3JYFA

The crystal structure of a 2,3-cyclic nucleotide 2-phosphodiesterase/3-nucleotidase bifunctional periplasmic precursor protein from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
AATVDLRIMETTDLHSNMMDFDYYKDAATEKFGLVRTASLIEQARAEVKNSVLVDNGDVIQGSPLGDYMAAKGLKEGDVHPVYKAMNTLNYAVGNLGNHEFNYGLDFLHKALAGAKFPYVNANIIDAKTGKPMFTPYLIQDTRVVDSDGQIHTLRIGYIGFVPPQIMTWDKANLNGKVTVNDITETARKYIPEMRAKGADVVVVVAHSGLSADPYQAMAENSVYYLSQVPGVDAIMFGHAHAVFPGKDFANIKGADIAKGTLNGVPAVMPGMWGDHLGVVDLVLNNDSGKWQVTQSKAEARPIYDAVAKKSLAAEDGKLVSVLKADHDATREFVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase
publication title The crystal structure of a 2,3-cyclic nucleotide 2-phosphodiesterase/3-nucleotidase bifunctional periplasmic precursor protein from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 91
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3jyfA00
3THOB 3ZTVA 2USHA 4O5GA 4O24A 2NYMC 2O8AA 5GTUA 2HYOA 5DNYA 5B8IA 4H2FA 4FCXA 5INBA 4ORBA 2WDFA 4V0XA 3IB8A 2GJUA 3DSDA 3TGHA 3RQZA 2XMOA 1IT6A 2BCDA 3H60A 1U32A 3K7VC 1S8EA 3DW8C 3IVDA 4I5NC 3KBPA 4MP0A 1Z2WA 2QJCA 1T70A 3EGGA 3AV0A 4ORAA 2AHDA 5C1VA 1OIDA 4H2BA 5JPFA 3E7AA 4ZVZA 4F0ZA 3FGAC 2IE3C 2CV9A 3QFNA 1OI8A 2ZBMA 1UTEA 4H1SA 4J6OA 3H62B 4H1YP 1S3MA 5EQVA 4B2OA 4XPNA 4IL1A 1HO5A 4LTYA 4NZVA 1NNWA 4H2IA 5F3WA 1JK7A 4O4KA 2O8GA 2JOGA 4OR9A 1S3NA 1QFCA 3N5UA 2Z06A 3H61A 4UT3B 4H2GA 3HVQA 4KKZA 3H68A 4IYPC 3QG5C 2KKNA 3LL8A 1S70A 2IAEC 2QFRA 4FBQA 4JA9A 1SU1A 4V0VA 4WWLA 1MF8A 2QFPA 3IB7A 3RL3A 1FJMA 3IVEA 4Q7FA 1V73A 4TUIA 4MOYA 1HP1A 2HY1A 4DSYA 3H64A 3ICFA 4HD0A 3JYFA 3DSCA 1G5BA 3AUZA 3RL4A 3C9FA 5JPEA 4FBKA 3CK2A 4JA7A 2HYPA 4FBWA 5IOHA 2WDDA 5J28A 2Z1AA 2YVTA 3C5WC 3ZU0A 4O43A 1T71A 3QFKA 4I5LC 4UWQA 5HPEA 1WAO1 2IE4C 3T1IA 3THNA 4ORCA 4M0VA 3GVEA 4ZX2A 2NPPC 1S95A 1XZWA 4MOVA 4G9JA 1QHWA 4YKEA 4LACC 4UT2A 1KBPA 4DT2A 3QFOA 5JJTA 2Z72A 4LU9A 2Q8UA 3E7BA 2R17A 3H69A 3RL5A 2DFJA 2P6BA 1II7A 3QFMA 2WDEA 1Z2XA 3PSNA 1UF3A 2A22A 4DHLA 3P71C 4V0WA 2BQ8X 1S3LA 2WDCA 3K7WC 4KBPA 1HPUA 4UT3A 3V4YA 1AUIA 3H67A 3PSOA 3H63A 1W24A 2NXFA 1M63A 1WARA 1XM7A 1TCOA 2BDXA 3EGHA 3H66A 1OIEA 4TUGA 1USHA 2NYLC
chains in the Genus database with same CATH superfamily
3THOB 3ZTVA 2USHA 4O5GA 4O24A 2NYMC 2O8AA 5GTUA 2HYOA 5DNYA 5B8IA 4H2FA 4FCXA 5INBA 4ORBA 2WDFA 4V0XA 3IB8A 2GJUA 3DSDA 3TGHA 3RQZA 2XMOA 1IT6A 2BCDA 3H60A 1U32A 3K7VC 1S8EA 3DW8C 3IVDA 4I5NC 3KBPA 4MP0A 1Z2WA 2QJCA 1T70A 3EGGA 3AV0A 4ORAA 2AHDA 5C1VA 1OIDA 4H2BA 5JPFA 2YEQA 2DXNA 3E7AA 4ZVZA 4F0ZA 3FGAC 2IE3C 2CV9A 3QFNA 1OI8A 2ZBMA 1UTEA 4H1SA 4J6OA 3H62B 4H1YP 1S3MA 5EQVA 4B2OA 4XPNA 4IL1A 1HO5A 4LTYA 4NZVA 1NNWA 4H2IA 5F3WA 1JK7A 3D03A 2DXLA 2ZO9B 2O8GA 4O4KA 2JOGA 4OR9A 1S3NA 1QFCA 3N5UA 2Z06A 3H61A 4UT3B 4H2GA 3HVQA 4KKZA 3H68A 4IYPC 3QG5C 2KKNA 3LL8A 1S70A 2IAEC 2QFRA 4FBQA 4JA9A 1SU1A 4V0VA 4WWLA 1MF8A 2QFPA 3IB7A 3RL3A 1FJMA 3IVEA 4Q7FA 1V73A 4TUIA 4MOYA 1HP1A 2HY1A 4DSYA 3H64A 3ICFA 4HD0A 3JYFA 3DSCA 1G5BA 3AUZA 3RL4A 3C9FA 5JPEA 4FBKA 3CK2A 4JA7A 2HYPA 4FBWA 5IOHA 2WDDA 5J28A 2Z1AA 2YVTA 3C5WC 3ZU0A 4O43A 1T71A 3QFKA 4I5LC 4UWQA 5HPEA 1WAO1 2IE4C 3T1IA 3THNA 4ORCA 4M0VA 3FLOA 3GVEA 4ZX2A 2NPPC 1S95A 1XZWA 4MOVA 4G9JA 1QHWA 4YKEA 4LACC 4UT2A 1KBPA 4DT2A 3QFOA 5JJTA 2Z72A 4LU9A 2Q8UA 3E7BA 2R17A 3H69A 3RL5A 2DFJA 2P6BA 1II7A 2ZOAA 3QFMA 2WDEA 1Z2XA 3PSNA 1UF3A 2A22A 4DHLA 3P71C 4V0WA 2BQ8X 1S3LA 2WDCA 3K7WC 4KBPA 1HPUA 4UT3A 3V4YA 1AUIA 3H67A 3PSOA 3H63A 1W24A 2NXFA 1M63A 1WARA 1XM7A 1TCOA 2BDXA 3E0JA 3EGHA 3H66A 1OIEA 4TUGA 1USHA 2NYLC
chains in the Genus database with same CATH topology
3THOB 3ZTVA 2USHA 4O5GA 4O24A 2NYMC 2O8AA 5GTUA 2HYOA 5DNYA 5B8IA 4H2FA 4FCXA 5INBA 4ORBA 2WDFA 4V0XA 3IB8A 2GJUA 3DSDA 3TGHA 3RQZA 2XMOA 1IT6A 2BCDA 3H60A 1U32A 3K7VC 1S8EA 3DW8C 3IVDA 4I5NC 3KBPA 4MP0A 1Z2WA 2QJCA 1T70A 3EGGA 3AV0A 4ORAA 2AHDA 5C1VA 1OIDA 4H2BA 5JPFA 2YEQA 2DXNA 3E7AA 4ZVZA 4F0ZA 3FGAC 2IE3C 2CV9A 3QFNA 1OI8A 2ZBMA 1UTEA 4H1SA 4J6OA 3H62B 4H1YP 1S3MA 5EQVA 4B2OA 4XPNA 4IL1A 1HO5A 4LTYA 4NZVA 1NNWA 4H2IA 5F3WA 1JK7A 3D03A 2DXLA 2ZO9B 2O8GA 4O4KA 2JOGA 4OR9A 1S3NA 1QFCA 3N5UA 2Z06A 3H61A 4UT3B 4H2GA 3HVQA 4KKZA 3H68A 4IYPC 3QG5C 2KKNA 3LL8A 1S70A 2IAEC 2QFRA 4FBQA 4JA9A 1SU1A 4V0VA 4WWLA 1MF8A 2QFPA 3IB7A 3RL3A 1FJMA 3IVEA 4Q7FA 1V73A 4TUIA 4MOYA 1HP1A 2HY1A 4DSYA 3H64A 3ICFA 4HD0A 3JYFA 3DSCA 1G5BA 3AUZA 3RL4A 3C9FA 5JPEA 4FBKA 3CK2A 4JA7A 2HYPA 4FBWA 5IOHA 2WDDA 5J28A 2Z1AA 2YVTA 3C5WC 3ZU0A 4O43A 1T71A 3QFKA 4I5LC 4UWQA 5HPEA 1WAO1 2IE4C 3T1IA 3THNA 4ORCA 4M0VA 3FLOA 3GVEA 4ZX2A 2NPPC 1S95A 1XZWA 4MOVA 4G9JA 1QHWA 4YKEA 4LACC 4UT2A 1KBPA 4DT2A 3QFOA 5JJTA 2Z72A 4LU9A 2Q8UA 3E7BA 2R17A 3H69A 3RL5A 2DFJA 2P6BA 1II7A 2ZOAA 3QFMA 2WDEA 1Z2XA 3PSNA 1UF3A 2A22A 4DHLA 3P71C 4V0WA 2BQ8X 1S3LA 2WDCA 3K7WC 4KBPA 1HPUA 4UT3A 3V4YA 1AUIA 3H67A 3PSOA 3H63A 1W24A 2NXFA 1M63A 1WARA 1XM7A 1TCOA 2BDXA 3E0JA 3EGHA 3H66A 1OIEA 4TUGA 1USHA 2NYLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THO B;  3ZTV A;  2USH A;  4O5G A;  4O24 A;  2NYM C;  2O8A A;  5GTU A;  2HYO A;  5DNY A;  5B8I A;  4H2F A;  4FCX A;  5INB A;  4ORB A;  2WDF A;  4V0X A;  3IB8 A;  2GJU A;  3DSD A;  3TGH A;  3RQZ A;  2XMO A;  1IT6 A;  2BCD A;  3H60 A;  1U32 A;  3K7V C;  1S8E A;  3DW8 C;  3IVD A;  4I5N C;  3KBP A;  4MP0 A;  1Z2W A;  2QJC A;  1T70 A;  3EGG A;  3AV0 A;  4ORA A;  2AHD A;  5C1V A;  1OID A;  4H2B A;  5JPF A;  3E7A A;  4ZVZ A;  4F0Z A;  3FGA C;  2IE3 C;  2CV9 A;  3QFN A;  1OI8 A;  2ZBM A;  1UTE A;  4H1S A;  4J6O A;  3H62 B;  4H1Y P;  1S3M A;  5EQV A;  4B2O A;  4XPN A;  4IL1 A;  1HO5 A;  4LTY A;  4NZV A;  1NNW A;  4H2I A;  5F3W A;  1JK7 A;  4O4K A;  2O8G A;  2JOG A;  4OR9 A;  1S3N A;  1QFC A;  3N5U A;  2Z06 A;  3H61 A;  4UT3 B;  4H2G A;  3HVQ A;  4KKZ A;  3H68 A;  4IYP C;  3QG5 C;  2KKN A;  3LL8 A;  1S70 A;  2IAE C;  2QFR A;  4FBQ A;  4JA9 A;  1SU1 A;  4V0V A;  4WWL A;  1MF8 A;  2QFP A;  3IB7 A;  3RL3 A;  1FJM A;  3IVE A;  4Q7F A;  1V73 A;  4TUI A;  4MOY A;  1HP1 A;  2HY1 A;  4DSY A;  3H64 A;  3ICF A;  4HD0 A;  3JYF A;  3DSC A;  1G5B A;  3AUZ A;  3RL4 A;  3C9F A;  5JPE A;  4FBK A;  3CK2 A;  4JA7 A;  2HYP A;  4FBW A;  5IOH A;  2WDD A;  5J28 A;  2Z1A A;  2YVT A;  3C5W C;  3ZU0 A;  4O43 A;  1T71 A;  3QFK A;  4I5L C;  4UWQ A;  5HPE A;  1WAO 1;  2IE4 C;  3T1I A;  3THN A;  4ORC A;  4M0V A;  3GVE A;  4ZX2 A;  2NPP C;  1S95 A;  1XZW A;  4MOV A;  4G9J A;  1QHW A;  4YKE A;  4LAC C;  4UT2 A;  1KBP A;  4DT2 A;  3QFO A;  5JJT A;  2Z72 A;  4LU9 A;  2Q8U A;  3E7B A;  2R17 A;  3H69 A;  3RL5 A;  2DFJ A;  2P6B A;  1II7 A;  3QFM A;  2WDE A;  1Z2X A;  3PSN A;  1UF3 A;  2A22 A;  4DHL A;  3P71 C;  4V0W A;  2BQ8 X;  1S3L A;  2WDC A;  3K7W C;  4KBP A;  1HPU A;  4UT3 A;  3V4Y A;  1AUI A;  3H67 A;  3PSO A;  3H63 A;  1W24 A;  2NXF A;  1M63 A;  1WAR A;  1XM7 A;  1TCO A;  2BDX A;  3EGH A;  3H66 A;  1OIE A;  4TUG A;  1USH A;  2NYL C; 
#chains in the Genus database with same CATH topology
 3THO B;  3ZTV A;  2USH A;  4O5G A;  4O24 A;  2NYM C;  2O8A A;  5GTU A;  2HYO A;  5DNY A;  5B8I A;  4H2F A;  4FCX A;  5INB A;  4ORB A;  2WDF A;  4V0X A;  3IB8 A;  2GJU A;  3DSD A;  3TGH A;  3RQZ A;  2XMO A;  1IT6 A;  2BCD A;  3H60 A;  1U32 A;  3K7V C;  1S8E A;  3DW8 C;  3IVD A;  4I5N C;  3KBP A;  4MP0 A;  1Z2W A;  2QJC A;  1T70 A;  3EGG A;  3AV0 A;  4ORA A;  2AHD A;  5C1V A;  1OID A;  4H2B A;  5JPF A;  2YEQ A;  2DXN A;  3E7A A;  4ZVZ A;  4F0Z A;  3FGA C;  2IE3 C;  2CV9 A;  3QFN A;  1OI8 A;  2ZBM A;  1UTE A;  4H1S A;  4J6O A;  3H62 B;  4H1Y P;  1S3M A;  5EQV A;  4B2O A;  4XPN A;  4IL1 A;  1HO5 A;  4LTY A;  4NZV A;  1NNW A;  4H2I A;  5F3W A;  1JK7 A;  3D03 A;  2DXL A;  2ZO9 B;  2O8G A;  4O4K A;  2JOG A;  4OR9 A;  1S3N A;  1QFC A;  3N5U A;  2Z06 A;  3H61 A;  4UT3 B;  4H2G A;  3HVQ A;  4KKZ A;  3H68 A;  4IYP C;  3QG5 C;  2KKN A;  3LL8 A;  1S70 A;  2IAE C;  2QFR A;  4FBQ A;  4JA9 A;  1SU1 A;  4V0V A;  4WWL A;  1MF8 A;  2QFP A;  3IB7 A;  3RL3 A;  1FJM A;  3IVE A;  4Q7F A;  1V73 A;  4TUI A;  4MOY A;  1HP1 A;  2HY1 A;  4DSY A;  3H64 A;  3ICF A;  4HD0 A;  3JYF A;  3DSC A;  1G5B A;  3AUZ A;  3RL4 A;  3C9F A;  5JPE A;  4FBK A;  3CK2 A;  4JA7 A;  2HYP A;  4FBW A;  5IOH A;  2WDD A;  5J28 A;  2Z1A A;  2YVT A;  3C5W C;  3ZU0 A;  4O43 A;  1T71 A;  3QFK A;  4I5L C;  4UWQ A;  5HPE A;  1WAO 1;  2IE4 C;  3T1I A;  3THN A;  4ORC A;  4M0V A;  3FLO A;  3GVE A;  4ZX2 A;  2NPP C;  1S95 A;  1XZW A;  4MOV A;  4G9J A;  1QHW A;  4YKE A;  4LAC C;  4UT2 A;  1KBP A;  4DT2 A;  3QFO A;  5JJT A;  2Z72 A;  4LU9 A;  2Q8U A;  3E7B A;  2R17 A;  3H69 A;  3RL5 A;  2DFJ A;  2P6B A;  1II7 A;  2ZOA A;  3QFM A;  2WDE A;  1Z2X A;  3PSN A;  1UF3 A;  2A22 A;  4DHL A;  3P71 C;  4V0W A;  2BQ8 X;  1S3L A;  2WDC A;  3K7W C;  4KBP A;  1HPU A;  4UT3 A;  3V4Y A;  1AUI A;  3H67 A;  3PSO A;  3H63 A;  1W24 A;  2NXF A;  1M63 A;  1WAR A;  1XM7 A;  1TCO A;  2BDX A;  3E0J A;  3EGH A;  3H66 A;  1OIE A;  4TUG A;  1USH A;  2NYL C; 
#chains in the Genus database with same CATH homology
 3THO B;  3ZTV A;  2USH A;  4O5G A;  4O24 A;  2NYM C;  2O8A A;  5GTU A;  2HYO A;  5DNY A;  5B8I A;  4H2F A;  4FCX A;  5INB A;  4ORB A;  2WDF A;  4V0X A;  3IB8 A;  2GJU A;  3DSD A;  3TGH A;  3RQZ A;  2XMO A;  1IT6 A;  2BCD A;  3H60 A;  1U32 A;  3K7V C;  1S8E A;  3DW8 C;  3IVD A;  4I5N C;  3KBP A;  4MP0 A;  1Z2W A;  2QJC A;  1T70 A;  3EGG A;  3AV0 A;  4ORA A;  2AHD A;  5C1V A;  1OID A;  4H2B A;  5JPF A;  2YEQ A;  2DXN A;  3E7A A;  4ZVZ A;  4F0Z A;  3FGA C;  2IE3 C;  2CV9 A;  3QFN A;  1OI8 A;  2ZBM A;  1UTE A;  4H1S A;  4J6O A;  3H62 B;  4H1Y P;  1S3M A;  5EQV A;  4B2O A;  4XPN A;  4IL1 A;  1HO5 A;  4LTY A;  4NZV A;  1NNW A;  4H2I A;  5F3W A;  1JK7 A;  3D03 A;  2DXL A;  2ZO9 B;  2O8G A;  4O4K A;  2JOG A;  4OR9 A;  1S3N A;  1QFC A;  3N5U A;  2Z06 A;  3H61 A;  4UT3 B;  4H2G A;  3HVQ A;  4KKZ A;  3H68 A;  4IYP C;  3QG5 C;  2KKN A;  3LL8 A;  1S70 A;  2IAE C;  2QFR A;  4FBQ A;  4JA9 A;  1SU1 A;  4V0V A;  4WWL A;  1MF8 A;  2QFP A;  3IB7 A;  3RL3 A;  1FJM A;  3IVE A;  4Q7F A;  1V73 A;  4TUI A;  4MOY A;  1HP1 A;  2HY1 A;  4DSY A;  3H64 A;  3ICF A;  4HD0 A;  3JYF A;  3DSC A;  1G5B A;  3AUZ A;  3RL4 A;  3C9F A;  5JPE A;  4FBK A;  3CK2 A;  4JA7 A;  2HYP A;  4FBW A;  5IOH A;  2WDD A;  5J28 A;  2Z1A A;  2YVT A;  3C5W C;  3ZU0 A;  4O43 A;  1T71 A;  3QFK A;  4I5L C;  4UWQ A;  5HPE A;  1WAO 1;  2IE4 C;  3T1I A;  3THN A;  4ORC A;  4M0V A;  3FLO A;  3GVE A;  4ZX2 A;  2NPP C;  1S95 A;  1XZW A;  4MOV A;  4G9J A;  1QHW A;  4YKE A;  4LAC C;  4UT2 A;  1KBP A;  4DT2 A;  3QFO A;  5JJT A;  2Z72 A;  4LU9 A;  2Q8U A;  3E7B A;  2R17 A;  3H69 A;  3RL5 A;  2DFJ A;  2P6B A;  1II7 A;  2ZOA A;  3QFM A;  2WDE A;  1Z2X A;  3PSN A;  1UF3 A;  2A22 A;  4DHL A;  3P71 C;  4V0W A;  2BQ8 X;  1S3L A;  2WDC A;  3K7W C;  4KBP A;  1HPU A;  4UT3 A;  3V4Y A;  1AUI A;  3H67 A;  3PSO A;  3H63 A;  1W24 A;  2NXF A;  1M63 A;  1WAR A;  1XM7 A;  1TCO A;  2BDX A;  3E0J A;  3EGH A;  3H66 A;  1OIE A;  4TUG A;  1USH A;  2NYL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...