3JYFA

The crystal structure of a 2,3-cyclic nucleotide 2-phosphodiesterase/3-nucleotidase bifunctional periplasmic precursor protein from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
336
structure length
336
Chain Sequence
AATVDLRIMETTDLHSNMMDFDYYKDAATEKFGLVRTASLIEQARAEVKNSVLVDNGDVIQGSPLGDYMAAKGLKEGDVHPVYKAMNTLNYAVGNLGNHEFNYGLDFLHKALAGAKFPYVNANIIDAKTGKPMFTPYLIQDTRVVDSDGQIHTLRIGYIGFVPPQIMTWDKANLNGKVTVNDITETARKYIPEMRAKGADVVVVVAHSGLSADPYQAMAENSVYYLSQVPGVDAIMFGHAHAVFPGKDFANIKGADIAKGTLNGVPAVMPGMWGDHLGVVDLVLNNDSGKWQVTQSKAEARPIYDAVAKKSLAAEDGKLVSVLKADHDATREFVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase
publication title The crystal structure of a 2,3-cyclic nucleotide 2-phosphodiesterase/3-nucleotidase bifunctional periplasmic precursor protein from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase
total genus 91
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3jyfA00
1Z2XA 2Q8UA 1HPUA 5B8IA 1QFCA 4TUGA 3QFKA 4OR9A 3IB8A 1HP1A 3IVEA 2WDFA 4LACC 3JYFA 4G9JA 4JA7A 4UT2A 3T1IA 2HYOA 4FBQA 4UWQA 5JPFA 2QJCA 1OIEA 1T70A 1Z2WA 3EGGA 3H60A 4LU9A 2USHA 3QFOA 3DSCA 4H1YP 3RQZA 4IL1A 5F3WA 3H62B 4I5LC 4H2BA 1IT6A 5GTUA 2BCDA 2NPPC 2A22A 2IE3C 5EQVA 4HD0A 4H2IA 1KBPA 4MP0A 4NZVA 1NNWA 4ORAA 4H1SA 2WDEA 4V0WA 3DW8C 5INBA 2Z1AA 4DSYA 4ZX2A 1OIDA 3H61A 3H69A 2CV9A 2QFRA 1AUIA 1S3MA 3ZTVA 5IOHA 5JJTA 3HVQA 1XM7A 4O4KA 2IE4C 1WARA 2Z72A 4Q7FA 3PSNA 3RL4A 3IVDA 1WAO1 4XPNA 5DNYA 3EGHA 1HO5A 4JA9A 4MOYA 3ICFA 2AHDA 4TUIA 1M63A 2BDXA 2JOGA 4UT3B 3IB7A 1W24A 3RL3A 1II7A 1U32A 3H64A 1XZWA 4MOVA 4LTYA 4ORCA 1S3LA 3THOB 4DHLA 3P71C 2O8AA 3AUZA 1MF8A 3CK2A 4O43A 2WDDA 5JPEA 1S8EA 3THNA 3RL5A 3H63A 2KKNA 1JK7A 4J6OA 4H2FA 3C9FA 2BQ8X 3H68A 2GJUA 4DT2A 2HY1A 2NYMC 4KBPA 2DFJA 5HPEA 2P6BA 1UTEA 4WWLA 2WDCA 3TGHA 3FGAC 2O8GA 2QFPA 4F0ZA 4ORBA 4I5NC 3H67A 1QHWA 1FJMA 2XMOA 3ZU0A 2NXFA 1OI8A 1T71A 2YVTA 4B2OA 3GVEA 3LL8A 4O24A 2Z06A 4IYPC 2R17A 4M0VA 4V0VA 2IAEC 5J28A 4FCXA 4ZVZA 2NYLC 3K7WC 3KBPA 4H2GA 3PSOA 1S3NA 3QFNA 3AV0A 3K7VC 4FBKA 3N5UA 4YKEA 1SU1A 4V0XA 3V4YA 4UT3A 3H66A 1USHA 4KKZA 1V73A 2ZBMA 1TCOA 3E7BA 3E7AA 5C1VA 3C5WC 1UF3A 1S70A 3QG5C 4O5GA 3DSDA 3QFMA 1S95A 1G5BA 2HYPA 4FBWA
chains in the Genus database with same CATH superfamily
1Z2XA 2Q8UA 1HPUA 5B8IA 1QFCA 4TUGA 3QFKA 4OR9A 3IB8A 1HP1A 3IVEA 2WDFA 4LACC 3JYFA 4G9JA 4JA7A 4UT2A 3T1IA 2HYOA 4FBQA 4UWQA 5JPFA 2QJCA 1OIEA 1T70A 1Z2WA 3EGGA 3H60A 4LU9A 2USHA 3QFOA 3DSCA 4H1YP 3RQZA 4IL1A 5F3WA 3H62B 4I5LC 2DXLA 2YEQA 4H2BA 1IT6A 5GTUA 2BCDA 2NPPC 2A22A 2IE3C 5EQVA 4HD0A 4H2IA 1KBPA 4MP0A 4NZVA 1NNWA 4ORAA 4H1SA 2WDEA 4V0WA 3DW8C 5INBA 2Z1AA 4DSYA 4ZX2A 1OIDA 3H61A 3H69A 2CV9A 2QFRA 1AUIA 1S3MA 3ZTVA 5IOHA 3FLOA 5JJTA 3E0JA 3HVQA 1XM7A 4O4KA 2IE4C 1WARA 2Z72A 4Q7FA 3PSNA 3RL4A 3IVDA 1WAO1 4XPNA 5DNYA 2ZO9B 3EGHA 1HO5A 4JA9A 4MOYA 3ICFA 2AHDA 4TUIA 1M63A 2BDXA 2JOGA 4UT3B 3IB7A 1W24A 3RL3A 1II7A 1U32A 3H64A 1XZWA 4MOVA 4LTYA 4ORCA 1S3LA 3THOB 4DHLA 3P71C 2O8AA 3AUZA 1MF8A 3CK2A 4O43A 2WDDA 5JPEA 1S8EA 3THNA 3RL5A 3H63A 2KKNA 1JK7A 4J6OA 4H2FA 3C9FA 2BQ8X 3H68A 2GJUA 4DT2A 2HY1A 2NYMC 4KBPA 2DFJA 5HPEA 2P6BA 1UTEA 4WWLA 2WDCA 3TGHA 3FGAC 2O8GA 2QFPA 4F0ZA 4ORBA 4I5NC 3H67A 1QHWA 1FJMA 2XMOA 3ZU0A 2NXFA 1OI8A 1T71A 2YVTA 4B2OA 3GVEA 3LL8A 4O24A 2Z06A 4IYPC 2DXNA 2R17A 4M0VA 4V0VA 2IAEC 5J28A 4FCXA 4ZVZA 2NYLC 3K7WC 3KBPA 4H2GA 3PSOA 1S3NA 3QFNA 3AV0A 3K7VC 4FBKA 3N5UA 4YKEA 1SU1A 4V0XA 3V4YA 4UT3A 3H66A 1USHA 4KKZA 1V73A 2ZBMA 1TCOA 3E7BA 3E7AA 2ZOAA 5C1VA 3C5WC 1UF3A 1S70A 3QG5C 3D03A 4O5GA 3DSDA 3QFMA 1S95A 1G5BA 2HYPA 4FBWA
chains in the Genus database with same CATH topology
1Z2XA 2Q8UA 1HPUA 5B8IA 1QFCA 4TUGA 3QFKA 4OR9A 3IB8A 1HP1A 3IVEA 2WDFA 4LACC 3JYFA 4G9JA 4JA7A 4UT2A 3T1IA 2HYOA 4FBQA 4UWQA 5JPFA 2QJCA 1OIEA 1T70A 1Z2WA 3EGGA 3H60A 4LU9A 2USHA 3QFOA 3DSCA 4H1YP 3RQZA 4IL1A 5F3WA 3H62B 4I5LC 2DXLA 2YEQA 4H2BA 1IT6A 5GTUA 2BCDA 2NPPC 2A22A 2IE3C 5EQVA 4HD0A 4H2IA 1KBPA 4MP0A 4NZVA 1NNWA 4ORAA 4H1SA 2WDEA 4V0WA 3DW8C 5INBA 2Z1AA 4DSYA 4ZX2A 1OIDA 3H61A 3H69A 2CV9A 2QFRA 1AUIA 1S3MA 3ZTVA 5IOHA 3FLOA 5JJTA 3E0JA 3HVQA 1XM7A 4O4KA 2IE4C 1WARA 2Z72A 4Q7FA 3PSNA 3RL4A 3IVDA 1WAO1 4XPNA 5DNYA 2ZO9B 3EGHA 1HO5A 4JA9A 4MOYA 3ICFA 2AHDA 4TUIA 1M63A 2BDXA 2JOGA 4UT3B 3IB7A 1W24A 3RL3A 1II7A 1U32A 3H64A 1XZWA 4MOVA 4LTYA 4ORCA 1S3LA 3THOB 4DHLA 3P71C 2O8AA 3AUZA 1MF8A 3CK2A 4O43A 2WDDA 5JPEA 1S8EA 3THNA 3RL5A 3H63A 2KKNA 1JK7A 4J6OA 4H2FA 3C9FA 2BQ8X 3H68A 2GJUA 4DT2A 2HY1A 2NYMC 4KBPA 2DFJA 5HPEA 2P6BA 1UTEA 4WWLA 2WDCA 3TGHA 3FGAC 2O8GA 2QFPA 4F0ZA 4ORBA 4I5NC 3H67A 1QHWA 1FJMA 2XMOA 3ZU0A 2NXFA 1OI8A 1T71A 2YVTA 4B2OA 3GVEA 3LL8A 4O24A 2Z06A 4IYPC 2DXNA 2R17A 4M0VA 4V0VA 2IAEC 5J28A 4FCXA 4ZVZA 2NYLC 3K7WC 3KBPA 4H2GA 3PSOA 1S3NA 3QFNA 3AV0A 3K7VC 4FBKA 3N5UA 4YKEA 1SU1A 4V0XA 3V4YA 4UT3A 3H66A 1USHA 4KKZA 1V73A 2ZBMA 1TCOA 3E7BA 3E7AA 2ZOAA 5C1VA 3C5WC 1UF3A 1S70A 3QG5C 3D03A 4O5GA 3DSDA 3QFMA 1S95A 1G5BA 2HYPA 4FBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2X A;  2Q8U A;  1HPU A;  5B8I A;  1QFC A;  4TUG A;  3QFK A;  4OR9 A;  3IB8 A;  1HP1 A;  3IVE A;  2WDF A;  4LAC C;  3JYF A;  4G9J A;  4JA7 A;  4UT2 A;  3T1I A;  2HYO A;  4FBQ A;  4UWQ A;  5JPF A;  2QJC A;  1OIE A;  1T70 A;  1Z2W A;  3EGG A;  3H60 A;  4LU9 A;  2USH A;  3QFO A;  3DSC A;  4H1Y P;  3RQZ A;  4IL1 A;  5F3W A;  3H62 B;  4I5L C;  4H2B A;  1IT6 A;  5GTU A;  2BCD A;  2NPP C;  2A22 A;  2IE3 C;  5EQV A;  4HD0 A;  4H2I A;  1KBP A;  4MP0 A;  4NZV A;  1NNW A;  4ORA A;  4H1S A;  2WDE A;  4V0W A;  3DW8 C;  5INB A;  2Z1A A;  4DSY A;  4ZX2 A;  1OID A;  3H61 A;  3H69 A;  2CV9 A;  2QFR A;  1AUI A;  1S3M A;  3ZTV A;  5IOH A;  5JJT A;  3HVQ A;  1XM7 A;  4O4K A;  2IE4 C;  1WAR A;  2Z72 A;  4Q7F A;  3PSN A;  3RL4 A;  3IVD A;  1WAO 1;  4XPN A;  5DNY A;  3EGH A;  1HO5 A;  4JA9 A;  4MOY A;  3ICF A;  2AHD A;  4TUI A;  1M63 A;  2BDX A;  2JOG A;  4UT3 B;  3IB7 A;  1W24 A;  3RL3 A;  1II7 A;  1U32 A;  3H64 A;  1XZW A;  4MOV A;  4LTY A;  4ORC A;  1S3L A;  3THO B;  4DHL A;  3P71 C;  2O8A A;  3AUZ A;  1MF8 A;  3CK2 A;  4O43 A;  2WDD A;  5JPE A;  1S8E A;  3THN A;  3RL5 A;  3H63 A;  2KKN A;  1JK7 A;  4J6O A;  4H2F A;  3C9F A;  2BQ8 X;  3H68 A;  2GJU A;  4DT2 A;  2HY1 A;  2NYM C;  4KBP A;  2DFJ A;  5HPE A;  2P6B A;  1UTE A;  4WWL A;  2WDC A;  3TGH A;  3FGA C;  2O8G A;  2QFP A;  4F0Z A;  4ORB A;  4I5N C;  3H67 A;  1QHW A;  1FJM A;  2XMO A;  3ZU0 A;  2NXF A;  1OI8 A;  1T71 A;  2YVT A;  4B2O A;  3GVE A;  3LL8 A;  4O24 A;  2Z06 A;  4IYP C;  2R17 A;  4M0V A;  4V0V A;  2IAE C;  5J28 A;  4FCX A;  4ZVZ A;  2NYL C;  3K7W C;  3KBP A;  4H2G A;  3PSO A;  1S3N A;  3QFN A;  3AV0 A;  3K7V C;  4FBK A;  3N5U A;  4YKE A;  1SU1 A;  4V0X A;  3V4Y A;  4UT3 A;  3H66 A;  1USH A;  4KKZ A;  1V73 A;  2ZBM A;  1TCO A;  3E7B A;  3E7A A;  5C1V A;  3C5W C;  1UF3 A;  1S70 A;  3QG5 C;  4O5G A;  3DSD A;  3QFM A;  1S95 A;  1G5B A;  2HYP A;  4FBW A; 
#chains in the Genus database with same CATH topology
 1Z2X A;  2Q8U A;  1HPU A;  5B8I A;  1QFC A;  4TUG A;  3QFK A;  4OR9 A;  3IB8 A;  1HP1 A;  3IVE A;  2WDF A;  4LAC C;  3JYF A;  4G9J A;  4JA7 A;  4UT2 A;  3T1I A;  2HYO A;  4FBQ A;  4UWQ A;  5JPF A;  2QJC A;  1OIE A;  1T70 A;  1Z2W A;  3EGG A;  3H60 A;  4LU9 A;  2USH A;  3QFO A;  3DSC A;  4H1Y P;  3RQZ A;  4IL1 A;  5F3W A;  3H62 B;  4I5L C;  2DXL A;  2YEQ A;  4H2B A;  1IT6 A;  5GTU A;  2BCD A;  2NPP C;  2A22 A;  2IE3 C;  5EQV A;  4HD0 A;  4H2I A;  1KBP A;  4MP0 A;  4NZV A;  1NNW A;  4ORA A;  4H1S A;  2WDE A;  4V0W A;  3DW8 C;  5INB A;  2Z1A A;  4DSY A;  4ZX2 A;  1OID A;  3H61 A;  3H69 A;  2CV9 A;  2QFR A;  1AUI A;  1S3M A;  3ZTV A;  5IOH A;  3FLO A;  5JJT A;  3E0J A;  3HVQ A;  1XM7 A;  4O4K A;  2IE4 C;  1WAR A;  2Z72 A;  4Q7F A;  3PSN A;  3RL4 A;  3IVD A;  1WAO 1;  4XPN A;  5DNY A;  2ZO9 B;  3EGH A;  1HO5 A;  4JA9 A;  4MOY A;  3ICF A;  2AHD A;  4TUI A;  1M63 A;  2BDX A;  2JOG A;  4UT3 B;  3IB7 A;  1W24 A;  3RL3 A;  1II7 A;  1U32 A;  3H64 A;  1XZW A;  4MOV A;  4LTY A;  4ORC A;  1S3L A;  3THO B;  4DHL A;  3P71 C;  2O8A A;  3AUZ A;  1MF8 A;  3CK2 A;  4O43 A;  2WDD A;  5JPE A;  1S8E A;  3THN A;  3RL5 A;  3H63 A;  2KKN A;  1JK7 A;  4J6O A;  4H2F A;  3C9F A;  2BQ8 X;  3H68 A;  2GJU A;  4DT2 A;  2HY1 A;  2NYM C;  4KBP A;  2DFJ A;  5HPE A;  2P6B A;  1UTE A;  4WWL A;  2WDC A;  3TGH A;  3FGA C;  2O8G A;  2QFP A;  4F0Z A;  4ORB A;  4I5N C;  3H67 A;  1QHW A;  1FJM A;  2XMO A;  3ZU0 A;  2NXF A;  1OI8 A;  1T71 A;  2YVT A;  4B2O A;  3GVE A;  3LL8 A;  4O24 A;  2Z06 A;  4IYP C;  2DXN A;  2R17 A;  4M0V A;  4V0V A;  2IAE C;  5J28 A;  4FCX A;  4ZVZ A;  2NYL C;  3K7W C;  3KBP A;  4H2G A;  3PSO A;  1S3N A;  3QFN A;  3AV0 A;  3K7V C;  4FBK A;  3N5U A;  4YKE A;  1SU1 A;  4V0X A;  3V4Y A;  4UT3 A;  3H66 A;  1USH A;  4KKZ A;  1V73 A;  2ZBM A;  1TCO A;  3E7B A;  3E7A A;  2ZOA A;  5C1V A;  3C5W C;  1UF3 A;  1S70 A;  3QG5 C;  3D03 A;  4O5G A;  3DSD A;  3QFM A;  1S95 A;  1G5B A;  2HYP A;  4FBW A; 
#chains in the Genus database with same CATH homology
 1Z2X A;  2Q8U A;  1HPU A;  5B8I A;  1QFC A;  4TUG A;  3QFK A;  4OR9 A;  3IB8 A;  1HP1 A;  3IVE A;  2WDF A;  4LAC C;  3JYF A;  4G9J A;  4JA7 A;  4UT2 A;  3T1I A;  2HYO A;  4FBQ A;  4UWQ A;  5JPF A;  2QJC A;  1OIE A;  1T70 A;  1Z2W A;  3EGG A;  3H60 A;  4LU9 A;  2USH A;  3QFO A;  3DSC A;  4H1Y P;  3RQZ A;  4IL1 A;  5F3W A;  3H62 B;  4I5L C;  2DXL A;  2YEQ A;  4H2B A;  1IT6 A;  5GTU A;  2BCD A;  2NPP C;  2A22 A;  2IE3 C;  5EQV A;  4HD0 A;  4H2I A;  1KBP A;  4MP0 A;  4NZV A;  1NNW A;  4ORA A;  4H1S A;  2WDE A;  4V0W A;  3DW8 C;  5INB A;  2Z1A A;  4DSY A;  4ZX2 A;  1OID A;  3H61 A;  3H69 A;  2CV9 A;  2QFR A;  1AUI A;  1S3M A;  3ZTV A;  5IOH A;  3FLO A;  5JJT A;  3E0J A;  3HVQ A;  1XM7 A;  4O4K A;  2IE4 C;  1WAR A;  2Z72 A;  4Q7F A;  3PSN A;  3RL4 A;  3IVD A;  1WAO 1;  4XPN A;  5DNY A;  2ZO9 B;  3EGH A;  1HO5 A;  4JA9 A;  4MOY A;  3ICF A;  2AHD A;  4TUI A;  1M63 A;  2BDX A;  2JOG A;  4UT3 B;  3IB7 A;  1W24 A;  3RL3 A;  1II7 A;  1U32 A;  3H64 A;  1XZW A;  4MOV A;  4LTY A;  4ORC A;  1S3L A;  3THO B;  4DHL A;  3P71 C;  2O8A A;  3AUZ A;  1MF8 A;  3CK2 A;  4O43 A;  2WDD A;  5JPE A;  1S8E A;  3THN A;  3RL5 A;  3H63 A;  2KKN A;  1JK7 A;  4J6O A;  4H2F A;  3C9F A;  2BQ8 X;  3H68 A;  2GJU A;  4DT2 A;  2HY1 A;  2NYM C;  4KBP A;  2DFJ A;  5HPE A;  2P6B A;  1UTE A;  4WWL A;  2WDC A;  3TGH A;  3FGA C;  2O8G A;  2QFP A;  4F0Z A;  4ORB A;  4I5N C;  3H67 A;  1QHW A;  1FJM A;  2XMO A;  3ZU0 A;  2NXF A;  1OI8 A;  1T71 A;  2YVT A;  4B2O A;  3GVE A;  3LL8 A;  4O24 A;  2Z06 A;  4IYP C;  2DXN A;  2R17 A;  4M0V A;  4V0V A;  2IAE C;  5J28 A;  4FCX A;  4ZVZ A;  2NYL C;  3K7W C;  3KBP A;  4H2G A;  3PSO A;  1S3N A;  3QFN A;  3AV0 A;  3K7V C;  4FBK A;  3N5U A;  4YKE A;  1SU1 A;  4V0X A;  3V4Y A;  4UT3 A;  3H66 A;  1USH A;  4KKZ A;  1V73 A;  2ZBM A;  1TCO A;  3E7B A;  3E7A A;  2ZOA A;  5C1V A;  3C5W C;  1UF3 A;  1S70 A;  3QG5 C;  3D03 A;  4O5G A;  3DSD A;  3QFM A;  1S95 A;  1G5B A;  2HYP A;  4FBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...