4TUGA

Crystal structure of mjmre11-dna2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA double-strand break repair protein Mre11
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 100
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tugA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tugA01
4B2OA 1UF3A 2O8AA 1II7A 1USHA 3IB8A 3RL5A 1KBPA 4YKEA 3QFKA 1HP1A 3H66A 4ZVZA 2Z06A 3PSNA 4ZX2A 3V4YA 5DNYA 1S70A 4HD0A 1QHWA 3K7WC 4IYPC 2WDEA 1MF8A 4ORCA 4DT2A 3GVEA 5IOHA 4ORBA 1WAO1 3JYFA 3DSCA 3PSOA 3E7BA 3TGHA 4MP0A 4O24A 2QFRA 4V0VA 4IL1A 4Q7FA 4UWQA 3AV0A 2O8GA 1U32A 4H2GA 3P71C 4TUIA 4O4KA 1XM7A 3E7AA 5J28A 4UT3A 3THNA 4NZVA 3H60A 1S8EA 2R17A 4LTYA 1FJMA 4JA7A 2HYOA 4OR9A 4O43A 2IAEC 2ZBMA 5JJTA 3RQZA 5B8IA 3AUZA 1HPUA 1AUIA 2A22A 4M0VA 3LL8A 4V0XA 1NNWA 2BQ8X 2DFJA 3ICFA 2NPPC 4J6OA 5F3WA 2P6BA 3T1IA 4DSYA 4UT2A 4FBWA 1T71A 4H2IA 5C1VA 5JPEA 5EQVA 1M63A 1JK7A 3QFMA 3EGGA 2GJUA 2CV9A 4ORAA 4O5GA 1S3NA 2IE3C 3CK2A 4XPNA 2WDDA 5HPEA 3QG5C 1TCOA 1SU1A 4V0WA 5INBA 2USHA 3RL3A 5JPFA 4I5LC 3DW8C 1T70A 2NYLC 4KKZA 4FBQA 1G5BA 3H63A 2HYPA 3H67A 3QFNA 4F0ZA 3FGAC 1Z2XA 2KKNA 1OI8A 3H68A 1OIDA 1WARA 2BCDA 3N5UA 1HO5A 3HVQA 2QJCA 2AHDA 2HY1A 4UT3B 3THOB 4MOVA 2YVTA 1V73A 2WDCA 4H2BA 3IVDA 3EGHA 2WDFA 3KBPA 4I5NC 4H1YP 3ZTVA 4G9JA 1S3LA 4FCXA 3H64A 4WWLA 2BDXA 3C5WC 1UTEA 3IB7A 3K7VC 1S95A 4LACC 2JOGA 3H62B 3H69A 2Z1AA 4H1SA 1IT6A 1S3MA 4FBKA 3DSDA 3RL4A 2NXFA 4JA9A 4H2FA 2NYMC 1OIEA 3H61A 3C9FA 3QFOA 2XMOA 4TUGA 4KBPA 2QFPA 1W24A 4LU9A 3ZU0A 1XZWA 3IVEA 2IE4C 4DHLA 4MOYA 2Q8UA 5GTUA 2Z72A 1Z2WA 1QFCA
chains in the Genus database with same CATH superfamily
3JTZA 4WSGA 4I8OA 4DV1E 1BBGA 1WHNA 5AC4A 1JK1A 1UILA 3JAMC 3H66A 4JI2E 4LF7E 2Z06A 5AE3A 3ADJA 2EM2A 5DNYA 1ZBTA 2WDEA 1BB8A 4LF6E 4LF5E 3ADLA 1MF8A 4ZYDA 3GVEA 2K7IA 1SFEA 4ORBA 1X6EA 2UUAE 2EMKA 2V87A 5IT9C 2VQEE 4L5NC 2FTXB 3EPJA 3DJWA 2WCC3 2KOUA 2EOFA 2QFRA 3VK6A 4DUYE 4UWQA 2GPIA 3OMLA 2O8GA 2EE8A 4R03A 5AASA 1GTKA 2N3GA 1HNWE 3P71C 1ZBQA 1XM7A 3E7AA 2YTGA 3BGHA 2RPCA 2ADRA 1T39A 3EPHA 3H60A 3J7Yp 4JA7A 2HYOA 2UXDE 5JJTA 1KYQA 3AUZA 1WXRA 2MDRA 4M0VA 2RQLA 3LL8A 1NNWA 2BQ8X 1GQEA 5LL6R 2M9AA 2R1FA 1RQ0A 4WSPA 5A2QC 3EPLA 3VHTB 3FIGA 4UT2A 1T71A 2R76A 1LLMC 1DGCA 3IWBA 1WJPA 1A1JA 3MHHC 2EPMX 1Z1BA 5EQVA 1M63A 3QFMA 4ORAA 4O5GA 2JR1A 1A1HA 2WDDA 4YHHE 3D03A 2EMCA 1J5EE 1FJGE 2USHA 2A25A 2I9IA 2HGHA 4K0KE 1X6HA 1DI2A 1EH7A 4ZYHA 2ENHA 4WPYA 3F6GA 1T70A 4BS9A 2DXLA 4R2RA 4DMIA 1F2IG 3BIDA 1UN6B 2L2KB 2L2NA 2VE7C 2L33A 4BC7A 3IWDA 1OIDA 2AHDA 1N36E 4X9JA 4N4RB 4BHCA 2CTDA 1G2FC 4LFAE 2FGGA 3C4BA 4DV0E 2ODRC 4DR5E 1V73A 2YU8A 2EL4A 1NCSA 2V89A 3IVDA 3BF2A 3KBPA 4I5NC 4B3SE 1O0WA 2MC5A 3DF6A 2BDXA 4WWLA 4P78A 2DMYA 1S95A 2JOGA 2V86A 1IT6A 1YSAC 2YTFA 1T4LB 3EQ1A 4JA9A 3ECRA 2EM8A 2XMOA 2JXPA 2LCEA 4JI3E 4OX9E 4DV7E 4X8WA 3ZU0A 1XZWA 2EOIA 1N34E 2Z72A 2IHR1 1QFCA 3M99B 1X49A 1YYOA 1STUA 4JI7E 3IB8A 4YKEA 2EMBA 4JI0E 4ZVZA 2KHXA 3HQ1A 2EMAA 1QHWA 3K7WC 4LF8E 4WFTA 4ORCA 4DT2A 3VYXA 1YYWA 4AQYE 1WAO1 2EOSA 3JYFA 1B69A 3DSCA 3PSOA 1A1LA 2EL6A 2EPLX 2RSIA 4NHRA 5KL3A 4X65E 5KL7A 4O24A 4FK5C 4V0VA 3AV0A 1EH6A 4H2GA 4M2ZA 4O4KA 2JPAA 2EPRA 2EMZA 1GZ6A 2YT4A 4X62E 4NZVA 1J26A 2MC6A 1EKZA 2EOZA 3E0JA 2MDGA 2UXCE 2EOEA 2IAEC 1TN9A 2DLKA 2A22A 2NABA 4P7DA 4V0XA 4GEQB 5A6AA 3ICFA 1RMDA 2JWOA 4J6OA 2V88A 2LJUA 4FBWA 2EMFA 4DR2E 2ZO9B 4DR7E 2EN4A 5TSEA 2EMYA 2HC5A 2EP3A 1XMOE 1IMUA 2GJUA 3EGGA 2LUPB 3CK2A 3ADIA 2LJHA 4XPNA 5HPEA 2EJ4A 2YRMA 2RS7A 1SU1A 5INBA 3RL3A 4HTGA 5AE2A 2EPAA 2EPOA 2EMXA 4X64E 5JPFA 3HTXA 4L8NA 1SR9A 2NYLC 4KKZA 4WX9A 4J8ZA 3H67A 2YTOA 3FGAC 2D9HA 2BCDA 3N5UA 4BMJA 2WBSA 1UBDC 2DLQA 1DQ3A 1PDAA 4B3RE 2HY1A 2YEQA 2GLIA 2EOYA 1XNQE 1PJTA 2ZOAA 4UT3B 2YVTA 2RS6A 2L6MA 3JU0A 4F6NA 2JY9A 4GZNC 4JV5E 3EGHA 4JI6E 4R2DA 4OOGC 1RC7A 1ZU1A 3ZTVA 4G9JA 1T4OA 5IWAE 1S3LA 3H64A 4DV3E 1PJSA 3C5WC 4M9VC 2DXNA 3H62B 3H69A 2Z1AA 1S3MA 3DSDA 2E1MA 2YSOA 1X5WA 2NYMC 2V8QB 2B3TB 3L00A 4R2EA 2EN6A 1IQSA 1I94E 2NUGA 5GTUA 4DKKA 4DV6E 2YZTA 4DR1E 2EMLA 2H36X 2EQ1A 4B2OA 5AE1A 4F9AB 3TQMA 2CPNA 3RMPA 1XNRE 2VF1A 2V85A 2JOXA 4BHBA 2EPZA 1HR0E 1HP1A 5A6JA 4HEIA 4R2SA 4BBYA 3V4YA 2G7HA 1S70A 1A1GA 2EZ6A 4HD0A 2KONA 4LF9E 2YRHA 4F9CB 2WBUA 2YU5A 5IOHA 1IBME 4LFCE 5ADZA 1HNXE 3LLHA 2JVAA 2EN2A 4RHBB 4MP0A 2YTIA 1FKAE 4Q7FA 2F8BA 3MHSC 2RSMA 2EQ0A 2HHHE 2LO3A 2JP9A 4TUIA 3C6MA 2EQ3A 1ZR9A 4YY3E 4DR3E 3KZZA 4UT3A 3THNA 3F6HA 2EM3A 5A6BD 1S8EA 2R17A 2LUQA 2WZOA 4OR9A 4O43A 4IS1C 4GKJE 2WBTA 5LMNE 5B8IA 4R2AA 1HPUA 5KL2A 1XMQE 3P1XA 4X66E 2ENCA 2JOBA 2M1SA 2BBGA 5KL4A 5F3WA 1YPNA 4DSYA 4ZYGA 2YTNA 2J7JA 2B9DA 2ODRD 5JPEA 3OTOE 1JK7A 2L2MA 2VRDA 2CV9A 4DR6E 4LFBE 1QNTA 4MLVA 3T1HE 5T6JA 1TCOA 4KZSA 4F9BB 4R2CA 4M30A 3FLOA 2EOJA 3VYYA 2LRSA 2EMGA 4WYQB 2LTRA 3DW8C 2UUBE 2NUEA 4F54A 1T38A 2YRKA 2LMZA 2HYPA 3QFNA 4RH8A 1Z2XA 1P47A 1OI8A 2YTEA 4KWYA 2L3JA 5KL6A 2YTQA 2JYAA 4ZYEA 2M4IA 4H2BA 2WDFA 5FLXC 2EM7A 4F2JC 3H09A 1YFHA 2E5LE 4BC9A 4FCXA 1EH8A 2EM9A 3IB7A 3ADGA 2VQFE 2EPNA 1N3GA 4F6MA 4GKKE 2CT1A 4FBKA 2N8XA 5CFFE 2EMHA 2NXFA 3RL4A 5IXMB 4H2FA 1OIEA 3H61A 2PRTA 3C9FA 3QFOA 2YTJA 1X3CA 3J7AG 4TUGA 2LVHA 3HPSA 4KBPA 1W24A 5A6KA 2LTSA 1A1KA 4DHLA 3T1YE 1Z2WA 1PJQA 5BR8E 3KZYA 3ZOQB 3MSWA 1WHQA 1UF3A 2EPXA 1II7A 2ELZA 2DIXA 4JI1E 1USHA 1PKPA 2O8AA 1KBPA 3RL5A 3EPKA 3IWCA 3QFKA 2ZM6E 2EPKX 3PSNA 4ZX2A 2YSPA 4R2QA 2N3HA 2EWLA 4IYPC 2EOQA 3J81C 4DV4E 1UHZA 2EM5A 2EPPA 2EOHA 3J80C 2EOMA 3HPZA 4IJDA 3E7BA 3TGHA 2EN1A 4DV2E 2B7VA 2EN3A 2V83A 1AH5A 4IL1A 1YUJA 4LF4E 1U32A 1IBLE 4B3TE 2EORA 2GHFA 3C4TA 1YZ9A 2EMWA 4DR4E 2HJJA 5J28A 2FV4B 1L4SA 4LTYA 1A1IA 3KWRA 1FJMA 4JYAE 2EM6A 2DGCA 2MKNA 2ZBMA 2EOOA 5A69A 1IBKE 4B3ME 3RQZA 2EPCA 5IV8B 1AUIA 1MGTA 2ELYA 2EOXA 5LMUE 2UU9E 2DFJA 2EM4A 4JI4E 1X48A 1JK2A 2UUCE 2NPPC 1KJKA 2P6BA 3T1IA 2L8TA 4KHPE 4H2IA 2DSYA 2ENAA 5A6BA 4DV5E 5C1VA 4MLQA 1G2DC 3UK3C 2RTXA 4NXME 2EPUA 1ZAAC 1YYKA 2I13A 1N32E 1S3NA 4JI8E 2IE3C 2K4VA 1HNZE 3QG5C 4V0WA 2EMIA 1QU6A 3HXLA 2YTDA 2MKDA 2DRPA 1N33E 2L3CA 2LT7A 2DB2A 2EN8A 4Q35B 3K6QA 2LBSB 4I5LC 1YUIA 2EM0A 2M7QA 1TF3A 3C6KA 4FBQA 1G5BA 3BBGA 3H63A 4F0ZA 1MEYC 5KL5A 4NXNE 2KKNA 3H68A 2EL5A 4R8OA 2EN7A 1WARA 1IQOA 1WRJA 1HO5A 2QJCA 3HVQA 5LLQA 4JI5E 4R2PA 5AC5A 3THOB 2DMIA 4MOVA 2WDCA 1AAYA 1TF6A 2L92A 2YTPA 1BBOA 4H1YP 2B7TA 4WXCA 4BCAA 4DUZE 1UTEA 2YPNA 1X47A 3K7VC 4LACC 1X6FA 1A1FA 4Q28A 4H1SA 2YWQA 2E72A 2F4VE 2LE2A 2BB8A 2LV2A 2NUFA 2CSHA 2NA2A 1NEIA 2QFPA 4LU9A 3IVEA 2IE4C 4MOYA 2Q8UA 4WXDA 3LMLA 2UXBE 1T4NA
chains in the Genus database with same CATH topology
3JTZA 4I8OA 4DV1E 1WHNA 1UILA 3JAMC 3H66A 4JI2E 4LF7E 2Z06A 5AE3A 3ADJA 5DNYA 1ZBTA 2WDEA 4LF6E 4LF5E 3ADLA 1MF8A 3GVEA 4ORBA 2UUAE 2V87A 5IT9C 2VQEE 4L5NC 2FTXB 3DJWA 2KOUA 2QFRA 3VK6A 4DUYE 4UWQA 3OMLA 2O8GA 4R03A 5AASA 2N3GA 1HNWE 3P71C 1ZBQA 1XM7A 3E7AA 3H60A 3J7Yp 4JA7A 2HYOA 2UXDE 5JJTA 3AUZA 1WXRA 2MDRA 4M0VA 3LL8A 1NNWA 2BQ8X 1GQEA 5LL6R 1RQ0A 4WSPA 5A2QC 3FIGA 4UT2A 1T71A 3IWBA 5EQVA 1M63A 3QFMA 4ORAA 4O5GA 2JR1A 2WDDA 4YHHE 3D03A 1J5EE 1FJGE 2USHA 4K0KE 1DI2A 4WPYA 3F6GA 1T70A 4BS9A 2DXLA 4DMIA 2L2KB 2L2NA 2VE7C 2L33A 4BC7A 3IWDA 1OIDA 2AHDA 1N36E 4LFAE 2FGGA 3C4BA 4DV0E 2ODRC 4DR5E 1V73A 2V89A 3IVDA 3KBPA 4I5NC 4B3SE 1O0WA 2MC5A 3DF6A 2BDXA 4WWLA 4P78A 2DMYA 1S95A 2JOGA 2V86A 1IT6A 1T4LB 4JA9A 2XMOA 4JI3E 4OX9E 4DV7E 4X8WA 3ZU0A 1XZWA 1N34E 2Z72A 2IHR1 1QFCA 1X49A 1YYOA 1STUA 4JI7E 3IB8A 4YKEA 4JI0E 4ZVZA 2KHXA 3HQ1A 1QHWA 3K7WC 4LF8E 4WFTA 4ORCA 4DT2A 3VYXA 1YYWA 4AQYE 1WAO1 3JYFA 3DSCA 3PSOA 4X65E 4O24A 4V0VA 3AV0A 4H2GA 4M2ZA 4O4KA 1GZ6A 2YT4A 4X62E 4NZVA 1J26A 2MC6A 1EKZA 3E0JA 2UXCE 2IAEC 2A22A 4P7DA 4V0XA 4GEQB 3ICFA 2JWOA 4J6OA 2V88A 4FBWA 4DR2E 2ZO9B 4DR7E 1XMOE 3EGGA 2GJUA 2LUPB 3CK2A 3ADIA 2LJHA 4XPNA 5HPEA 2RS7A 1SU1A 5INBA 3RL3A 5AE2A 5JPFA 4X64E 3HTXA 4L8NA 1SR9A 2NYLC 4KKZA 4J8ZA 3H67A 3FGAC 2BCDA 3N5UA 4BMJA 1DQ3A 4B3RE 2HY1A 2YEQA 1XNQE 2ZOAA 4UT3B 2YVTA 2RS6A 2L6MA 3JU0A 2JY9A 4JV5E 3EGHA 4JI6E 4OOGC 1RC7A 3ZTVA 4G9JA 1T4OA 5IWAE 1S3LA 3H64A 4DV3E 3C5WC 2DXNA 3H62B 3H69A 2Z1AA 1S3MA 3DSDA 2E1MA 2NYMC 2V8QB 2B3TB 1I94E 2NUGA 5GTUA 4DKKA 4DV6E 4DR1E 2YZTA 2H36X 4B2OA 5AE1A 4F9AB 2CPNA 3RMPA 1XNRE 2VF1A 2V85A 2JOXA 1HP1A 1HR0E 4BBYA 3V4YA 2G7HA 1S70A 2EZ6A 4HD0A 2KONA 4LF9E 4F9CB 5IOHA 1IBME 4LFCE 5ADZA 1HNXE 3LLHA 2JVAA 4MP0A 1FKAE 4Q7FA 2F8BA 2RSMA 2HHHE 4TUIA 4YY3E 4DR3E 4UT3A 3THNA 3F6HA 1S8EA 2R17A 2LUQA 2WZOA 4OR9A 4O43A 4GKJE 5LMNE 5B8IA 1HPUA 1XMQE 3P1XA 4X66E 2JOBA 2M1SA 5F3WA 4DSYA 2B9DA 2ODRD 5JPEA 3OTOE 1JK7A 2L2MA 2CV9A 4DR6E 4LFBE 3T1HE 5T6JA 1TCOA 4KZSA 4F9BB 3FLOA 4M30A 3VYYA 2LRSA 4WYQB 2LTRA 3DW8C 2UUBE 2NUEA 4F54A 2LMZA 2HYPA 3QFNA 1Z2XA 1OI8A 2L3JA 2M4IA 4H2BA 2WDFA 5FLXC 3H09A 2E5LE 4BC9A 4FCXA 3IB7A 3ADGA 2VQFE 4GKKE 4FBKA 5CFFE 3RL4A 2NXFA 4H2FA 1OIEA 3H61A 3C9FA 3QFOA 3J7AG 4TUGA 3HPSA 4KBPA 1W24A 2LTSA 4DHLA 3T1YE 1Z2WA 5BR8E 3ZOQB 3MSWA 1WHQA 1UF3A 2O8AA 1II7A 1USHA 2DIXA 4JI1E 1PKPA 3RL5A 1KBPA 3QFKA 3IWCA 2ZM6E 3PSNA 4ZX2A 2N3HA 2EWLA 4IYPC 3J81C 4DV4E 1UHZA 3J80C 3HPZA 3E7BA 3TGHA 4DV2E 2B7VA 2V83A 4IL1A 4LF4E 1U32A 1IBLE 4B3TE 3C4TA 1YZ9A 4DR4E 5J28A 2FV4B 4LTYA 3KWRA 1FJMA 4JYAE 2ZBMA 1IBKE 4B3ME 3RQZA 1AUIA 5LMUE 2UU9E 2DFJA 4JI4E 1X48A 2UUCE 2NPPC 2P6BA 3T1IA 2L8TA 4KHPE 4H2IA 2DSYA 4DV5E 5C1VA 2RTXA 4NXME 1YYKA 1N32E 1S3NA 4JI8E 2IE3C 2K4VA 1HNZE 3QG5C 4V0WA 1QU6A 3HXLA 1N33E 2L3CA 2DB2A 3K6QA 2LBSB 4I5LC 2M7QA 4FBQA 1G5BA 3H63A 4F0ZA 4NXNE 2KKNA 3H68A 4R8OA 1WARA 1HO5A 3HVQA 2QJCA 4JI5E 3THOB 4MOVA 2WDCA 2L92A 4H1YP 2B7TA 4BCAA 4DUZE 1UTEA 1X47A 3K7VC 4LACC 4Q28A 4H1SA 2F4VE 2LE2A 2NUFA 2NA2A 2QFPA 4LU9A 3IVEA 2IE4C 4MOYA 2Q8UA 3LMLA 2UXBE 1T4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B2O A;  1UF3 A;  2O8A A;  1II7 A;  1USH A;  3IB8 A;  3RL5 A;  1KBP A;  4YKE A;  3QFK A;  1HP1 A;  3H66 A;  4ZVZ A;  2Z06 A;  3PSN A;  4ZX2 A;  3V4Y A;  5DNY A;  1S70 A;  4HD0 A;  1QHW A;  3K7W C;  4IYP C;  2WDE A;  1MF8 A;  4ORC A;  4DT2 A;  3GVE A;  5IOH A;  4ORB A;  1WAO 1;  3JYF A;  3DSC A;  3PSO A;  3E7B A;  3TGH A;  4MP0 A;  4O24 A;  2QFR A;  4V0V A;  4IL1 A;  4Q7F A;  4UWQ A;  3AV0 A;  2O8G A;  1U32 A;  4H2G A;  3P71 C;  4TUI A;  4O4K A;  1XM7 A;  3E7A A;  5J28 A;  4UT3 A;  3THN A;  4NZV A;  3H60 A;  1S8E A;  2R17 A;  4LTY A;  1FJM A;  4JA7 A;  2HYO A;  4OR9 A;  4O43 A;  2IAE C;  2ZBM A;  5JJT A;  3RQZ A;  5B8I A;  3AUZ A;  1HPU A;  1AUI A;  2A22 A;  4M0V A;  3LL8 A;  4V0X A;  1NNW A;  2BQ8 X;  2DFJ A;  3ICF A;  2NPP C;  4J6O A;  5F3W A;  2P6B A;  3T1I A;  4DSY A;  4UT2 A;  4FBW A;  1T71 A;  4H2I A;  5C1V A;  5JPE A;  5EQV A;  1M63 A;  1JK7 A;  3QFM A;  3EGG A;  2GJU A;  2CV9 A;  4ORA A;  4O5G A;  1S3N A;  2IE3 C;  3CK2 A;  4XPN A;  2WDD A;  5HPE A;  3QG5 C;  1TCO A;  1SU1 A;  4V0W A;  5INB A;  2USH A;  3RL3 A;  5JPF A;  4I5L C;  3DW8 C;  1T70 A;  2NYL C;  4KKZ A;  4FBQ A;  1G5B A;  3H63 A;  2HYP A;  3H67 A;  3QFN A;  4F0Z A;  3FGA C;  1Z2X A;  2KKN A;  1OI8 A;  3H68 A;  1OID A;  1WAR A;  2BCD A;  3N5U A;  1HO5 A;  3HVQ A;  2QJC A;  2AHD A;  2HY1 A;  4UT3 B;  3THO B;  4MOV A;  2YVT A;  1V73 A;  2WDC A;  4H2B A;  3IVD A;  3EGH A;  2WDF A;  3KBP A;  4I5N C;  4H1Y P;  3ZTV A;  4G9J A;  1S3L A;  4FCX A;  3H64 A;  4WWL A;  2BDX A;  3C5W C;  1UTE A;  3IB7 A;  3K7V C;  1S95 A;  4LAC C;  2JOG A;  3H62 B;  3H69 A;  2Z1A A;  4H1S A;  1IT6 A;  1S3M A;  4FBK A;  3DSD A;  3RL4 A;  2NXF A;  4JA9 A;  4H2F A;  2NYM C;  1OIE A;  3H61 A;  3C9F A;  3QFO A;  2XMO A;  4TUG A;  4KBP A;  2QFP A;  1W24 A;  4LU9 A;  3ZU0 A;  1XZW A;  3IVE A;  2IE4 C;  4DHL A;  4MOY A;  2Q8U A;  5GTU A;  2Z72 A;  1Z2W A;  1QFC A; 
#chains in the Genus database with same CATH topology
 3JTZ A;  4WSG A;  4I8O A;  4DV1 E;  1BBG A;  1WHN A;  5AC4 A;  1JK1 A;  1UIL A;  3JAM C;  3H66 A;  4JI2 E;  4LF7 E;  2Z06 A;  5AE3 A;  3ADJ A;  2EM2 A;  5DNY A;  1ZBT A;  2WDE A;  1BB8 A;  4LF6 E;  4LF5 E;  3ADL A;  1MF8 A;  4ZYD A;  3GVE A;  2K7I A;  1SFE A;  4ORB A;  1X6E A;  2UUA E;  2EMK A;  2V87 A;  5IT9 C;  2VQE E;  4L5N C;  2FTX B;  3EPJ A;  3DJW A;  2WCC 3;  2KOU A;  2EOF A;  2QFR A;  3VK6 A;  4DUY E;  4UWQ A;  2GPI A;  3OML A;  2O8G A;  2EE8 A;  4R03 A;  5AAS A;  1GTK A;  2N3G A;  1HNW E;  3P71 C;  1ZBQ A;  1XM7 A;  3E7A A;  2YTG A;  3BGH A;  2RPC A;  2ADR A;  1T39 A;  3EPH A;  3H60 A;  3J7Y p;  4JA7 A;  2HYO A;  2UXD E;  5JJT A;  1KYQ A;  3AUZ A;  1WXR A;  2MDR A;  4M0V A;  2RQL A;  3LL8 A;  1NNW A;  2BQ8 X;  1GQE A;  5LL6 R;  2M9A A;  2R1F A;  1RQ0 A;  4WSP A;  5A2Q C;  3EPL A;  3VHT B;  3FIG A;  4UT2 A;  1T71 A;  2R76 A;  1LLM C;  1DGC A;  3IWB A;  1WJP A;  1A1J A;  3MHH C;  2EPM X;  1Z1B A;  5EQV A;  1M63 A;  3QFM A;  4ORA A;  4O5G A;  2JR1 A;  1A1H A;  2WDD A;  4YHH E;  3D03 A;  2EMC A;  1J5E E;  1FJG E;  2USH A;  2A25 A;  2I9I A;  2HGH A;  4K0K E;  1X6H A;  1DI2 A;  1EH7 A;  4ZYH A;  2ENH A;  4WPY A;  3F6G A;  1T70 A;  4BS9 A;  2DXL A;  4R2R A;  4DMI A;  1F2I G;  3BID A;  1UN6 B;  2L2K B;  2L2N A;  2VE7 C;  2L33 A;  4BC7 A;  3IWD A;  1OID A;  2AHD A;  1N36 E;  4X9J A;  4N4R B;  4BHC A;  2CTD A;  1G2F C;  4LFA E;  2FGG A;  3C4B A;  4DV0 E;  2ODR C;  4DR5 E;  1V73 A;  2YU8 A;  2EL4 A;  1NCS A;  2V89 A;  3IVD A;  3BF2 A;  3KBP A;  4I5N C;  4B3S E;  1O0W A;  2MC5 A;  3DF6 A;  2BDX A;  4WWL A;  4P78 A;  2DMY A;  1S95 A;  2JOG A;  2V86 A;  1IT6 A;  1YSA C;  2YTF A;  1T4L B;  3EQ1 A;  4JA9 A;  3ECR A;  2EM8 A;  2XMO A;  2JXP A;  2LCE A;  4JI3 E;  4OX9 E;  4DV7 E;  4X8W A;  3ZU0 A;  1XZW A;  2EOI A;  1N34 E;  2Z72 A;  2IHR 1;  1QFC A;  3M99 B;  1X49 A;  1YYO A;  1STU A;  4JI7 E;  3IB8 A;  4YKE A;  2EMB A;  4JI0 E;  4ZVZ A;  2KHX A;  3HQ1 A;  2EMA A;  1QHW A;  3K7W C;  4LF8 E;  4WFT A;  4ORC A;  4DT2 A;  3VYX A;  1YYW A;  4AQY E;  1WAO 1;  2EOS A;  3JYF A;  1B69 A;  3DSC A;  3PSO A;  1A1L A;  2EL6 A;  2EPL X;  2RSI A;  4NHR A;  5KL3 A;  4X65 E;  5KL7 A;  4O24 A;  4FK5 C;  4V0V A;  3AV0 A;  1EH6 A;  4H2G A;  4M2Z A;  4O4K A;  2JPA A;  2EPR A;  2EMZ A;  1GZ6 A;  2YT4 A;  4X62 E;  4NZV A;  1J26 A;  2MC6 A;  1EKZ A;  2EOZ A;  3E0J A;  2MDG A;  2UXC E;  2EOE A;  2IAE C;  1TN9 A;  2DLK A;  2A22 A;  2NAB A;  4P7D A;  4V0X A;  4GEQ B;  5A6A A;  3ICF A;  1RMD A;  2JWO A;  4J6O A;  2V88 A;  2LJU A;  4FBW A;  2EMF A;  4DR2 E;  2ZO9 B;  4DR7 E;  2EN4 A;  5TSE A;  2EMY A;  2HC5 A;  2EP3 A;  1XMO E;  1IMU A;  2GJU A;  3EGG A;  2LUP B;  3CK2 A;  3ADI A;  2LJH A;  4XPN A;  5HPE A;  2EJ4 A;  2YRM A;  2RS7 A;  1SU1 A;  5INB A;  3RL3 A;  4HTG A;  5AE2 A;  2EPA A;  2EPO A;  2EMX A;  4X64 E;  5JPF A;  3HTX A;  4L8N A;  1SR9 A;  2NYL C;  4KKZ A;  4WX9 A;  4J8Z A;  3H67 A;  2YTO A;  3FGA C;  2D9H A;  2BCD A;  3N5U A;  4BMJ A;  2WBS A;  1UBD C;  2DLQ A;  1DQ3 A;  1PDA A;  4B3R E;  2HY1 A;  2YEQ A;  2GLI A;  2EOY A;  1XNQ E;  1PJT A;  2ZOA A;  4UT3 B;  2YVT A;  2RS6 A;  2L6M A;  3JU0 A;  4F6N A;  2JY9 A;  4GZN C;  4JV5 E;  3EGH A;  4JI6 E;  4R2D A;  4OOG C;  1RC7 A;  1ZU1 A;  3ZTV A;  4G9J A;  1T4O A;  5IWA E;  1S3L A;  3H64 A;  4DV3 E;  1PJS A;  3C5W C;  4M9V C;  2DXN A;  3H62 B;  3H69 A;  2Z1A A;  1S3M A;  3DSD A;  2E1M A;  2YSO A;  1X5W A;  2NYM C;  2V8Q B;  2B3T B;  3L00 A;  4R2E A;  2EN6 A;  1IQS A;  1I94 E;  2NUG A;  5GTU A;  4DKK A;  4DV6 E;  2YZT A;  4DR1 E;  2EML A;  2H36 X;  2EQ1 A;  4B2O A;  5AE1 A;  4F9A B;  3TQM A;  2CPN A;  3RMP A;  1XNR E;  2VF1 A;  2V85 A;  2JOX A;  4BHB A;  2EPZ A;  1HR0 E;  1HP1 A;  5A6J A;  4HEI A;  4R2S A;  4BBY A;  3V4Y A;  2G7H A;  1S70 A;  1A1G A;  2EZ6 A;  4HD0 A;  2KON A;  4LF9 E;  2YRH A;  4F9C B;  2WBU A;  2YU5 A;  5IOH A;  1IBM E;  4LFC E;  5ADZ A;  1HNX E;  3LLH A;  2JVA A;  2EN2 A;  4RHB B;  4MP0 A;  2YTI A;  1FKA E;  4Q7F A;  2F8B A;  3MHS C;  2RSM A;  2EQ0 A;  2HHH E;  2LO3 A;  2JP9 A;  4TUI A;  3C6M A;  2EQ3 A;  1ZR9 A;  4YY3 E;  4DR3 E;  3KZZ A;  4UT3 A;  3THN A;  3F6H A;  2EM3 A;  5A6B D;  1S8E A;  2R17 A;  2LUQ A;  2WZO A;  4OR9 A;  4O43 A;  4IS1 C;  4GKJ E;  2WBT A;  5LMN E;  5B8I A;  4R2A A;  1HPU A;  5KL2 A;  1XMQ E;  3P1X A;  4X66 E;  2ENC A;  2JOB A;  2M1S A;  2BBG A;  5KL4 A;  5F3W A;  1YPN A;  4DSY A;  4ZYG A;  2YTN A;  2J7J A;  2B9D A;  2ODR D;  5JPE A;  3OTO E;  1JK7 A;  2L2M A;  2VRD A;  2CV9 A;  4DR6 E;  4LFB E;  1QNT A;  4MLV A;  3T1H E;  5T6J A;  1TCO A;  4KZS A;  4F9B B;  4R2C A;  4M30 A;  3FLO A;  2EOJ A;  3VYY A;  2LRS A;  2EMG A;  4WYQ B;  2LTR A;  3DW8 C;  2UUB E;  2NUE A;  4F54 A;  1T38 A;  2YRK A;  2LMZ A;  2HYP A;  3QFN A;  4RH8 A;  1Z2X A;  1P47 A;  1OI8 A;  2YTE A;  4KWY A;  2L3J A;  5KL6 A;  2YTQ A;  2JYA A;  4ZYE A;  2M4I A;  4H2B A;  2WDF A;  5FLX C;  2EM7 A;  4F2J C;  3H09 A;  1YFH A;  2E5L E;  4BC9 A;  4FCX A;  1EH8 A;  2EM9 A;  3IB7 A;  3ADG A;  2VQF E;  2EPN A;  1N3G A;  4F6M A;  4GKK E;  2CT1 A;  4FBK A;  2N8X A;  5CFF E;  2EMH A;  2NXF A;  3RL4 A;  5IXM B;  4H2F A;  1OIE A;  3H61 A;  2PRT A;  3C9F A;  3QFO A;  2YTJ A;  1X3C A;  3J7A G;  4TUG A;  2LVH A;  3HPS A;  4KBP A;  1W24 A;  5A6K A;  2LTS A;  1A1K A;  4DHL A;  3T1Y E;  1Z2W A;  1PJQ A;  5BR8 E;  3KZY A;  3ZOQ B;  3MSW A;  1WHQ A;  1UF3 A;  2EPX A;  1II7 A;  2ELZ A;  2DIX A;  4JI1 E;  1USH A;  1PKP A;  2O8A A;  1KBP A;  3RL5 A;  3EPK A;  3IWC A;  3QFK A;  2ZM6 E;  2EPK X;  3PSN A;  4ZX2 A;  2YSP A;  4R2Q A;  2N3H A;  2EWL A;  4IYP C;  2EOQ A;  3J81 C;  4DV4 E;  1UHZ A;  2EM5 A;  2EPP A;  2EOH A;  3J80 C;  2EOM A;  3HPZ A;  4IJD A;  3E7B A;  3TGH A;  2EN1 A;  4DV2 E;  2B7V A;  2EN3 A;  2V83 A;  1AH5 A;  4IL1 A;  1YUJ A;  4LF4 E;  1U32 A;  1IBL E;  4B3T E;  2EOR A;  2GHF A;  3C4T A;  1YZ9 A;  2EMW A;  4DR4 E;  2HJJ A;  5J28 A;  2FV4 B;  1L4S A;  4LTY A;  1A1I A;  3KWR A;  1FJM A;  4JYA E;  2EM6 A;  2DGC A;  2MKN A;  2ZBM A;  2EOO A;  5A69 A;  1IBK E;  4B3M E;  3RQZ A;  2EPC A;  5IV8 B;  1AUI A;  1MGT A;  2ELY A;  2EOX A;  5LMU E;  2UU9 E;  2DFJ A;  2EM4 A;  4JI4 E;  1X48 A;  1JK2 A;  2UUC E;  2NPP C;  1KJK A;  2P6B A;  3T1I A;  2L8T A;  4KHP E;  4H2I A;  2DSY A;  2ENA A;  5A6B A;  4DV5 E;  5C1V A;  4MLQ A;  1G2D C;  3UK3 C;  2RTX A;  4NXM E;  2EPU A;  1ZAA C;  1YYK A;  2I13 A;  1N32 E;  1S3N A;  4JI8 E;  2IE3 C;  2K4V A;  1HNZ E;  3QG5 C;  4V0W A;  2EMI A;  1QU6 A;  3HXL A;  2YTD A;  2MKD A;  2DRP A;  1N33 E;  2L3C A;  2LT7 A;  2DB2 A;  2EN8 A;  4Q35 B;  3K6Q A;  2LBS B;  4I5L C;  1YUI A;  2EM0 A;  2M7Q A;  1TF3 A;  3C6K A;  4FBQ A;  1G5B A;  3BBG A;  3H63 A;  4F0Z A;  1MEY C;  5KL5 A;  4NXN E;  2KKN A;  3H68 A;  2EL5 A;  4R8O A;  2EN7 A;  1WAR A;  1IQO A;  1WRJ A;  1HO5 A;  2QJC A;  3HVQ A;  5LLQ A;  4JI5 E;  4R2P A;  5AC5 A;  3THO B;  2DMI A;  4MOV A;  2WDC A;  1AAY A;  1TF6 A;  2L92 A;  2YTP A;  1BBO A;  4H1Y P;  2B7T A;  4WXC A;  4BCA A;  4DUZ E;  1UTE A;  2YPN A;  1X47 A;  3K7V C;  4LAC C;  1X6F A;  1A1F A;  4Q28 A;  4H1S A;  2YWQ A;  2E72 A;  2F4V E;  2LE2 A;  2BB8 A;  2LV2 A;  2NUF A;  2CSH A;  2NA2 A;  1NEI A;  2QFP A;  4LU9 A;  3IVE A;  2IE4 C;  4MOY A;  2Q8U A;  4WXD A;  3LML A;  2UXB E;  1T4N A; 
#chains in the Genus database with same CATH homology
 3JTZ A;  4I8O A;  4DV1 E;  1WHN A;  1UIL A;  3JAM C;  3H66 A;  4JI2 E;  4LF7 E;  2Z06 A;  5AE3 A;  3ADJ A;  5DNY A;  1ZBT A;  2WDE A;  4LF6 E;  4LF5 E;  3ADL A;  1MF8 A;  3GVE A;  4ORB A;  2UUA E;  2V87 A;  5IT9 C;  2VQE E;  4L5N C;  2FTX B;  3DJW A;  2KOU A;  2QFR A;  3VK6 A;  4DUY E;  4UWQ A;  3OML A;  2O8G A;  4R03 A;  5AAS A;  2N3G A;  1HNW E;  3P71 C;  1ZBQ A;  1XM7 A;  3E7A A;  3H60 A;  3J7Y p;  4JA7 A;  2HYO A;  2UXD E;  5JJT A;  3AUZ A;  1WXR A;  2MDR A;  4M0V A;  3LL8 A;  1NNW A;  2BQ8 X;  1GQE A;  5LL6 R;  1RQ0 A;  4WSP A;  5A2Q C;  3FIG A;  4UT2 A;  1T71 A;  3IWB A;  5EQV A;  1M63 A;  3QFM A;  4ORA A;  4O5G A;  2JR1 A;  2WDD A;  4YHH E;  3D03 A;  1J5E E;  1FJG E;  2USH A;  4K0K E;  1DI2 A;  4WPY A;  3F6G A;  1T70 A;  4BS9 A;  2DXL A;  4DMI A;  2L2K B;  2L2N A;  2VE7 C;  2L33 A;  4BC7 A;  3IWD A;  1OID A;  2AHD A;  1N36 E;  4LFA E;  2FGG A;  3C4B A;  4DV0 E;  2ODR C;  4DR5 E;  1V73 A;  2V89 A;  3IVD A;  3KBP A;  4I5N C;  4B3S E;  1O0W A;  2MC5 A;  3DF6 A;  2BDX A;  4WWL A;  4P78 A;  2DMY A;  1S95 A;  2JOG A;  2V86 A;  1IT6 A;  1T4L B;  4JA9 A;  2XMO A;  4JI3 E;  4OX9 E;  4DV7 E;  4X8W A;  3ZU0 A;  1XZW A;  1N34 E;  2Z72 A;  2IHR 1;  1QFC A;  1X49 A;  1YYO A;  1STU A;  4JI7 E;  3IB8 A;  4YKE A;  4JI0 E;  4ZVZ A;  2KHX A;  3HQ1 A;  1QHW A;  3K7W C;  4LF8 E;  4WFT A;  4ORC A;  4DT2 A;  3VYX A;  1YYW A;  4AQY E;  1WAO 1;  3JYF A;  3DSC A;  3PSO A;  4X65 E;  4O24 A;  4V0V A;  3AV0 A;  4H2G A;  4M2Z A;  4O4K A;  1GZ6 A;  2YT4 A;  4X62 E;  4NZV A;  1J26 A;  2MC6 A;  1EKZ A;  3E0J A;  2UXC E;  2IAE C;  2A22 A;  4P7D A;  4V0X A;  4GEQ B;  3ICF A;  2JWO A;  4J6O A;  2V88 A;  4FBW A;  4DR2 E;  2ZO9 B;  4DR7 E;  1XMO E;  3EGG A;  2GJU A;  2LUP B;  3CK2 A;  3ADI A;  2LJH A;  4XPN A;  5HPE A;  2RS7 A;  1SU1 A;  5INB A;  3RL3 A;  5AE2 A;  5JPF A;  4X64 E;  3HTX A;  4L8N A;  1SR9 A;  2NYL C;  4KKZ A;  4J8Z A;  3H67 A;  3FGA C;  2BCD A;  3N5U A;  4BMJ A;  1DQ3 A;  4B3R E;  2HY1 A;  2YEQ A;  1XNQ E;  2ZOA A;  4UT3 B;  2YVT A;  2RS6 A;  2L6M A;  3JU0 A;  2JY9 A;  4JV5 E;  3EGH A;  4JI6 E;  4OOG C;  1RC7 A;  3ZTV A;  4G9J A;  1T4O A;  5IWA E;  1S3L A;  3H64 A;  4DV3 E;  3C5W C;  2DXN A;  3H62 B;  3H69 A;  2Z1A A;  1S3M A;  3DSD A;  2E1M A;  2NYM C;  2V8Q B;  2B3T B;  1I94 E;  2NUG A;  5GTU A;  4DKK A;  4DV6 E;  4DR1 E;  2YZT A;  2H36 X;  4B2O A;  5AE1 A;  4F9A B;  2CPN A;  3RMP A;  1XNR E;  2VF1 A;  2V85 A;  2JOX A;  1HP1 A;  1HR0 E;  4BBY A;  3V4Y A;  2G7H A;  1S70 A;  2EZ6 A;  4HD0 A;  2KON A;  4LF9 E;  4F9C B;  5IOH A;  1IBM E;  4LFC E;  5ADZ A;  1HNX E;  3LLH A;  2JVA A;  4MP0 A;  1FKA E;  4Q7F A;  2F8B A;  2RSM A;  2HHH E;  4TUI A;  4YY3 E;  4DR3 E;  4UT3 A;  3THN A;  3F6H A;  1S8E A;  2R17 A;  2LUQ A;  2WZO A;  4OR9 A;  4O43 A;  4GKJ E;  5LMN E;  5B8I A;  1HPU A;  1XMQ E;  3P1X A;  4X66 E;  2JOB A;  2M1S A;  5F3W A;  4DSY A;  2B9D A;  2ODR D;  5JPE A;  3OTO E;  1JK7 A;  2L2M A;  2CV9 A;  4DR6 E;  4LFB E;  3T1H E;  5T6J A;  1TCO A;  4KZS A;  4F9B B;  3FLO A;  4M30 A;  3VYY A;  2LRS A;  4WYQ B;  2LTR A;  3DW8 C;  2UUB E;  2NUE A;  4F54 A;  2LMZ A;  2HYP A;  3QFN A;  1Z2X A;  1OI8 A;  2L3J A;  2M4I A;  4H2B A;  2WDF A;  5FLX C;  3H09 A;  2E5L E;  4BC9 A;  4FCX A;  3IB7 A;  3ADG A;  2VQF E;  4GKK E;  4FBK A;  5CFF E;  3RL4 A;  2NXF A;  4H2F A;  1OIE A;  3H61 A;  3C9F A;  3QFO A;  3J7A G;  4TUG A;  3HPS A;  4KBP A;  1W24 A;  2LTS A;  4DHL A;  3T1Y E;  1Z2W A;  5BR8 E;  3ZOQ B;  3MSW A;  1WHQ A;  1UF3 A;  2O8A A;  1II7 A;  1USH A;  2DIX A;  4JI1 E;  1PKP A;  3RL5 A;  1KBP A;  3QFK A;  3IWC A;  2ZM6 E;  3PSN A;  4ZX2 A;  2N3H A;  2EWL A;  4IYP C;  3J81 C;  4DV4 E;  1UHZ A;  3J80 C;  3HPZ A;  3E7B A;  3TGH A;  4DV2 E;  2B7V A;  2V83 A;  4IL1 A;  4LF4 E;  1U32 A;  1IBL E;  4B3T E;  3C4T A;  1YZ9 A;  4DR4 E;  5J28 A;  2FV4 B;  4LTY A;  3KWR A;  1FJM A;  4JYA E;  2ZBM A;  1IBK E;  4B3M E;  3RQZ A;  1AUI A;  5LMU E;  2UU9 E;  2DFJ A;  4JI4 E;  1X48 A;  2UUC E;  2NPP C;  2P6B A;  3T1I A;  2L8T A;  4KHP E;  4H2I A;  2DSY A;  4DV5 E;  5C1V A;  2RTX A;  4NXM E;  1YYK A;  1N32 E;  1S3N A;  4JI8 E;  2IE3 C;  2K4V A;  1HNZ E;  3QG5 C;  4V0W A;  1QU6 A;  3HXL A;  1N33 E;  2L3C A;  2DB2 A;  3K6Q A;  2LBS B;  4I5L C;  2M7Q A;  4FBQ A;  1G5B A;  3H63 A;  4F0Z A;  4NXN E;  2KKN A;  3H68 A;  4R8O A;  1WAR A;  1HO5 A;  3HVQ A;  2QJC A;  4JI5 E;  3THO B;  4MOV A;  2WDC A;  2L92 A;  4H1Y P;  2B7T A;  4BCA A;  4DUZ E;  1UTE A;  1X47 A;  3K7V C;  4LAC C;  4Q28 A;  4H1S A;  2F4V E;  2LE2 A;  2NUF A;  2NA2 A;  2QFP A;  4LU9 A;  3IVE A;  2IE4 C;  4MOY A;  2Q8U A;  3LML A;  2UXB E;  1T4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...