4O5GA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exonuclease, putative
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
total genus 102
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o5gA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o5gA01
2BDXA 1HO5A 3E7AA 4O4KA 4FCXA 2ZBMA 4H2IA 2YVTA 4HD0A 2IE4C 1SU1A 2HYPA 3H61A 1OIDA 2O8AA 2IE3C 4OR9A 2NXFA 3H69A 4V0WA 2HYOA 1WARA 4TUGA 3H68A 1Z2XA 2Z1AA 3QFMA 1S70A 3DSCA 4UT2A 1QHWA 3H64A 1W24A 3IVEA 4I5LC 2A22A 4IYPC 4F0ZA 1S3NA 4J6OA 1U32A 3KBPA 1KBPA 2R17A 4IL1A 3H67A 3C5WC 4ORBA 5JJTA 1JK7A 4I5NC 1OI8A 4H2GA 3HVQA 3QG5C 4O24A 4G9JA 1T70A 3IB8A 5C1VA 3QFOA 1UF3A 3E7BA 1MF8A 2QJCA 4O5GA 5DNYA 3FGAC 3PSNA 2O8GA 3N5UA 2IAEC 4ORCA 4UWQA 5B8IA 5IOHA 1II7A 4ORAA 1Z2WA 3EGHA 1WAO1 2DFJA 2WDCA 4LACC 4MOVA 4ZVZA 3ZU0A 1QFCA 4XPNA 4KKZA 2WDFA 5JPFA 4KBPA 2Z72A 3ZTVA 4H2BA 1OIEA 4UT3A 5F3WA 2KKNA 4DSYA 1XZWA 1IT6A 1HPUA 3H63A 3RL3A 4H1YP 3IB7A 1XM7A 4MP0A 3QFKA 3LL8A 3EGGA 4LU9A 4LTYA 4MOYA 3THNA 1S3LA 3AUZA 3RL5A 1USHA 1V73A 5J28A 4Q7FA 5JPEA 4H2FA 2XMOA 4UT3B 3H60A 3CK2A 3DSDA 3V4YA 2NPPC 4DT2A 4DHLA 2BCDA 3P71C 3PSOA 4O43A 3T1IA 2NYMC 5HPEA 2JOGA 2Q8UA 3QFNA 4YKEA 1G5BA 1NNWA 3H62B 2WDEA 3H66A 1AUIA 2AHDA 4M0VA 1FJMA 3THOB 3DW8C 4FBQA 5INBA 3RL4A 3AV0A 3K7WC 1S3MA 1TCOA 3ICFA 1HP1A 2USHA 2Z06A 1T71A 1UTEA 4JA7A 2BQ8X 3GVEA 4B2OA 3C9FA 4V0VA 2HY1A 4NZVA 4H1SA 5GTUA 3RQZA 4WWLA 4FBKA 2WDDA 2QFPA 2QFRA 4JA9A 4TUIA 2GJUA 3TGHA 4FBWA 1S8EA 4V0XA 4ZX2A 3JYFA 2NYLC 3K7VC 2P6BA 5EQVA 1S95A 1M63A 2CV9A 3IVDA
chains in the Genus database with same CATH superfamily
1Z1BA 2EOIA 4O4KA 4R2CA 2EM7A 2DRPA 2EL4A 2V88A 3EPLA 2KONA 1PKPA 3RMPA 4DR7E 4F6NA 2EMHA 4HD0A 2IE4C 4R2SA 1SU1A 2EOHA 1J5EE 4L5NC 4DV6E 4OR9A 1AAYA 2E5LE 1T4LB 1A1FA 1Z2XA 4BC9A 4IJDA 4DV3E 4I8OA 1S70A 3DSCA 4L8NA 5AC4A 3FIGA 4F9AB 1S3NA 4DV4E 4HTGA 3KBPA 2M7QA 4HEIA 5A6AA 2YRMA 1WXRA 4LFAE 4IL1A 2N3HA 2UUBE 5JJTA 3VHTB 1XMOE 4H2GA 2WCC3 4JV5E 2EQ0A 1A1JA 1BBOA 4IS1C 1UF3A 1TN9A 1O0WA 2ELZA 2RS7A 5IWAE 4P7DA 2YTPA 4O5GA 5KL6A 1RQ0A 1DGCA 1MGTA 2IAEC 4ORCA 1IQSA 1BBGA 4ORAA 2LBSB 1QNTA 3ZU0A 4XPNA 4KKZA 2WDFA 4KBPA 1HNXE 2D9HA 4F54A 3ZTVA 4ZYDA 1ZR9A 2JVAA 2EOMA 1OIEA 4UT3A 2KKNA 2LJUA 4M2ZA 4RHBB 1XM7A 3QFKA 2VE7C 2EPAA 5T6JA 2EORA 2YTOA 3THNA 4DUZE 2ODRD 2KHXA 4F9BB 1HR0E 4Q7FA 5JPEA 2UUCE 4BHCA 2B7VA 3CK2A 3V4YA 2EMWA 4DHLA 2BCDA 3PSOA 3T1IA 4JI4E 2JOGA 1HNWE 3H62B 5LMNE 2NA2A 4Q28A 1N3GA 2EMGA 2EOYA 1YUIA 3H66A 5A6JA 2HGHA 3KZZA 2VQFE 3AV0A 3LLHA 1TCOA 2WBUA 1EH6A 1HNZE 2UXBE 2EZ6A 4DKKA 1J26A 4WX9A 2HY1A 4NZVA 4H1SA 2ODRC 2JXPA 2R76A 2LT7A 2QFPA 4GKKE 1A1HA 2LTRA 4FBWA 1ZBTA 2DIXA 2FV4B 1TF6A 1TF3A 3TQMA 2NYLC 2ENCA 2EPZA 2LRSA 2V8QB 1QFCA 2P6BA 2VRDA 4V0VA 5AASA 2K4VA 3EQ1A 3E7AA 4BMJA 4FCXA 5KL7A 3JAMC 1SR9A 2YU5A 2EQ3A 4H2IA 1ZU1A 4MLQA 2MC5A 1X48A 2FTXB 2HYPA 1OIDA 2MC6A 5KL2A 2EMFA 2NUEA 4JI7E 4LF5E 2LV2A 2L3CA 1WARA 1X47A 1N33E 2CTDA 2EPOA 2LTSA 2PRTA 1JK2A 2A22A 3C4BA 2EMYA 1UILA 4J6OA 5TSEA 1LLMC 4M9VC 4NXNE 2EPLX 4DV2E 4F2JC 2EPRA 2YPNA 4J8ZA 2JP9A 2ENAA 2EPXA 2B9DA 2YRKA 1RC7A 2EN2A 1MF8A 2J7JA 2QJCA 4BC7A 5FLXC 5A2QC 2EE8A 2YU8A 5B8IA 5LMUE 3MHHC 4JI2E 1WJPA 2DMYA 3IWCA 4P78A 1Z2WA 1WAO1 4YHHE 2LJHA 2VF1A 4MOVA 1PJSA 2EL6A 2V86A 2B7TA 4X62E 2MKNA 1N36E 4JI1E 4H2BA 1EH8A 3JTZA 3LMLA 1A1KA 2EMKA 1XNRE 4LF7E 1XZWA 1HPUA 2B3TB 2K7IA 2L92A 5ADZA 2YTEA 2HC5A 2JY9A 4LTYA 1WHQA 2EM2A 2RSMA 3AUZA 1XMQE 1N32E 2V89A 2MDRA 2EL5A 2XMOA 3H60A 3DSDA 2NPPC 3ADJA 2LMZA 2DLQA 4O43A 4B3TE 2HJJA 2Q8UA 4YKEA 3M99B 2GLIA 1STUA 4KHPE 2EM5A 4WXDA 1FJMA 4FBQA 5CFFE 2E72A 3K7WC 3HPZA 2EOFA 3ICFA 1HP1A 2USHA 1P47A 4LF6E 1UTEA 1X6EA 1PDAA 4DR3E 4DV0E 4JA7A 4GKJE 2BQ8X 3GVEA 4DV7E 4F6MA 2LE2A 3RQZA 5KL5A 4NXME 2ZO9B 4FBKA 3VK6A 3E0JA 2QFRA 4JA9A 2E1MA 2EM3A 5AE2A 3OTOE 4DUYE 4V0XA 3C6KA 4R8OA 5BR8E 3JYFA 1YYOA 2DLKA 2DSYA 2I13A 5EQVA 1QU6A 5A6KA 4WXCA 3BF2A 1HO5A 2ZBMA 2M1SA 2EMIA 1WRJA 2EPNA 2A25A 2YRHA 4AQYE 2JWOA 2WBTA 2EMBA 3HQ1A 2NXFA 1YPNA 3BGHA 4R03A 2BBGA 1UN6B 2Z1AA 3QFMA 1DI2A 2YTJA 2UUAE 3H09A 1NCSA 1QHWA 1UHZA 2EJ4A 4IYPC 2EOZA 2EMXA 4ZYHA 1X6FA 2RPCA 3J7Yp 5AE1A 2R17A 3H67A 3C5WC 3VYYA 1JK7A 1G2DC 4I5NC 3EPKA 4BCAA 1T4OA 4DV5E 3QG5C 4O24A 1IBLE 2JOXA 2DMIA 2JOBA 5C1VA 2UXDE 2EM0A 1SFEA 1PJQA 1X6HA 1A1IA 4GEQB 2DGCA 3E7BA 1L4SA 2R1FA 2V85A 1YYWA 4FK5C 2YTQA 4WSGA 1T38A 3PSNA 2V83A 2O8GA 3N5UA 2EM8A 4UWQA 1II7A 1A1LA 2DFJA 2F8BA 1XNQE 3ADGA 2Z72A 1EKZA 4WYQB 2CSHA 1ZBQA 4OOGC 4N4RB 2VQEE 4GZNC 2HHHE 2JR1A 1FJGE 4R2EA 3H63A 3MSWA 3MHSC 1WHNA 4MP0A 3EPJA 2H36X 1FKAE 3LL8A 2YTIA 2EWLA 3EGGA 4R2QA 2YTFA 1YYKA 1S3LA 2DB2A 2DXNA 1USHA 3JU0A 1V73A 4ZYGA 2UXCE 5J28A 4R2PA 5LLQA 2EPUA 1N34E 4UT3B 4R2DA 2YTNA 5IT9C 4B3RE 1X5WA 3K6QA 4DR5E 2YSOA 3QFNA 2YTDA 2WDEA 2DXLA 3OMLA 5IV8B 1AUIA 2AHDA 3THOB 3T1YE 3DW8C 1BB8A 4B3ME 3ECRA 2G7HA 2YZTA 1EH7A 1T71A 1I94E 2CPNA 1YZ9A 5A6BD 3D03A 1JK1A 3ADIA 3HPSA 2ZM6E 2BB8A 5GTUA 2M4IA 5KL4A 2EPKX 5IXMB 4TUIA 2EOJA 3C4TA 2GJUA 4Q35B 3TGHA 5A6BA 4R2RA 1IMUA 3HXLA 2JYAA 4DV1E 2UU9E 4LFBE 3J81C 3K7VC 2EOXA 3DJWA 2ELYA 4BS9A 1MEYC 4JI3E 1S95A 2CV9A 2BDXA 2KOUA 1YSAC 2EM4A 2EMAA 4JI8E 4X8WA 2MKDA 2YVTA 2LVHA 2YTGA 2LCEA 2YT4A 3FLOA 4BBYA 2L33A 2O8AA 2EQ1A 2IE3C 2EN8A 3H61A 4JI5E 1UBDC 3F6GA 3H69A 2L6MA 4V0WA 2HYOA 4TUGA 3J80C 3H68A 1AH5A 2EN4A 1IBME 1IQOA 2WZOA 2EN3A 4UT2A 4X66E 2ZOAA 2WBSA 3H64A 1W24A 3IVEA 3BBGA 4MLVA 4I5LC 4F0ZA 5AE3A 2EMLA 4LF9E 1U32A 2L8TA 1KBPA 2NABA 4DMIA 3BIDA 4ORBA 2NUFA 2EOQA 2MDGA 4DR6E 1OI8A 3HVQA 2RTXA 2EM9A 3J7AG 2N8XA 4G9JA 1T70A 2EMZA 3IB8A 1NEIA 1X49A 2N3GA 4R2AA 3IWBA 1YUJA 4JI6E 4OX9E 2YEQA 3QFOA 2GPIA 2RQLA 2CT1A 2IHR1 4KZSA 4WFTA 4X9JA 4DR1E 1GTKA 1X3CA 5DNYA 1IBKE 2LO3A 3FGAC 2GHFA 1ZAAC 1T4NA 2NUGA 1A1GA 1KYQA 2EM6A 2FGGA 2RSIA 5IOHA 2M9AA 2YSPA 1GZ6A 2EPPA 3EGHA 4ZVZA 2WDCA 4LACC 2I9IA 2EOEA 2V87A 2LUQA 1G2FC 5JPFA 1RMDA 4NHRA 1YFHA 4LFCE 4JYAE 3DF6A 4KWYA 5F3WA 4M30A 2F4VE 5A69A 2EPCA 4DSYA 1IT6A 3L00A 3RL3A 3UK3C 4H1YP 3VYXA 3IB7A 4F9CB 4WSPA 2EOOA 4RH8A 5LL6R 4DR4E 4LU9A 4DR2E 2EMCA 2EPMX 3P1XA 3EPHA 3ZOQB 4WPYA 4MOYA 3RL5A 1PJTA 3KZYA 4H2FA 2EN7A 3F6HA 3KWRA 4X65E 4DT2A 1B69A 1GQEA 3P71C 5HPEA 2RS6A 4LF8E 2NYMC 1G5BA 1NNWA 1T39A 4X64E 2ADRA 4M0VA 5AC5A 1F2IG 5INBA 4YY3E 3RL4A 2EN1A 2EP3A 5KL3A 1S3MA 2LUPB 4BHBA 2L2MA 2Z06A 3C6MA 4ZYEA 3C9FA 2JPAA 4B2OA 2L2KB 4WWLA 2WDDA 2YWQA 4K0KE 2ENHA 2EOSA 4B3SE 3HTXA 1S8EA 3ADLA 4JI0E 3T1HE 2EN6A 1DQ3A 4ZX2A 4LF4E 1KJKA 3IWDA 2L2NA 2L3JA 1M63A 3IVDA
chains in the Genus database with same CATH topology
2BDXA 1HO5A 3E7AA 4O4KA 4FCXA 2ZBMA 4H2IA 2YVTA 4HD0A 2IE4C 1SU1A 2HYPA 3FLOA 3H61A 1OIDA 2O8AA 2IE3C 4OR9A 2NXFA 3H69A 4V0WA 2HYOA 1WARA 4TUGA 3H68A 1Z2XA 2Z1AA 3QFMA 1S70A 3DSCA 4UT2A 1QHWA 2ZOAA 3H64A 1W24A 3IVEA 4I5LC 2A22A 4IYPC 4F0ZA 1S3NA 4J6OA 1U32A 3KBPA 1KBPA 2R17A 4IL1A 3H67A 3C5WC 4ORBA 5JJTA 1JK7A 4I5NC 1OI8A 4H2GA 3HVQA 3QG5C 4O24A 4G9JA 1T70A 3IB8A 5C1VA 2YEQA 3QFOA 1UF3A 3E7BA 1MF8A 2QJCA 4O5GA 5DNYA 3FGAC 3PSNA 2O8GA 3N5UA 2IAEC 4ORCA 4UWQA 5B8IA 5IOHA 1II7A 4ORAA 1Z2WA 3EGHA 1WAO1 2DFJA 2WDCA 4LACC 4MOVA 4ZVZA 3ZU0A 1QFCA 4XPNA 4KKZA 2WDFA 5JPFA 4KBPA 2Z72A 3ZTVA 4H2BA 1OIEA 4UT3A 5F3WA 2KKNA 4DSYA 1XZWA 1IT6A 1HPUA 3H63A 3RL3A 4H1YP 3IB7A 1XM7A 4MP0A 3QFKA 3LL8A 3EGGA 4LU9A 4LTYA 4MOYA 3THNA 1S3LA 3AUZA 2DXNA 3RL5A 1USHA 1V73A 5J28A 4Q7FA 5JPEA 4H2FA 2XMOA 4UT3B 3H60A 3CK2A 3DSDA 3V4YA 2NPPC 4DT2A 4DHLA 2BCDA 3P71C 3PSOA 4O43A 3T1IA 2NYMC 5HPEA 2JOGA 2Q8UA 3QFNA 4YKEA 1G5BA 1NNWA 3H62B 2WDEA 2DXLA 3H66A 1AUIA 2AHDA 4M0VA 1FJMA 3THOB 3DW8C 4FBQA 5INBA 3RL4A 3AV0A 3K7WC 1S3MA 1TCOA 3ICFA 1HP1A 2USHA 2Z06A 1T71A 1UTEA 4JA7A 3D03A 2BQ8X 3GVEA 4B2OA 3C9FA 4V0VA 2HY1A 4NZVA 4H1SA 5GTUA 3RQZA 4WWLA 2ZO9B 4FBKA 2WDDA 2QFPA 3E0JA 2QFRA 4JA9A 4TUIA 2GJUA 3TGHA 4FBWA 1S8EA 4V0XA 4ZX2A 3JYFA 2NYLC 3K7VC 2P6BA 5EQVA 1S95A 1M63A 2CV9A 3IVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDX A;  1HO5 A;  3E7A A;  4O4K A;  4FCX A;  2ZBM A;  4H2I A;  2YVT A;  4HD0 A;  2IE4 C;  1SU1 A;  2HYP A;  3H61 A;  1OID A;  2O8A A;  2IE3 C;  4OR9 A;  2NXF A;  3H69 A;  4V0W A;  2HYO A;  1WAR A;  4TUG A;  3H68 A;  1Z2X A;  2Z1A A;  3QFM A;  1S70 A;  3DSC A;  4UT2 A;  1QHW A;  3H64 A;  1W24 A;  3IVE A;  4I5L C;  2A22 A;  4IYP C;  4F0Z A;  1S3N A;  4J6O A;  1U32 A;  3KBP A;  1KBP A;  2R17 A;  4IL1 A;  3H67 A;  3C5W C;  4ORB A;  5JJT A;  1JK7 A;  4I5N C;  1OI8 A;  4H2G A;  3HVQ A;  3QG5 C;  4O24 A;  4G9J A;  1T70 A;  3IB8 A;  5C1V A;  3QFO A;  1UF3 A;  3E7B A;  1MF8 A;  2QJC A;  4O5G A;  5DNY A;  3FGA C;  3PSN A;  2O8G A;  3N5U A;  2IAE C;  4ORC A;  4UWQ A;  5B8I A;  5IOH A;  1II7 A;  4ORA A;  1Z2W A;  3EGH A;  1WAO 1;  2DFJ A;  2WDC A;  4LAC C;  4MOV A;  4ZVZ A;  3ZU0 A;  1QFC A;  4XPN A;  4KKZ A;  2WDF A;  5JPF A;  4KBP A;  2Z72 A;  3ZTV A;  4H2B A;  1OIE A;  4UT3 A;  5F3W A;  2KKN A;  4DSY A;  1XZW A;  1IT6 A;  1HPU A;  3H63 A;  3RL3 A;  4H1Y P;  3IB7 A;  1XM7 A;  4MP0 A;  3QFK A;  3LL8 A;  3EGG A;  4LU9 A;  4LTY A;  4MOY A;  3THN A;  1S3L A;  3AUZ A;  3RL5 A;  1USH A;  1V73 A;  5J28 A;  4Q7F A;  5JPE A;  4H2F A;  2XMO A;  4UT3 B;  3H60 A;  3CK2 A;  3DSD A;  3V4Y A;  2NPP C;  4DT2 A;  4DHL A;  2BCD A;  3P71 C;  3PSO A;  4O43 A;  3T1I A;  2NYM C;  5HPE A;  2JOG A;  2Q8U A;  3QFN A;  4YKE A;  1G5B A;  1NNW A;  3H62 B;  2WDE A;  3H66 A;  1AUI A;  2AHD A;  4M0V A;  1FJM A;  3THO B;  3DW8 C;  4FBQ A;  5INB A;  3RL4 A;  3AV0 A;  3K7W C;  1S3M A;  1TCO A;  3ICF A;  1HP1 A;  2USH A;  2Z06 A;  1T71 A;  1UTE A;  4JA7 A;  2BQ8 X;  3GVE A;  4B2O A;  3C9F A;  4V0V A;  2HY1 A;  4NZV A;  4H1S A;  5GTU A;  3RQZ A;  4WWL A;  4FBK A;  2WDD A;  2QFP A;  2QFR A;  4JA9 A;  4TUI A;  2GJU A;  3TGH A;  4FBW A;  1S8E A;  4V0X A;  4ZX2 A;  3JYF A;  2NYL C;  3K7V C;  2P6B A;  5EQV A;  1S95 A;  1M63 A;  2CV9 A;  3IVD A; 
#chains in the Genus database with same CATH topology
 1Z1B A;  2EOI A;  4O4K A;  4R2C A;  2EM7 A;  2DRP A;  2EL4 A;  2V88 A;  3EPL A;  2KON A;  1PKP A;  3RMP A;  4DR7 E;  4F6N A;  2EMH A;  4HD0 A;  2IE4 C;  4R2S A;  1SU1 A;  2EOH A;  1J5E E;  4L5N C;  4DV6 E;  4OR9 A;  1AAY A;  2E5L E;  1T4L B;  1A1F A;  1Z2X A;  4BC9 A;  4IJD A;  4DV3 E;  4I8O A;  1S70 A;  3DSC A;  4L8N A;  5AC4 A;  3FIG A;  4F9A B;  1S3N A;  4DV4 E;  4HTG A;  3KBP A;  2M7Q A;  4HEI A;  5A6A A;  2YRM A;  1WXR A;  4LFA E;  4IL1 A;  2N3H A;  2UUB E;  5JJT A;  3VHT B;  1XMO E;  4H2G A;  2WCC 3;  4JV5 E;  2EQ0 A;  1A1J A;  1BBO A;  4IS1 C;  1UF3 A;  1TN9 A;  1O0W A;  2ELZ A;  2RS7 A;  5IWA E;  4P7D A;  2YTP A;  4O5G A;  5KL6 A;  1RQ0 A;  1DGC A;  1MGT A;  2IAE C;  4ORC A;  1IQS A;  1BBG A;  4ORA A;  2LBS B;  1QNT A;  3ZU0 A;  4XPN A;  4KKZ A;  2WDF A;  4KBP A;  1HNX E;  2D9H A;  4F54 A;  3ZTV A;  4ZYD A;  1ZR9 A;  2JVA A;  2EOM A;  1OIE A;  4UT3 A;  2KKN A;  2LJU A;  4M2Z A;  4RHB B;  1XM7 A;  3QFK A;  2VE7 C;  2EPA A;  5T6J A;  2EOR A;  2YTO A;  3THN A;  4DUZ E;  2ODR D;  2KHX A;  4F9B B;  1HR0 E;  4Q7F A;  5JPE A;  2UUC E;  4BHC A;  2B7V A;  3CK2 A;  3V4Y A;  2EMW A;  4DHL A;  2BCD A;  3PSO A;  3T1I A;  4JI4 E;  2JOG A;  1HNW E;  3H62 B;  5LMN E;  2NA2 A;  4Q28 A;  1N3G A;  2EMG A;  2EOY A;  1YUI A;  3H66 A;  5A6J A;  2HGH A;  3KZZ A;  2VQF E;  3AV0 A;  3LLH A;  1TCO A;  2WBU A;  1EH6 A;  1HNZ E;  2UXB E;  2EZ6 A;  4DKK A;  1J26 A;  4WX9 A;  2HY1 A;  4NZV A;  4H1S A;  2ODR C;  2JXP A;  2R76 A;  2LT7 A;  2QFP A;  4GKK E;  1A1H A;  2LTR A;  4FBW A;  1ZBT A;  2DIX A;  2FV4 B;  1TF6 A;  1TF3 A;  3TQM A;  2NYL C;  2ENC A;  2EPZ A;  2LRS A;  2V8Q B;  1QFC A;  2P6B A;  2VRD A;  4V0V A;  5AAS A;  2K4V A;  3EQ1 A;  3E7A A;  4BMJ A;  4FCX A;  5KL7 A;  3JAM C;  1SR9 A;  2YU5 A;  2EQ3 A;  4H2I A;  1ZU1 A;  4MLQ A;  2MC5 A;  1X48 A;  2FTX B;  2HYP A;  1OID A;  2MC6 A;  5KL2 A;  2EMF A;  2NUE A;  4JI7 E;  4LF5 E;  2LV2 A;  2L3C A;  1WAR A;  1X47 A;  1N33 E;  2CTD A;  2EPO A;  2LTS A;  2PRT A;  1JK2 A;  2A22 A;  3C4B A;  2EMY A;  1UIL A;  4J6O A;  5TSE A;  1LLM C;  4M9V C;  4NXN E;  2EPL X;  4DV2 E;  4F2J C;  2EPR A;  2YPN A;  4J8Z A;  2JP9 A;  2ENA A;  2EPX A;  2B9D A;  2YRK A;  1RC7 A;  2EN2 A;  1MF8 A;  2J7J A;  2QJC A;  4BC7 A;  5FLX C;  5A2Q C;  2EE8 A;  2YU8 A;  5B8I A;  5LMU E;  3MHH C;  4JI2 E;  1WJP A;  2DMY A;  3IWC A;  4P78 A;  1Z2W A;  1WAO 1;  4YHH E;  2LJH A;  2VF1 A;  4MOV A;  1PJS A;  2EL6 A;  2V86 A;  2B7T A;  4X62 E;  2MKN A;  1N36 E;  4JI1 E;  4H2B A;  1EH8 A;  3JTZ A;  3LML A;  1A1K A;  2EMK A;  1XNR E;  4LF7 E;  1XZW A;  1HPU A;  2B3T B;  2K7I A;  2L92 A;  5ADZ A;  2YTE A;  2HC5 A;  2JY9 A;  4LTY A;  1WHQ A;  2EM2 A;  2RSM A;  3AUZ A;  1XMQ E;  1N32 E;  2V89 A;  2MDR A;  2EL5 A;  2XMO A;  3H60 A;  3DSD A;  2NPP C;  3ADJ A;  2LMZ A;  2DLQ A;  4O43 A;  4B3T E;  2HJJ A;  2Q8U A;  4YKE A;  3M99 B;  2GLI A;  1STU A;  4KHP E;  2EM5 A;  4WXD A;  1FJM A;  4FBQ A;  5CFF E;  2E72 A;  3K7W C;  3HPZ A;  2EOF A;  3ICF A;  1HP1 A;  2USH A;  1P47 A;  4LF6 E;  1UTE A;  1X6E A;  1PDA A;  4DR3 E;  4DV0 E;  4JA7 A;  4GKJ E;  2BQ8 X;  3GVE A;  4DV7 E;  4F6M A;  2LE2 A;  3RQZ A;  5KL5 A;  4NXM E;  2ZO9 B;  4FBK A;  3VK6 A;  3E0J A;  2QFR A;  4JA9 A;  2E1M A;  2EM3 A;  5AE2 A;  3OTO E;  4DUY E;  4V0X A;  3C6K A;  4R8O A;  5BR8 E;  3JYF A;  1YYO A;  2DLK A;  2DSY A;  2I13 A;  5EQV A;  1QU6 A;  5A6K A;  4WXC A;  3BF2 A;  1HO5 A;  2ZBM A;  2M1S A;  2EMI A;  1WRJ A;  2EPN A;  2A25 A;  2YRH A;  4AQY E;  2JWO A;  2WBT A;  2EMB A;  3HQ1 A;  2NXF A;  1YPN A;  3BGH A;  4R03 A;  2BBG A;  1UN6 B;  2Z1A A;  3QFM A;  1DI2 A;  2YTJ A;  2UUA E;  3H09 A;  1NCS A;  1QHW A;  1UHZ A;  2EJ4 A;  4IYP C;  2EOZ A;  2EMX A;  4ZYH A;  1X6F A;  2RPC A;  3J7Y p;  5AE1 A;  2R17 A;  3H67 A;  3C5W C;  3VYY A;  1JK7 A;  1G2D C;  4I5N C;  3EPK A;  4BCA A;  1T4O A;  4DV5 E;  3QG5 C;  4O24 A;  1IBL E;  2JOX A;  2DMI A;  2JOB A;  5C1V A;  2UXD E;  2EM0 A;  1SFE A;  1PJQ A;  1X6H A;  1A1I A;  4GEQ B;  2DGC A;  3E7B A;  1L4S A;  2R1F A;  2V85 A;  1YYW A;  4FK5 C;  2YTQ A;  4WSG A;  1T38 A;  3PSN A;  2V83 A;  2O8G A;  3N5U A;  2EM8 A;  4UWQ A;  1II7 A;  1A1L A;  2DFJ A;  2F8B A;  1XNQ E;  3ADG A;  2Z72 A;  1EKZ A;  4WYQ B;  2CSH A;  1ZBQ A;  4OOG C;  4N4R B;  2VQE E;  4GZN C;  2HHH E;  2JR1 A;  1FJG E;  4R2E A;  3H63 A;  3MSW A;  3MHS C;  1WHN A;  4MP0 A;  3EPJ A;  2H36 X;  1FKA E;  3LL8 A;  2YTI A;  2EWL A;  3EGG A;  4R2Q A;  2YTF A;  1YYK A;  1S3L A;  2DB2 A;  2DXN A;  1USH A;  3JU0 A;  1V73 A;  4ZYG A;  2UXC E;  5J28 A;  4R2P A;  5LLQ A;  2EPU A;  1N34 E;  4UT3 B;  4R2D A;  2YTN A;  5IT9 C;  4B3R E;  1X5W A;  3K6Q A;  4DR5 E;  2YSO A;  3QFN A;  2YTD A;  2WDE A;  2DXL A;  3OML A;  5IV8 B;  1AUI A;  2AHD A;  3THO B;  3T1Y E;  3DW8 C;  1BB8 A;  4B3M E;  3ECR A;  2G7H A;  2YZT A;  1EH7 A;  1T71 A;  1I94 E;  2CPN A;  1YZ9 A;  5A6B D;  3D03 A;  1JK1 A;  3ADI A;  3HPS A;  2ZM6 E;  2BB8 A;  5GTU A;  2M4I A;  5KL4 A;  2EPK X;  5IXM B;  4TUI A;  2EOJ A;  3C4T A;  2GJU A;  4Q35 B;  3TGH A;  5A6B A;  4R2R A;  1IMU A;  3HXL A;  2JYA A;  4DV1 E;  2UU9 E;  4LFB E;  3J81 C;  3K7V C;  2EOX A;  3DJW A;  2ELY A;  4BS9 A;  1MEY C;  4JI3 E;  1S95 A;  2CV9 A;  2BDX A;  2KOU A;  1YSA C;  2EM4 A;  2EMA A;  4JI8 E;  4X8W A;  2MKD A;  2YVT A;  2LVH A;  2YTG A;  2LCE A;  2YT4 A;  3FLO A;  4BBY A;  2L33 A;  2O8A A;  2EQ1 A;  2IE3 C;  2EN8 A;  3H61 A;  4JI5 E;  1UBD C;  3F6G A;  3H69 A;  2L6M A;  4V0W A;  2HYO A;  4TUG A;  3J80 C;  3H68 A;  1AH5 A;  2EN4 A;  1IBM E;  1IQO A;  2WZO A;  2EN3 A;  4UT2 A;  4X66 E;  2ZOA A;  2WBS A;  3H64 A;  1W24 A;  3IVE A;  3BBG A;  4MLV A;  4I5L C;  4F0Z A;  5AE3 A;  2EML A;  4LF9 E;  1U32 A;  2L8T A;  1KBP A;  2NAB A;  4DMI A;  3BID A;  4ORB A;  2NUF A;  2EOQ A;  2MDG A;  4DR6 E;  1OI8 A;  3HVQ A;  2RTX A;  2EM9 A;  3J7A G;  2N8X A;  4G9J A;  1T70 A;  2EMZ A;  3IB8 A;  1NEI A;  1X49 A;  2N3G A;  4R2A A;  3IWB A;  1YUJ A;  4JI6 E;  4OX9 E;  2YEQ A;  3QFO A;  2GPI A;  2RQL A;  2CT1 A;  2IHR 1;  4KZS A;  4WFT A;  4X9J A;  4DR1 E;  1GTK A;  1X3C A;  5DNY A;  1IBK E;  2LO3 A;  3FGA C;  2GHF A;  1ZAA C;  1T4N A;  2NUG A;  1A1G A;  1KYQ A;  2EM6 A;  2FGG A;  2RSI A;  5IOH A;  2M9A A;  2YSP A;  1GZ6 A;  2EPP A;  3EGH A;  4ZVZ A;  2WDC A;  4LAC C;  2I9I A;  2EOE A;  2V87 A;  2LUQ A;  1G2F C;  5JPF A;  1RMD A;  4NHR A;  1YFH A;  4LFC E;  4JYA E;  3DF6 A;  4KWY A;  5F3W A;  4M30 A;  2F4V E;  5A69 A;  2EPC A;  4DSY A;  1IT6 A;  3L00 A;  3RL3 A;  3UK3 C;  4H1Y P;  3VYX A;  3IB7 A;  4F9C B;  4WSP A;  2EOO A;  4RH8 A;  5LL6 R;  4DR4 E;  4LU9 A;  4DR2 E;  2EMC A;  2EPM X;  3P1X A;  3EPH A;  3ZOQ B;  4WPY A;  4MOY A;  3RL5 A;  1PJT A;  3KZY A;  4H2F A;  2EN7 A;  3F6H A;  3KWR A;  4X65 E;  4DT2 A;  1B69 A;  1GQE A;  3P71 C;  5HPE A;  2RS6 A;  4LF8 E;  2NYM C;  1G5B A;  1NNW A;  1T39 A;  4X64 E;  2ADR A;  4M0V A;  5AC5 A;  1F2I G;  5INB A;  4YY3 E;  3RL4 A;  2EN1 A;  2EP3 A;  5KL3 A;  1S3M A;  2LUP B;  4BHB A;  2L2M A;  2Z06 A;  3C6M A;  4ZYE A;  3C9F A;  2JPA A;  4B2O A;  2L2K B;  4WWL A;  2WDD A;  2YWQ A;  4K0K E;  2ENH A;  2EOS A;  4B3S E;  3HTX A;  1S8E A;  3ADL A;  4JI0 E;  3T1H E;  2EN6 A;  1DQ3 A;  4ZX2 A;  4LF4 E;  1KJK A;  3IWD A;  2L2N A;  2L3J A;  1M63 A;  3IVD A; 
#chains in the Genus database with same CATH homology
 2BDX A;  1HO5 A;  3E7A A;  4O4K A;  4FCX A;  2ZBM A;  4H2I A;  2YVT A;  4HD0 A;  2IE4 C;  1SU1 A;  2HYP A;  3FLO A;  3H61 A;  1OID A;  2O8A A;  2IE3 C;  4OR9 A;  2NXF A;  3H69 A;  4V0W A;  2HYO A;  1WAR A;  4TUG A;  3H68 A;  1Z2X A;  2Z1A A;  3QFM A;  1S70 A;  3DSC A;  4UT2 A;  1QHW A;  2ZOA A;  3H64 A;  1W24 A;  3IVE A;  4I5L C;  2A22 A;  4IYP C;  4F0Z A;  1S3N A;  4J6O A;  1U32 A;  3KBP A;  1KBP A;  2R17 A;  4IL1 A;  3H67 A;  3C5W C;  4ORB A;  5JJT A;  1JK7 A;  4I5N C;  1OI8 A;  4H2G A;  3HVQ A;  3QG5 C;  4O24 A;  4G9J A;  1T70 A;  3IB8 A;  5C1V A;  2YEQ A;  3QFO A;  1UF3 A;  3E7B A;  1MF8 A;  2QJC A;  4O5G A;  5DNY A;  3FGA C;  3PSN A;  2O8G A;  3N5U A;  2IAE C;  4ORC A;  4UWQ A;  5B8I A;  5IOH A;  1II7 A;  4ORA A;  1Z2W A;  3EGH A;  1WAO 1;  2DFJ A;  2WDC A;  4LAC C;  4MOV A;  4ZVZ A;  3ZU0 A;  1QFC A;  4XPN A;  4KKZ A;  2WDF A;  5JPF A;  4KBP A;  2Z72 A;  3ZTV A;  4H2B A;  1OIE A;  4UT3 A;  5F3W A;  2KKN A;  4DSY A;  1XZW A;  1IT6 A;  1HPU A;  3H63 A;  3RL3 A;  4H1Y P;  3IB7 A;  1XM7 A;  4MP0 A;  3QFK A;  3LL8 A;  3EGG A;  4LU9 A;  4LTY A;  4MOY A;  3THN A;  1S3L A;  3AUZ A;  2DXN A;  3RL5 A;  1USH A;  1V73 A;  5J28 A;  4Q7F A;  5JPE A;  4H2F A;  2XMO A;  4UT3 B;  3H60 A;  3CK2 A;  3DSD A;  3V4Y A;  2NPP C;  4DT2 A;  4DHL A;  2BCD A;  3P71 C;  3PSO A;  4O43 A;  3T1I A;  2NYM C;  5HPE A;  2JOG A;  2Q8U A;  3QFN A;  4YKE A;  1G5B A;  1NNW A;  3H62 B;  2WDE A;  2DXL A;  3H66 A;  1AUI A;  2AHD A;  4M0V A;  1FJM A;  3THO B;  3DW8 C;  4FBQ A;  5INB A;  3RL4 A;  3AV0 A;  3K7W C;  1S3M A;  1TCO A;  3ICF A;  1HP1 A;  2USH A;  2Z06 A;  1T71 A;  1UTE A;  4JA7 A;  3D03 A;  2BQ8 X;  3GVE A;  4B2O A;  3C9F A;  4V0V A;  2HY1 A;  4NZV A;  4H1S A;  5GTU A;  3RQZ A;  4WWL A;  2ZO9 B;  4FBK A;  2WDD A;  2QFP A;  3E0J A;  2QFR A;  4JA9 A;  4TUI A;  2GJU A;  3TGH A;  4FBW A;  1S8E A;  4V0X A;  4ZX2 A;  3JYF A;  2NYL C;  3K7V C;  2P6B A;  5EQV A;  1S95 A;  1M63 A;  2CV9 A;  3IVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...