Genus database with same CATH homology
 5C1V A;  5INB A;  3H69 A;  4H2I A;  1QFC A;  4OR9 A;  3V4Y A;  4ZX2 A;  1USH A;  5F3W A;  3IB8 A;  1Z2W A;  1S3L A;  3QFM A;  4LU9 A;  4TUI A;  1Z2X A;  4UT2 A;  4V0W A;  1OID A;  2IE4 C;  3H67 A;  4JA9 A;  1G5B A;  1WAO 1;  3IVD A;  5HPE A;  1IT6 A;  3ICF A;  4O24 A;  2AHD A;  1MF8 A;  2WDF A;  1S3N A;  1UTE A;  3DW8 C;  4M0V A;  3DSD A;  1S3M A;  4H2F A;  1SU1 A;  4ORB A;  5JJT A;  4XPN A;  2WDD A;  1XM7 A;  2GJU A;  1U32 A;  2NPP C;  3N5U A;  2ZOA A;  2DXL A;  1W24 A;  4V0V A;  3H61 A;  3T1I A;  3C5W C;  2P6B A;  3QFN A;  5DNY A;  2WDC A;  1FJM A;  2QFR A;  2IE3 C;  4J6O A;  3H68 A;  2DFJ A;  3H60 A;  3EGG A;  1II7 A;  4UWQ A;  3PSN A;  2Z06 A;  1HPU A;  3QG5 C;  4F0Z A;  3H64 A;  5EQV A;  4MOV A;  3EGH A;  3E7A A;  1XZW A;  3IB7 A;  4O4K A;  5J28 A;  2BCD A;  2Z1A A;  3DSC A;  3K7V C;  5GTU A;  4H1Y P;  1TCO A;  3H66 A;  3CK2 A;  4KBP A;  2XMO A;  1AUI A;  4ORA A;  2JOG A;  1UF3 A;  2NXF A;  4I5N C;  3D03 A;  4HD0 A;  1JK7 A;  1S95 A;  3C9F A;  3QFO A;  5JPE A;  4NZV A;  2WDE A;  4ZVZ A;  1WAR A;  2IAE C;  3PSO A;  3RL4 A;  4DT2 A;  2NYM C;  4IYP C;  4FCX A;  4H1S A;  5IOH A;  3KBP A;  1QHW A;  2QFP A;  2Z72 A;  3K7W C;  2A22 A;  1T71 A;  4FBQ A;  4O5G A;  2Q8U A;  2R17 A;  3E7B A;  4I5L C;  4MOY A;  3P71 C;  4ORC A;  1KBP A;  1M63 A;  4YKE A;  4UT3 A;  4Q7F A;  3THO B;  3QFK A;  1NNW A;  3FGA C;  2YEQ A;  3JYF A;  4LTY A;  4KKZ A;  3RL3 A;  4WWL A;  1S70 A;  3LL8 A;  4O43 A;  3ZU0 A;  2ZBM A;  4DHL A;  1HP1 A;  2HYO A;  2NYL C;  1T70 A;  4IL1 A;  3IVE A;  3ZTV A;  3H63 A;  4V0X A;  4B2O A;  1HO5 A;  4G9J A;  3RL5 A;  2O8G A;  3E0J A;  2KKN A;  3H62 B;  2ZO9 B;  2HY1 A;  1V73 A;  4MP0 A;  2CV9 A;  2BQ8 X;  4LAC C;  4DSY A;  1OI8 A;  2HYP A;  2BDX A;  1OIE A;  5B8I A;  4FBK A;  2O8A A;  3TGH A;  3RQZ A;  3GVE A;  3THN A;  2DXN A;  3AUZ A;  4H2B A;  2USH A;  4UT3 B;  4FBW A;  2YVT A;  3AV0 A;  4H2G A;  5JPF A;  2QJC A;  3FLO A;  1S8E A;  4TUG A;  4JA7 A;  3HVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...