4O5GA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
total genus 102
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o5gA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o5gA01
2Z06A 3IB8A 3RL3A 2HYOA 4NZVA 3H60A 4YKEA 4FBQA 4O24A 2KKNA 4V0WA 3ICFA 1NNWA 3P71C 1TCOA 4F0ZA 2Q8UA 4LTYA 4ZX2A 1HO5A 4V0XA 1S3MA 3H61A 3H66A 1JK7A 3H62B 4H1SA 5EQVA 4DSYA 1SU1A 4UWQA 5F3WA 4H2GA 2BCDA 4HD0A 3AV0A 2AHDA 3RL4A 5HPEA 2WDEA 3K7VC 4ORBA 3ZU0A 4KKZA 1AUIA 2NYLC 3JYFA 3QG5C 3H68A 3KBPA 2QJCA 3QFOA 3E7BA 1OIEA 4LACC 4UT2A 4ZVZA 4JA9A 3V4YA 4DHLA 3THNA 1XM7A 3DW8C 4O43A 5JJTA 3C5WC 1S8EA 4ORAA 3DSCA 2QFPA 4ORCA 5JPEA 4G9JA 3LL8A 3PSNA 1USHA 3K7WC 4UT3A 2O8GA 3EGGA 2R17A 2HYPA 1OIDA 4IYPC 1FJMA 5JPFA 1XZWA 3IVEA 3H67A 5DNYA 1W24A 3H64A 3QFMA 3T1IA 5GTUA 1S3NA 2JOGA 4FBKA 3RQZA 2IE4C 2IAEC 4O5GA 4JA7A 4MOVA 1KBPA 4I5LC 2A22A 2WDFA 3THOB 4FCXA 3FGAC 4TUGA 4TUIA 1HPUA 4O4KA 4V0VA 1II7A 1Z2XA 4KBPA 4H1YP 1T71A 2QFRA 3ZTVA 1QHWA 3IB7A 3EGHA 5INBA 1V73A 1S70A 2DFJA 1HP1A 5B8IA 4LU9A 3C9FA 3QFNA 1MF8A 3CK2A 1T70A 3TGHA 4UT3B 5J28A 2Z72A 1Z2WA 2XMOA 4WWLA 3PSOA 3QFKA 2CV9A 2USHA 4M0VA 2BDXA 2NXFA 3DSDA 1UF3A 4MOYA 2NPPC 1U32A 4XPNA 2P6BA 1G5BA 1M63A 4OR9A 3HVQA 4H2FA 4H2BA 4IL1A 5IOHA 2BQ8X 4MP0A 5C1VA 2NYMC 2YVTA 1UTEA 3H63A 2O8AA 3AUZA 4Q7FA 3RL5A 2HY1A 4H2IA 2Z1AA 3N5UA 1S3LA 1WAO1 4J6OA 3H69A 1WARA 2WDDA 2ZBMA 3IVDA 4I5NC 3E7AA 1QFCA 1S95A 2IE3C 4B2OA 3GVEA 4DT2A 1IT6A 2GJUA 1OI8A 4FBWA 2WDCA
chains in the Genus database with same CATH superfamily
3IB8A 1UHZA 4DV1E 5KL5A 2KKNA 2YTNA 4DKKA 2YZTA 2NA2A 2DIXA 2EMBA 2MDRA 2EMYA 2CPNA 4LF6E 1PJSA 4R2CA 4UWQA 1UBDC 2JY9A 1NEIA 3IWCA 3J81C 4R2DA 1T38A 1YUIA 3IWDA 4KKZA 2EPXA 4B3TE 1AUIA 2NYLC 3JYFA 3QG5C 4NXME 2V8QB 2A25A 1KYQA 2NUGA 2WZOA 4DR1E 4P7DA 4ZVZA 2FV4B 3TQMA 2LBSB 3V4YA 2K4VA 3L00A 1NCSA 5LMNE 4NHRA 1S8EA 2DMYA 2DXLA 2EP3A 4M9VC 1XNRE 2I9IA 3DSCA 2QFPA 1EH8A 4G9JA 4B3RE 4F9CB 2V86A 3BBGA 2ZOAA 3MHHC 3EGGA 2N3GA 2R17A 2HYPA 2EMLA 2WCC3 1FJMA 2ZO9B 5LMUE 4DUZE 1B69A 2UXCE 4X62E 3ADIA 3H64A 1QNTA 4WX9A 3D03A 3T1IA 1EH6A 2EN4A 3IWBA 2EM9A 5GTUA 2LJHA 4ZYDA 3RQZA 4DV2E 2L6MA 2E72A 2M7QA 4K0KE 4DV4E 1YYOA 4WPYA 2WDFA 2F8BA 2DMIA 4BCAA 4DV0E 4O4KA 2YTOA 1HPUA 1HNWE 2B3TB 2ODRC 4R2PA 4LF5E 4H1YP 5KL6A 2JXPA 2QFRA 3ZTVA 4DR2E 1V73A 2V87A 1GTKA 3K6QA 3TGHA 1T70A 1YYWA 4HEIA 4WWLA 5AC5A 2CV9A 2YTDA 1WHNA 3KWRA 4DMIA 2L92A 2NPPC 3FLOA 2N8XA 2JR1A 4J8ZA 2VF1A 4DV3E 4JI7E 1YYKA 4H2BA 1MEYC 4IL1A 5IOHA 4YHHE 4OX9E 2I13A 1A1HA 1UTEA 3H63A 3HPSA 3J7AG 2HY1A 2DB2A 3RMPA 1TN9A 5IWAE 3N5UA 1TF3A 2E1MA 3FIGA 1S3LA 3H69A 1YFHA 4GZNC 1WARA 1BBGA 2MC6A 4OOGC 1QU6A 2UUCE 4BBYA 4AQYE 2M1SA 2UUBE 2EWLA 4FBWA 2GJUA 4DHLA 2H36X 2MDGA 5KL4A 4BS9A 3ADLA 1X6EA 2YSPA 2YU8A 3C6MA 1X49A 2LV2A 1DGCA 4P78A 4NZVA 2V89A 3H60A 1P47A 3ICFA 1TCOA 2EMZA 2G7HA 4WSPA 2Q8UA 5LL6R 4X64E 5KL2A 1HO5A 3E0JA 3H66A 1IBLE 1JK7A 3H62B 3P1XA 2GPIA 2LT7A 2RPCA 2RS6A 4H2GA 3DJWA 2EL6A 2KHXA 3RL4A 2EM8A 2ADRA 2WDEA 3K7VC 5HPEA 4ORBA 1GQEA 2EQ1A 4ZYHA 3M99B 3H68A 2LUPB 4DV5E 3E7BA 2EL4A 1OIEA 1WJPA 4LACC 2EN6A 4HTGA 4L5NC 4JA9A 2EN2A 2EMWA 2DRPA 2EOEA 1YUJA 2BBGA 1X6FA 5KL3A 4O43A 1HNXE 2DSYA 3C6KA 4JI8E 1N34E 2EPNA 5LLQA 3J7Yp 1JK1A 4R2EA 2V88A 2KONA 1BB8A 2ZM6E 3PSNA 1USHA 3K7WC 2O8GA 4WXCA 1UN6B 2CT1A 4F9BB 4IYPC 2EPMX 4DR5E 1SFEA 2DLQA 4DV7E 3DF6A 1PJQA 2YTQA 2WBUA 1G2DC 4WSGA 3KZYA 1W24A 3H67A 2JOGA 4FBKA 2RS7A 1KJKA 2IAEC 2EMHA 1ZR9A 4N4RB 5IT9C 2HGHA 2UU9E 4GEQB 1DI2A 2GLIA 2JYAA 2UUAE 1KBPA 2A22A 3THOB 4FCXA 1IQSA 2EPCA 4JI3E 2FTXB 2ENAA 2KOUA 4RH8A 1X3CA 1II7A 2V83A 3C4BA 1YPNA 1Z2XA 1T71A 3VK6A 1HNZE 4I8OA 1RMDA 4LU9A 2EN7A 2M9AA 2D9HA 4JYAE 5A6BD 3CK2A 2YU5A 3PSOA 4WXDA 1WRJA 1T4NA 2JWOA 2BDXA 3VYYA 2EMFA 2EOSA 4F2JC 1LLMC 4MOYA 2JP9A 2WBSA 1G5BA 2NUFA 2RTXA 2ELYA 4H2FA 2DXNA 1ZAAC 2LCEA 2E5LE 5C1VA 4JI6E 3HTXA 1J26A 2HJJA 5TSEA 1L4SA 2LTSA 2IHR1 2YSOA 2Z1AA 2JVAA 2EOJA 5KL7A 2EN8A 5A2QC 4R2RA 1STUA 2YT4A 4B2OA 4DV6E 3HXLA 5A6AA 1IT6A 1OI8A 2EM4A 2EOZA 4M2ZA 3RL3A 3EQ1A 2EPPA 1HR0E 5IV8B 4JI5E 2F4VE 2ENCA 4YKEA 4WYQB 2EORA 1AAYA 2YRHA 4BHBA 1N3GA 3P71C 2ELZA 4LTYA 4MLQA 4ZX2A 2K7IA 1WHQA 4F9AB 4Q35B 5EQVA 2EOXA 2CTDA 5BR8E 4DSYA 2JOXA 1SU1A 2GHFA 1EH7A 5F3WA 2BCDA 3HPZA 3EPHA 3AV0A 1ZBQA 1T39A 1G2FC 3EPJA 2HC5A 3ZU0A 1SR9A 4X9JA 2LTRA 2YTGA 5A6KA 2EN3A 1XMQE 2EJ4A 3KBPA 4DUYE 5A69A 2QJCA 1EKZA 2MC5A 1A1JA 4LFBE 3BF2A 2ENHA 3THNA 4L8NA 3DW8C 4ORAA 2R1FA 5JPEA 2FGGA 3F6HA 2EPKX 4IS1C 3LMLA 1X6HA 2EMKA 2EM3A 4R2SA 2DLKA 4B3ME 5DNYA 1IQOA 3IVEA 5JPFA 4YY3E 3T1HE 3BGHA 3KZZA 2EPRA 2EPUA 1S3NA 4O5GA 4JA7A 4MOVA 4I5LC 2ODRD 3EPKA 1ZBTA 3FGAC 2EMIA 2YRMA 4ZYGA 4R2AA 4TUGA 4TUIA 2VQFE 3ZOQB 1IMUA 4DR3E 4F6NA 1T4LB 2EL5A 1WXRA 3LLHA 1QHWA 3EGHA 3IB7A 5INBA 2EOHA 2EPLX 2EM7A 4LF8E 5ADZA 1DQ3A 3MHSC 2LRSA 2EMCA 1HP1A 3C9FA 2VQEE 3QFNA 2MKNA 5J28A 4UT3B 4JI2E 2EM6A 1N32E 3QFKA 2USHA 4M0VA 4DR6E 1UF3A 3C4TA 4BMJA 2LE2A 1U32A 2YTIA 4OR9A 2EPZA 3JU0A 3MSWA 4MP0A 2NYMC 2YVTA 2EOQA 4R8OA 2V85A 4MLVA 4Q7FA 3RL5A 5A6BA 4H2IA 1IBKE 1JK2A 2EOOA 2M4IA 4B3SE 2B7TA 1O0WA 2ZBMA 2EQ3A 4J6OA 4X65E 1N36E 1A1FA 1N33E 2L3CA 2B9DA 2EQ0A 4KHPE 1FKAE 2L8TA 5AE1A 2RSIA 4GKJE 2RSMA 2WDCA 4F6MA 1A1LA 2Z06A 2L2KB 2JPAA 1PDAA 3BIDA 2HYOA 3HQ1A 4LFCE 2EM0A 1MGTA 2LJUA 5IXMB 1X47A 4FBQA 4O24A 2B7VA 4V0WA 1NNWA 4F0ZA 3ECRA 4DR7E 2EPOA 3ADJA 3EPLA 4JI0E 4JI4E 5FLXC 3J80C 4V0XA 2L2MA 1F2IG 1S3MA 3H61A 3VYXA 4H1SA 2YWQA 5A6JA 1X48A 4KWYA 5T6JA 2R76A 5AC4A 2VRDA 2EPAA 4HD0A 2EMGA 2EM5A 4M30A 3JTZA 4BC7A 4F54A 2AHDA 4NXNE 2EE8A 4BC9A 2LMZA 2EZ6A 1ZU1A 4FK5C 4GKKE 3QFOA 2EMAA 4UT2A 4R2QA 2CSHA 1XM7A 1I94E 1A1GA 1PJTA 2YTEA 4X8WA 3T1YE 5JJTA 3C5WC 2EMXA 4LF7E 2L2NA 2MKDA 1J5EE 2BB8A 4ORCA 2LO3A 1YZ9A 2LVHA 2EN1A 2VE7C 2UXBE 4LFAE 3LL8A 2WBTA 1GZ6A 4UT3A 3VHTB 4X66E 3F6GA 1OIDA 2UXDE 3H09A 2JOBA 1XZWA 5AE2A 4RHBB 1UILA 3QFMA 2YPNA 2IE4C 2EOYA 2L3JA 2EOMA 5CFFE 3OTOE 4LF9E 1Z1BA 4LF4E 4V0VA 1RQ0A 1RC7A 4IJDA 4BHCA 4KBPA 4ZYEA 2EM2A 1T4OA 2YTJA 3OMLA 1S70A 2HHHE 2DFJA 3UK3C 5B8IA 2RQLA 1MF8A 1XMOE 4JV5E 4DR4E 2Z72A 1Z2WA 2XMOA 2YTPA 1A1IA 2NXFA 3DSDA 4Q28A 2EOIA 4XPNA 2P6BA 2LUQA 2NUEA 2EOFA 2DGCA 1M63A 3HVQA 1YSAC 2J7JA 2NABA 1PKPA 2BQ8X 4WFTA 2O8AA 4JI1E 2YRKA 3AUZA 1TF6A 1IBME 5AE3A 1WAO1 4KZSA 1XNQE 2YTFA 2WDDA 3IVDA 4I5NC 2L33A 3E7AA 2YEQA 1QFCA 5AASA 2N3HA 3JAMC 1S95A 2IE3C 1A1KA 1X5WA 3ADGA 2PRTA 3GVEA 1FJGE 4DT2A 1BBOA 4R03A 1AH5A
chains in the Genus database with same CATH topology
2Z06A 3IB8A 3RL3A 2HYOA 4NZVA 3H60A 4YKEA 4FBQA 4O24A 2KKNA 4V0WA 3ICFA 1NNWA 3P71C 1TCOA 4F0ZA 2Q8UA 4LTYA 4ZX2A 1HO5A 4V0XA 3E0JA 1S3MA 3H61A 3H66A 1JK7A 3H62B 4H1SA 5EQVA 4DSYA 1SU1A 4UWQA 5F3WA 4H2GA 4HD0A 2BCDA 3AV0A 2AHDA 3RL4A 5HPEA 2WDEA 3K7VC 4ORBA 3ZU0A 4KKZA 1AUIA 2NYLC 3JYFA 3QG5C 3H68A 3KBPA 2QJCA 3QFOA 3E7BA 1OIEA 4LACC 4UT2A 4ZVZA 4JA9A 3V4YA 4DHLA 3THNA 1XM7A 3DW8C 4O43A 5JJTA 3C5WC 1S8EA 4ORAA 2DXLA 3DSCA 2QFPA 4ORCA 5JPEA 4G9JA 3LL8A 3PSNA 1USHA 3K7WC 4UT3A 2ZOAA 2O8GA 3EGGA 2R17A 2HYPA 1OIDA 4IYPC 1FJMA 2ZO9B 5JPFA 1XZWA 3IVEA 3H67A 5DNYA 1W24A 3H64A 3D03A 3QFMA 3T1IA 5GTUA 1S3NA 2JOGA 4FBKA 3RQZA 2IE4C 2IAEC 4O5GA 4JA7A 4MOVA 1KBPA 4I5LC 2A22A 2WDFA 3THOB 4FCXA 3FGAC 4TUGA 4TUIA 4O4KA 1HPUA 4V0VA 1II7A 1Z2XA 4KBPA 4H1YP 1T71A 2QFRA 3ZTVA 1QHWA 3IB7A 3EGHA 5INBA 1V73A 1S70A 2DFJA 1HP1A 5B8IA 4LU9A 3C9FA 3QFNA 1MF8A 3CK2A 1T70A 3TGHA 4UT3B 5J28A 2Z72A 1Z2WA 2XMOA 4WWLA 3PSOA 3QFKA 2CV9A 2USHA 4M0VA 3DSDA 2BDXA 2NXFA 1UF3A 3FLOA 2NPPC 1U32A 4MOYA 4XPNA 2P6BA 1G5BA 1M63A 4OR9A 3HVQA 4H2FA 2DXNA 4H2BA 4IL1A 5IOHA 2BQ8X 4MP0A 5C1VA 2NYMC 2YVTA 1UTEA 3H63A 2O8AA 3AUZA 4Q7FA 3RL5A 2HY1A 4H2IA 2Z1AA 3N5UA 1S3LA 1WAO1 4J6OA 3H69A 1WARA 2WDDA 2ZBMA 3IVDA 4I5NC 3E7AA 2YEQA 1QFCA 1S95A 2IE3C 4B2OA 3GVEA 4DT2A 1IT6A 2GJUA 1OI8A 4FBWA 2WDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z06 A;  3IB8 A;  3RL3 A;  2HYO A;  4NZV A;  3H60 A;  4YKE A;  4FBQ A;  4O24 A;  2KKN A;  4V0W A;  3ICF A;  1NNW A;  3P71 C;  1TCO A;  4F0Z A;  2Q8U A;  4LTY A;  4ZX2 A;  1HO5 A;  4V0X A;  1S3M A;  3H61 A;  3H66 A;  1JK7 A;  3H62 B;  4H1S A;  5EQV A;  4DSY A;  1SU1 A;  4UWQ A;  5F3W A;  4H2G A;  2BCD A;  4HD0 A;  3AV0 A;  2AHD A;  3RL4 A;  5HPE A;  2WDE A;  3K7V C;  4ORB A;  3ZU0 A;  4KKZ A;  1AUI A;  2NYL C;  3JYF A;  3QG5 C;  3H68 A;  3KBP A;  2QJC A;  3QFO A;  3E7B A;  1OIE A;  4LAC C;  4UT2 A;  4ZVZ A;  4JA9 A;  3V4Y A;  4DHL A;  3THN A;  1XM7 A;  3DW8 C;  4O43 A;  5JJT A;  3C5W C;  1S8E A;  4ORA A;  3DSC A;  2QFP A;  4ORC A;  5JPE A;  4G9J A;  3LL8 A;  3PSN A;  1USH A;  3K7W C;  4UT3 A;  2O8G A;  3EGG A;  2R17 A;  2HYP A;  1OID A;  4IYP C;  1FJM A;  5JPF A;  1XZW A;  3IVE A;  3H67 A;  5DNY A;  1W24 A;  3H64 A;  3QFM A;  3T1I A;  5GTU A;  1S3N A;  2JOG A;  4FBK A;  3RQZ A;  2IE4 C;  2IAE C;  4O5G A;  4JA7 A;  4MOV A;  1KBP A;  4I5L C;  2A22 A;  2WDF A;  3THO B;  4FCX A;  3FGA C;  4TUG A;  4TUI A;  1HPU A;  4O4K A;  4V0V A;  1II7 A;  1Z2X A;  4KBP A;  4H1Y P;  1T71 A;  2QFR A;  3ZTV A;  1QHW A;  3IB7 A;  3EGH A;  5INB A;  1V73 A;  1S70 A;  2DFJ A;  1HP1 A;  5B8I A;  4LU9 A;  3C9F A;  3QFN A;  1MF8 A;  3CK2 A;  1T70 A;  3TGH A;  4UT3 B;  5J28 A;  2Z72 A;  1Z2W A;  2XMO A;  4WWL A;  3PSO A;  3QFK A;  2CV9 A;  2USH A;  4M0V A;  2BDX A;  2NXF A;  3DSD A;  1UF3 A;  4MOY A;  2NPP C;  1U32 A;  4XPN A;  2P6B A;  1G5B A;  1M63 A;  4OR9 A;  3HVQ A;  4H2F A;  4H2B A;  4IL1 A;  5IOH A;  2BQ8 X;  4MP0 A;  5C1V A;  2NYM C;  2YVT A;  1UTE A;  3H63 A;  2O8A A;  3AUZ A;  4Q7F A;  3RL5 A;  2HY1 A;  4H2I A;  2Z1A A;  3N5U A;  1S3L A;  1WAO 1;  4J6O A;  3H69 A;  1WAR A;  2WDD A;  2ZBM A;  3IVD A;  4I5N C;  3E7A A;  1QFC A;  1S95 A;  2IE3 C;  4B2O A;  3GVE A;  4DT2 A;  1IT6 A;  2GJU A;  1OI8 A;  4FBW A;  2WDC A; 
#chains in the Genus database with same CATH topology
 3IB8 A;  1UHZ A;  4DV1 E;  5KL5 A;  2KKN A;  2YTN A;  4DKK A;  2YZT A;  2NA2 A;  2DIX A;  2EMB A;  2MDR A;  2EMY A;  2CPN A;  4LF6 E;  1PJS A;  4R2C A;  4UWQ A;  1UBD C;  2JY9 A;  1NEI A;  3IWC A;  3J81 C;  4R2D A;  1T38 A;  1YUI A;  3IWD A;  4KKZ A;  2EPX A;  4B3T E;  1AUI A;  2NYL C;  3JYF A;  3QG5 C;  4NXM E;  2V8Q B;  2A25 A;  1KYQ A;  2NUG A;  2WZO A;  4DR1 E;  4P7D A;  4ZVZ A;  2FV4 B;  3TQM A;  2LBS B;  3V4Y A;  2K4V A;  3L00 A;  1NCS A;  5LMN E;  4NHR A;  1S8E A;  2DMY A;  2DXL A;  2EP3 A;  4M9V C;  1XNR E;  2I9I A;  3DSC A;  2QFP A;  1EH8 A;  4G9J A;  4B3R E;  4F9C B;  2V86 A;  3BBG A;  2ZOA A;  3MHH C;  3EGG A;  2N3G A;  2R17 A;  2HYP A;  2EML A;  2WCC 3;  1FJM A;  2ZO9 B;  5LMU E;  4DUZ E;  1B69 A;  2UXC E;  4X62 E;  3ADI A;  3H64 A;  1QNT A;  4WX9 A;  3D03 A;  3T1I A;  1EH6 A;  2EN4 A;  3IWB A;  2EM9 A;  5GTU A;  2LJH A;  4ZYD A;  3RQZ A;  4DV2 E;  2L6M A;  2E72 A;  2M7Q A;  4K0K E;  4DV4 E;  1YYO A;  4WPY A;  2WDF A;  2F8B A;  2DMI A;  4BCA A;  4DV0 E;  4O4K A;  2YTO A;  1HPU A;  1HNW E;  2B3T B;  2ODR C;  4R2P A;  4LF5 E;  4H1Y P;  5KL6 A;  2JXP A;  2QFR A;  3ZTV A;  4DR2 E;  1V73 A;  2V87 A;  1GTK A;  3K6Q A;  3TGH A;  1T70 A;  1YYW A;  4HEI A;  4WWL A;  5AC5 A;  2CV9 A;  2YTD A;  1WHN A;  3KWR A;  4DMI A;  2L92 A;  2NPP C;  3FLO A;  2N8X A;  2JR1 A;  4J8Z A;  2VF1 A;  4DV3 E;  4JI7 E;  1YYK A;  4H2B A;  1MEY C;  4IL1 A;  5IOH A;  4YHH E;  4OX9 E;  2I13 A;  1A1H A;  1UTE A;  3H63 A;  3HPS A;  3J7A G;  2HY1 A;  2DB2 A;  3RMP A;  1TN9 A;  5IWA E;  3N5U A;  1TF3 A;  2E1M A;  3FIG A;  1S3L A;  3H69 A;  1YFH A;  4GZN C;  1WAR A;  1BBG A;  2MC6 A;  4OOG C;  1QU6 A;  2UUC E;  4BBY A;  4AQY E;  2M1S A;  2UUB E;  2EWL A;  4FBW A;  2GJU A;  4DHL A;  2H36 X;  2MDG A;  5KL4 A;  4BS9 A;  3ADL A;  1X6E A;  2YSP A;  2YU8 A;  3C6M A;  1X49 A;  2LV2 A;  1DGC A;  4P78 A;  4NZV A;  2V89 A;  3H60 A;  1P47 A;  3ICF A;  1TCO A;  2EMZ A;  2G7H A;  4WSP A;  2Q8U A;  5LL6 R;  4X64 E;  5KL2 A;  1HO5 A;  3E0J A;  3H66 A;  1IBL E;  1JK7 A;  3H62 B;  3P1X A;  2GPI A;  2LT7 A;  2RPC A;  2RS6 A;  4H2G A;  3DJW A;  2EL6 A;  2KHX A;  3RL4 A;  2EM8 A;  2ADR A;  2WDE A;  3K7V C;  5HPE A;  4ORB A;  1GQE A;  2EQ1 A;  4ZYH A;  3M99 B;  3H68 A;  2LUP B;  4DV5 E;  3E7B A;  2EL4 A;  1OIE A;  1WJP A;  4LAC C;  2EN6 A;  4HTG A;  4L5N C;  4JA9 A;  2EN2 A;  2EMW A;  2DRP A;  2EOE A;  1YUJ A;  2BBG A;  1X6F A;  5KL3 A;  4O43 A;  1HNX E;  2DSY A;  3C6K A;  4JI8 E;  1N34 E;  2EPN A;  5LLQ A;  3J7Y p;  1JK1 A;  4R2E A;  2V88 A;  2KON A;  1BB8 A;  2ZM6 E;  3PSN A;  1USH A;  3K7W C;  2O8G A;  4WXC A;  1UN6 B;  2CT1 A;  4F9B B;  4IYP C;  2EPM X;  4DR5 E;  1SFE A;  2DLQ A;  4DV7 E;  3DF6 A;  1PJQ A;  2YTQ A;  2WBU A;  1G2D C;  4WSG A;  3KZY A;  1W24 A;  3H67 A;  2JOG A;  4FBK A;  2RS7 A;  1KJK A;  2IAE C;  2EMH A;  1ZR9 A;  4N4R B;  5IT9 C;  2HGH A;  2UU9 E;  4GEQ B;  1DI2 A;  2GLI A;  2JYA A;  2UUA E;  1KBP A;  2A22 A;  3THO B;  4FCX A;  1IQS A;  2EPC A;  4JI3 E;  2FTX B;  2ENA A;  2KOU A;  4RH8 A;  1X3C A;  1II7 A;  2V83 A;  3C4B A;  1YPN A;  1Z2X A;  1T71 A;  3VK6 A;  1HNZ E;  4I8O A;  1RMD A;  4LU9 A;  2EN7 A;  2M9A A;  2D9H A;  4JYA E;  5A6B D;  3CK2 A;  2YU5 A;  3PSO A;  4WXD A;  1WRJ A;  1T4N A;  2JWO A;  2BDX A;  3VYY A;  2EMF A;  2EOS A;  4F2J C;  1LLM C;  4MOY A;  2JP9 A;  2WBS A;  1G5B A;  2NUF A;  2RTX A;  2ELY A;  4H2F A;  2DXN A;  1ZAA C;  2LCE A;  2E5L E;  5C1V A;  4JI6 E;  3HTX A;  1J26 A;  2HJJ A;  5TSE A;  1L4S A;  2LTS A;  2IHR 1;  2YSO A;  2Z1A A;  2JVA A;  2EOJ A;  5KL7 A;  2EN8 A;  5A2Q C;  4R2R A;  1STU A;  2YT4 A;  4B2O A;  4DV6 E;  3HXL A;  5A6A A;  1IT6 A;  1OI8 A;  2EM4 A;  2EOZ A;  4M2Z A;  3RL3 A;  3EQ1 A;  2EPP A;  1HR0 E;  5IV8 B;  4JI5 E;  2F4V E;  2ENC A;  4YKE A;  4WYQ B;  2EOR A;  1AAY A;  2YRH A;  4BHB A;  1N3G A;  3P71 C;  2ELZ A;  4LTY A;  4MLQ A;  4ZX2 A;  2K7I A;  1WHQ A;  4F9A B;  4Q35 B;  5EQV A;  2EOX A;  2CTD A;  5BR8 E;  4DSY A;  2JOX A;  1SU1 A;  2GHF A;  1EH7 A;  5F3W A;  2BCD A;  3HPZ A;  3EPH A;  3AV0 A;  1ZBQ A;  1T39 A;  1G2F C;  3EPJ A;  2HC5 A;  3ZU0 A;  1SR9 A;  4X9J A;  2LTR A;  2YTG A;  5A6K A;  2EN3 A;  1XMQ E;  2EJ4 A;  3KBP A;  4DUY E;  5A69 A;  2QJC A;  1EKZ A;  2MC5 A;  1A1J A;  4LFB E;  3BF2 A;  2ENH A;  3THN A;  4L8N A;  3DW8 C;  4ORA A;  2R1F A;  5JPE A;  2FGG A;  3F6H A;  2EPK X;  4IS1 C;  3LML A;  1X6H A;  2EMK A;  2EM3 A;  4R2S A;  2DLK A;  4B3M E;  5DNY A;  1IQO A;  3IVE A;  5JPF A;  4YY3 E;  3T1H E;  3BGH A;  3KZZ A;  2EPR A;  2EPU A;  1S3N A;  4O5G A;  4JA7 A;  4MOV A;  4I5L C;  2ODR D;  3EPK A;  1ZBT A;  3FGA C;  2EMI A;  2YRM A;  4ZYG A;  4R2A A;  4TUG A;  4TUI A;  2VQF E;  3ZOQ B;  1IMU A;  4DR3 E;  4F6N A;  1T4L B;  2EL5 A;  1WXR A;  3LLH A;  1QHW A;  3EGH A;  3IB7 A;  5INB A;  2EOH A;  2EPL X;  2EM7 A;  4LF8 E;  5ADZ A;  1DQ3 A;  3MHS C;  2LRS A;  2EMC A;  1HP1 A;  3C9F A;  2VQE E;  3QFN A;  2MKN A;  5J28 A;  4UT3 B;  4JI2 E;  2EM6 A;  1N32 E;  3QFK A;  2USH A;  4M0V A;  4DR6 E;  1UF3 A;  3C4T A;  4BMJ A;  2LE2 A;  1U32 A;  2YTI A;  4OR9 A;  2EPZ A;  3JU0 A;  3MSW A;  4MP0 A;  2NYM C;  2YVT A;  2EOQ A;  4R8O A;  2V85 A;  4MLV A;  4Q7F A;  3RL5 A;  5A6B A;  4H2I A;  1IBK E;  1JK2 A;  2EOO A;  2M4I A;  4B3S E;  2B7T A;  1O0W A;  2ZBM A;  2EQ3 A;  4J6O A;  4X65 E;  1N36 E;  1A1F A;  1N33 E;  2L3C A;  2B9D A;  2EQ0 A;  4KHP E;  1FKA E;  2L8T A;  5AE1 A;  2RSI A;  4GKJ E;  2RSM A;  2WDC A;  4F6M A;  1A1L A;  2Z06 A;  2L2K B;  2JPA A;  1PDA A;  3BID A;  2HYO A;  3HQ1 A;  4LFC E;  2EM0 A;  1MGT A;  2LJU A;  5IXM B;  1X47 A;  4FBQ A;  4O24 A;  2B7V A;  4V0W A;  1NNW A;  4F0Z A;  3ECR A;  4DR7 E;  2EPO A;  3ADJ A;  3EPL A;  4JI0 E;  4JI4 E;  5FLX C;  3J80 C;  4V0X A;  2L2M A;  1F2I G;  1S3M A;  3H61 A;  3VYX A;  4H1S A;  2YWQ A;  5A6J A;  1X48 A;  4KWY A;  5T6J A;  2R76 A;  5AC4 A;  2VRD A;  2EPA A;  4HD0 A;  2EMG A;  2EM5 A;  4M30 A;  3JTZ A;  4BC7 A;  4F54 A;  2AHD A;  4NXN E;  2EE8 A;  4BC9 A;  2LMZ A;  2EZ6 A;  1ZU1 A;  4FK5 C;  4GKK E;  3QFO A;  2EMA A;  4UT2 A;  4R2Q A;  2CSH A;  1XM7 A;  1I94 E;  1A1G A;  1PJT A;  2YTE A;  4X8W A;  3T1Y E;  5JJT A;  3C5W C;  2EMX A;  4LF7 E;  2L2N A;  2MKD A;  1J5E E;  2BB8 A;  4ORC A;  2LO3 A;  1YZ9 A;  2LVH A;  2EN1 A;  2VE7 C;  2UXB E;  4LFA E;  3LL8 A;  2WBT A;  1GZ6 A;  4UT3 A;  3VHT B;  4X66 E;  3F6G A;  1OID A;  2UXD E;  3H09 A;  2JOB A;  1XZW A;  5AE2 A;  4RHB B;  1UIL A;  3QFM A;  2YPN A;  2IE4 C;  2EOY A;  2L3J A;  2EOM A;  5CFF E;  3OTO E;  4LF9 E;  1Z1B A;  4LF4 E;  4V0V A;  1RQ0 A;  1RC7 A;  4IJD A;  4BHC A;  4KBP A;  4ZYE A;  2EM2 A;  1T4O A;  2YTJ A;  3OML A;  1S70 A;  2HHH E;  2DFJ A;  3UK3 C;  5B8I A;  2RQL A;  1MF8 A;  1XMO E;  4JV5 E;  4DR4 E;  2Z72 A;  1Z2W A;  2XMO A;  2YTP A;  1A1I A;  2NXF A;  3DSD A;  4Q28 A;  2EOI A;  4XPN A;  2P6B A;  2LUQ A;  2NUE A;  2EOF A;  2DGC A;  1M63 A;  3HVQ A;  1YSA C;  2J7J A;  2NAB A;  1PKP A;  2BQ8 X;  4WFT A;  2O8A A;  4JI1 E;  2YRK A;  3AUZ A;  1TF6 A;  1IBM E;  5AE3 A;  1WAO 1;  4KZS A;  1XNQ E;  2YTF A;  2WDD A;  3IVD A;  4I5N C;  2L33 A;  3E7A A;  2YEQ A;  1QFC A;  5AAS A;  2N3H A;  3JAM C;  1S95 A;  2IE3 C;  1A1K A;  1X5W A;  3ADG A;  2PRT A;  3GVE A;  1FJG E;  4DT2 A;  1BBO A;  4R03 A;  1AH5 A; 
#chains in the Genus database with same CATH homology
 2Z06 A;  3IB8 A;  3RL3 A;  2HYO A;  4NZV A;  3H60 A;  4YKE A;  4FBQ A;  4O24 A;  2KKN A;  4V0W A;  3ICF A;  1NNW A;  3P71 C;  1TCO A;  4F0Z A;  2Q8U A;  4LTY A;  4ZX2 A;  1HO5 A;  4V0X A;  3E0J A;  1S3M A;  3H61 A;  3H66 A;  1JK7 A;  3H62 B;  4H1S A;  5EQV A;  4DSY A;  1SU1 A;  4UWQ A;  5F3W A;  4H2G A;  4HD0 A;  2BCD A;  3AV0 A;  2AHD A;  3RL4 A;  5HPE A;  2WDE A;  3K7V C;  4ORB A;  3ZU0 A;  4KKZ A;  1AUI A;  2NYL C;  3JYF A;  3QG5 C;  3H68 A;  3KBP A;  2QJC A;  3QFO A;  3E7B A;  1OIE A;  4LAC C;  4UT2 A;  4ZVZ A;  4JA9 A;  3V4Y A;  4DHL A;  3THN A;  1XM7 A;  3DW8 C;  4O43 A;  5JJT A;  3C5W C;  1S8E A;  4ORA A;  2DXL A;  3DSC A;  2QFP A;  4ORC A;  5JPE A;  4G9J A;  3LL8 A;  3PSN A;  1USH A;  3K7W C;  4UT3 A;  2ZOA A;  2O8G A;  3EGG A;  2R17 A;  2HYP A;  1OID A;  4IYP C;  1FJM A;  2ZO9 B;  5JPF A;  1XZW A;  3IVE A;  3H67 A;  5DNY A;  1W24 A;  3H64 A;  3D03 A;  3QFM A;  3T1I A;  5GTU A;  1S3N A;  2JOG A;  4FBK A;  3RQZ A;  2IE4 C;  2IAE C;  4O5G A;  4JA7 A;  4MOV A;  1KBP A;  4I5L C;  2A22 A;  2WDF A;  3THO B;  4FCX A;  3FGA C;  4TUG A;  4TUI A;  4O4K A;  1HPU A;  4V0V A;  1II7 A;  1Z2X A;  4KBP A;  4H1Y P;  1T71 A;  2QFR A;  3ZTV A;  1QHW A;  3IB7 A;  3EGH A;  5INB A;  1V73 A;  1S70 A;  2DFJ A;  1HP1 A;  5B8I A;  4LU9 A;  3C9F A;  3QFN A;  1MF8 A;  3CK2 A;  1T70 A;  3TGH A;  4UT3 B;  5J28 A;  2Z72 A;  1Z2W A;  2XMO A;  4WWL A;  3PSO A;  3QFK A;  2CV9 A;  2USH A;  4M0V A;  3DSD A;  2BDX A;  2NXF A;  1UF3 A;  3FLO A;  2NPP C;  1U32 A;  4MOY A;  4XPN A;  2P6B A;  1G5B A;  1M63 A;  4OR9 A;  3HVQ A;  4H2F A;  2DXN A;  4H2B A;  4IL1 A;  5IOH A;  2BQ8 X;  4MP0 A;  5C1V A;  2NYM C;  2YVT A;  1UTE A;  3H63 A;  2O8A A;  3AUZ A;  4Q7F A;  3RL5 A;  2HY1 A;  4H2I A;  2Z1A A;  3N5U A;  1S3L A;  1WAO 1;  4J6O A;  3H69 A;  1WAR A;  2WDD A;  2ZBM A;  3IVD A;  4I5N C;  3E7A A;  2YEQ A;  1QFC A;  1S95 A;  2IE3 C;  4B2O A;  3GVE A;  4DT2 A;  1IT6 A;  2GJU A;  1OI8 A;  4FBW A;  2WDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...