5EQVA

1.45 angstrom crystal structure of bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein from yersinia pestis with phosphate bound to the active site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
336
structure length
336
Chain Sequence
AATVDLRVLETTDLHSNMMDFDYYKDKPTEKFGLVRTASLIIAARQQATNSVLVDNGDVIQGSPLGDYIAAKGLNDGEIHPVYKAMNTLDYAVGNIGNHEFNYGLDYLKKSLAGAKFPYVNANVIDVKTGKPLFQPYLIIDTPVKDRDGKSHNLRIGYIGFVPPQVMIWDKANLSGKVTVNDITETAKKWVPEMREQGADLVVAIPHSGLSSDPYKTMAENSVYYLSQVPGIDAIMFGHAHGVFPSKDFAAIKGADITQGTLNGIPAVMPGQWGDHLGVVDFVLNNDQGKWQVIDAKAEARPIYDKTAQKSLAAENAKLVEVLAVDHQSTRDFVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'
publication title 1.45 Angstrom Crystal Structure of Bifunctional 2',3'-cyclic Nucleotide 2'-phosphodiesterase/3'-Nucleotidase Periplasmic Precursor Protein from Yersinia pestis with Phosphate bound to the Active site.
rcsb
source organism Yersinia pestis co92
total genus 111
structure length 336
sequence length 336
ec nomenclature ec 3.1.4.16: 2',3'-cyclic-nucleotide 2'-phosphodiesterase.
pdb deposition date 2015-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 5eqvA00
4M0VA 2WDEA 4I5LC 3EGHA 3IVEA 2WDDA 1S8EA 4IL1A 1WARA 4XPNA 3QG5C 3JYFA 1SU1A 2BCDA 3EGGA 4B2OA 3QFNA 4Q7FA 3H66A 3H63A 4G9JA 3H68A 1OIEA 3AV0A 2WDCA 4FBKA 2R17A 1UTEA 2A22A 2O8AA 3QFMA 1HPUA 2ZBMA 3RL5A 1JK7A 5IOHA 3IB7A 2O8GA 3AUZA 2P6BA 2QJCA 5DNYA 1V73A 2NXFA 3C9FA 4MP0A 5JJTA 1S3NA 1II7A 3IB8A 3P71C 4HD0A 3RL3A 3LL8A 4WWLA 1TCOA 2BQ8X 3E7AA 2Z1AA 3K7VC 1G5BA 3E7BA 2NPPC 3H62B 2XMOA 2WDFA 4ORBA 3H67A 4O43A 1IT6A 1XM7A 1M63A 2KKNA 3N5UA 3HVQA 1QHWA 4FBQA 4TUGA 4UT3A 3GVEA 5JPFA 4DSYA 4O24A 1NNWA 4H2FA 1OIDA 3RL4A 4NZVA 2QFRA 1USHA 2HY1A 4UT2A 4H2IA 4MOVA 3DSCA 3TGHA 3THOB 4ORCA 1T70A 2USHA 1Z2WA 5F3WA 3QFKA 3H69A 4TUIA 3THNA 3T1IA 5HPEA 4FCXA 3DSDA 3QFOA 2GJUA 3IVDA 1Z2XA 4H1SA 2Z72A 4FBWA 1U32A 1XZWA 2YVTA 1MF8A 3H61A 4V0WA 3V4YA 4O4KA 4LACC 4H2BA 3ZU0A 1S3LA 3DW8C 2IAEC 3H64A 4J6OA 2Z06A 4JA9A 4KBPA 4V0XA 2NYMC 4F0ZA 3KBPA 2IE4C 3ICFA 4MOYA 5EQVA 4DT2A 2Q8UA 5B8IA 4UT3B 1S3MA 4YKEA 4IYPC 1W24A 1T71A 2HYPA 2CV9A 3RQZA 3FGAC 4H1YP 2NYLC 2HYOA 4H2GA 3PSOA 4KKZA 3K7WC 2QFPA 1QFCA 4ORAA 2IE3C 1UF3A 4ZX2A 3C5WC 3PSNA 4JA7A 5C1VA 1OI8A 3ZTVA 5J28A 1S70A 3CK2A 4O5GA 1HP1A 1FJMA 2AHDA 4ZVZA 4V0VA 2DFJA 2JOGA 1WAO1 2BDXA 1KBPA 4I5NC 4LU9A 5GTUA 1HO5A 1S95A 1AUIA 5JPEA 4DHLA 4LTYA 5INBA 4UWQA 3H60A 4OR9A
chains in the Genus database with same CATH superfamily
4M0VA 2WDEA 4I5LC 3EGHA 3IVEA 2WDDA 1S8EA 4IL1A 1WARA 4XPNA 3QG5C 3JYFA 1SU1A 2BCDA 3EGGA 4B2OA 2ZO9B 3QFNA 4Q7FA 3H66A 3H63A 4G9JA 3H68A 1OIEA 3AV0A 2WDCA 3E0JA 3V4YA 4FBKA 2R17A 1UTEA 2A22A 2O8AA 3D03A 3QFMA 1HPUA 2ZBMA 3RL5A 1JK7A 5IOHA 3IB7A 2O8GA 3AUZA 2P6BA 2QJCA 5DNYA 3FLOA 1V73A 2NXFA 3C9FA 4MP0A 5JJTA 1S3NA 1II7A 3IB8A 3P71C 4HD0A 3RL3A 3LL8A 4WWLA 1TCOA 2BQ8X 3E7AA 2Z1AA 3K7VC 1G5BA 3E7BA 2NPPC 3H62B 2XMOA 2WDFA 4ORBA 3H67A 4O43A 1IT6A 1XM7A 1M63A 2KKNA 3N5UA 3HVQA 1QHWA 4FBQA 4TUGA 4UT3A 3GVEA 5JPFA 4DSYA 4O24A 1NNWA 4H2FA 1OIDA 3RL4A 4NZVA 2QFRA 1USHA 2HY1A 4UT2A 4H2IA 4MOVA 3DSCA 3TGHA 3THOB 2DXLA 4ORCA 1T70A 2USHA 1Z2WA 5F3WA 3QFKA 3H69A 4TUIA 3THNA 3T1IA 5HPEA 4FCXA 3DSDA 3QFOA 2GJUA 3IVDA 1Z2XA 4H1SA 2Z72A 4FBWA 1U32A 1XZWA 2YEQA 1MF8A 2YVTA 3H61A 4V0WA 4O4KA 4LACC 4H2BA 3ZU0A 1S3LA 3DW8C 2IAEC 3H64A 4J6OA 2Z06A 4JA9A 4KBPA 4V0XA 2NYMC 4F0ZA 3KBPA 2IE4C 3ICFA 4MOYA 5EQVA 4DT2A 2Q8UA 5B8IA 4UT3B 1S3MA 2ZOAA 4YKEA 4IYPC 1W24A 1T71A 2HYPA 2CV9A 3RQZA 3FGAC 4H1YP 2NYLC 2HYOA 4H2GA 3PSOA 4KKZA 3K7WC 2QFPA 1QFCA 4ORAA 2IE3C 2DXNA 1UF3A 4ZX2A 3C5WC 3PSNA 4JA7A 5C1VA 1OI8A 3ZTVA 5J28A 1S70A 3CK2A 4O5GA 1HP1A 1FJMA 2AHDA 4ZVZA 4V0VA 2DFJA 2JOGA 1WAO1 2BDXA 1KBPA 4I5NC 4LU9A 5GTUA 1HO5A 1S95A 1AUIA 5JPEA 4DHLA 4LTYA 5INBA 4UWQA 3H60A 4OR9A
chains in the Genus database with same CATH topology
4M0VA 2WDEA 4I5LC 3EGHA 3IVEA 2WDDA 1S8EA 4IL1A 1WARA 4XPNA 3QG5C 3JYFA 1SU1A 2BCDA 3EGGA 4B2OA 2ZO9B 3QFNA 4Q7FA 3H66A 3H63A 4G9JA 3H68A 1OIEA 3AV0A 2WDCA 3E0JA 3V4YA 4FBKA 2R17A 1UTEA 2A22A 2O8AA 3D03A 3QFMA 1HPUA 2ZBMA 3RL5A 1JK7A 5IOHA 3IB7A 2O8GA 3AUZA 2P6BA 2QJCA 5DNYA 3FLOA 1V73A 2NXFA 3C9FA 4MP0A 5JJTA 1S3NA 1II7A 3IB8A 3P71C 4HD0A 3RL3A 3LL8A 4WWLA 1TCOA 2BQ8X 3E7AA 2Z1AA 3K7VC 1G5BA 3E7BA 2NPPC 3H62B 2XMOA 2WDFA 4ORBA 3H67A 4O43A 1IT6A 1XM7A 1M63A 2KKNA 3N5UA 3HVQA 1QHWA 4FBQA 4TUGA 4UT3A 3GVEA 5JPFA 4DSYA 4O24A 1NNWA 4H2FA 1OIDA 3RL4A 4NZVA 2QFRA 1USHA 2HY1A 4UT2A 4H2IA 4MOVA 3DSCA 3TGHA 3THOB 2DXLA 4ORCA 1T70A 2USHA 1Z2WA 5F3WA 3QFKA 3H69A 4TUIA 3THNA 3T1IA 5HPEA 4FCXA 3DSDA 3QFOA 2GJUA 3IVDA 1Z2XA 4H1SA 2Z72A 4FBWA 1U32A 1XZWA 2YEQA 1MF8A 2YVTA 3H61A 4V0WA 4O4KA 4LACC 4H2BA 3ZU0A 1S3LA 3DW8C 2IAEC 3H64A 4J6OA 2Z06A 4JA9A 4KBPA 4V0XA 2NYMC 4F0ZA 3KBPA 2IE4C 3ICFA 4MOYA 5EQVA 4DT2A 2Q8UA 5B8IA 4UT3B 1S3MA 2ZOAA 4YKEA 4IYPC 1W24A 1T71A 2HYPA 2CV9A 3RQZA 3FGAC 4H1YP 2NYLC 2HYOA 4H2GA 3PSOA 4KKZA 3K7WC 2QFPA 1QFCA 4ORAA 2IE3C 2DXNA 1UF3A 4ZX2A 3C5WC 3PSNA 4JA7A 5C1VA 1OI8A 3ZTVA 5J28A 1S70A 3CK2A 4O5GA 1HP1A 1FJMA 2AHDA 4ZVZA 4V0VA 2DFJA 2JOGA 1WAO1 2BDXA 1KBPA 4I5NC 4LU9A 5GTUA 1HO5A 1S95A 1AUIA 5JPEA 4DHLA 4LTYA 5INBA 4UWQA 3H60A 4OR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M0V A;  2WDE A;  4I5L C;  3EGH A;  3IVE A;  2WDD A;  1S8E A;  4IL1 A;  1WAR A;  4XPN A;  3QG5 C;  3JYF A;  1SU1 A;  2BCD A;  3EGG A;  4B2O A;  3QFN A;  4Q7F A;  3H66 A;  3H63 A;  4G9J A;  3H68 A;  1OIE A;  3AV0 A;  2WDC A;  4FBK A;  2R17 A;  1UTE A;  2A22 A;  2O8A A;  3QFM A;  1HPU A;  2ZBM A;  3RL5 A;  1JK7 A;  5IOH A;  3IB7 A;  2O8G A;  3AUZ A;  2P6B A;  2QJC A;  5DNY A;  1V73 A;  2NXF A;  3C9F A;  4MP0 A;  5JJT A;  1S3N A;  1II7 A;  3IB8 A;  3P71 C;  4HD0 A;  3RL3 A;  3LL8 A;  4WWL A;  1TCO A;  2BQ8 X;  3E7A A;  2Z1A A;  3K7V C;  1G5B A;  3E7B A;  2NPP C;  3H62 B;  2XMO A;  2WDF A;  4ORB A;  3H67 A;  4O43 A;  1IT6 A;  1XM7 A;  1M63 A;  2KKN A;  3N5U A;  3HVQ A;  1QHW A;  4FBQ A;  4TUG A;  4UT3 A;  3GVE A;  5JPF A;  4DSY A;  4O24 A;  1NNW A;  4H2F A;  1OID A;  3RL4 A;  4NZV A;  2QFR A;  1USH A;  2HY1 A;  4UT2 A;  4H2I A;  4MOV A;  3DSC A;  3TGH A;  3THO B;  4ORC A;  1T70 A;  2USH A;  1Z2W A;  5F3W A;  3QFK A;  3H69 A;  4TUI A;  3THN A;  3T1I A;  5HPE A;  4FCX A;  3DSD A;  3QFO A;  2GJU A;  3IVD A;  1Z2X A;  4H1S A;  2Z72 A;  4FBW A;  1U32 A;  1XZW A;  2YVT A;  1MF8 A;  3H61 A;  4V0W A;  3V4Y A;  4O4K A;  4LAC C;  4H2B A;  3ZU0 A;  1S3L A;  3DW8 C;  2IAE C;  3H64 A;  4J6O A;  2Z06 A;  4JA9 A;  4KBP A;  4V0X A;  2NYM C;  4F0Z A;  3KBP A;  2IE4 C;  3ICF A;  4MOY A;  5EQV A;  4DT2 A;  2Q8U A;  5B8I A;  4UT3 B;  1S3M A;  4YKE A;  4IYP C;  1W24 A;  1T71 A;  2HYP A;  2CV9 A;  3RQZ A;  3FGA C;  4H1Y P;  2NYL C;  2HYO A;  4H2G A;  3PSO A;  4KKZ A;  3K7W C;  2QFP A;  1QFC A;  4ORA A;  2IE3 C;  1UF3 A;  4ZX2 A;  3C5W C;  3PSN A;  4JA7 A;  5C1V A;  1OI8 A;  3ZTV A;  5J28 A;  1S70 A;  3CK2 A;  4O5G A;  1HP1 A;  1FJM A;  2AHD A;  4ZVZ A;  4V0V A;  2DFJ A;  2JOG A;  1WAO 1;  2BDX A;  1KBP A;  4I5N C;  4LU9 A;  5GTU A;  1HO5 A;  1S95 A;  1AUI A;  5JPE A;  4DHL A;  4LTY A;  5INB A;  4UWQ A;  3H60 A;  4OR9 A; 
#chains in the Genus database with same CATH topology
 4M0V A;  2WDE A;  4I5L C;  3EGH A;  3IVE A;  2WDD A;  1S8E A;  4IL1 A;  1WAR A;  4XPN A;  3QG5 C;  3JYF A;  1SU1 A;  2BCD A;  3EGG A;  4B2O A;  2ZO9 B;  3QFN A;  4Q7F A;  3H66 A;  3H63 A;  4G9J A;  3H68 A;  1OIE A;  3AV0 A;  2WDC A;  3E0J A;  3V4Y A;  4FBK A;  2R17 A;  1UTE A;  2A22 A;  2O8A A;  3D03 A;  3QFM A;  1HPU A;  2ZBM A;  3RL5 A;  1JK7 A;  5IOH A;  3IB7 A;  2O8G A;  3AUZ A;  2P6B A;  2QJC A;  5DNY A;  3FLO A;  1V73 A;  2NXF A;  3C9F A;  4MP0 A;  5JJT A;  1S3N A;  1II7 A;  3IB8 A;  3P71 C;  4HD0 A;  3RL3 A;  3LL8 A;  4WWL A;  1TCO A;  2BQ8 X;  3E7A A;  2Z1A A;  3K7V C;  1G5B A;  3E7B A;  2NPP C;  3H62 B;  2XMO A;  2WDF A;  4ORB A;  3H67 A;  4O43 A;  1IT6 A;  1XM7 A;  1M63 A;  2KKN A;  3N5U A;  3HVQ A;  1QHW A;  4FBQ A;  4TUG A;  4UT3 A;  3GVE A;  5JPF A;  4DSY A;  4O24 A;  1NNW A;  4H2F A;  1OID A;  3RL4 A;  4NZV A;  2QFR A;  1USH A;  2HY1 A;  4UT2 A;  4H2I A;  4MOV A;  3DSC A;  3TGH A;  3THO B;  2DXL A;  4ORC A;  1T70 A;  2USH A;  1Z2W A;  5F3W A;  3QFK A;  3H69 A;  4TUI A;  3THN A;  3T1I A;  5HPE A;  4FCX A;  3DSD A;  3QFO A;  2GJU A;  3IVD A;  1Z2X A;  4H1S A;  2Z72 A;  4FBW A;  1U32 A;  1XZW A;  2YEQ A;  1MF8 A;  2YVT A;  3H61 A;  4V0W A;  4O4K A;  4LAC C;  4H2B A;  3ZU0 A;  1S3L A;  3DW8 C;  2IAE C;  3H64 A;  4J6O A;  2Z06 A;  4JA9 A;  4KBP A;  4V0X A;  2NYM C;  4F0Z A;  3KBP A;  2IE4 C;  3ICF A;  4MOY A;  5EQV A;  4DT2 A;  2Q8U A;  5B8I A;  4UT3 B;  1S3M A;  2ZOA A;  4YKE A;  4IYP C;  1W24 A;  1T71 A;  2HYP A;  2CV9 A;  3RQZ A;  3FGA C;  4H1Y P;  2NYL C;  2HYO A;  4H2G A;  3PSO A;  4KKZ A;  3K7W C;  2QFP A;  1QFC A;  4ORA A;  2IE3 C;  2DXN A;  1UF3 A;  4ZX2 A;  3C5W C;  3PSN A;  4JA7 A;  5C1V A;  1OI8 A;  3ZTV A;  5J28 A;  1S70 A;  3CK2 A;  4O5G A;  1HP1 A;  1FJM A;  2AHD A;  4ZVZ A;  4V0V A;  2DFJ A;  2JOG A;  1WAO 1;  2BDX A;  1KBP A;  4I5N C;  4LU9 A;  5GTU A;  1HO5 A;  1S95 A;  1AUI A;  5JPE A;  4DHL A;  4LTY A;  5INB A;  4UWQ A;  3H60 A;  4OR9 A; 
#chains in the Genus database with same CATH homology
 4M0V A;  2WDE A;  4I5L C;  3EGH A;  3IVE A;  2WDD A;  1S8E A;  4IL1 A;  1WAR A;  4XPN A;  3QG5 C;  3JYF A;  1SU1 A;  2BCD A;  3EGG A;  4B2O A;  2ZO9 B;  3QFN A;  4Q7F A;  3H66 A;  3H63 A;  4G9J A;  3H68 A;  1OIE A;  3AV0 A;  2WDC A;  3E0J A;  3V4Y A;  4FBK A;  2R17 A;  1UTE A;  2A22 A;  2O8A A;  3D03 A;  3QFM A;  1HPU A;  2ZBM A;  3RL5 A;  1JK7 A;  5IOH A;  3IB7 A;  2O8G A;  3AUZ A;  2P6B A;  2QJC A;  5DNY A;  3FLO A;  1V73 A;  2NXF A;  3C9F A;  4MP0 A;  5JJT A;  1S3N A;  1II7 A;  3IB8 A;  3P71 C;  4HD0 A;  3RL3 A;  3LL8 A;  4WWL A;  1TCO A;  2BQ8 X;  3E7A A;  2Z1A A;  3K7V C;  1G5B A;  3E7B A;  2NPP C;  3H62 B;  2XMO A;  2WDF A;  4ORB A;  3H67 A;  4O43 A;  1IT6 A;  1XM7 A;  1M63 A;  2KKN A;  3N5U A;  3HVQ A;  1QHW A;  4FBQ A;  4TUG A;  4UT3 A;  3GVE A;  5JPF A;  4DSY A;  4O24 A;  1NNW A;  4H2F A;  1OID A;  3RL4 A;  4NZV A;  2QFR A;  1USH A;  2HY1 A;  4UT2 A;  4H2I A;  4MOV A;  3DSC A;  3TGH A;  3THO B;  2DXL A;  4ORC A;  1T70 A;  2USH A;  1Z2W A;  5F3W A;  3QFK A;  3H69 A;  4TUI A;  3THN A;  3T1I A;  5HPE A;  4FCX A;  3DSD A;  3QFO A;  2GJU A;  3IVD A;  1Z2X A;  4H1S A;  2Z72 A;  4FBW A;  1U32 A;  1XZW A;  2YEQ A;  1MF8 A;  2YVT A;  3H61 A;  4V0W A;  4O4K A;  4LAC C;  4H2B A;  3ZU0 A;  1S3L A;  3DW8 C;  2IAE C;  3H64 A;  4J6O A;  2Z06 A;  4JA9 A;  4KBP A;  4V0X A;  2NYM C;  4F0Z A;  3KBP A;  2IE4 C;  3ICF A;  4MOY A;  5EQV A;  4DT2 A;  2Q8U A;  5B8I A;  4UT3 B;  1S3M A;  2ZOA A;  4YKE A;  4IYP C;  1W24 A;  1T71 A;  2HYP A;  2CV9 A;  3RQZ A;  3FGA C;  4H1Y P;  2NYL C;  2HYO A;  4H2G A;  3PSO A;  4KKZ A;  3K7W C;  2QFP A;  1QFC A;  4ORA A;  2IE3 C;  2DXN A;  1UF3 A;  4ZX2 A;  3C5W C;  3PSN A;  4JA7 A;  5C1V A;  1OI8 A;  3ZTV A;  5J28 A;  1S70 A;  3CK2 A;  4O5G A;  1HP1 A;  1FJM A;  2AHD A;  4ZVZ A;  4V0V A;  2DFJ A;  2JOG A;  1WAO 1;  2BDX A;  1KBP A;  4I5N C;  4LU9 A;  5GTU A;  1HO5 A;  1S95 A;  1AUI A;  5JPE A;  4DHL A;  4LTY A;  5INB A;  4UWQ A;  3H60 A;  4OR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...