4O5GA

Dna double-strand break repair pathway choice is directed by distinct mre11 nuclease activities
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
331
structure length
331
Chain Sequence
IHHHHHHVINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDFGEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLMGEIDNLVKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Double-Strand Break Repair Pathway Choice Is Directed by Distinct MRE11 Nuclease Activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein/inhibitor
molecule keywords Exonuclease, putative
total genus 102
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.210 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain DNA double-strand break repair nuclease 4o5gA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4o5gA01
4H2FA 1V73A 1JK7A 1U32A 1S8EA 4FBQA 3C5WC 3N5UA 4H2BA 4WWLA 4DSYA 2WDCA 4FBWA 3RL4A 2CV9A 4H1YP 5JPEA 3QG5C 5B8IA 3H62B 1IT6A 1HPUA 2BQ8X 4G9JA 4ZX2A 4MOVA 3V4YA 2IAEC 1HP1A 3IB8A 4H1SA 2Q8UA 2O8AA 3THOB 3PSOA 3H68A 1UF3A 4JA7A 2BDXA 2NPPC 4TUIA 4Q7FA 3E7BA 3HVQA 1XM7A 3CK2A 2NYLC 4O4KA 3K7VC 1Z2WA 1SU1A 3ZU0A 5EQVA 3H66A 4O43A 2WDDA 2DFJA 2HYOA 1OIDA 2IE3C 2USHA 4FBKA 3ICFA 4KKZA 4IYPC 1WARA 3ZTVA 3H63A 4IL1A 3DSCA 3DSDA 5IOHA 1HO5A 3C9FA 5JPFA 1QFCA 1XZWA 1M63A 2A22A 3FGAC 3AV0A 4MP0A 3JYFA 4I5NC 3H69A 4NZVA 4B2OA 1S70A 4UT2A 3THNA 1OIEA 1TCOA 4LTYA 3E7AA 5C1VA 3GVEA 2WDFA 4UWQA 3QFKA 4M0VA 3IVDA 1MF8A 1II7A 2ZBMA 5F3WA 4LACC 1KBPA 3IVEA 4UT3A 4O24A 3QFNA 1W24A 4DT2A 2QFRA 4ZVZA 4TUGA 3PSNA 1USHA 2GJUA 3H61A 4KBPA 2QJCA 2NXFA 1AUIA 3DW8C 4ORAA 1G5BA 4J6OA 2AHDA 5HPEA 5JJTA 1S3NA 1UTEA 4V0WA 5INBA 4LU9A 3RL3A 5J28A 4YKEA 1WAO1 3IB7A 1T70A 2JOGA 4HD0A 1Z2XA 2KKNA 4V0XA 3KBPA 3AUZA 5GTUA 2Z1AA 2NYMC 4UT3B 4O5GA 4V0VA 2IE4C 4I5LC 4H2IA 4ORBA 4OR9A 2QFPA 1NNWA 2Z06A 2Z72A 3K7WC 2O8GA 2HY1A 2P6BA 5DNYA 3H67A 4ORCA 2HYPA 4H2GA 2R17A 1T71A 4XPNA 3H64A 4MOYA 1S95A 3EGHA 3EGGA 3TGHA 1S3MA 3T1IA 3QFOA 2BCDA 2XMOA 3H60A 1FJMA 2WDEA 3QFMA 3RL5A 1OI8A 1S3LA 3P71C 3RQZA 4JA9A 4FCXA 4DHLA 3LL8A 4F0ZA 2YVTA 1QHWA
chains in the Genus database with same CATH superfamily
4P78A 2E72A 2A25A 5A6KA 2EN1A 2WBSA 2LUPB 4GEQB 2ENHA 2EM6A 3DF6A 1YZ9A 4DV0E 2M7QA 1HPUA 2BQ8X 4ZX2A 2F8BA 3V4YA 1A1FA 2LJHA 2MC6A 4LF5E 3RMPA 3H68A 1T4OA 2DMIA 2UU9E 4JA7A 2NPPC 2EOJA 3IWCA 2IHR1 4HTGA 4GKKE 1XM7A 4LF8E 1IMUA 3CK2A 3EQ1A 1Z2WA 2K7IA 2CSHA 2HC5A 2EOFA 3H66A 2WDDA 2B9DA 3C6KA 2LCEA 5EQVA 2EM4A 2N3HA 2EM5A 2LBSB 2MDRA 2USHA 4R2AA 1DGCA 1GTKA 4FBKA 3KZZA 3ADJA 2YTFA 2VQFE 2RSMA 2EOSA 2RS6A 2EMZA 3H09A 2EOOA 4DUZE 2EM2A 4JI1E 4X62E 5BR8E 1JK2A 4KHPE 2EP3A 2YWQA 2DLKA 2JOBA 1EKZA 3JYFA 4I5NC 3EPJA 4DV7E 4IJDA 1TCOA 2WCC3 5C1VA 3GVEA 4X9JA 3E0JA 2EN7A 2EN3A 2ODRD 4LACC 2YPNA 2EZ6A 2EPXA 4HEIA 4Q28A 4DR7E 4JI2E 2EPMX 2ZOAA 2EOZA 5LL6R 2KONA 1MEYC 2EMXA 4WPYA 4TUGA 2EQ0A 2NUGA 1XNRE 2KHXA 2ENAA 5AE2A 2N3GA 3H61A 3LMLA 4F54A 1ZBTA 2LTSA 2LO3A 4JI3E 2EN8A 3UK3C 5LMUE 1G5BA 2EOHA 5AC5A 2DXNA 3BBGA 4BBYA 2CTDA 3IWBA 3D03A 4HD0A 4R2PA 2NUFA 4DV5E 2KKNA 1X6FA 2RSIA 3AUZA 3BIDA 5A6BD 3LLHA 4M30A 1UHZA 2WZOA 5A6BA 2ELYA 2EM3A 4H2IA 2YRMA 2EOMA 2RPCA 1IBLE 4WX9A 2Z72A 3K7WC 2EMGA 2EMLA 2HJJA 3H67A 4XPNA 2YU8A 2L6MA 3OMLA 3EGHA 3EGGA 2EPPA 1S3MA 3T1IA 3QFMA 2EJ4A 3RL5A 2V88A 1FJMA 2VRDA 2YTQA 2VF1A 1OI8A 4KZSA 5TSEA 4GZNC 2RQLA 2EPRA 2L3JA 2FGGA 2HY1A 4DMIA 4H2FA 1N34E 1JK7A 1U32A 4FBQA 1QU6A 4WWLA 2EMKA 3N5UA 4DSYA 1ZAAC 2LT7A 2DMYA 3EPLA 5LLQA 2ZO9B 3QG5C 2NABA 2JYAA 1HR0E 4F6MA 3JU0A 4X66E 4DR6E 4NXNE 2IAEC 2FTXB 2UXBE 1HP1A 4H1SA 2V8QB 2Q8UA 3MSWA 4NHRA 4LFCE 2EMCA 1T4NA 3T1YE 1YYWA 2JR1A 2K4VA 4DV1E 2YEQA 3TQMA 4B3ME 1WRJA 3IWDA 2RS7A 2M4IA 2ODRC 1N3GA 4O43A 4WSPA 1RC7A 2EMAA 3K6QA 2L92A 1YYKA 1WJPA 2EL5A 2B7VA 1T39A 4IYPC 1WARA 2DB2A 4DR3E 4IL1A 3DSCA 3VHTB 1B69A 2V89A 4DR2E 5IOHA 4BCAA 5JPFA 1QFCA 1M63A 3FGAC 5AASA 3HTXA 2UXCE 1X3CA 2CPNA 1YSAC 4JI4E 4DR4E 4ZYEA 1S70A 1J5EE 4R2EA 3T1HE 4JI5E 4JI6E 3DJWA 4F9CB 4JI8E 4YHHE 2EN2A 1AAYA 1N32E 3IVDA 1MF8A 3JAMC 1STUA 1O0WA 2LE2A 4B3RE 2B7TA 2DIXA 1I94E 2ENCA 3J81C 4RH8A 3J80C 4KWYA 3QFNA 2YT4A 2YTDA 2UUCE 2EL4A 1X6EA 4X65E 1PDAA 4R2RA 5IV8B 3PSNA 2LTRA 2YTEA 2V87A 4ORAA 5AE3A 2JOXA 2AHDA 1TF6A 5KL3A 2ADRA 1A1HA 3OTOE 2EQ3A 2F4VE 1HNXE 1WHNA 4F9BB 2YSOA 1WAO1 4DR5E 1T4LB 5A2QC 2JOGA 3ADGA 2HGHA 1Z2XA 4WFTA 2Z1AA 4UT3B 4O5GA 1BBOA 2D9HA 4V0VA 1UN6B 2EM7A 4ORBA 1WXRA 2QFPA 1F2IG 2YSPA 4OR9A 1NNWA 2Z06A 4BS9A 4JI0E 2MKDA 2EE8A 4Q35B 4X64E 2O8GA 2L33A 2P6BA 1A1IA 4LF9E 2WBUA 4H2GA 4MOYA 2DXLA 2JVAA 2NUEA 2XMOA 3H60A 3RQZA 4DUYE 1IBME 1GZ6A 1A1GA 1AH5A 4FCXA 4JA9A 4GKJE 4R2CA 4DR1E 4F0ZA 4B3TE 2LJUA 4R2SA 2YRHA 2YVTA 1QHWA 4LF6E 2V86A 4H2BA 2EMHA 1BBGA 2WDCA 3F6GA 2CV9A 4FBWA 2L2MA 4H1YP 2YTNA 4DV3E 1YYOA 1MGTA 5B8IA 3H62B 1IT6A 2VE7C 4K0KE 2EORA 4MOVA 2YTIA 1A1JA 3EPHA 3IB8A 1RMDA 4N4RB 1HNZE 1ZR9A 1T38A 2H36X 2MDGA 1PJTA 2MC5A 1UF3A 2GLIA 2LV2A 4RHBB 2BDXA 5A6AA 2EOQA 2YTGA 4TUIA 1IBKE 1PJSA 3HVQA 1YUJA 3HPZA 5IWAE 4L8NA 1GQEA 3ZOQB 4ZYHA 4O4KA 2EOIA 5A69A 2PRTA 3C4BA 4BMJA 2DFJA 1DI2A 1EH6A 1X48A 1EH7A 1FKAE 3ICFA 4KKZA 1NCSA 1XNQE 3H63A 2JXPA 3ADLA 2EOEA 1EH8A 4M9VC 3DSDA 3C9FA 1XZWA 4R2QA 2A22A 1KYQA 1YFHA 4DV2E 2UXDE 2G7HA 4OX9E 1G2FC 4DKKA 2ZM6E 4NZVA 4BC7A 4B2OA 2B3TB 2EPAA 3MHHC 3THNA 4LTYA 4BC9A 3E7AA 2WDFA 4B3SE 2WBTA 4M0VA 3HPSA 2JPAA 3QFKA 4LF4E 1II7A 4LF7E 1RQ0A 2YTJA 1KBPA 2LVHA 2EPZA 3C4TA 4UT3A 4I8OA 2EMYA 4O24A 4JI7E 4L5NC 1Z1BA 5AC4A 2YTOA 4F6NA 3J7AG 4DT2A 1BB8A 1FJGE 4YY3E 4WXCA 1USHA 1TN9A 2UUBE 1HNWE 4DV4E 1AUIA 3DW8C 1NEIA 3FLOA 5HPEA 4LFBE 2ELZA 5JJTA 1S3NA 1SR9A 2L8TA 2EMWA 4MLVA 4DV6E 1UTEA 4LU9A 5CFFE 1G2DC 3KWRA 4V0WA 5INBA 5J28A 1PJQA 2M1SA 1X49A 4V0XA 2L3CA 3KZYA 3BF2A 2NYMC 5KL2A 1KJKA 4I5LC 3MHSC 5DNYA 2HHHE 4ORCA 2YTPA 1T71A 2R1FA 1UBDC 1ZBQA 4BHBA 1S95A 3TGHA 2BBGA 2V85A 1L4SA 2BCDA 3HQ1A 3QFOA 2GHFA 3P71C 2EM9A 5KL6A 1N36E 2BB8A 2FV4B 3H69A 4OOGC 4G9JA 1V73A 2EPNA 1S8EA 3C5WC 5LMNE 1YPNA 3RL4A 1DQ3A 2KOUA 3J7Yp 4BHCA 5JPEA 5FLXC 3HXLA 2VQEE 2GPIA 1TF3A 4WXDA 2EOXA 2L2NA 5KL7A 2EQ1A 4R8OA 1LLMC 2O8AA 3THOB 3PSOA 4MLQA 1X5WA 2R76A 2N8XA 2JY9A 2EMIA 4WSGA 4Q7FA 3E7BA 4F9AB 2EPOA 2I13A 4WYQB 2E5LE 1J26A 2NYLC 1A1KA 1SU1A 3ZU0A 4FK5C 4P7DA 4NXME 2HYOA 3JTZA 1OIDA 2IE3C 2DLQA 2YRKA 5AE1A 2L2KB 2LMZA 2J7JA 3ZTVA 4R2DA 2CT1A 2EMFA 2LRSA 2UUAE 4X8WA 1HO5A 2I9IA 1UILA 2EPLX 1IQOA 2JWOA 3AV0A 4MP0A 4F2JC 3VYYA 4UT2A 4LFAE 1OIEA 5KL4A 3BGHA 4UWQA 5A6JA 2EN4A 4IS1C 2EL6A 4ZYDA 1ZU1A 1QNTA 5KL5A 5F3WA 3C6MA 2ZBMA 3ADIA 3VK6A 1P47A 3IVEA 2EN6A 3F6HA 1W24A 2QFRA 2EPUA 4JYAE 4ZVZA 4J8ZA 2RTXA 2EPCA 2GJUA 4KBPA 3M99B 2QJCA 2DSYA 2NXFA 2DGCA 1PKPA 2EWLA 4J6OA 3P1XA 4ZYGA 3FIGA 5IXMB 2JP9A 2EPKX 2NA2A 4AQYE 1X6HA 4YKEA 3RL3A 2EM8A 1JK1A 3IB7A 3L00A 1T70A 3KBPA 5GTUA 2YZTA 3ECRA 5T6JA 1X47A 2E1MA 5IT9C 2YU5A 2IE4C 2V83A 1A1LA 1YUIA 4JV5E 3VYXA 2LUQA 2HYPA 2R17A 3H64A 2MKNA 4M2ZA 1WHQA 2EMBA 4R03A 2WDEA 2EOYA 2EM0A 1S3LA 1IQSA 2DRPA 4DHLA 2M9AA 1SFEA 3LL8A 1XMQE 5ADZA 1XMOE 1N33E 3K7VC 3EPKA
chains in the Genus database with same CATH topology
4H2FA 1V73A 1JK7A 1U32A 1S8EA 4FBQA 3C5WC 3N5UA 4H2BA 4WWLA 4DSYA 2WDCA 4FBWA 3RL4A 2CV9A 4H1YP 5JPEA 2ZO9B 3QG5C 5B8IA 3H62B 1IT6A 1HPUA 2BQ8X 4G9JA 4ZX2A 4MOVA 3V4YA 2IAEC 1HP1A 3IB8A 4H1SA 2Q8UA 2O8AA 3THOB 3PSOA 3H68A 1UF3A 4JA7A 2BDXA 2NPPC 4TUIA 4Q7FA 3E7BA 3HVQA 1XM7A 3CK2A 2YEQA 2NYLC 4O4KA 3K7VC 1Z2WA 1SU1A 3ZU0A 5EQVA 3H66A 4O43A 2WDDA 2DFJA 2HYOA 1OIDA 2IE3C 2USHA 4FBKA 3ICFA 4KKZA 4IYPC 1WARA 3ZTVA 3H63A 4IL1A 3DSCA 3DSDA 5IOHA 1HO5A 3C9FA 5JPFA 1QFCA 1XZWA 1M63A 2A22A 3FGAC 3AV0A 4MP0A 3JYFA 4I5NC 3H69A 4NZVA 4B2OA 1S70A 4UT2A 3THNA 1OIEA 1TCOA 4LTYA 3E7AA 5C1VA 3GVEA 2WDFA 4UWQA 3E0JA 3QFKA 4M0VA 3IVDA 1MF8A 1II7A 2ZBMA 5F3WA 4LACC 1KBPA 2YVTA 3IVEA 4UT3A 4O24A 2ZOAA 3QFNA 1W24A 4DT2A 2QFRA 4ZVZA 4TUGA 3PSNA 1USHA 2GJUA 3H61A 4KBPA 2QJCA 2NXFA 1AUIA 3DW8C 4ORAA 1G5BA 3FLOA 2DXNA 4J6OA 2AHDA 5HPEA 5JJTA 1S3NA 1UTEA 4V0WA 5INBA 4LU9A 3RL3A 5J28A 4YKEA 1WAO1 3IB7A 3D03A 4HD0A 1T70A 2JOGA 1Z2XA 2KKNA 4V0XA 3KBPA 3AUZA 5GTUA 2Z1AA 2NYMC 4UT3B 4O5GA 4V0VA 2IE4C 4I5LC 4H2IA 4ORBA 4OR9A 2QFPA 1NNWA 2Z06A 2Z72A 3K7WC 2O8GA 5DNYA 2P6BA 3H67A 4ORCA 2HYPA 4H2GA 2R17A 1T71A 4XPNA 3H64A 4MOYA 1S95A 2DXLA 3EGHA 3EGGA 3TGHA 1S3MA 3T1IA 3QFOA 2BCDA 2XMOA 3H60A 1FJMA 2WDEA 3QFMA 3RL5A 1OI8A 1S3LA 3P71C 3RQZA 4JA9A 4FCXA 4DHLA 3LL8A 4F0ZA 2HY1A 1QHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2F A;  1V73 A;  1JK7 A;  1U32 A;  1S8E A;  4FBQ A;  3C5W C;  3N5U A;  4H2B A;  4WWL A;  4DSY A;  2WDC A;  4FBW A;  3RL4 A;  2CV9 A;  4H1Y P;  5JPE A;  3QG5 C;  5B8I A;  3H62 B;  1IT6 A;  1HPU A;  2BQ8 X;  4G9J A;  4ZX2 A;  4MOV A;  3V4Y A;  2IAE C;  1HP1 A;  3IB8 A;  4H1S A;  2Q8U A;  2O8A A;  3THO B;  3PSO A;  3H68 A;  1UF3 A;  4JA7 A;  2BDX A;  2NPP C;  4TUI A;  4Q7F A;  3E7B A;  3HVQ A;  1XM7 A;  3CK2 A;  2NYL C;  4O4K A;  3K7V C;  1Z2W A;  1SU1 A;  3ZU0 A;  5EQV A;  3H66 A;  4O43 A;  2WDD A;  2DFJ A;  2HYO A;  1OID A;  2IE3 C;  2USH A;  4FBK A;  3ICF A;  4KKZ A;  4IYP C;  1WAR A;  3ZTV A;  3H63 A;  4IL1 A;  3DSC A;  3DSD A;  5IOH A;  1HO5 A;  3C9F A;  5JPF A;  1QFC A;  1XZW A;  1M63 A;  2A22 A;  3FGA C;  3AV0 A;  4MP0 A;  3JYF A;  4I5N C;  3H69 A;  4NZV A;  4B2O A;  1S70 A;  4UT2 A;  3THN A;  1OIE A;  1TCO A;  4LTY A;  3E7A A;  5C1V A;  3GVE A;  2WDF A;  4UWQ A;  3QFK A;  4M0V A;  3IVD A;  1MF8 A;  1II7 A;  2ZBM A;  5F3W A;  4LAC C;  1KBP A;  3IVE A;  4UT3 A;  4O24 A;  3QFN A;  1W24 A;  4DT2 A;  2QFR A;  4ZVZ A;  4TUG A;  3PSN A;  1USH A;  2GJU A;  3H61 A;  4KBP A;  2QJC A;  2NXF A;  1AUI A;  3DW8 C;  4ORA A;  1G5B A;  4J6O A;  2AHD A;  5HPE A;  5JJT A;  1S3N A;  1UTE A;  4V0W A;  5INB A;  4LU9 A;  3RL3 A;  5J28 A;  4YKE A;  1WAO 1;  3IB7 A;  1T70 A;  2JOG A;  4HD0 A;  1Z2X A;  2KKN A;  4V0X A;  3KBP A;  3AUZ A;  5GTU A;  2Z1A A;  2NYM C;  4UT3 B;  4O5G A;  4V0V A;  2IE4 C;  4I5L C;  4H2I A;  4ORB A;  4OR9 A;  2QFP A;  1NNW A;  2Z06 A;  2Z72 A;  3K7W C;  2O8G A;  2HY1 A;  2P6B A;  5DNY A;  3H67 A;  4ORC A;  2HYP A;  4H2G A;  2R17 A;  1T71 A;  4XPN A;  3H64 A;  4MOY A;  1S95 A;  3EGH A;  3EGG A;  3TGH A;  1S3M A;  3T1I A;  3QFO A;  2BCD A;  2XMO A;  3H60 A;  1FJM A;  2WDE A;  3QFM A;  3RL5 A;  1OI8 A;  1S3L A;  3P71 C;  3RQZ A;  4JA9 A;  4FCX A;  4DHL A;  3LL8 A;  4F0Z A;  2YVT A;  1QHW A; 
#chains in the Genus database with same CATH topology
 4P78 A;  2E72 A;  2A25 A;  5A6K A;  2EN1 A;  2WBS A;  2LUP B;  4GEQ B;  2ENH A;  2EM6 A;  3DF6 A;  1YZ9 A;  4DV0 E;  2M7Q A;  1HPU A;  2BQ8 X;  4ZX2 A;  2F8B A;  3V4Y A;  1A1F A;  2LJH A;  2MC6 A;  4LF5 E;  3RMP A;  3H68 A;  1T4O A;  2DMI A;  2UU9 E;  4JA7 A;  2NPP C;  2EOJ A;  3IWC A;  2IHR 1;  4HTG A;  4GKK E;  1XM7 A;  4LF8 E;  1IMU A;  3CK2 A;  3EQ1 A;  1Z2W A;  2K7I A;  2CSH A;  2HC5 A;  2EOF A;  3H66 A;  2WDD A;  2B9D A;  3C6K A;  2LCE A;  5EQV A;  2EM4 A;  2N3H A;  2EM5 A;  2LBS B;  2MDR A;  2USH A;  4R2A A;  1DGC A;  1GTK A;  4FBK A;  3KZZ A;  3ADJ A;  2YTF A;  2VQF E;  2RSM A;  2EOS A;  2RS6 A;  2EMZ A;  3H09 A;  2EOO A;  4DUZ E;  2EM2 A;  4JI1 E;  4X62 E;  5BR8 E;  1JK2 A;  4KHP E;  2EP3 A;  2YWQ A;  2DLK A;  2JOB A;  1EKZ A;  3JYF A;  4I5N C;  3EPJ A;  4DV7 E;  4IJD A;  1TCO A;  2WCC 3;  5C1V A;  3GVE A;  4X9J A;  3E0J A;  2EN7 A;  2EN3 A;  2ODR D;  4LAC C;  2YPN A;  2EZ6 A;  2EPX A;  4HEI A;  4Q28 A;  4DR7 E;  4JI2 E;  2EPM X;  2ZOA A;  2EOZ A;  5LL6 R;  2KON A;  1MEY C;  2EMX A;  4WPY A;  4TUG A;  2EQ0 A;  2NUG A;  1XNR E;  2KHX A;  2ENA A;  5AE2 A;  2N3G A;  3H61 A;  3LML A;  4F54 A;  1ZBT A;  2LTS A;  2LO3 A;  4JI3 E;  2EN8 A;  3UK3 C;  5LMU E;  1G5B A;  2EOH A;  5AC5 A;  2DXN A;  3BBG A;  4BBY A;  2CTD A;  3IWB A;  3D03 A;  4HD0 A;  4R2P A;  2NUF A;  4DV5 E;  2KKN A;  1X6F A;  2RSI A;  3AUZ A;  3BID A;  5A6B D;  3LLH A;  4M30 A;  1UHZ A;  2WZO A;  5A6B A;  2ELY A;  2EM3 A;  4H2I A;  2YRM A;  2EOM A;  2RPC A;  1IBL E;  4WX9 A;  2Z72 A;  3K7W C;  2EMG A;  2EML A;  2HJJ A;  3H67 A;  4XPN A;  2YU8 A;  2L6M A;  3OML A;  3EGH A;  3EGG A;  2EPP A;  1S3M A;  3T1I A;  3QFM A;  2EJ4 A;  3RL5 A;  2V88 A;  1FJM A;  2VRD A;  2YTQ A;  2VF1 A;  1OI8 A;  4KZS A;  5TSE A;  4GZN C;  2RQL A;  2EPR A;  2L3J A;  2FGG A;  2HY1 A;  4DMI A;  4H2F A;  1N34 E;  1JK7 A;  1U32 A;  4FBQ A;  1QU6 A;  4WWL A;  2EMK A;  3N5U A;  4DSY A;  1ZAA C;  2LT7 A;  2DMY A;  3EPL A;  5LLQ A;  2ZO9 B;  3QG5 C;  2NAB A;  2JYA A;  1HR0 E;  4F6M A;  3JU0 A;  4X66 E;  4DR6 E;  4NXN E;  2IAE C;  2FTX B;  2UXB E;  1HP1 A;  4H1S A;  2V8Q B;  2Q8U A;  3MSW A;  4NHR A;  4LFC E;  2EMC A;  1T4N A;  3T1Y E;  1YYW A;  2JR1 A;  2K4V A;  4DV1 E;  2YEQ A;  3TQM A;  4B3M E;  1WRJ A;  3IWD A;  2RS7 A;  2M4I A;  2ODR C;  1N3G A;  4O43 A;  4WSP A;  1RC7 A;  2EMA A;  3K6Q A;  2L92 A;  1YYK A;  1WJP A;  2EL5 A;  2B7V A;  1T39 A;  4IYP C;  1WAR A;  2DB2 A;  4DR3 E;  4IL1 A;  3DSC A;  3VHT B;  1B69 A;  2V89 A;  4DR2 E;  5IOH A;  4BCA A;  5JPF A;  1QFC A;  1M63 A;  3FGA C;  5AAS A;  3HTX A;  2UXC E;  1X3C A;  2CPN A;  1YSA C;  4JI4 E;  4DR4 E;  4ZYE A;  1S70 A;  1J5E E;  4R2E A;  3T1H E;  4JI5 E;  4JI6 E;  3DJW A;  4F9C B;  4JI8 E;  4YHH E;  2EN2 A;  1AAY A;  1N32 E;  3IVD A;  1MF8 A;  3JAM C;  1STU A;  1O0W A;  2LE2 A;  4B3R E;  2B7T A;  2DIX A;  1I94 E;  2ENC A;  3J81 C;  4RH8 A;  3J80 C;  4KWY A;  3QFN A;  2YT4 A;  2YTD A;  2UUC E;  2EL4 A;  1X6E A;  4X65 E;  1PDA A;  4R2R A;  5IV8 B;  3PSN A;  2LTR A;  2YTE A;  2V87 A;  4ORA A;  5AE3 A;  2JOX A;  2AHD A;  1TF6 A;  5KL3 A;  2ADR A;  1A1H A;  3OTO E;  2EQ3 A;  2F4V E;  1HNX E;  1WHN A;  4F9B B;  2YSO A;  1WAO 1;  4DR5 E;  1T4L B;  5A2Q C;  2JOG A;  3ADG A;  2HGH A;  1Z2X A;  4WFT A;  2Z1A A;  4UT3 B;  4O5G A;  1BBO A;  2D9H A;  4V0V A;  1UN6 B;  2EM7 A;  4ORB A;  1WXR A;  2QFP A;  1F2I G;  2YSP A;  4OR9 A;  1NNW A;  2Z06 A;  4BS9 A;  4JI0 E;  2MKD A;  2EE8 A;  4Q35 B;  4X64 E;  2O8G A;  2L33 A;  2P6B A;  1A1I A;  4LF9 E;  2WBU A;  4H2G A;  4MOY A;  2DXL A;  2JVA A;  2NUE A;  2XMO A;  3H60 A;  3RQZ A;  4DUY E;  1IBM E;  1GZ6 A;  1A1G A;  1AH5 A;  4FCX A;  4JA9 A;  4GKJ E;  4R2C A;  4DR1 E;  4F0Z A;  4B3T E;  2LJU A;  4R2S A;  2YRH A;  2YVT A;  1QHW A;  4LF6 E;  2V86 A;  4H2B A;  2EMH A;  1BBG A;  2WDC A;  3F6G A;  2CV9 A;  4FBW A;  2L2M A;  4H1Y P;  2YTN A;  4DV3 E;  1YYO A;  1MGT A;  5B8I A;  3H62 B;  1IT6 A;  2VE7 C;  4K0K E;  2EOR A;  4MOV A;  2YTI A;  1A1J A;  3EPH A;  3IB8 A;  1RMD A;  4N4R B;  1HNZ E;  1ZR9 A;  1T38 A;  2H36 X;  2MDG A;  1PJT A;  2MC5 A;  1UF3 A;  2GLI A;  2LV2 A;  4RHB B;  2BDX A;  5A6A A;  2EOQ A;  2YTG A;  4TUI A;  1IBK E;  1PJS A;  3HVQ A;  1YUJ A;  3HPZ A;  5IWA E;  4L8N A;  1GQE A;  3ZOQ B;  4ZYH A;  4O4K A;  2EOI A;  5A69 A;  2PRT A;  3C4B A;  4BMJ A;  2DFJ A;  1DI2 A;  1EH6 A;  1X48 A;  1EH7 A;  1FKA E;  3ICF A;  4KKZ A;  1NCS A;  1XNQ E;  3H63 A;  2JXP A;  3ADL A;  2EOE A;  1EH8 A;  4M9V C;  3DSD A;  3C9F A;  1XZW A;  4R2Q A;  2A22 A;  1KYQ A;  1YFH A;  4DV2 E;  2UXD E;  2G7H A;  4OX9 E;  1G2F C;  4DKK A;  2ZM6 E;  4NZV A;  4BC7 A;  4B2O A;  2B3T B;  2EPA A;  3MHH C;  3THN A;  4LTY A;  4BC9 A;  3E7A A;  2WDF A;  4B3S E;  2WBT A;  4M0V A;  3HPS A;  2JPA A;  3QFK A;  4LF4 E;  1II7 A;  4LF7 E;  1RQ0 A;  2YTJ A;  1KBP A;  2LVH A;  2EPZ A;  3C4T A;  4UT3 A;  4I8O A;  2EMY A;  4O24 A;  4JI7 E;  4L5N C;  1Z1B A;  5AC4 A;  2YTO A;  4F6N A;  3J7A G;  4DT2 A;  1BB8 A;  1FJG E;  4YY3 E;  4WXC A;  1USH A;  1TN9 A;  2UUB E;  1HNW E;  4DV4 E;  1AUI A;  3DW8 C;  1NEI A;  3FLO A;  5HPE A;  4LFB E;  2ELZ A;  5JJT A;  1S3N A;  1SR9 A;  2L8T A;  2EMW A;  4MLV A;  4DV6 E;  1UTE A;  4LU9 A;  5CFF E;  1G2D C;  3KWR A;  4V0W A;  5INB A;  5J28 A;  1PJQ A;  2M1S A;  1X49 A;  4V0X A;  2L3C A;  3KZY A;  3BF2 A;  2NYM C;  5KL2 A;  1KJK A;  4I5L C;  3MHS C;  5DNY A;  2HHH E;  4ORC A;  2YTP A;  1T71 A;  2R1F A;  1UBD C;  1ZBQ A;  4BHB A;  1S95 A;  3TGH A;  2BBG A;  2V85 A;  1L4S A;  2BCD A;  3HQ1 A;  3QFO A;  2GHF A;  3P71 C;  2EM9 A;  5KL6 A;  1N36 E;  2BB8 A;  2FV4 B;  3H69 A;  4OOG C;  4G9J A;  1V73 A;  2EPN A;  1S8E A;  3C5W C;  5LMN E;  1YPN A;  3RL4 A;  1DQ3 A;  2KOU A;  3J7Y p;  4BHC A;  5JPE A;  5FLX C;  3HXL A;  2VQE E;  2GPI A;  1TF3 A;  4WXD A;  2EOX A;  2L2N A;  5KL7 A;  2EQ1 A;  4R8O A;  1LLM C;  2O8A A;  3THO B;  3PSO A;  4MLQ A;  1X5W A;  2R76 A;  2N8X A;  2JY9 A;  2EMI A;  4WSG A;  4Q7F A;  3E7B A;  4F9A B;  2EPO A;  2I13 A;  4WYQ B;  2E5L E;  1J26 A;  2NYL C;  1A1K A;  1SU1 A;  3ZU0 A;  4FK5 C;  4P7D A;  4NXM E;  2HYO A;  3JTZ A;  1OID A;  2IE3 C;  2DLQ A;  2YRK A;  5AE1 A;  2L2K B;  2LMZ A;  2J7J A;  3ZTV A;  4R2D A;  2CT1 A;  2EMF A;  2LRS A;  2UUA E;  4X8W A;  1HO5 A;  2I9I A;  1UIL A;  2EPL X;  1IQO A;  2JWO A;  3AV0 A;  4MP0 A;  4F2J C;  3VYY A;  4UT2 A;  4LFA E;  1OIE A;  5KL4 A;  3BGH A;  4UWQ A;  5A6J A;  2EN4 A;  4IS1 C;  2EL6 A;  4ZYD A;  1ZU1 A;  1QNT A;  5KL5 A;  5F3W A;  3C6M A;  2ZBM A;  3ADI A;  3VK6 A;  1P47 A;  3IVE A;  2EN6 A;  3F6H A;  1W24 A;  2QFR A;  2EPU A;  4JYA E;  4ZVZ A;  4J8Z A;  2RTX A;  2EPC A;  2GJU A;  4KBP A;  3M99 B;  2QJC A;  2DSY A;  2NXF A;  2DGC A;  1PKP A;  2EWL A;  4J6O A;  3P1X A;  4ZYG A;  3FIG A;  5IXM B;  2JP9 A;  2EPK X;  2NA2 A;  4AQY E;  1X6H A;  4YKE A;  3RL3 A;  2EM8 A;  1JK1 A;  3IB7 A;  3L00 A;  1T70 A;  3KBP A;  5GTU A;  2YZT A;  3ECR A;  5T6J A;  1X47 A;  2E1M A;  5IT9 C;  2YU5 A;  2IE4 C;  2V83 A;  1A1L A;  1YUI A;  4JV5 E;  3VYX A;  2LUQ A;  2HYP A;  2R17 A;  3H64 A;  2MKN A;  4M2Z A;  1WHQ A;  2EMB A;  4R03 A;  2WDE A;  2EOY A;  2EM0 A;  1S3L A;  1IQS A;  2DRP A;  4DHL A;  2M9A A;  1SFE A;  3LL8 A;  1XMQ E;  5ADZ A;  1XMO E;  1N33 E;  3K7V C;  3EPK A; 
#chains in the Genus database with same CATH homology
 4H2F A;  1V73 A;  1JK7 A;  1U32 A;  1S8E A;  4FBQ A;  3C5W C;  3N5U A;  4H2B A;  4WWL A;  4DSY A;  2WDC A;  4FBW A;  3RL4 A;  2CV9 A;  4H1Y P;  5JPE A;  2ZO9 B;  3QG5 C;  5B8I A;  3H62 B;  1IT6 A;  1HPU A;  2BQ8 X;  4G9J A;  4ZX2 A;  4MOV A;  3V4Y A;  2IAE C;  1HP1 A;  3IB8 A;  4H1S A;  2Q8U A;  2O8A A;  3THO B;  3PSO A;  3H68 A;  1UF3 A;  4JA7 A;  2BDX A;  2NPP C;  4TUI A;  4Q7F A;  3E7B A;  3HVQ A;  1XM7 A;  3CK2 A;  2YEQ A;  2NYL C;  4O4K A;  3K7V C;  1Z2W A;  1SU1 A;  3ZU0 A;  5EQV A;  3H66 A;  4O43 A;  2WDD A;  2DFJ A;  2HYO A;  1OID A;  2IE3 C;  2USH A;  4FBK A;  3ICF A;  4KKZ A;  4IYP C;  1WAR A;  3ZTV A;  3H63 A;  4IL1 A;  3DSC A;  3DSD A;  5IOH A;  1HO5 A;  3C9F A;  5JPF A;  1QFC A;  1XZW A;  1M63 A;  2A22 A;  3FGA C;  3AV0 A;  4MP0 A;  3JYF A;  4I5N C;  3H69 A;  4NZV A;  4B2O A;  1S70 A;  4UT2 A;  3THN A;  1OIE A;  1TCO A;  4LTY A;  3E7A A;  5C1V A;  3GVE A;  2WDF A;  4UWQ A;  3E0J A;  3QFK A;  4M0V A;  3IVD A;  1MF8 A;  1II7 A;  2ZBM A;  5F3W A;  4LAC C;  1KBP A;  2YVT A;  3IVE A;  4UT3 A;  4O24 A;  2ZOA A;  3QFN A;  1W24 A;  4DT2 A;  2QFR A;  4ZVZ A;  4TUG A;  3PSN A;  1USH A;  2GJU A;  3H61 A;  4KBP A;  2QJC A;  2NXF A;  1AUI A;  3DW8 C;  4ORA A;  1G5B A;  3FLO A;  2DXN A;  4J6O A;  2AHD A;  5HPE A;  5JJT A;  1S3N A;  1UTE A;  4V0W A;  5INB A;  4LU9 A;  3RL3 A;  5J28 A;  4YKE A;  1WAO 1;  3IB7 A;  3D03 A;  4HD0 A;  1T70 A;  2JOG A;  1Z2X A;  2KKN A;  4V0X A;  3KBP A;  3AUZ A;  5GTU A;  2Z1A A;  2NYM C;  4UT3 B;  4O5G A;  4V0V A;  2IE4 C;  4I5L C;  4H2I A;  4ORB A;  4OR9 A;  2QFP A;  1NNW A;  2Z06 A;  2Z72 A;  3K7W C;  2O8G A;  5DNY A;  2P6B A;  3H67 A;  4ORC A;  2HYP A;  4H2G A;  2R17 A;  1T71 A;  4XPN A;  3H64 A;  4MOY A;  1S95 A;  2DXL A;  3EGH A;  3EGG A;  3TGH A;  1S3M A;  3T1I A;  3QFO A;  2BCD A;  2XMO A;  3H60 A;  1FJM A;  2WDE A;  3QFM A;  3RL5 A;  1OI8 A;  1S3L A;  3P71 C;  3RQZ A;  4JA9 A;  4FCX A;  4DHL A;  3LL8 A;  4F0Z A;  2HY1 A;  1QHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...