4O5GA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
331
Chain Sequence
b'IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 102
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o5gA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o5gA01
1NNWA 4O43A 3QFKA 2HYOA 3C9FA 1T70A 3CK2A 3HVQA 1W24A 1QHWA 2GJUA 4ORAA 5JJTA 1S3NA 3QG5C 1Z2WA 3QFOA 1U32A 5JPFA 3LL8A 5DNYA 2YVTA 2HY1A 2Q8UA 3H66A 3ZU0A 2BDXA 3K7VC 3H67A 1XM7A 3RQZA 4IYPC 4FBQA 3RL5A 1OIEA 4ZX2A 3H64A 4TUGA 1S95A 1FJMA 2BCDA 2DFJA 4FBKA 4H1YP 4KBPA 3RL3A 2O8GA 3H68A 2P6BA 2IE4C 1USHA 4XPNA 4FCXA 4O24A 4B2OA 2NXFA 3H61A 4H2IA 3JYFA 4YKEA 3AV0A 1MF8A 3EGGA 2Z06A 2NYLC 5GTUA 3GVEA 3H69A 3PSNA 2XMOA 4H2BA 4LACC 4UT2A 1UF3A 1AUIA 1S70A 3FGAC 2QFRA 4MOVA 1IT6A 4M0VA 4ZVZA 1UTEA 2WDFA 4J6OA 4UWQA 1HO5A 2NPPC 3PSOA 3T1IA 4DSYA 4WWLA 2CV9A 1T71A 2USHA 2BQ8X 2WDDA 3AUZA 2HYPA 3H63A 4JA7A 1WARA 2AHDA 3V4YA 4LU9A 5J28A 3RL4A 4ORCA 1HP1A 1QFCA 3E7BA 4H2FA 5EQVA 5IOHA 4FBWA 4I5NC 3IVEA 2WDCA 3ICFA 3KBPA 3K7WC 2WDEA 3ZTVA 1S8EA 1OIDA 1WAO1 1G5BA 1II7A 3IB8A 1Z2XA 2R17A 1TCOA 2O8AA 4KKZA 1SU1A 1XZWA 4I5LC 4DT2A 3DSCA 3H62B 1KBPA 4NZVA 3DSDA 2QJCA 3IB7A 2IE3C 2ZBMA 3EGHA 1M63A 5JPEA 3QFMA 3P71C 4UT3A 1OI8A 3H60A 2Z72A 3QFNA 5HPEA 1HPUA 4F0ZA 1S3LA 2Z1AA 4OR9A 5F3WA 2NYMC 3TGHA 3THOB 5B8IA 4H1SA 4H2GA 3THNA 5C1VA 3C5WC 4UT3B 4V0WA 2KKNA 4DHLA 4V0XA 2QFPA 3IVDA 4MOYA 1S3MA 4G9JA 3DW8C 4TUIA 4LTYA 1JK7A 2A22A 2IAEC 4O5GA 4JA9A 4IL1A 2JOGA 4ORBA 3N5UA 4HD0A 4V0VA 1V73A 3E7AA 4O4KA 4Q7FA 4MP0A 5INBA
chains in the Genus database with same CATH superfamily
1WHQA 1IQSA 4R2PA 4JI5E 4O43A 1X47A 2M1SA 2HYOA 4K0KE 4JI2E 2UXDE 2JP9A 4BC7A 2YEQA 2RSIA 2K4VA 4ZYHA 2YT4A 2WBSA 1L4SA 4ORAA 5JJTA 3J7Yp 2YRKA 2V83A 3J80C 3QG5C 3E0JA 3C6KA 3P1XA 5KL7A 2RS7A 4DR6E 1RQ0A 2EOHA 2BDXA 2JY9A 3H67A 1EH7A 4YY3E 3RQZA 2BBGA 4IYPC 3RL5A 4TUGA 3OMLA 3VYYA 5A2QC 1S95A 1FJMA 2ENAA 4FBKA 2EM6A 5KL3A 3H68A 5A6AA 2IE4C 1XMQE 3F6HA 4FK5C 1USHA 4LF6E 4FCXA 1DQ3A 2L2KB 4LF7E 1A1GA 2EPNA 2D9HA 3HXLA 3GVEA 3H69A 4LFCE 2XMOA 2EN3A 2M9AA 1SR9A 4MOVA 3FGAC 4DUYE 1RC7A 5LMUE 4M0VA 5A6BA 1BB8A 1UTEA 2KOUA 1T4NA 2YSOA 5A6BD 2NPPC 2EMCA 3T1IA 1GZ6A 1A1FA 1IBLE 2ENCA 2WCC3 3AUZA 5TSEA 2DXLA 1WARA 3ADIA 1X6FA 2AHDA 2EWLA 3BF2A 2V86A 1HNXE 1YYKA 3E7BA 2YWQA 2JVAA 4F6MA 4FBWA 2EM8A 2GHFA 4H2FA 1UHZA 2EOIA 3K6QA 3ICFA 3MHHC 4F2JC 5IT9C 5AE2A 3IVEA 2EM7A 3K7WC 1S8EA 2E1MA 1BBOA 2ELZA 1Z2XA 2EOSA 2CTDA 2R17A 1TCOA 2JOBA 5KL4A 2EPCA 2WBTA 4DR3E 1KBPA 3EQ1A 3DSDA 1HR0E 3BIDA 2RQLA 5IWAE 2ZBMA 3C4TA 5JPEA 4ZYEA 4WSGA 2YPNA 4R2AA 2YTEA 2EOEA 2VQEE 1IBME 2Z72A 4BCAA 3JTZA 4ZYDA 1FJGE 4F0ZA 2ZO9B 2LVHA 1YYOA 1FKAE 4GZNC 2L3CA 1J5EE 4F54A 2L3JA 1XNRE 4GEQB 5C1VA 4H2GA 3MSWA 5AC5A 2K7IA 4BC9A 3FIGA 5BR8E 1S3MA 4G9JA 4WX9A 4LTYA 4WSPA 2EM0A 4BMJA 2JOGA 3J7AG 3N5UA 2L33A 2LE2A 2UUBE 2LMZA 5INBA 4P78A 4HEIA 1YPNA 4WXCA 1AH5A 1TF6A 3C9FA 1PDAA 1PJQA 1W24A 2B7TA 1T39A 2YU5A 3ADLA 4GKJE 1SFEA 2MC6A 2EOZA 2L8TA 4J8ZA 2WZOA 1RMDA 2EN2A 5A6JA 5FLXC 1N34E 4JI0E 4LFBE 4WYQB 1S3NA 2RTXA 4LFAE 1Z2WA 5DNYA 1KYQA 2VRDA 3HTXA 2DSYA 1ZU1A 2EJ4A 2VF1A 1A1KA 3ECRA 2IHR1 2V85A 2LUPB 2M4IA 4H1YP 2FV4B 2MC5A 1N36E 4O24A 2BB8A 2VE7C 4H2IA 1GQEA 2EPAA 3C4BA 4Q28A 2B9DA 2N8XA 1WRJA 3AV0A 4JI6E 3ADGA 2Z06A 2EMBA 1TN9A 3PSNA 4H2BA 4L8NA 2YTQA 1QNTA 4BBYA 2QFRA 2EZ6A 4ZVZA 2YTFA 4J6OA 1MEYC 1HO5A 3MHSC 5AE1A 2CT1A 3EPKA 3L00A 1T38A 1T71A 2USHA 2EPRA 2EM5A 3D03A 5LL6R 3VHTB 3DJWA 4LU9A 5J28A 3RL4A 2JWOA 4B3RE 2CPNA 4I5NC 2WDCA 4KWYA 2GLIA 2YU8A 4OX9E 3ZTVA 4IJDA 4RHBB 3IB8A 4BHCA 5AASA 5KL2A 1I94E 4X64E 2YSPA 2O8AA 1ZAAC 2EMKA 4KZSA 5T6JA 4DV7E 3H62B 1JK1A 3HQ1A 1X3CA 4DUZE 1A1IA 2QJCA 4YHHE 3IB7A 2N3GA 3EGHA 3P71C 4IS1C 4LF5E 2EP3A 2HC5A 1B69A 4DR2E 1STUA 5AC4A 3QFNA 2EMIA 4ZYGA 4R2RA 1N33E 2LRSA 2ODRC 2F4VE 2EPMX 1IQOA 2DLQA 4H1SA 4DKKA 5EQVA 5IXMB 2DGCA 2KKNA 1X5WA 1NCSA 4N4RB 4DHLA 2DMYA 4M30A 4MOYA 2YTIA 2EM3A 2EM2A 5LMNE 2IAEC 4O5GA 2UXBE 4IL1A 4F9BB 4NXME 2YTDA 4ORBA 4V0VA 1V73A 1PKPA 4MLVA 3EPLA 4Q7FA 4MP0A 3QFKA 1YSAC 2DLKA 3TQMA 3FLOA 2LBSB 1QU6A 1ZR9A 1T70A 3HVQA 2L92A 4DV3E 2B7VA 1QHWA 4BHBA 4R2CA 1UILA 4RH8A 2DXNA 2EOYA 4DR1E 2GJUA 2NUFA 5LLQA 3RMPA 2L6MA 4AQYE 1U32A 3QFOA 1EH8A 2YTJA 5AE3A 2EMGA 2HY1A 2EMXA 3H66A 2EPPA 4JYAE 1XM7A 2HJJA 1ZBQA 2R76A 4R2SA 1UN6B 3H64A 3ADJA 2VQFE 2YTOA 2FTXB 2DFJA 1WJPA 3JAMC 1ZBTA 4I8OA 4XPNA 2EL5A 2EMAA 2LTRA 2FGGA 4B3ME 3JYFA 2EPXA 2RPCA 2L2NA 4NXNE 1XMOE 3EGGA 2NYLC 5GTUA 4GKKE 2EPKX 1UF3A 1AUIA 2NUEA 1XNQE 1A1HA 1S70A 2UU9E 2DRPA 5ADZA 2YTNA 2WDFA 2UUCE 5A6KA 2ELYA 4F9CB 2H36X 4BS9A 4B3TE 5A69A 3J81C 3BBGA 2A25A 2JXPA 1O0WA 4DSYA 4WWLA 3F6GA 4X66E 2CSHA 2NUGA 4ORCA 1QFCA 5IOHA 2EPOA 2EL6A 4KHPE 4JI3E 3LLHA 2LJHA 4JI8E 3T1YE 1YZ9A 2YRMA 1T4LB 2EOJA 1G5BA 4L5NC 2G7HA 1YUJA 2HGHA 2EN6A 4DV5E 3HPZA 4B3SE 1HNWE 4KKZA 1SU1A 1XZWA 4I5LC 2V87A 2EN8A 4DR4E 3DSCA 1F2IG 1JK2A 4NZVA 2I9IA 2JYAA 1LLMC 1WHNA 3DF6A 2EM9A 1DGCA 5KL5A 1X48A 1BBGA 2DMIA 3IWDA 1P47A 4DR7E 1HPUA 2KONA 2Z1AA 2JOXA 4OR9A 2HHHE 2LUQA 1X6HA 2J7JA 1G2DC 4X62E 2EPZA 2YTPA 2EQ1A 3THNA 2DB2A 4R2QA 4DV4E 2EE8A 3DW8C 4TUIA 1JK7A 2MDGA 4LF4E 1A1LA 2ADRA 4F9AB 4HD0A 2E72A 2LCEA 3M99B 4O4KA 1X49A 2EOQA 5CFFE 1NNWA 2EMZA 3KWRA 4X9JA 2ZOAA 4JI7E 4X65E 1MGTA 3EPJA 3CK2A 2EL4A 4OOGC 1T4OA 4JI1E 2EOFA 1YUIA 1YYWA 4LF8E 2EN1A 2M7QA 2EN4A 2V89A 3JU0A 5JPFA 2L2MA 3LL8A 2YVTA 2MKNA 2LO3A 2Q8UA 3ZU0A 2UXCE 4R2EA 3K7VC 3ZOQB 2EMWA 2GPIA 4FBQA 5IV8B 1OIEA 4ZX2A 2BCDA 4KBPA 3RL3A 1UBDC 2O8GA 3C6MA 2P6BA 3H09A 1EH6A 1IMUA 3T1HE 4B2OA 2NXFA 3H61A 2EM4A 4WFTA 2EMFA 4YKEA 4DR5E 2PRTA 2E5LE 1MF8A 1DI2A 2N3HA 4WPYA 1KJKA 4R2DA 4UT2A 4LACC 4DMIA 2EQ0A 1IT6A 2EOOA 1IBKE 4M9VC 3VYXA 2MKDA 4MLQA 1HNZE 3HPSA 1YFHA 4UWQA 4X8WA 3OTOE 3PSOA 3KZZA 2CV9A 2WDDA 1X6EA 2BQ8X 4Q35B 3H63A 2HYPA 4JA7A 2RS6A 2NABA 2YTGA 2EORA 2B3TB 3EPHA 3V4YA 2EN7A 2V88A 3UK3C 1HP1A 3LMLA 4DV1E 3VK6A 1G2FC 4M2ZA 4HTGA 2KHXA 3KBPA 3BGHA 2WDEA 2JR1A 1J26A 4NHRA 3KZYA 4R03A 4DV6E 4DV0E 1OIDA 2JPAA 1WAO1 1II7A 2EOXA 2DIXA 4P7DA 4DV2E 2ODRD 2YZTA 4DT2A 5KL6A 2WBUA 2ENHA 1TF3A 3IWBA 4JV5E 2R1FA 2F8BA 2EMLA 2IE3C 1PJSA 2LJUA 1NEIA 1M63A 3QFMA 2UUAE 2NA2A 1WXRA 4UT3A 2EPLX 4LF9E 1OI8A 3H60A 2LV2A 5HPEA 2EMYA 1PJTA 1S3LA 2EPUA 5F3WA 1A1JA 2NYMC 4WXDA 2LT7A 2LTSA 1N3GA 3TGHA 2V8QB 3THOB 2EMHA 5B8IA 2EQ3A 1EKZA 4F6NA 3C5WC 4UT3B 4V0WA 4JI4E 4R8OA 2ZM6E 4V0XA 2QFPA 1Z1BA 3IVDA 2RSMA 2YRHA 3IWCA 2MDRA 2A22A 4JA9A 2I13A 1AAYA 2EOMA 3E7AA 1N32E 1GTKA
chains in the Genus database with same CATH topology
1NNWA 2ZOAA 4O43A 3QFKA 3FLOA 2HYOA 3C9FA 1T70A 3CK2A 3HVQA 1W24A 1QHWA 2DXNA 2YEQA 2GJUA 4ORAA 5JJTA 1S3NA 3QG5C 3E0JA 1Z2WA 3QFOA 1U32A 5JPFA 3LL8A 5DNYA 2YVTA 2HY1A 2Q8UA 3H66A 3ZU0A 2BDXA 3K7VC 3H67A 1XM7A 3RQZA 4IYPC 4FBQA 3RL5A 1OIEA 4ZX2A 3H64A 4TUGA 1S95A 1FJMA 2BCDA 2DFJA 4FBKA 4H1YP 4KBPA 3RL3A 2O8GA 3H68A 2P6BA 2IE4C 1USHA 4XPNA 4FCXA 4O24A 4B2OA 2NXFA 3H61A 4H2IA 3JYFA 4YKEA 3AV0A 1MF8A 3EGGA 2Z06A 2NYLC 5GTUA 3GVEA 3H69A 3PSNA 2XMOA 4H2BA 4LACC 4UT2A 1UF3A 1AUIA 1S70A 3FGAC 2QFRA 4MOVA 1IT6A 4M0VA 4ZVZA 1UTEA 2WDFA 4J6OA 4UWQA 1HO5A 2NPPC 3PSOA 3T1IA 4DSYA 4WWLA 2CV9A 1T71A 2USHA 2BQ8X 2WDDA 2DXLA 2HYPA 3AUZA 3H63A 1WARA 3D03A 4JA7A 2AHDA 3V4YA 4LU9A 5J28A 3RL4A 4ORCA 1HP1A 1QFCA 3E7BA 4H2FA 5EQVA 5IOHA 4FBWA 4I5NC 3IVEA 2WDCA 3ICFA 3KBPA 3K7WC 2WDEA 3ZTVA 1S8EA 1OIDA 1WAO1 1G5BA 1II7A 3IB8A 1Z2XA 2R17A 1TCOA 2O8AA 4KKZA 1SU1A 1XZWA 4I5LC 3DSCA 4DT2A 3H62B 1KBPA 4NZVA 3DSDA 2QJCA 3IB7A 2IE3C 2ZBMA 3EGHA 1M63A 5JPEA 3QFMA 3P71C 4UT3A 1OI8A 3H60A 2Z72A 3QFNA 5HPEA 1HPUA 4F0ZA 2ZO9B 1S3LA 2Z1AA 4OR9A 5F3WA 2NYMC 3TGHA 3THOB 5B8IA 4H1SA 4H2GA 3THNA 5C1VA 3C5WC 4UT3B 4V0WA 2KKNA 4DHLA 4V0XA 2QFPA 3IVDA 4MOYA 1S3MA 4G9JA 3DW8C 4TUIA 4LTYA 1JK7A 2A22A 2IAEC 4O5GA 4JA9A 4IL1A 2JOGA 4ORBA 3N5UA 4HD0A 4V0VA 1V73A 3E7AA 4O4KA 4Q7FA 4MP0A 5INBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNW A;  4O43 A;  3QFK A;  2HYO A;  3C9F A;  1T70 A;  3CK2 A;  3HVQ A;  1W24 A;  1QHW A;  2GJU A;  4ORA A;  5JJT A;  1S3N A;  3QG5 C;  1Z2W A;  3QFO A;  1U32 A;  5JPF A;  3LL8 A;  5DNY A;  2YVT A;  2HY1 A;  2Q8U A;  3H66 A;  3ZU0 A;  2BDX A;  3K7V C;  3H67 A;  1XM7 A;  3RQZ A;  4IYP C;  4FBQ A;  3RL5 A;  1OIE A;  4ZX2 A;  3H64 A;  4TUG A;  1S95 A;  1FJM A;  2BCD A;  2DFJ A;  4FBK A;  4H1Y P;  4KBP A;  3RL3 A;  2O8G A;  3H68 A;  2P6B A;  2IE4 C;  1USH A;  4XPN A;  4FCX A;  4O24 A;  4B2O A;  2NXF A;  3H61 A;  4H2I A;  3JYF A;  4YKE A;  3AV0 A;  1MF8 A;  3EGG A;  2Z06 A;  2NYL C;  5GTU A;  3GVE A;  3H69 A;  3PSN A;  2XMO A;  4H2B A;  4LAC C;  4UT2 A;  1UF3 A;  1AUI A;  1S70 A;  3FGA C;  2QFR A;  4MOV A;  1IT6 A;  4M0V A;  4ZVZ A;  1UTE A;  2WDF A;  4J6O A;  4UWQ A;  1HO5 A;  2NPP C;  3PSO A;  3T1I A;  4DSY A;  4WWL A;  2CV9 A;  1T71 A;  2USH A;  2BQ8 X;  2WDD A;  3AUZ A;  2HYP A;  3H63 A;  4JA7 A;  1WAR A;  2AHD A;  3V4Y A;  4LU9 A;  5J28 A;  3RL4 A;  4ORC A;  1HP1 A;  1QFC A;  3E7B A;  4H2F A;  5EQV A;  5IOH A;  4FBW A;  4I5N C;  3IVE A;  2WDC A;  3ICF A;  3KBP A;  3K7W C;  2WDE A;  3ZTV A;  1S8E A;  1OID A;  1WAO 1;  1G5B A;  1II7 A;  3IB8 A;  1Z2X A;  2R17 A;  1TCO A;  2O8A A;  4KKZ A;  1SU1 A;  1XZW A;  4I5L C;  4DT2 A;  3DSC A;  3H62 B;  1KBP A;  4NZV A;  3DSD A;  2QJC A;  3IB7 A;  2IE3 C;  2ZBM A;  3EGH A;  1M63 A;  5JPE A;  3QFM A;  3P71 C;  4UT3 A;  1OI8 A;  3H60 A;  2Z72 A;  3QFN A;  5HPE A;  1HPU A;  4F0Z A;  1S3L A;  2Z1A A;  4OR9 A;  5F3W A;  2NYM C;  3TGH A;  3THO B;  5B8I A;  4H1S A;  4H2G A;  3THN A;  5C1V A;  3C5W C;  4UT3 B;  4V0W A;  2KKN A;  4DHL A;  4V0X A;  2QFP A;  3IVD A;  4MOY A;  1S3M A;  4G9J A;  3DW8 C;  4TUI A;  4LTY A;  1JK7 A;  2A22 A;  2IAE C;  4O5G A;  4JA9 A;  4IL1 A;  2JOG A;  4ORB A;  3N5U A;  4HD0 A;  4V0V A;  1V73 A;  3E7A A;  4O4K A;  4Q7F A;  4MP0 A;  5INB A; 
#chains in the Genus database with same CATH topology
 1WHQ A;  1IQS A;  4R2P A;  4JI5 E;  4O43 A;  1X47 A;  2M1S A;  2HYO A;  4K0K E;  4JI2 E;  2UXD E;  2JP9 A;  4BC7 A;  2YEQ A;  2RSI A;  2K4V A;  4ZYH A;  2YT4 A;  2WBS A;  1L4S A;  4ORA A;  5JJT A;  3J7Y p;  2YRK A;  2V83 A;  3J80 C;  3QG5 C;  3E0J A;  3C6K A;  3P1X A;  5KL7 A;  2RS7 A;  4DR6 E;  1RQ0 A;  2EOH A;  2BDX A;  2JY9 A;  3H67 A;  1EH7 A;  4YY3 E;  3RQZ A;  2BBG A;  4IYP C;  3RL5 A;  4TUG A;  3OML A;  3VYY A;  5A2Q C;  1S95 A;  1FJM A;  2ENA A;  4FBK A;  2EM6 A;  5KL3 A;  3H68 A;  5A6A A;  2IE4 C;  1XMQ E;  3F6H A;  4FK5 C;  1USH A;  4LF6 E;  4FCX A;  1DQ3 A;  2L2K B;  4LF7 E;  1A1G A;  2EPN A;  2D9H A;  3HXL A;  3GVE A;  3H69 A;  4LFC E;  2XMO A;  2EN3 A;  2M9A A;  1SR9 A;  4MOV A;  3FGA C;  4DUY E;  1RC7 A;  5LMU E;  4M0V A;  5A6B A;  1BB8 A;  1UTE A;  2KOU A;  1T4N A;  2YSO A;  5A6B D;  2NPP C;  2EMC A;  3T1I A;  1GZ6 A;  1A1F A;  1IBL E;  2ENC A;  2WCC 3;  3AUZ A;  5TSE A;  2DXL A;  1WAR A;  3ADI A;  1X6F A;  2AHD A;  2EWL A;  3BF2 A;  2V86 A;  1HNX E;  1YYK A;  3E7B A;  2YWQ A;  2JVA A;  4F6M A;  4FBW A;  2EM8 A;  2GHF A;  4H2F A;  1UHZ A;  2EOI A;  3K6Q A;  3ICF A;  3MHH C;  4F2J C;  5IT9 C;  5AE2 A;  3IVE A;  2EM7 A;  3K7W C;  1S8E A;  2E1M A;  1BBO A;  2ELZ A;  1Z2X A;  2EOS A;  2CTD A;  2R17 A;  1TCO A;  2JOB A;  5KL4 A;  2EPC A;  2WBT A;  4DR3 E;  1KBP A;  3EQ1 A;  3DSD A;  1HR0 E;  3BID A;  2RQL A;  5IWA E;  2ZBM A;  3C4T A;  5JPE A;  4ZYE A;  4WSG A;  2YPN A;  4R2A A;  2YTE A;  2EOE A;  2VQE E;  1IBM E;  2Z72 A;  4BCA A;  3JTZ A;  4ZYD A;  1FJG E;  4F0Z A;  2ZO9 B;  2LVH A;  1YYO A;  1FKA E;  4GZN C;  2L3C A;  1J5E E;  4F54 A;  2L3J A;  1XNR E;  4GEQ B;  5C1V A;  4H2G A;  3MSW A;  5AC5 A;  2K7I A;  4BC9 A;  3FIG A;  5BR8 E;  1S3M A;  4G9J A;  4WX9 A;  4LTY A;  4WSP A;  2EM0 A;  4BMJ A;  2JOG A;  3J7A G;  3N5U A;  2L33 A;  2LE2 A;  2UUB E;  2LMZ A;  5INB A;  4P78 A;  4HEI A;  1YPN A;  4WXC A;  1AH5 A;  1TF6 A;  3C9F A;  1PDA A;  1PJQ A;  1W24 A;  2B7T A;  1T39 A;  2YU5 A;  3ADL A;  4GKJ E;  1SFE A;  2MC6 A;  2EOZ A;  2L8T A;  4J8Z A;  2WZO A;  1RMD A;  2EN2 A;  5A6J A;  5FLX C;  1N34 E;  4JI0 E;  4LFB E;  4WYQ B;  1S3N A;  2RTX A;  4LFA E;  1Z2W A;  5DNY A;  1KYQ A;  2VRD A;  3HTX A;  2DSY A;  1ZU1 A;  2EJ4 A;  2VF1 A;  1A1K A;  3ECR A;  2IHR 1;  2V85 A;  2LUP B;  2M4I A;  4H1Y P;  2FV4 B;  2MC5 A;  1N36 E;  4O24 A;  2BB8 A;  2VE7 C;  4H2I A;  1GQE A;  2EPA A;  3C4B A;  4Q28 A;  2B9D A;  2N8X A;  1WRJ A;  3AV0 A;  4JI6 E;  3ADG A;  2Z06 A;  2EMB A;  1TN9 A;  3PSN A;  4H2B A;  4L8N A;  2YTQ A;  1QNT A;  4BBY A;  2QFR A;  2EZ6 A;  4ZVZ A;  2YTF A;  4J6O A;  1MEY C;  1HO5 A;  3MHS C;  5AE1 A;  2CT1 A;  3EPK A;  3L00 A;  1T38 A;  1T71 A;  2USH A;  2EPR A;  2EM5 A;  3D03 A;  5LL6 R;  3VHT B;  3DJW A;  4LU9 A;  5J28 A;  3RL4 A;  2JWO A;  4B3R E;  2CPN A;  4I5N C;  2WDC A;  4KWY A;  2GLI A;  2YU8 A;  4OX9 E;  3ZTV A;  4IJD A;  4RHB B;  3IB8 A;  4BHC A;  5AAS A;  5KL2 A;  1I94 E;  4X64 E;  2YSP A;  2O8A A;  1ZAA C;  2EMK A;  4KZS A;  5T6J A;  4DV7 E;  3H62 B;  1JK1 A;  3HQ1 A;  1X3C A;  4DUZ E;  1A1I A;  2QJC A;  4YHH E;  3IB7 A;  2N3G A;  3EGH A;  3P71 C;  4IS1 C;  4LF5 E;  2EP3 A;  2HC5 A;  1B69 A;  4DR2 E;  1STU A;  5AC4 A;  3QFN A;  2EMI A;  4ZYG A;  4R2R A;  1N33 E;  2LRS A;  2ODR C;  2F4V E;  2EPM X;  1IQO A;  2DLQ A;  4H1S A;  4DKK A;  5EQV A;  5IXM B;  2DGC A;  2KKN A;  1X5W A;  1NCS A;  4N4R B;  4DHL A;  2DMY A;  4M30 A;  4MOY A;  2YTI A;  2EM3 A;  2EM2 A;  5LMN E;  2IAE C;  4O5G A;  2UXB E;  4IL1 A;  4F9B B;  4NXM E;  2YTD A;  4ORB A;  4V0V A;  1V73 A;  1PKP A;  4MLV A;  3EPL A;  4Q7F A;  4MP0 A;  3QFK A;  1YSA C;  2DLK A;  3TQM A;  3FLO A;  2LBS B;  1QU6 A;  1ZR9 A;  1T70 A;  3HVQ A;  2L92 A;  4DV3 E;  2B7V A;  1QHW A;  4BHB A;  4R2C A;  1UIL A;  4RH8 A;  2DXN A;  2EOY A;  4DR1 E;  2GJU A;  2NUF A;  5LLQ A;  3RMP A;  2L6M A;  4AQY E;  1U32 A;  3QFO A;  1EH8 A;  2YTJ A;  5AE3 A;  2EMG A;  2HY1 A;  2EMX A;  3H66 A;  2EPP A;  4JYA E;  1XM7 A;  2HJJ A;  1ZBQ A;  2R76 A;  4R2S A;  1UN6 B;  3H64 A;  3ADJ A;  2VQF E;  2YTO A;  2FTX B;  2DFJ A;  1WJP A;  3JAM C;  1ZBT A;  4I8O A;  4XPN A;  2EL5 A;  2EMA A;  2LTR A;  2FGG A;  4B3M E;  3JYF A;  2EPX A;  2RPC A;  2L2N A;  4NXN E;  1XMO E;  3EGG A;  2NYL C;  5GTU A;  4GKK E;  2EPK X;  1UF3 A;  1AUI A;  2NUE A;  1XNQ E;  1A1H A;  1S70 A;  2UU9 E;  2DRP A;  5ADZ A;  2YTN A;  2WDF A;  2UUC E;  5A6K A;  2ELY A;  4F9C B;  2H36 X;  4BS9 A;  4B3T E;  5A69 A;  3J81 C;  3BBG A;  2A25 A;  2JXP A;  1O0W A;  4DSY A;  4WWL A;  3F6G A;  4X66 E;  2CSH A;  2NUG A;  4ORC A;  1QFC A;  5IOH A;  2EPO A;  2EL6 A;  4KHP E;  4JI3 E;  3LLH A;  2LJH A;  4JI8 E;  3T1Y E;  1YZ9 A;  2YRM A;  1T4L B;  2EOJ A;  1G5B A;  4L5N C;  2G7H A;  1YUJ A;  2HGH A;  2EN6 A;  4DV5 E;  3HPZ A;  4B3S E;  1HNW E;  4KKZ A;  1SU1 A;  1XZW A;  4I5L C;  2V87 A;  2EN8 A;  4DR4 E;  3DSC A;  1F2I G;  1JK2 A;  4NZV A;  2I9I A;  2JYA A;  1LLM C;  1WHN A;  3DF6 A;  2EM9 A;  1DGC A;  5KL5 A;  1X48 A;  1BBG A;  2DMI A;  3IWD A;  1P47 A;  4DR7 E;  1HPU A;  2KON A;  2Z1A A;  2JOX A;  4OR9 A;  2HHH E;  2LUQ A;  1X6H A;  2J7J A;  1G2D C;  4X62 E;  2EPZ A;  2YTP A;  2EQ1 A;  3THN A;  2DB2 A;  4R2Q A;  4DV4 E;  2EE8 A;  3DW8 C;  4TUI A;  1JK7 A;  2MDG A;  4LF4 E;  1A1L A;  2ADR A;  4F9A B;  4HD0 A;  2E72 A;  2LCE A;  3M99 B;  4O4K A;  1X49 A;  2EOQ A;  5CFF E;  1NNW A;  2EMZ A;  3KWR A;  4X9J A;  2ZOA A;  4JI7 E;  4X65 E;  1MGT A;  3EPJ A;  3CK2 A;  2EL4 A;  4OOG C;  1T4O A;  4JI1 E;  2EOF A;  1YUI A;  1YYW A;  4LF8 E;  2EN1 A;  2M7Q A;  2EN4 A;  2V89 A;  3JU0 A;  5JPF A;  2L2M A;  3LL8 A;  2YVT A;  2MKN A;  2LO3 A;  2Q8U A;  3ZU0 A;  2UXC E;  4R2E A;  3K7V C;  3ZOQ B;  2EMW A;  2GPI A;  4FBQ A;  5IV8 B;  1OIE A;  4ZX2 A;  2BCD A;  4KBP A;  3RL3 A;  1UBD C;  2O8G A;  3C6M A;  2P6B A;  3H09 A;  1EH6 A;  1IMU A;  3T1H E;  4B2O A;  2NXF A;  3H61 A;  2EM4 A;  4WFT A;  2EMF A;  4YKE A;  4DR5 E;  2PRT A;  2E5L E;  1MF8 A;  1DI2 A;  2N3H A;  4WPY A;  1KJK A;  4R2D A;  4UT2 A;  4LAC C;  4DMI A;  2EQ0 A;  1IT6 A;  2EOO A;  1IBK E;  4M9V C;  3VYX A;  2MKD A;  4MLQ A;  1HNZ E;  3HPS A;  1YFH A;  4UWQ A;  4X8W A;  3OTO E;  3PSO A;  3KZZ A;  2CV9 A;  2WDD A;  1X6E A;  2BQ8 X;  4Q35 B;  3H63 A;  2HYP A;  4JA7 A;  2RS6 A;  2NAB A;  2YTG A;  2EOR A;  2B3T B;  3EPH A;  3V4Y A;  2EN7 A;  2V88 A;  3UK3 C;  1HP1 A;  3LML A;  4DV1 E;  3VK6 A;  1G2F C;  4M2Z A;  4HTG A;  2KHX A;  3KBP A;  3BGH A;  2WDE A;  2JR1 A;  1J26 A;  4NHR A;  3KZY A;  4R03 A;  4DV6 E;  4DV0 E;  1OID A;  2JPA A;  1WAO 1;  1II7 A;  2EOX A;  2DIX A;  4P7D A;  4DV2 E;  2ODR D;  2YZT A;  4DT2 A;  5KL6 A;  2WBU A;  2ENH A;  1TF3 A;  3IWB A;  4JV5 E;  2R1F A;  2F8B A;  2EML A;  2IE3 C;  1PJS A;  2LJU A;  1NEI A;  1M63 A;  3QFM A;  2UUA E;  2NA2 A;  1WXR A;  4UT3 A;  2EPL X;  4LF9 E;  1OI8 A;  3H60 A;  2LV2 A;  5HPE A;  2EMY A;  1PJT A;  1S3L A;  2EPU A;  5F3W A;  1A1J A;  2NYM C;  4WXD A;  2LT7 A;  2LTS A;  1N3G A;  3TGH A;  2V8Q B;  3THO B;  2EMH A;  5B8I A;  2EQ3 A;  1EKZ A;  4F6N A;  3C5W C;  4UT3 B;  4V0W A;  4JI4 E;  4R8O A;  2ZM6 E;  4V0X A;  2QFP A;  1Z1B A;  3IVD A;  2RSM A;  2YRH A;  3IWC A;  2MDR A;  2A22 A;  4JA9 A;  2I13 A;  1AAY A;  2EOM A;  3E7A A;  1N32 E;  1GTK A; 
#chains in the Genus database with same CATH homology
 1NNW A;  2ZOA A;  4O43 A;  3QFK A;  3FLO A;  2HYO A;  3C9F A;  1T70 A;  3CK2 A;  3HVQ A;  1W24 A;  1QHW A;  2DXN A;  2YEQ A;  2GJU A;  4ORA A;  5JJT A;  1S3N A;  3QG5 C;  3E0J A;  1Z2W A;  3QFO A;  1U32 A;  5JPF A;  3LL8 A;  5DNY A;  2YVT A;  2HY1 A;  2Q8U A;  3H66 A;  3ZU0 A;  2BDX A;  3K7V C;  3H67 A;  1XM7 A;  3RQZ A;  4IYP C;  4FBQ A;  3RL5 A;  1OIE A;  4ZX2 A;  3H64 A;  4TUG A;  1S95 A;  1FJM A;  2BCD A;  2DFJ A;  4FBK A;  4H1Y P;  4KBP A;  3RL3 A;  2O8G A;  3H68 A;  2P6B A;  2IE4 C;  1USH A;  4XPN A;  4FCX A;  4O24 A;  4B2O A;  2NXF A;  3H61 A;  4H2I A;  3JYF A;  4YKE A;  3AV0 A;  1MF8 A;  3EGG A;  2Z06 A;  2NYL C;  5GTU A;  3GVE A;  3H69 A;  3PSN A;  2XMO A;  4H2B A;  4LAC C;  4UT2 A;  1UF3 A;  1AUI A;  1S70 A;  3FGA C;  2QFR A;  4MOV A;  1IT6 A;  4M0V A;  4ZVZ A;  1UTE A;  2WDF A;  4J6O A;  4UWQ A;  1HO5 A;  2NPP C;  3PSO A;  3T1I A;  4DSY A;  4WWL A;  2CV9 A;  1T71 A;  2USH A;  2BQ8 X;  2WDD A;  2DXL A;  2HYP A;  3AUZ A;  3H63 A;  1WAR A;  3D03 A;  4JA7 A;  2AHD A;  3V4Y A;  4LU9 A;  5J28 A;  3RL4 A;  4ORC A;  1HP1 A;  1QFC A;  3E7B A;  4H2F A;  5EQV A;  5IOH A;  4FBW A;  4I5N C;  3IVE A;  2WDC A;  3ICF A;  3KBP A;  3K7W C;  2WDE A;  3ZTV A;  1S8E A;  1OID A;  1WAO 1;  1G5B A;  1II7 A;  3IB8 A;  1Z2X A;  2R17 A;  1TCO A;  2O8A A;  4KKZ A;  1SU1 A;  1XZW A;  4I5L C;  3DSC A;  4DT2 A;  3H62 B;  1KBP A;  4NZV A;  3DSD A;  2QJC A;  3IB7 A;  2IE3 C;  2ZBM A;  3EGH A;  1M63 A;  5JPE A;  3QFM A;  3P71 C;  4UT3 A;  1OI8 A;  3H60 A;  2Z72 A;  3QFN A;  5HPE A;  1HPU A;  4F0Z A;  2ZO9 B;  1S3L A;  2Z1A A;  4OR9 A;  5F3W A;  2NYM C;  3TGH A;  3THO B;  5B8I A;  4H1S A;  4H2G A;  3THN A;  5C1V A;  3C5W C;  4UT3 B;  4V0W A;  2KKN A;  4DHL A;  4V0X A;  2QFP A;  3IVD A;  4MOY A;  1S3M A;  4G9J A;  3DW8 C;  4TUI A;  4LTY A;  1JK7 A;  2A22 A;  2IAE C;  4O5G A;  4JA9 A;  4IL1 A;  2JOG A;  4ORB A;  3N5U A;  4HD0 A;  4V0V A;  1V73 A;  3E7A A;  4O4K A;  4Q7F A;  4MP0 A;  5INB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...