4O5GA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 102
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o5gA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o5gA01
1XM7A 3K7WC 4TUGA 2BQ8X 1WAO1 3THOB 4MOYA 4ORBA 2IE4C 4V0VA 1USHA 2Z06A 4HD0A 3TGHA 1QFCA 3ICFA 3P71C 4F0ZA 2DFJA 4LU9A 3RQZA 3K7VC 1S3LA 5JJTA 3PSOA 1Z2WA 3QFNA 4B2OA 1S95A 4UT3A 1AUIA 1HO5A 4LTYA 1XZWA 4V0WA 1Z2XA 1IT6A 2HYPA 3H69A 4H2BA 4JA7A 3RL5A 5C1VA 4H2FA 4O43A 2NPPC 4I5NC 4ZX2A 1S3MA 1G5BA 3AV0A 3N5UA 5F3WA 4JA9A 2QJCA 3IVEA 3H62B 5JPEA 4NZVA 3AUZA 2R17A 3CK2A 4YKEA 4H1YP 2WDDA 4UWQA 4O24A 3H63A 1M63A 2P6BA 4FBWA 1S3NA 4WWLA 4ZVZA 5J28A 5INBA 4FCXA 4O5GA 3JYFA 4G9JA 1W24A 3RL4A 3ZU0A 3LL8A 2USHA 2QFPA 2ZBMA 2JOGA 1T70A 1OI8A 2WDEA 1UF3A 2KKNA 5GTUA 2CV9A 1JK7A 4V0XA 3QG5C 1HPUA 3DSDA 1FJMA 5DNYA 3THNA 4H2IA 1OIDA 4FBQA 2HYOA 4Q7FA 3H64A 2NXFA 2Z1AA 2BDXA 4XPNA 4M0VA 2GJUA 1V73A 3H68A 3RL3A 1S70A 4MOVA 4MP0A 3EGHA 2IAEC 4LACC 4DHLA 2Q8UA 3DW8C 2YVTA 2O8AA 3FGAC 1QHWA 2NYMC 3IB7A 1KBPA 4FBKA 2WDCA 4KBPA 2O8GA 3IVDA 4UT2A 2HY1A 3E7BA 2QFRA 1MF8A 1U32A 1WARA 5B8IA 2NYLC 2WDFA 3EGGA 2A22A 4IYPC 1SU1A 1S8EA 3C9FA 1HP1A 5IOHA 3H66A 4O4KA 3QFKA 4DSYA 1OIEA 3H61A 3PSNA 3HVQA 3T1IA 1II7A 2AHDA 4IL1A 4UT3B 2XMOA 3IB8A 4H1SA 4ORAA 3ZTVA 4TUIA 4OR9A 3KBPA 4ORCA 3H67A 3C5WC 3QFMA 3H60A 2IE3C 2Z72A 3V4YA 5JPFA 5HPEA 3QFOA 3DSCA 1T71A 4KKZA 4H2GA 2BCDA 4DT2A 3E7AA 5EQVA 4J6OA 1TCOA 1NNWA 3GVEA 4I5LC 1UTEA
chains in the Genus database with same CATH superfamily
3D03A 2FTXB 1XNQE 2BQ8X 4MOYA 5LMNE 1G2FC 2ELZA 4LFCE 4ORBA 2EMKA 4GEQB 3TGHA 2LTSA 2LTRA 2YPNA 4LU9A 3RQZA 1X49A 5JJTA 2ENHA 1GZ6A 4FK5C 4F6MA 2DRPA 2NABA 4LTYA 4LF5E 1XZWA 2LUQA 1Z2XA 2EM6A 1IT6A 5A6AA 4H2BA 2L3JA 5C1VA 1TF6A 4BHBA 4I5NC 4ZX2A 2PRTA 2VQFE 3VK6A 1N32E 2L2MA 2M1SA 2MDRA 1PJTA 1AH5A 4H1YP 4UWQA 4FBWA 4WWLA 2EM0A 1S3NA 3RL4A 1W24A 2YTOA 4R2PA 1A1JA 3BGHA 2USHA 4DV7E 2WBTA 2JOGA 1OI8A 2WDEA 2KHXA 2VE7C 2LV2A 4M2ZA 2V87A 1JK7A 2UXBE 2YSOA 1X6EA 3VYYA 1WXRA 2F4VE 2EPUA 1JK1A 2ZOAA 3IWDA 4Q28A 1WRJA 1DGCA 4X9JA 4XPNA 2LCEA 2GJUA 3H68A 3BF2A 4K0KE 4MOVA 2IAEC 3MHSC 1TF3A 3HPSA 5TSEA 2EP3A 3DW8C 1EKZA 1YFHA 3T1YE 4KZSA 2JWOA 5FLXC 4B3SE 2L2KB 2RS7A 2VF1A 4ZYHA 2WDCA 4JI7E 4R2CA 2DLQA 3IVDA 4OOGC 2YRHA 4X66E 1EH7A 4ZYEA 1U32A 2EN3A 1WARA 5B8IA 2EJ4A 1UN6B 4DR2E 2L8TA 4IYPC 3IWBA 2DMYA 2JP9A 3C9FA 2EMXA 1XMOE 5BR8E 3QFKA 1PDAA 2CSHA 3DJWA 4DKKA 2LT7A 4BC9A 4R2RA 2EPPA 2KONA 1NEIA 2EM9A 4TUIA 3KBPA 4R2EA 3H67A 4I8OA 3H60A 1NCSA 2Z72A 2N3GA 4GZNC 5A6BD 2EMCA 1T71A 4JI6E 4JI8E 2LE2A 4H2GA 2I13A 2EPRA 4DT2A 1ZR9A 3UK3C 1NNWA 1T39A 3GVEA 2EM4A 1IMUA 2LO3A 2EMWA 5KL2A 1FJGE 2ODRC 2K7IA 3EPKA 4WPYA 4V0VA 2LBSB 2EPKX 2EOOA 4HD0A 1TN9A 1DI2A 2UUAE 2DFJA 1O0WA 3VYXA 1G2DC 2JR1A 1A1HA 2M7QA 3PSOA 5A69A 1Z2WA 3QFNA 1HO5A 2WCC3 2IHR1 3EPHA 5AE1A 1L4SA 2G7HA 4DV3E 3H69A 3RL5A 4L8NA 4DR3E 2DMIA 2EM2A 4O43A 2NPPC 5AC4A 2YTPA 3M99B 1S3MA 2EM7A 3N5UA 2WZOA 4JA9A 2YTEA 2EM3A 2QJCA 3IVEA 2RTXA 4NZVA 2CPNA 4ZYDA 3AUZA 2R17A 3CK2A 2J7JA 2L6MA 4O24A 3ADIA 1ZBQA 5IT9C 1M63A 1ZU1A 1EH8A 4DV6E 2UU9E 4O5GA 4FCXA 1AAYA 2EPAA 2V88A 4F9AB 2EN1A 4DR1E 1B69A 4P78A 3HPZA 2EPMX 1X47A 2ZBMA 1UF3A 5GTUA 4LF8E 2EMHA 4DMIA 2MKDA 5IXMB 3EPJA 4B3ME 1HPUA 4DUZE 1A1FA 2EMBA 1A1KA 3OMLA 2EPCA 3JAMC 1SFEA 2CT1A 3THNA 4M9VC 1A1GA 2NXFA 2Z1AA 2JYAA 1HNZE 2UUCE 1IBKE 4LF6E 2EN7A 2HJJA 1X6FA 4WXDA 4MP0A 3EGHA 4LACC 2EL4A 4BHCA 4DV1E 2EOEA 1UBDC 4JYAE 2HGHA 4LF7E 1YZ9A 3FGAC 2LJUA 1YYWA 5AE2A 4X65E 1IBLE 4IJDA 5A6BA 4FBKA 5KL7A 2YSPA 4P7DA 1YYOA 3C6MA 4F6NA 3F6HA 1A1LA 1WJPA 2GHFA 2GLIA 2NYLC 2LVHA 3H09A 2A22A 1SU1A 1N3GA 4KHPE 1YUIA 1S8EA 5IOHA 2UXDE 1UHZA 2EL6A 3H66A 2ZM6E 2L33A 2JPAA 2YTQA 3PSNA 1X6HA 4IL1A 4LF9E 3IB8A 3BIDA 4ORAA 4MLQA 3HXLA 2L2NA 2EMAA 2EMLA 2MC5A 3C6KA 4JI4E 2IE3C 2B3TB 4DR6E 3V4YA 2DIXA 2JVAA 3QFOA 2YTNA 2CTDA 4MLVA 2EZ6A 4KKZA 3HQ1A 1T4OA 3DF6A 2DSYA 3ZOQB 2LJHA 4DV2E 2UXCE 2EPXA 2HC5A 3K7WC 1QU6A 4JI5E 3EPLA 2IE4C 3C4BA 2Z06A 4OX9E 3ICFA 3P71C 4F0ZA 1WHNA 2RS6A 2YTDA 2ENCA 5AE3A 3E0JA 2N8XA 3K7VC 1UILA 4RH8A 4B2OA 2EPNA 4DV4E 4BBYA 1S95A 3MSWA 4V0WA 2EN6A 2YTJA 4X64E 4GKKE 1X3CA 1MGTA 4GKJE 4H2FA 2YRKA 1G5BA 5F3WA 4JV5E 3J7Yp 2MKNA 5JPEA 3H63A 4ZVZA 2V86A 2YEQA 5INBA 2F8BA 1YSAC 2K4VA 4BS9A 5A2QC 3LL8A 2EOXA 2QFPA 2B7TA 3L00A 1T70A 2EPLX 4LFAE 2YTGA 2KKNA 1F2IG 2EQ1A 3QG5C 2DB2A 1EH6A 2VRDA 4YHHE 2YTFA 4WYQB 2H36X 5DNYA 5LMUE 4BC7A 2ODRD 3JTZA 2NUGA 2HYOA 3H64A 3J7AG 4M0VA 3RL3A 4JI1E 4LFBE 1S70A 2DXLA 5IV8B 4WSPA 2YU8A 2Q8UA 4LF4E 2RSIA 2EMYA 3VHTB 2EOFA 3ADJA 2EMZA 2EOIA 2N3HA 1JK2A 2LMZA 4F54A 1IQOA 2YVTA 2O8AA 2BBGA 4Q35B 1T4LB 1QHWA 2NYMC 2YZTA 1HR0E 4F2JC 4JI2E 4R2DA 2NUEA 5T6JA 1KBPA 1RQ0A 3K6QA 4DR7E 2EN2A 4L5NC 3TQMA 2YU5A 4NXNE 4KBPA 2ZO9B 2O8GA 4UT2A 1BBOA 1KJKA 2HY1A 2V83A 2JY9A 3E7BA 5KL3A 3ADGA 1MF8A 2EPOA 4ZYGA 4R2SA 2WDFA 2KOUA 1DQ3A 2EMGA 1HP1A 4O4KA 4DSYA 1GTKA 3FIGA 2MDGA 2I9IA 3EQ1A 3HVQA 2ADRA 2AHDA 4UT3B 4H1SA 2JXPA 2EWLA 1N34E 2DGCA 4ORCA 1ZBTA 3KZYA 1Z1BA 1YYKA 2M4IA 3QFMA 4WXCA 1I94E 4NXME 1QNTA 3RMPA 1GQEA 5JPFA 4KWYA 4R2QA 4N4RB 4DV0E 4DV5E 5LLQA 2YWQA 3T1HE 2YT4A 2JOXA 1J5EE 3E7AA 3F6GA 4J6OA 3HTXA 1TCOA 3J81C 1UTEA 2EOMA 3KWRA 4TUGA 4NHRA 1XNRE 1XM7A 1WAO1 3THOB 1RC7A 1STUA 5A6JA 3ADLA 1USHA 2R1FA 4HTGA 4BCAA 1QFCA 4WX9A 1PKPA 3P1XA 2L3CA 1S3LA 2ENAA 3KZZA 2EQ3A 4UT3A 1AUIA 2RQLA 2EPZA 4RHBB 2HYPA 4JA7A 2EOYA 2YRMA 4DR4E 5AC5A 1N36E 3AV0A 2L92A 2EN8A 2LRSA 2ELYA 4DR5E 2M9AA 2LUPB 2EE8A 3H62B 2B7VA 3J80C 4JI3E 4YKEA 2WDDA 3BBGA 2V8QB 2D9HA 1X48A 5KL4A 3JU0A 2P6BA 2MC6A 5J28A 3LMLA 1P47A 4G9JA 3ZU0A 1X5WA 2EORA 4J8ZA 1N33E 2R76A 2YTIA 2NUFA 5KL6A 2EOQA 1LLMC 4B3RE 3ECRA 2CV9A 3OTOE 4V0XA 4BMJA 3DSDA 1FJMA 5KL5A 4DUYE 2WBUA 1FKAE 1HNWE 1WHQA 2EN4A 2EM5A 1PJSA 4H2IA 1OIDA 4FBQA 5ADZA 2RPCA 4Q7FA 2BDXA 1V73A 2NA2A 2E1MA 1ZAAC 1IBME 1BB8A 1RMDA 4DHLA 2EMFA 3IWCA 2EL5A 2A25A 3LLHA 1J26A 4AQYE 3IB7A 2EOHA 2B9DA 3FLOA 4F9BB 2DXNA 4JI0E 4R2AA 2EOJA 3C4TA 1IQSA 2EOZA 2QFRA 4R03A 5IWAE 1SR9A 2HHHE 5A6KA 3EGGA 4X8WA 2FGGA 2DLKA 2E5LE 1MEYC 2RSMA 2UUBE 1T4NA 2EQ0A 4IS1C 5AASA 2WBSA 2EMIA 4YY3E 1OIEA 1PJQA 3H61A 1A1IA 3T1IA 4WFTA 2EOSA 1II7A 4M30A 5LL6R 2XMOA 4F9CB 4HEIA 3ZTVA 4OR9A 1YPNA 2VQEE 1T38A 3MHHC 1XMQE 2EM8A 3C5WC 2V89A 2JOBA 1BBGA 4X62E 2FV4B 5CFFE 4R8OA 1HNXE 4B3TE 5HPEA 2E72A 2V85A 1YUJA 3DSCA 2BB8A 2BCDA 5EQVA 1KYQA 2GPIA 3JYFA 4I5LC 4WSGA
chains in the Genus database with same CATH topology
1XM7A 3D03A 3K7WC 4TUGA 2BQ8X 1WAO1 3THOB 4MOYA 4ORBA 2IE4C 4V0VA 1USHA 2Z06A 4HD0A 3TGHA 1QFCA 3ICFA 3P71C 4F0ZA 2DFJA 4LU9A 3RQZA 3E0JA 3K7VC 1S3LA 5JJTA 3PSOA 1Z2WA 3QFNA 4B2OA 1S95A 4UT3A 1AUIA 1HO5A 4LTYA 1XZWA 4V0WA 1Z2XA 1IT6A 2HYPA 3H69A 4H2BA 4JA7A 3RL5A 5C1VA 4H2FA 4O43A 2NPPC 4I5NC 4ZX2A 1S3MA 1G5BA 3AV0A 3N5UA 5F3WA 4JA9A 2QJCA 3IVEA 3H62B 5JPEA 4NZVA 3AUZA 2R17A 3CK2A 4YKEA 4H1YP 2WDDA 4UWQA 4O24A 3H63A 1M63A 2P6BA 4FBWA 1S3NA 4WWLA 4ZVZA 2YEQA 5J28A 5INBA 4FCXA 4O5GA 3JYFA 4G9JA 1W24A 3RL4A 3ZU0A 3LL8A 2USHA 2QFPA 2ZBMA 2JOGA 1T70A 1OI8A 2WDEA 1UF3A 2KKNA 5GTUA 2CV9A 1JK7A 4V0XA 3QG5C 1HPUA 3DSDA 1FJMA 5DNYA 3THNA 4H2IA 1OIDA 4FBQA 2HYOA 2ZOAA 3H64A 4Q7FA 2NXFA 2Z1AA 2BDXA 4XPNA 4M0VA 2GJUA 1V73A 3H68A 3RL3A 1S70A 2DXLA 4MOVA 4MP0A 3EGHA 2IAEC 4LACC 4DHLA 2Q8UA 3DW8C 2YVTA 2O8AA 3FGAC 1QHWA 2NYMC 3IB7A 1KBPA 3FLOA 4FBKA 2WDCA 2DXNA 4KBPA 2ZO9B 2O8GA 3IVDA 4UT2A 2HY1A 3E7BA 2QFRA 1MF8A 1U32A 1WARA 5B8IA 2NYLC 2WDFA 3EGGA 2A22A 4IYPC 1SU1A 1S8EA 3C9FA 1HP1A 5IOHA 3H66A 4O4KA 3QFKA 4DSYA 1OIEA 3H61A 3PSNA 3HVQA 3T1IA 1II7A 2AHDA 4IL1A 4UT3B 2XMOA 3IB8A 4H1SA 4ORAA 3ZTVA 4TUIA 4OR9A 3KBPA 4ORCA 3H67A 3C5WC 3QFMA 3H60A 2IE3C 2Z72A 3V4YA 5JPFA 5HPEA 3QFOA 3DSCA 1T71A 4KKZA 4H2GA 2BCDA 4DT2A 3E7AA 5EQVA 4J6OA 1TCOA 1NNWA 3GVEA 4I5LC 1UTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XM7 A;  3K7W C;  4TUG A;  2BQ8 X;  1WAO 1;  3THO B;  4MOY A;  4ORB A;  2IE4 C;  4V0V A;  1USH A;  2Z06 A;  4HD0 A;  3TGH A;  1QFC A;  3ICF A;  3P71 C;  4F0Z A;  2DFJ A;  4LU9 A;  3RQZ A;  3K7V C;  1S3L A;  5JJT A;  3PSO A;  1Z2W A;  3QFN A;  4B2O A;  1S95 A;  4UT3 A;  1AUI A;  1HO5 A;  4LTY A;  1XZW A;  4V0W A;  1Z2X A;  1IT6 A;  2HYP A;  3H69 A;  4H2B A;  4JA7 A;  3RL5 A;  5C1V A;  4H2F A;  4O43 A;  2NPP C;  4I5N C;  4ZX2 A;  1S3M A;  1G5B A;  3AV0 A;  3N5U A;  5F3W A;  4JA9 A;  2QJC A;  3IVE A;  3H62 B;  5JPE A;  4NZV A;  3AUZ A;  2R17 A;  3CK2 A;  4YKE A;  4H1Y P;  2WDD A;  4UWQ A;  4O24 A;  3H63 A;  1M63 A;  2P6B A;  4FBW A;  1S3N A;  4WWL A;  4ZVZ A;  5J28 A;  5INB A;  4FCX A;  4O5G A;  3JYF A;  4G9J A;  1W24 A;  3RL4 A;  3ZU0 A;  3LL8 A;  2USH A;  2QFP A;  2ZBM A;  2JOG A;  1T70 A;  1OI8 A;  2WDE A;  1UF3 A;  2KKN A;  5GTU A;  2CV9 A;  1JK7 A;  4V0X A;  3QG5 C;  1HPU A;  3DSD A;  1FJM A;  5DNY A;  3THN A;  4H2I A;  1OID A;  4FBQ A;  2HYO A;  4Q7F A;  3H64 A;  2NXF A;  2Z1A A;  2BDX A;  4XPN A;  4M0V A;  2GJU A;  1V73 A;  3H68 A;  3RL3 A;  1S70 A;  4MOV A;  4MP0 A;  3EGH A;  2IAE C;  4LAC C;  4DHL A;  2Q8U A;  3DW8 C;  2YVT A;  2O8A A;  3FGA C;  1QHW A;  2NYM C;  3IB7 A;  1KBP A;  4FBK A;  2WDC A;  4KBP A;  2O8G A;  3IVD A;  4UT2 A;  2HY1 A;  3E7B A;  2QFR A;  1MF8 A;  1U32 A;  1WAR A;  5B8I A;  2NYL C;  2WDF A;  3EGG A;  2A22 A;  4IYP C;  1SU1 A;  1S8E A;  3C9F A;  1HP1 A;  5IOH A;  3H66 A;  4O4K A;  3QFK A;  4DSY A;  1OIE A;  3H61 A;  3PSN A;  3HVQ A;  3T1I A;  1II7 A;  2AHD A;  4IL1 A;  4UT3 B;  2XMO A;  3IB8 A;  4H1S A;  4ORA A;  3ZTV A;  4TUI A;  4OR9 A;  3KBP A;  4ORC A;  3H67 A;  3C5W C;  3QFM A;  3H60 A;  2IE3 C;  2Z72 A;  3V4Y A;  5JPF A;  5HPE A;  3QFO A;  3DSC A;  1T71 A;  4KKZ A;  4H2G A;  2BCD A;  4DT2 A;  3E7A A;  5EQV A;  4J6O A;  1TCO A;  1NNW A;  3GVE A;  4I5L C;  1UTE A; 
#chains in the Genus database with same CATH topology
 3D03 A;  2FTX B;  1XNQ E;  2BQ8 X;  4MOY A;  5LMN E;  1G2F C;  2ELZ A;  4LFC E;  4ORB A;  2EMK A;  4GEQ B;  3TGH A;  2LTS A;  2LTR A;  2YPN A;  4LU9 A;  3RQZ A;  1X49 A;  5JJT A;  2ENH A;  1GZ6 A;  4FK5 C;  4F6M A;  2DRP A;  2NAB A;  4LTY A;  4LF5 E;  1XZW A;  2LUQ A;  1Z2X A;  2EM6 A;  1IT6 A;  5A6A A;  4H2B A;  2L3J A;  5C1V A;  1TF6 A;  4BHB A;  4I5N C;  4ZX2 A;  2PRT A;  2VQF E;  3VK6 A;  1N32 E;  2L2M A;  2M1S A;  2MDR A;  1PJT A;  1AH5 A;  4H1Y P;  4UWQ A;  4FBW A;  4WWL A;  2EM0 A;  1S3N A;  3RL4 A;  1W24 A;  2YTO A;  4R2P A;  1A1J A;  3BGH A;  2USH A;  4DV7 E;  2WBT A;  2JOG A;  1OI8 A;  2WDE A;  2KHX A;  2VE7 C;  2LV2 A;  4M2Z A;  2V87 A;  1JK7 A;  2UXB E;  2YSO A;  1X6E A;  3VYY A;  1WXR A;  2F4V E;  2EPU A;  1JK1 A;  2ZOA A;  3IWD A;  4Q28 A;  1WRJ A;  1DGC A;  4X9J A;  4XPN A;  2LCE A;  2GJU A;  3H68 A;  3BF2 A;  4K0K E;  4MOV A;  2IAE C;  3MHS C;  1TF3 A;  3HPS A;  5TSE A;  2EP3 A;  3DW8 C;  1EKZ A;  1YFH A;  3T1Y E;  4KZS A;  2JWO A;  5FLX C;  4B3S E;  2L2K B;  2RS7 A;  2VF1 A;  4ZYH A;  2WDC A;  4JI7 E;  4R2C A;  2DLQ A;  3IVD A;  4OOG C;  2YRH A;  4X66 E;  1EH7 A;  4ZYE A;  1U32 A;  2EN3 A;  1WAR A;  5B8I A;  2EJ4 A;  1UN6 B;  4DR2 E;  2L8T A;  4IYP C;  3IWB A;  2DMY A;  2JP9 A;  3C9F A;  2EMX A;  1XMO E;  5BR8 E;  3QFK A;  1PDA A;  2CSH A;  3DJW A;  4DKK A;  2LT7 A;  4BC9 A;  4R2R A;  2EPP A;  2KON A;  1NEI A;  2EM9 A;  4TUI A;  3KBP A;  4R2E A;  3H67 A;  4I8O A;  3H60 A;  1NCS A;  2Z72 A;  2N3G A;  4GZN C;  5A6B D;  2EMC A;  1T71 A;  4JI6 E;  4JI8 E;  2LE2 A;  4H2G A;  2I13 A;  2EPR A;  4DT2 A;  1ZR9 A;  3UK3 C;  1NNW A;  1T39 A;  3GVE A;  2EM4 A;  1IMU A;  2LO3 A;  2EMW A;  5KL2 A;  1FJG E;  2ODR C;  2K7I A;  3EPK A;  4WPY A;  4V0V A;  2LBS B;  2EPK X;  2EOO A;  4HD0 A;  1TN9 A;  1DI2 A;  2UUA E;  2DFJ A;  1O0W A;  3VYX A;  1G2D C;  2JR1 A;  1A1H A;  2M7Q A;  3PSO A;  5A69 A;  1Z2W A;  3QFN A;  1HO5 A;  2WCC 3;  2IHR 1;  3EPH A;  5AE1 A;  1L4S A;  2G7H A;  4DV3 E;  3H69 A;  3RL5 A;  4L8N A;  4DR3 E;  2DMI A;  2EM2 A;  4O43 A;  2NPP C;  5AC4 A;  2YTP A;  3M99 B;  1S3M A;  2EM7 A;  3N5U A;  2WZO A;  4JA9 A;  2YTE A;  2EM3 A;  2QJC A;  3IVE A;  2RTX A;  4NZV A;  2CPN A;  4ZYD A;  3AUZ A;  2R17 A;  3CK2 A;  2J7J A;  2L6M A;  4O24 A;  3ADI A;  1ZBQ A;  5IT9 C;  1M63 A;  1ZU1 A;  1EH8 A;  4DV6 E;  2UU9 E;  4O5G A;  4FCX A;  1AAY A;  2EPA A;  2V88 A;  4F9A B;  2EN1 A;  4DR1 E;  1B69 A;  4P78 A;  3HPZ A;  2EPM X;  1X47 A;  2ZBM A;  1UF3 A;  5GTU A;  4LF8 E;  2EMH A;  4DMI A;  2MKD A;  5IXM B;  3EPJ A;  4B3M E;  1HPU A;  4DUZ E;  1A1F A;  2EMB A;  1A1K A;  3OML A;  2EPC A;  3JAM C;  1SFE A;  2CT1 A;  3THN A;  4M9V C;  1A1G A;  2NXF A;  2Z1A A;  2JYA A;  1HNZ E;  2UUC E;  1IBK E;  4LF6 E;  2EN7 A;  2HJJ A;  1X6F A;  4WXD A;  4MP0 A;  3EGH A;  4LAC C;  2EL4 A;  4BHC A;  4DV1 E;  2EOE A;  1UBD C;  4JYA E;  2HGH A;  4LF7 E;  1YZ9 A;  3FGA C;  2LJU A;  1YYW A;  5AE2 A;  4X65 E;  1IBL E;  4IJD A;  5A6B A;  4FBK A;  5KL7 A;  2YSP A;  4P7D A;  1YYO A;  3C6M A;  4F6N A;  3F6H A;  1A1L A;  1WJP A;  2GHF A;  2GLI A;  2NYL C;  2LVH A;  3H09 A;  2A22 A;  1SU1 A;  1N3G A;  4KHP E;  1YUI A;  1S8E A;  5IOH A;  2UXD E;  1UHZ A;  2EL6 A;  3H66 A;  2ZM6 E;  2L33 A;  2JPA A;  2YTQ A;  3PSN A;  1X6H A;  4IL1 A;  4LF9 E;  3IB8 A;  3BID A;  4ORA A;  4MLQ A;  3HXL A;  2L2N A;  2EMA A;  2EML A;  2MC5 A;  3C6K A;  4JI4 E;  2IE3 C;  2B3T B;  4DR6 E;  3V4Y A;  2DIX A;  2JVA A;  3QFO A;  2YTN A;  2CTD A;  4MLV A;  2EZ6 A;  4KKZ A;  3HQ1 A;  1T4O A;  3DF6 A;  2DSY A;  3ZOQ B;  2LJH A;  4DV2 E;  2UXC E;  2EPX A;  2HC5 A;  3K7W C;  1QU6 A;  4JI5 E;  3EPL A;  2IE4 C;  3C4B A;  2Z06 A;  4OX9 E;  3ICF A;  3P71 C;  4F0Z A;  1WHN A;  2RS6 A;  2YTD A;  2ENC A;  5AE3 A;  3E0J A;  2N8X A;  3K7V C;  1UIL A;  4RH8 A;  4B2O A;  2EPN A;  4DV4 E;  4BBY A;  1S95 A;  3MSW A;  4V0W A;  2EN6 A;  2YTJ A;  4X64 E;  4GKK E;  1X3C A;  1MGT A;  4GKJ E;  4H2F A;  2YRK A;  1G5B A;  5F3W A;  4JV5 E;  3J7Y p;  2MKN A;  5JPE A;  3H63 A;  4ZVZ A;  2V86 A;  2YEQ A;  5INB A;  2F8B A;  1YSA C;  2K4V A;  4BS9 A;  5A2Q C;  3LL8 A;  2EOX A;  2QFP A;  2B7T A;  3L00 A;  1T70 A;  2EPL X;  4LFA E;  2YTG A;  2KKN A;  1F2I G;  2EQ1 A;  3QG5 C;  2DB2 A;  1EH6 A;  2VRD A;  4YHH E;  2YTF A;  4WYQ B;  2H36 X;  5DNY A;  5LMU E;  4BC7 A;  2ODR D;  3JTZ A;  2NUG A;  2HYO A;  3H64 A;  3J7A G;  4M0V A;  3RL3 A;  4JI1 E;  4LFB E;  1S70 A;  2DXL A;  5IV8 B;  4WSP A;  2YU8 A;  2Q8U A;  4LF4 E;  2RSI A;  2EMY A;  3VHT B;  2EOF A;  3ADJ A;  2EMZ A;  2EOI A;  2N3H A;  1JK2 A;  2LMZ A;  4F54 A;  1IQO A;  2YVT A;  2O8A A;  2BBG A;  4Q35 B;  1T4L B;  1QHW A;  2NYM C;  2YZT A;  1HR0 E;  4F2J C;  4JI2 E;  4R2D A;  2NUE A;  5T6J A;  1KBP A;  1RQ0 A;  3K6Q A;  4DR7 E;  2EN2 A;  4L5N C;  3TQM A;  2YU5 A;  4NXN E;  4KBP A;  2ZO9 B;  2O8G A;  4UT2 A;  1BBO A;  1KJK A;  2HY1 A;  2V83 A;  2JY9 A;  3E7B A;  5KL3 A;  3ADG A;  1MF8 A;  2EPO A;  4ZYG A;  4R2S A;  2WDF A;  2KOU A;  1DQ3 A;  2EMG A;  1HP1 A;  4O4K A;  4DSY A;  1GTK A;  3FIG A;  2MDG A;  2I9I A;  3EQ1 A;  3HVQ A;  2ADR A;  2AHD A;  4UT3 B;  4H1S A;  2JXP A;  2EWL A;  1N34 E;  2DGC A;  4ORC A;  1ZBT A;  3KZY A;  1Z1B A;  1YYK A;  2M4I A;  3QFM A;  4WXC A;  1I94 E;  4NXM E;  1QNT A;  3RMP A;  1GQE A;  5JPF A;  4KWY A;  4R2Q A;  4N4R B;  4DV0 E;  4DV5 E;  5LLQ A;  2YWQ A;  3T1H E;  2YT4 A;  2JOX A;  1J5E E;  3E7A A;  3F6G A;  4J6O A;  3HTX A;  1TCO A;  3J81 C;  1UTE A;  2EOM A;  3KWR A;  4TUG A;  4NHR A;  1XNR E;  1XM7 A;  1WAO 1;  3THO B;  1RC7 A;  1STU A;  5A6J A;  3ADL A;  1USH A;  2R1F A;  4HTG A;  4BCA A;  1QFC A;  4WX9 A;  1PKP A;  3P1X A;  2L3C A;  1S3L A;  2ENA A;  3KZZ A;  2EQ3 A;  4UT3 A;  1AUI A;  2RQL A;  2EPZ A;  4RHB B;  2HYP A;  4JA7 A;  2EOY A;  2YRM A;  4DR4 E;  5AC5 A;  1N36 E;  3AV0 A;  2L92 A;  2EN8 A;  2LRS A;  2ELY A;  4DR5 E;  2M9A A;  2LUP B;  2EE8 A;  3H62 B;  2B7V A;  3J80 C;  4JI3 E;  4YKE A;  2WDD A;  3BBG A;  2V8Q B;  2D9H A;  1X48 A;  5KL4 A;  3JU0 A;  2P6B A;  2MC6 A;  5J28 A;  3LML A;  1P47 A;  4G9J A;  3ZU0 A;  1X5W A;  2EOR A;  4J8Z A;  1N33 E;  2R76 A;  2YTI A;  2NUF A;  5KL6 A;  2EOQ A;  1LLM C;  4B3R E;  3ECR A;  2CV9 A;  3OTO E;  4V0X A;  4BMJ A;  3DSD A;  1FJM A;  5KL5 A;  4DUY E;  2WBU A;  1FKA E;  1HNW E;  1WHQ A;  2EN4 A;  2EM5 A;  1PJS A;  4H2I A;  1OID A;  4FBQ A;  5ADZ A;  2RPC A;  4Q7F A;  2BDX A;  1V73 A;  2NA2 A;  2E1M A;  1ZAA C;  1IBM E;  1BB8 A;  1RMD A;  4DHL A;  2EMF A;  3IWC A;  2EL5 A;  2A25 A;  3LLH A;  1J26 A;  4AQY E;  3IB7 A;  2EOH A;  2B9D A;  3FLO A;  4F9B B;  2DXN A;  4JI0 E;  4R2A A;  2EOJ A;  3C4T A;  1IQS A;  2EOZ A;  2QFR A;  4R03 A;  5IWA E;  1SR9 A;  2HHH E;  5A6K A;  3EGG A;  4X8W A;  2FGG A;  2DLK A;  2E5L E;  1MEY C;  2RSM A;  2UUB E;  1T4N A;  2EQ0 A;  4IS1 C;  5AAS A;  2WBS A;  2EMI A;  4YY3 E;  1OIE A;  1PJQ A;  3H61 A;  1A1I A;  3T1I A;  4WFT A;  2EOS A;  1II7 A;  4M30 A;  5LL6 R;  2XMO A;  4F9C B;  4HEI A;  3ZTV A;  4OR9 A;  1YPN A;  2VQE E;  1T38 A;  3MHH C;  1XMQ E;  2EM8 A;  3C5W C;  2V89 A;  2JOB A;  1BBG A;  4X62 E;  2FV4 B;  5CFF E;  4R8O A;  1HNX E;  4B3T E;  5HPE A;  2E72 A;  2V85 A;  1YUJ A;  3DSC A;  2BB8 A;  2BCD A;  5EQV A;  1KYQ A;  2GPI A;  3JYF A;  4I5L C;  4WSG A; 
#chains in the Genus database with same CATH homology
 1XM7 A;  3D03 A;  3K7W C;  4TUG A;  2BQ8 X;  1WAO 1;  3THO B;  4MOY A;  4ORB A;  2IE4 C;  4V0V A;  1USH A;  2Z06 A;  4HD0 A;  3TGH A;  1QFC A;  3ICF A;  3P71 C;  4F0Z A;  2DFJ A;  4LU9 A;  3RQZ A;  3E0J A;  3K7V C;  1S3L A;  5JJT A;  3PSO A;  1Z2W A;  3QFN A;  4B2O A;  1S95 A;  4UT3 A;  1AUI A;  1HO5 A;  4LTY A;  1XZW A;  4V0W A;  1Z2X A;  1IT6 A;  2HYP A;  3H69 A;  4H2B A;  4JA7 A;  3RL5 A;  5C1V A;  4H2F A;  4O43 A;  2NPP C;  4I5N C;  4ZX2 A;  1S3M A;  1G5B A;  3AV0 A;  3N5U A;  5F3W A;  4JA9 A;  2QJC A;  3IVE A;  3H62 B;  5JPE A;  4NZV A;  3AUZ A;  2R17 A;  3CK2 A;  4YKE A;  4H1Y P;  2WDD A;  4UWQ A;  4O24 A;  3H63 A;  1M63 A;  2P6B A;  4FBW A;  1S3N A;  4WWL A;  4ZVZ A;  2YEQ A;  5J28 A;  5INB A;  4FCX A;  4O5G A;  3JYF A;  4G9J A;  1W24 A;  3RL4 A;  3ZU0 A;  3LL8 A;  2USH A;  2QFP A;  2ZBM A;  2JOG A;  1T70 A;  1OI8 A;  2WDE A;  1UF3 A;  2KKN A;  5GTU A;  2CV9 A;  1JK7 A;  4V0X A;  3QG5 C;  1HPU A;  3DSD A;  1FJM A;  5DNY A;  3THN A;  4H2I A;  1OID A;  4FBQ A;  2HYO A;  2ZOA A;  3H64 A;  4Q7F A;  2NXF A;  2Z1A A;  2BDX A;  4XPN A;  4M0V A;  2GJU A;  1V73 A;  3H68 A;  3RL3 A;  1S70 A;  2DXL A;  4MOV A;  4MP0 A;  3EGH A;  2IAE C;  4LAC C;  4DHL A;  2Q8U A;  3DW8 C;  2YVT A;  2O8A A;  3FGA C;  1QHW A;  2NYM C;  3IB7 A;  1KBP A;  3FLO A;  4FBK A;  2WDC A;  2DXN A;  4KBP A;  2ZO9 B;  2O8G A;  3IVD A;  4UT2 A;  2HY1 A;  3E7B A;  2QFR A;  1MF8 A;  1U32 A;  1WAR A;  5B8I A;  2NYL C;  2WDF A;  3EGG A;  2A22 A;  4IYP C;  1SU1 A;  1S8E A;  3C9F A;  1HP1 A;  5IOH A;  3H66 A;  4O4K A;  3QFK A;  4DSY A;  1OIE A;  3H61 A;  3PSN A;  3HVQ A;  3T1I A;  1II7 A;  2AHD A;  4IL1 A;  4UT3 B;  2XMO A;  3IB8 A;  4H1S A;  4ORA A;  3ZTV A;  4TUI A;  4OR9 A;  3KBP A;  4ORC A;  3H67 A;  3C5W C;  3QFM A;  3H60 A;  2IE3 C;  2Z72 A;  3V4Y A;  5JPF A;  5HPE A;  3QFO A;  3DSC A;  1T71 A;  4KKZ A;  4H2G A;  2BCD A;  4DT2 A;  3E7A A;  5EQV A;  4J6O A;  1TCO A;  1NNW A;  3GVE A;  4I5L C;  1UTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...