4TUGA

Crystal structure of mjmre11-dna2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
total genus 100
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tugA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tugA01
4H2IA 5IOHA 4I5LC 2QFPA 3QG5C 3DW8C 3K7WC 1OI8A 3ZTVA 4FBQA 1AUIA 3P71C 2Q8UA 4FCXA 2HY1A 3ZU0A 4TUIA 5HPEA 4B2OA 3H68A 2NYLC 3ICFA 4H2BA 4DSYA 1UF3A 3KBPA 4H2FA 3T1IA 4XPNA 1MF8A 1S3LA 1Z2XA 5F3WA 3V4YA 3QFNA 3DSDA 3RL3A 3QFOA 4V0WA 1V73A 2JOGA 4ZVZA 1QHWA 3HVQA 4WWLA 2NYMC 3FGAC 2IAEC 4LACC 3H67A 3TGHA 5B8IA 3K7VC 2NXFA 1G5BA 4O43A 3E7BA 2A22A 1HO5A 4O24A 4H1YP 3RQZA 4MOVA 3H61A 4ORBA 3AUZA 2BCDA 3GVEA 4JA9A 3PSNA 3CK2A 1FJMA 4YKEA 4KKZA 4UT3A 2XMOA 2P6BA 2HYPA 4V0XA 1II7A 3H62B 2WDFA 4IL1A 4UT2A 2HYOA 5J28A 4FBKA 1KBPA 1Z2WA 2WDDA 1T71A 4ORAA 2DFJA 1S3MA 2O8GA 1OIDA 3C9FA 2USHA 1M63A 3C5WC 3RL4A 2QFRA 2QJCA 4H1SA 4HD0A 1USHA 4NZVA 4OR9A 1XM7A 1OIEA 3E7AA 2GJUA 3H60A 3N5UA 4LTYA 2O8AA 4MP0A 3QFKA 4UWQA 5JJTA 5DNYA 2Z1AA 4TUGA 2WDEA 2Z06A 3IVEA 4FBWA 2Z72A 4G9JA 5JPFA 2WDCA 4O4KA 3THNA 3PSOA 2AHDA 1UTEA 3H63A 3IB7A 2NPPC 4ORCA 4H2GA 4IYPC 5INBA 4MOYA 3DSCA 1JK7A 4JA7A 5JPEA 4V0VA 1TCOA 3LL8A 4DT2A 1WARA 4O5GA 1WAO1 1SU1A 4I5NC 2BDXA 3H69A 1HP1A 1XZWA 1W24A 1S95A 1T70A 4KBPA 5EQVA 2ZBMA 1S8EA 1HPUA 3JYFA 3IB8A 3IVDA 5GTUA 3THOB 3RL5A 1S70A 2R17A 4M0VA 2CV9A 3AV0A 4Q7FA 1NNWA 4DHLA 4F0ZA 3QFMA 4ZX2A 2KKNA 2BQ8X 1IT6A 4J6OA 4LU9A 4UT3B 3H64A 5C1VA 1S3NA 1QFCA 2IE3C 3H66A 2IE4C 3EGHA 1U32A 2YVTA 3EGGA
chains in the Genus database with same CATH superfamily
2QFPA 2UXBE 2L3CA 2RS6A 2EM0A 1XMOE 4FBQA 5T6JA 1HNXE 4LFCE 2HY1A 1UN6B 2EM5A 1ZBTA 1SFEA 1PDAA 2V88A 4KWYA 1S3LA 2VQFE 3DSDA 3RL3A 2EMKA 2EN2A 4WSPA 2UXCE 2EOHA 3HVQA 4LF9E 4JI5E 2EWLA 1PJQA 2EMYA 3TGHA 4OX9E 4JYAE 3K7VC 5B8IA 3C4BA 1T4OA 2A22A 4X9JA 1EKZA 4WFTA 1IMUA 1QU6A 2YSPA 4JI8E 2MC6A 4DV6E 2YTIA 3RQZA 2DMYA 2WZOA 3AUZA 2L2NA 1FJMA 2DIXA 4GKKE 2H36X 2B7TA 2P6BA 3TQMA 2EL4A 5AE2A 1II7A 2LUPB 2KOUA 1DGCA 2WDFA 1KBPA 1Z2WA 2LBSB 1U32A 2YTFA 1X6FA 1PJSA 4Q35B 2EPNA 2USHA 3C5WC 2BB8A 1BBGA 4NZVA 3ADGA 2EMIA 1STUA 2EPRA 3OMLA 1YYKA 1IBLE 4F6MA 4R2EA 2M4IA 4MP0A 3QFKA 2EOQA 4KHPE 5JJTA 4J8ZA 2EPAA 5AE1A 5FLXC 1UHZA 3MSWA 3HXLA 4P7DA 3ZOQB 2JOXA 5ADZA 5DNYA 4R2PA 2Z06A 3HQ1A 5JPFA 4ZYGA 2R76A 4R03A 2DXNA 1IQOA 1EH8A 2EMWA 1WHQA 3H63A 3BGHA 1QNTA 5KL6A 2YRHA 2LUQA 3DSCA 2E5LE 4JA7A 3LL8A 5BR8E 2EORA 4O5GA 2RSMA 1SU1A 1UBDC 4N4RB 3JTZA 2L6MA 2EMGA 2ODRC 3H69A 2CT1A 1HP1A 1XZWA 1W24A 1XNQE 3VYYA 1YSAC 1T39A 2ENAA 4JI6E 1GQEA 2M7QA 4M30A 3IB8A 1YYWA 4GKJE 4NXME 2MDRA 4F9AB 3RL5A 3T1HE 1X48A 3P1XA 4OOGC 1S70A 2R17A 2HGHA 2LT7A 4HTGA 1J5EE 2CV9A 2EMCA 3IWBA 3MHSC 2BQ8X 1TF6A 4J6OA 4LF7E 2NUFA 2V89A 2I13A 5KL3A 4B3SE 3RMPA 3H66A 2EOFA 2YTNA 4B3RE 4BS9A 1WHNA 3QG5C 2ZO9B 1LLMC 2YU5A 5A6AA 2N3HA 5IWAE 2JP9A 5KL5A 1OI8A 3ZTVA 1AUIA 2PRTA 4B3ME 4TUIA 5KL7A 2VQEE 1A1LA 3ZU0A 5HPEA 4GZNC 2EPUA 5AC5A 3H68A 4H2BA 2EJ4A 2EPOA 1UF3A 3KBPA 2MKDA 2E72A 2EL5A 4M9VC 4R2CA 2GLIA 5A6BA 1MF8A 4X65E 4DV1E 1HNWE 1DI2A 4MLQA 4WWLA 3IWCA 1XMQE 2NYMC 1WXRA 3FGAC 4RH8A 2EOSA 2VE7C 3VHTB 2NXFA 3E0JA 2N3GA 3E7BA 1MGTA 1GTKA 3T1YE 2YSOA 3L00A 3GVEA 2YZTA 2EN4A 4JI0E 1YPNA 5LLQA 2ELYA 2EPPA 4YKEA 2R1FA 4ZYDA 2YTEA 4IS1C 3DJWA 2LVHA 1NCSA 1WJPA 4BMJA 4FK5C 2DGCA 3LMLA 4IL1A 2HYOA 1BB8A 3EPLA 4FBKA 2JOBA 4DR2E 5A2QC 2WDDA 1T71A 2DFJA 4KZSA 2O8GA 2EPZA 2ODRD 1OIDA 3C9FA 2EM8A 2YRKA 3VK6A 3BF2A 1KYQA 2V8QB 2QFRA 5A6BD 4DV0E 4H1SA 4HD0A 4OR9A 2YWQA 4F9BB 2EZ6A 2YTJA 3IWDA 4F2JC 4DKKA 4LTYA 2UUCE 2JR1A 4DR6E 1T4NA 2YTGA 2JXPA 2WDEA 3IVEA 1YFHA 3ADJA 5A69A 4BCAA 2LO3A 5INBA 1BBOA 4DV5E 2YU8A 4DR5E 4V0VA 2WBSA 4WSGA 2LTRA 1YUJA 1WARA 2B3TB 4DT2A 4AQYE 4LFAE 1O0WA 2KONA 4Q28A 1HR0E 2K4VA 3ECRA 2EOMA 4R2SA 1EH6A 2BDXA 3ADIA 2JY9A 1SR9A 1T70A 1I94E 2YTQA 2CSHA 1IBKE 1S8EA 3HPSA 5GTUA 3IVDA 1N3GA 2LRSA 3J7AG 2DLKA 2YTOA 2FGGA 2EMHA 2LV2A 1AAYA 4ZYHA 4Q7FA 4F0ZA 2NUGA 3QFMA 3EQ1A 5LMNE 2ELZA 1A1GA 4L8NA 2E1MA 4RHBB 1IT6A 2VRDA 4X8WA 1G2FC 4F6NA 4UT3B 2EOYA 2LTSA 2V85A 4HEIA 4MLVA 2RTXA 1ZU1A 4H2IA 1JK2A 5IOHA 4I5LC 2EOZA 2EQ1A 2MKNA 2DLQA 2L33A 1A1KA 3JU0A 3P71C 4WPYA 2DSYA 3EPKA 4LF6E 3HTXA 3ADLA 4R8OA 4JI2E 1N34E 2F4VE 2NYLC 2ENCA 3C6MA 2EPLX 4DSYA 2RSIA 5LL6R 2LJUA 1Z2XA 2WCC3 2ADRA 3QFNA 1A1JA 1V73A 4ZVZA 2YRMA 4WXDA 2IAEC 2EOOA 4NHRA 3H67A 2NUEA 4DR4E 1N33E 1G5BA 4O43A 1HO5A 4LF8E 2IHR1 2K7IA 1RMDA 4H1YP 4DV3E 5AASA 4BHBA 3H61A 4MOVA 2BCDA 3HPZA 1XNRE 3PSNA 2LJHA 4YY3E 3CK2A 4KKZA 2EM4A 2DB2A 2XMOA 2HYPA 2RPCA 1N32E 2G7HA 4V0XA 1A1IA 4UT2A 2MC5A 1X3CA 2JYAA 2YTDA 2B7VA 4X64E 1FJGE 1S3MA 2A25A 3FLOA 4X62E 1L4SA 3LLHA 1M63A 1UILA 4JI7E 1X49A 4F9CB 4DR3E 1N36E 4JV5E 3RL4A 1USHA 1XM7A 1TF3A 2HC5A 1OIEA 3E7AA 1KJKA 3J7Yp 4JI4E 4DV7E 3H60A 2EM6A 3N5UA 2O8AA 4UWQA 1ZR9A 2YPNA 4B3TE 3UK3C 1G2DC 2Z72A 1NEIA 2FV4B 2WDCA 2AHDA 1UTEA 3IB7A 2FTXB 5CFFE 4H2GA 1JK7A 5JPEA 2ZM6E 2F8BA 4P78A 4DV4E 2MDGA 4L5NC 2EMLA 4KBPA 5EQVA 2DRPA 2NABA 2UUAE 2ZBMA 5IXMB 1HPUA 1F2IG 3JYFA 4DUYE 2EOIA 3THOB 2EMXA 3H09A 5TSEA 2EPKX 2EPCA 1ZBQA 3MHHC 1JK1A 2I9IA 4LF4E 1J26A 1X5WA 4M0VA 3AV0A 4DHLA 3KZZA 2YTPA 4WXCA 2KKNA 4K0KE 3F6HA 5IV8B 4LU9A 3H64A 5C1VA 2EOXA 3J81C 1X6HA 2EMAA 2EOEA 4DV2E 5KL2A 3VYXA 2IE4C 3EGHA 2J7JA 2CTDA 1AH5A 2EMBA 2YVTA 3EGGA 1A1FA 2N8XA 2UXDE 2B9DA 3DW8C 1TN9A 3K7WC 2V83A 1YYOA 2CPNA 2L2KB 4FCXA 3M99B 2Q8UA 4DR1E 4BC7A 4B2OA 1RQ0A 3ICFA 2RQLA 4I8OA 1YUIA 4H2FA 3T1IA 2EM3A 5IT9C 4XPNA 2RS7A 5F3WA 3V4YA 4DUZE 4R2QA 1MEYC 2EMFA 3QFOA 4V0WA 1T38A 5AE3A 2JOGA 1DQ3A 1QHWA 2YEQA 1RC7A 1GZ6A 5AC4A 4LACC 2L8TA 4WYQB 2JVAA 2GPIA 4IJDA 4O24A 2JPAA 2UU9E 2NA2A 3J80C 2VF1A 4R2AA 4LFBE 4ORBA 4JA9A 4X66E 1B69A 2V87A 3EPHA 4UT3A 2EL6A 3BIDA 4WX9A 3DF6A 4JI1E 3EPJA 2EE8A 2V86A 2M9AA 5KL4A 3H62B 1A1HA 5J28A 4F54A 2HHHE 2WBUA 2KHXA 2ZOAA 4ORAA 2EN6A 4ZYEA 2LCEA 3C4TA 2EQ3A 4R2RA 2EN7A 2EM7A 2LE2A 3D03A 1HNZE 2EQ0A 4YHHE 4NXNE 2QJCA 4DMIA 2GJUA 3C6KA 1X47A 4DR7E 2EMZA 2EN8A 1P47A 3K6QA 2GHFA 2JWOA 2Z1AA 4TUGA 4G9JA 4FBWA 3F6GA 4O4KA 3THNA 2UUBE 1X6EA 1WRJA 4LF5E 1IQSA 3PSOA 2EN3A 2YT4A 4ORCA 3KZYA 2EP3A 2NPPC 2HJJA 4IYPC 2DMIA 4MOYA 1ZAAC 4M2ZA 1PKPA 1YZ9A 1TCOA 1WAO1 1IBME 2L92A 4I5NC 2L2MA 1FKAE 4BC9A 5A6JA 4JI3E 2EPXA 4BHCA 1S95A 1EH7A 2EM9A 3JAMC 2LMZA 1T4LB 2EOJA 2M1SA 1PJTA 2WBTA 2BBGA 1NNWA 5LMUE 4ZX2A 2D9HA 3BBGA 2ENHA 3FIGA 3KWRA 4GEQB 2DXLA 2EPMX 1S3NA 1QFCA 1Z1BA 2IE3C 4R2DA 2L3JA 2EN1A 4BBYA 5A6KA 3OTOE 2EM2A
chains in the Genus database with same CATH topology
2QFPA 2UXBE 2L3CA 2RS6A 1XMOE 4FBQA 5T6JA 1HNXE 4LFCE 2HY1A 1ZBTA 2V88A 1S3LA 2VQFE 3DSDA 3RL3A 4WSPA 2UXCE 3HVQA 4LF9E 4JI5E 2EWLA 3TGHA 4OX9E 4JYAE 3K7VC 5B8IA 3C4BA 1T4OA 2A22A 1EKZA 4WFTA 1QU6A 4JI8E 2MC6A 4DV6E 3RQZA 2DMYA 2WZOA 3AUZA 2L2NA 1FJMA 2DIXA 4GKKE 2H36X 2B7TA 2P6BA 5AE2A 1II7A 2LUPB 2KOUA 2WDFA 1KBPA 1Z2WA 2LBSB 2USHA 3C5WC 4NZVA 3ADGA 1STUA 3OMLA 1YYKA 1IBLE 2M4IA 4MP0A 3QFKA 4KHPE 5JJTA 4J8ZA 5AE1A 5FLXC 4DUZE 1UHZA 3MSWA 3HXLA 4P7DA 3ZOQB 2JOXA 5ADZA 5DNYA 2Z06A 3HQ1A 5JPFA 4R03A 2DXNA 1WHQA 3H63A 2LUQA 3DSCA 2E5LE 4JA7A 3LL8A 5BR8E 4O5GA 2RSMA 1SU1A 3JTZA 2L6MA 2ODRC 3H69A 1HP1A 1XZWA 1W24A 1XNQE 3VYYA 4JI6E 1GQEA 2M7QA 4M30A 3IB8A 1YYWA 4GKJE 4NXME 2MDRA 4F9AB 3RL5A 3T1HE 1X48A 3P1XA 4OOGC 1S70A 2R17A 1J5EE 2CV9A 3IWBA 2BQ8X 4J6OA 4LF7E 2NUFA 2V89A 4B3SE 3RMPA 3H66A 4B3RE 4BS9A 1WHNA 3QG5C 2ZO9B 2N3HA 5IWAE 1OI8A 3ZTVA 1AUIA 4B3ME 4TUIA 2VQEE 3ZU0A 5HPEA 3H68A 4H2BA 1UF3A 3KBPA 1MF8A 4X65E 4DV1E 1HNWE 1DI2A 4WWLA 3IWCA 1XMQE 2NYMC 1WXRA 3FGAC 2VE7C 2NXFA 3E0JA 2N3GA 3E7BA 3T1YE 3GVEA 2YZTA 4JI0E 4YKEA 3DJWA 4BMJA 4IL1A 3LMLA 2HYOA 4FBKA 2JOBA 4DR2E 5A2QC 2WDDA 1T71A 2DFJA 4KZSA 2O8GA 2ODRD 1OIDA 3C9FA 3VK6A 2V8QB 2QFRA 4DV0E 4H1SA 4HD0A 4OR9A 4F9BB 2EZ6A 3IWDA 4DKKA 4LTYA 2UUCE 2JR1A 4DR6E 1T4NA 2WDEA 3IVEA 3ADJA 4BCAA 5INBA 4DV5E 4DR5E 4V0VA 4DT2A 2LTRA 1WARA 2B3TB 4AQYE 4LFAE 1O0WA 2KONA 4Q28A 1HR0E 2K4VA 2BDXA 3ADIA 2JY9A 1SR9A 1T70A 1I94E 1IBKE 1S8EA 3HPSA 5GTUA 3IVDA 2LRSA 3J7AG 2FGGA 4Q7FA 4F0ZA 2NUGA 3QFMA 5LMNE 4L8NA 2E1MA 1IT6A 4X8WA 4UT3B 2LTSA 2V85A 2RTXA 4H2IA 5IOHA 4I5LC 2L33A 3JU0A 3P71C 4WPYA 2DSYA 4LF6E 3HTXA 3ADLA 4R8OA 4JI2E 1N34E 2F4VE 2NYLC 4DSYA 5LL6R 1Z2XA 3QFNA 1V73A 4ZVZA 2IAEC 3H67A 2NUEA 4DR4E 1N33E 1G5BA 4O43A 1HO5A 4LF8E 2IHR1 4H1YP 4DV3E 5AASA 3H61A 4MOVA 2BCDA 3HPZA 1XNRE 3PSNA 2LJHA 4YY3E 3CK2A 4KKZA 2DB2A 2XMOA 2HYPA 1N32E 2G7HA 4V0XA 4UT2A 2MC5A 2B7VA 4X64E 1FJGE 1S3MA 3FLOA 4X62E 3LLHA 1M63A 1UILA 4JI7E 1X49A 4F9CB 4DR3E 1N36E 4JV5E 3RL4A 1USHA 1XM7A 1OIEA 3E7AA 3J7Yp 4JI4E 4DV7E 3H60A 3N5UA 2O8AA 4UWQA 4B3TE 2Z72A 2FV4B 2WDCA 2AHDA 1UTEA 3IB7A 2FTXB 5CFFE 4H2GA 1JK7A 5JPEA 2ZM6E 2F8BA 4P78A 4DV4E 4L5NC 4KBPA 5EQVA 2UUAE 2ZBMA 1HPUA 3JYFA 4DUYE 3THOB 3H09A 1ZBQA 4LF4E 1J26A 4M0VA 3AV0A 4DHLA 2KKNA 4K0KE 3F6HA 4LU9A 3H64A 5C1VA 3J81C 4DV2E 3VYXA 2IE4C 3EGHA 2YVTA 3EGGA 2UXDE 2B9DA 3DW8C 3K7WC 2V83A 1YYOA 2CPNA 2L2KB 4FCXA 2Q8UA 4DR1E 4BC7A 4B2OA 1RQ0A 3ICFA 4I8OA 4H2FA 3T1IA 5IT9C 4XPNA 2RS7A 5F3WA 3V4YA 3QFOA 4V0WA 5AE3A 2JOGA 1DQ3A 1QHWA 2YEQA 1RC7A 1GZ6A 4LACC 2L8TA 4WYQB 2JVAA 4O24A 2UU9E 2NA2A 3J80C 2VF1A 4LFBE 4ORBA 4JA9A 4X66E 2V87A 4UT3A 3DF6A 4JI1E 2V86A 3H62B 5J28A 4F54A 2HHHE 2KHXA 2ZOAA 4ORAA 3C4TA 2LE2A 3D03A 1HNZE 4YHHE 4NXNE 2QJCA 4DMIA 2GJUA 1X47A 4DR7E 3K6QA 2JWOA 2Z1AA 4TUGA 4G9JA 4FBWA 3F6GA 4O4KA 3THNA 2UUBE 4LF5E 3PSOA 2YT4A 4ORCA 2NPPC 4IYPC 4MOYA 4M2ZA 1PKPA 1YZ9A 1TCOA 1WAO1 1IBME 2L92A 4I5NC 2L2MA 1FKAE 4BC9A 4JI3E 1S95A 3JAMC 2LMZA 1T4LB 2M1SA 1NNWA 5LMUE 4ZX2A 3FIGA 3KWRA 4GEQB 2DXLA 1S3NA 1QFCA 2IE3C 2L3JA 3OTOE 4BBYA 1U32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2I A;  5IOH A;  4I5L C;  2QFP A;  3QG5 C;  3DW8 C;  3K7W C;  1OI8 A;  3ZTV A;  4FBQ A;  1AUI A;  3P71 C;  2Q8U A;  4FCX A;  2HY1 A;  3ZU0 A;  4TUI A;  5HPE A;  4B2O A;  3H68 A;  2NYL C;  3ICF A;  4H2B A;  4DSY A;  1UF3 A;  3KBP A;  4H2F A;  3T1I A;  4XPN A;  1MF8 A;  1S3L A;  1Z2X A;  5F3W A;  3V4Y A;  3QFN A;  3DSD A;  3RL3 A;  3QFO A;  4V0W A;  1V73 A;  2JOG A;  4ZVZ A;  1QHW A;  3HVQ A;  4WWL A;  2NYM C;  3FGA C;  2IAE C;  4LAC C;  3H67 A;  3TGH A;  5B8I A;  3K7V C;  2NXF A;  1G5B A;  4O43 A;  3E7B A;  2A22 A;  1HO5 A;  4O24 A;  4H1Y P;  3RQZ A;  4MOV A;  3H61 A;  4ORB A;  3AUZ A;  2BCD A;  3GVE A;  4JA9 A;  3PSN A;  3CK2 A;  1FJM A;  4YKE A;  4KKZ A;  4UT3 A;  2XMO A;  2P6B A;  2HYP A;  4V0X A;  1II7 A;  3H62 B;  2WDF A;  4IL1 A;  4UT2 A;  2HYO A;  5J28 A;  4FBK A;  1KBP A;  1Z2W A;  2WDD A;  1T71 A;  4ORA A;  2DFJ A;  1S3M A;  2O8G A;  1OID A;  3C9F A;  2USH A;  1M63 A;  3C5W C;  3RL4 A;  2QFR A;  2QJC A;  4H1S A;  4HD0 A;  1USH A;  4NZV A;  4OR9 A;  1XM7 A;  1OIE A;  3E7A A;  2GJU A;  3H60 A;  3N5U A;  4LTY A;  2O8A A;  4MP0 A;  3QFK A;  4UWQ A;  5JJT A;  5DNY A;  2Z1A A;  4TUG A;  2WDE A;  2Z06 A;  3IVE A;  4FBW A;  2Z72 A;  4G9J A;  5JPF A;  2WDC A;  4O4K A;  3THN A;  3PSO A;  2AHD A;  1UTE A;  3H63 A;  3IB7 A;  2NPP C;  4ORC A;  4H2G A;  4IYP C;  5INB A;  4MOY A;  3DSC A;  1JK7 A;  4JA7 A;  5JPE A;  4V0V A;  1TCO A;  3LL8 A;  4DT2 A;  1WAR A;  4O5G A;  1WAO 1;  1SU1 A;  4I5N C;  2BDX A;  3H69 A;  1HP1 A;  1XZW A;  1W24 A;  1S95 A;  1T70 A;  4KBP A;  5EQV A;  2ZBM A;  1S8E A;  1HPU A;  3JYF A;  3IB8 A;  3IVD A;  5GTU A;  3THO B;  3RL5 A;  1S70 A;  2R17 A;  4M0V A;  2CV9 A;  3AV0 A;  4Q7F A;  1NNW A;  4DHL A;  4F0Z A;  3QFM A;  4ZX2 A;  2KKN A;  2BQ8 X;  1IT6 A;  4J6O A;  4LU9 A;  4UT3 B;  3H64 A;  5C1V A;  1S3N A;  1QFC A;  2IE3 C;  3H66 A;  2IE4 C;  3EGH A;  1U32 A;  2YVT A;  3EGG A; 
#chains in the Genus database with same CATH topology
 2QFP A;  2UXB E;  2L3C A;  2RS6 A;  2EM0 A;  1XMO E;  4FBQ A;  5T6J A;  1HNX E;  4LFC E;  2HY1 A;  1UN6 B;  2EM5 A;  1ZBT A;  1SFE A;  1PDA A;  2V88 A;  4KWY A;  1S3L A;  2VQF E;  3DSD A;  3RL3 A;  2EMK A;  2EN2 A;  4WSP A;  2UXC E;  2EOH A;  3HVQ A;  4LF9 E;  4JI5 E;  2EWL A;  1PJQ A;  2EMY A;  3TGH A;  4OX9 E;  4JYA E;  3K7V C;  5B8I A;  3C4B A;  1T4O A;  2A22 A;  4X9J A;  1EKZ A;  4WFT A;  1IMU A;  1QU6 A;  2YSP A;  4JI8 E;  2MC6 A;  4DV6 E;  2YTI A;  3RQZ A;  2DMY A;  2WZO A;  3AUZ A;  2L2N A;  1FJM A;  2DIX A;  4GKK E;  2H36 X;  2B7T A;  2P6B A;  3TQM A;  2EL4 A;  5AE2 A;  1II7 A;  2LUP B;  2KOU A;  1DGC A;  2WDF A;  1KBP A;  1Z2W A;  2LBS B;  1U32 A;  2YTF A;  1X6F A;  1PJS A;  4Q35 B;  2EPN A;  2USH A;  3C5W C;  2BB8 A;  1BBG A;  4NZV A;  3ADG A;  2EMI A;  1STU A;  2EPR A;  3OML A;  1YYK A;  1IBL E;  4F6M A;  4R2E A;  2M4I A;  4MP0 A;  3QFK A;  2EOQ A;  4KHP E;  5JJT A;  4J8Z A;  2EPA A;  5AE1 A;  5FLX C;  1UHZ A;  3MSW A;  3HXL A;  4P7D A;  3ZOQ B;  2JOX A;  5ADZ A;  5DNY A;  4R2P A;  2Z06 A;  3HQ1 A;  5JPF A;  4ZYG A;  2R76 A;  4R03 A;  2DXN A;  1IQO A;  1EH8 A;  2EMW A;  1WHQ A;  3H63 A;  3BGH A;  1QNT A;  5KL6 A;  2YRH A;  2LUQ A;  3DSC A;  2E5L E;  4JA7 A;  3LL8 A;  5BR8 E;  2EOR A;  4O5G A;  2RSM A;  1SU1 A;  1UBD C;  4N4R B;  3JTZ A;  2L6M A;  2EMG A;  2ODR C;  3H69 A;  2CT1 A;  1HP1 A;  1XZW A;  1W24 A;  1XNQ E;  3VYY A;  1YSA C;  1T39 A;  2ENA A;  4JI6 E;  1GQE A;  2M7Q A;  4M30 A;  3IB8 A;  1YYW A;  4GKJ E;  4NXM E;  2MDR A;  4F9A B;  3RL5 A;  3T1H E;  1X48 A;  3P1X A;  4OOG C;  1S70 A;  2R17 A;  2HGH A;  2LT7 A;  4HTG A;  1J5E E;  2CV9 A;  2EMC A;  3IWB A;  3MHS C;  2BQ8 X;  1TF6 A;  4J6O A;  4LF7 E;  2NUF A;  2V89 A;  2I13 A;  5KL3 A;  4B3S E;  3RMP A;  3H66 A;  2EOF A;  2YTN A;  4B3R E;  4BS9 A;  1WHN A;  3QG5 C;  2ZO9 B;  1LLM C;  2YU5 A;  5A6A A;  2N3H A;  5IWA E;  2JP9 A;  5KL5 A;  1OI8 A;  3ZTV A;  1AUI A;  2PRT A;  4B3M E;  4TUI A;  5KL7 A;  2VQE E;  1A1L A;  3ZU0 A;  5HPE A;  4GZN C;  2EPU A;  5AC5 A;  3H68 A;  4H2B A;  2EJ4 A;  2EPO A;  1UF3 A;  3KBP A;  2MKD A;  2E72 A;  2EL5 A;  4M9V C;  4R2C A;  2GLI A;  5A6B A;  1MF8 A;  4X65 E;  4DV1 E;  1HNW E;  1DI2 A;  4MLQ A;  4WWL A;  3IWC A;  1XMQ E;  2NYM C;  1WXR A;  3FGA C;  4RH8 A;  2EOS A;  2VE7 C;  3VHT B;  2NXF A;  3E0J A;  2N3G A;  3E7B A;  1MGT A;  1GTK A;  3T1Y E;  2YSO A;  3L00 A;  3GVE A;  2YZT A;  2EN4 A;  4JI0 E;  1YPN A;  5LLQ A;  2ELY A;  2EPP A;  4YKE A;  2R1F A;  4ZYD A;  2YTE A;  4IS1 C;  3DJW A;  2LVH A;  1NCS A;  1WJP A;  4BMJ A;  4FK5 C;  2DGC A;  3LML A;  4IL1 A;  2HYO A;  1BB8 A;  3EPL A;  4FBK A;  2JOB A;  4DR2 E;  5A2Q C;  2WDD A;  1T71 A;  2DFJ A;  4KZS A;  2O8G A;  2EPZ A;  2ODR D;  1OID A;  3C9F A;  2EM8 A;  2YRK A;  3VK6 A;  3BF2 A;  1KYQ A;  2V8Q B;  2QFR A;  5A6B D;  4DV0 E;  4H1S A;  4HD0 A;  4OR9 A;  2YWQ A;  4F9B B;  2EZ6 A;  2YTJ A;  3IWD A;  4F2J C;  4DKK A;  4LTY A;  2UUC E;  2JR1 A;  4DR6 E;  1T4N A;  2YTG A;  2JXP A;  2WDE A;  3IVE A;  1YFH A;  3ADJ A;  5A69 A;  4BCA A;  2LO3 A;  5INB A;  1BBO A;  4DV5 E;  2YU8 A;  4DR5 E;  4V0V A;  2WBS A;  4WSG A;  2LTR A;  1YUJ A;  1WAR A;  2B3T B;  4DT2 A;  4AQY E;  4LFA E;  1O0W A;  2KON A;  4Q28 A;  1HR0 E;  2K4V A;  3ECR A;  2EOM A;  4R2S A;  1EH6 A;  2BDX A;  3ADI A;  2JY9 A;  1SR9 A;  1T70 A;  1I94 E;  2YTQ A;  2CSH A;  1IBK E;  1S8E A;  3HPS A;  5GTU A;  3IVD A;  1N3G A;  2LRS A;  3J7A G;  2DLK A;  2YTO A;  2FGG A;  2EMH A;  2LV2 A;  1AAY A;  4ZYH A;  4Q7F A;  4F0Z A;  2NUG A;  3QFM A;  3EQ1 A;  5LMN E;  2ELZ A;  1A1G A;  4L8N A;  2E1M A;  4RHB B;  1IT6 A;  2VRD A;  4X8W A;  1G2F C;  4F6N A;  4UT3 B;  2EOY A;  2LTS A;  2V85 A;  4HEI A;  4MLV A;  2RTX A;  1ZU1 A;  4H2I A;  1JK2 A;  5IOH A;  4I5L C;  2EOZ A;  2EQ1 A;  2MKN A;  2DLQ A;  2L33 A;  1A1K A;  3JU0 A;  3P71 C;  4WPY A;  2DSY A;  3EPK A;  4LF6 E;  3HTX A;  3ADL A;  4R8O A;  4JI2 E;  1N34 E;  2F4V E;  2NYL C;  2ENC A;  3C6M A;  2EPL X;  4DSY A;  2RSI A;  5LL6 R;  2LJU A;  1Z2X A;  2WCC 3;  2ADR A;  3QFN A;  1A1J A;  1V73 A;  4ZVZ A;  2YRM A;  4WXD A;  2IAE C;  2EOO A;  4NHR A;  3H67 A;  2NUE A;  4DR4 E;  1N33 E;  1G5B A;  4O43 A;  1HO5 A;  4LF8 E;  2IHR 1;  2K7I A;  1RMD A;  4H1Y P;  4DV3 E;  5AAS A;  4BHB A;  3H61 A;  4MOV A;  2BCD A;  3HPZ A;  1XNR E;  3PSN A;  2LJH A;  4YY3 E;  3CK2 A;  4KKZ A;  2EM4 A;  2DB2 A;  2XMO A;  2HYP A;  2RPC A;  1N32 E;  2G7H A;  4V0X A;  1A1I A;  4UT2 A;  2MC5 A;  1X3C A;  2JYA A;  2YTD A;  2B7V A;  4X64 E;  1FJG E;  1S3M A;  2A25 A;  3FLO A;  4X62 E;  1L4S A;  3LLH A;  1M63 A;  1UIL A;  4JI7 E;  1X49 A;  4F9C B;  4DR3 E;  1N36 E;  4JV5 E;  3RL4 A;  1USH A;  1XM7 A;  1TF3 A;  2HC5 A;  1OIE A;  3E7A A;  1KJK A;  3J7Y p;  4JI4 E;  4DV7 E;  3H60 A;  2EM6 A;  3N5U A;  2O8A A;  4UWQ A;  1ZR9 A;  2YPN A;  4B3T E;  3UK3 C;  1G2D C;  2Z72 A;  1NEI A;  2FV4 B;  2WDC A;  2AHD A;  1UTE A;  3IB7 A;  2FTX B;  5CFF E;  4H2G A;  1JK7 A;  5JPE A;  2ZM6 E;  2F8B A;  4P78 A;  4DV4 E;  2MDG A;  4L5N C;  2EML A;  4KBP A;  5EQV A;  2DRP A;  2NAB A;  2UUA E;  2ZBM A;  5IXM B;  1HPU A;  1F2I G;  3JYF A;  4DUY E;  2EOI A;  3THO B;  2EMX A;  3H09 A;  5TSE A;  2EPK X;  2EPC A;  1ZBQ A;  3MHH C;  1JK1 A;  2I9I A;  4LF4 E;  1J26 A;  1X5W A;  4M0V A;  3AV0 A;  4DHL A;  3KZZ A;  2YTP A;  4WXC A;  2KKN A;  4K0K E;  3F6H A;  5IV8 B;  4LU9 A;  3H64 A;  5C1V A;  2EOX A;  3J81 C;  1X6H A;  2EMA A;  2EOE A;  4DV2 E;  5KL2 A;  3VYX A;  2IE4 C;  3EGH A;  2J7J A;  2CTD A;  1AH5 A;  2EMB A;  2YVT A;  3EGG A;  1A1F A;  2N8X A;  2UXD E;  2B9D A;  3DW8 C;  1TN9 A;  3K7W C;  2V83 A;  1YYO A;  2CPN A;  2L2K B;  4FCX A;  3M99 B;  2Q8U A;  4DR1 E;  4BC7 A;  4B2O A;  1RQ0 A;  3ICF A;  2RQL A;  4I8O A;  1YUI A;  4H2F A;  3T1I A;  2EM3 A;  5IT9 C;  4XPN A;  2RS7 A;  5F3W A;  3V4Y A;  4DUZ E;  4R2Q A;  1MEY C;  2EMF A;  3QFO A;  4V0W A;  1T38 A;  5AE3 A;  2JOG A;  1DQ3 A;  1QHW A;  2YEQ A;  1RC7 A;  1GZ6 A;  5AC4 A;  4LAC C;  2L8T A;  4WYQ B;  2JVA A;  2GPI A;  4IJD A;  4O24 A;  2JPA A;  2UU9 E;  2NA2 A;  3J80 C;  2VF1 A;  4R2A A;  4LFB E;  4ORB A;  4JA9 A;  4X66 E;  1B69 A;  2V87 A;  3EPH A;  4UT3 A;  2EL6 A;  3BID A;  4WX9 A;  3DF6 A;  4JI1 E;  3EPJ A;  2EE8 A;  2V86 A;  2M9A A;  5KL4 A;  3H62 B;  1A1H A;  5J28 A;  4F54 A;  2HHH E;  2WBU A;  2KHX A;  2ZOA A;  4ORA A;  2EN6 A;  4ZYE A;  2LCE A;  3C4T A;  2EQ3 A;  4R2R A;  2EN7 A;  2EM7 A;  2LE2 A;  3D03 A;  1HNZ E;  2EQ0 A;  4YHH E;  4NXN E;  2QJC A;  4DMI A;  2GJU A;  3C6K A;  1X47 A;  4DR7 E;  2EMZ A;  2EN8 A;  1P47 A;  3K6Q A;  2GHF A;  2JWO A;  2Z1A A;  4TUG A;  4G9J A;  4FBW A;  3F6G A;  4O4K A;  3THN A;  2UUB E;  1X6E A;  1WRJ A;  4LF5 E;  1IQS A;  3PSO A;  2EN3 A;  2YT4 A;  4ORC A;  3KZY A;  2EP3 A;  2NPP C;  2HJJ A;  4IYP C;  2DMI A;  4MOY A;  1ZAA C;  4M2Z A;  1PKP A;  1YZ9 A;  1TCO A;  1WAO 1;  1IBM E;  2L92 A;  4I5N C;  2L2M A;  1FKA E;  4BC9 A;  5A6J A;  4JI3 E;  2EPX A;  4BHC A;  1S95 A;  1EH7 A;  2EM9 A;  3JAM C;  2LMZ A;  1T4L B;  2EOJ A;  2M1S A;  1PJT A;  2WBT A;  2BBG A;  1NNW A;  5LMU E;  4ZX2 A;  2D9H A;  3BBG A;  2ENH A;  3FIG A;  3KWR A;  4GEQ B;  2DXL A;  2EPM X;  1S3N A;  1QFC A;  1Z1B A;  2IE3 C;  4R2D A;  2L3J A;  2EN1 A;  4BBY A;  5A6K A;  3OTO E;  2EM2 A; 
#chains in the Genus database with same CATH homology
 2QFP A;  2UXB E;  2L3C A;  2RS6 A;  1XMO E;  4FBQ A;  5T6J A;  1HNX E;  4LFC E;  2HY1 A;  1ZBT A;  2V88 A;  1S3L A;  2VQF E;  3DSD A;  3RL3 A;  4WSP A;  2UXC E;  3HVQ A;  4LF9 E;  4JI5 E;  2EWL A;  3TGH A;  4OX9 E;  4JYA E;  3K7V C;  5B8I A;  3C4B A;  1T4O A;  2A22 A;  1EKZ A;  4WFT A;  1QU6 A;  4JI8 E;  2MC6 A;  4DV6 E;  3RQZ A;  2DMY A;  2WZO A;  3AUZ A;  2L2N A;  1FJM A;  2DIX A;  4GKK E;  2H36 X;  2B7T A;  2P6B A;  5AE2 A;  1II7 A;  2LUP B;  2KOU A;  2WDF A;  1KBP A;  1Z2W A;  2LBS B;  2USH A;  3C5W C;  4NZV A;  3ADG A;  1STU A;  3OML A;  1YYK A;  1IBL E;  2M4I A;  4MP0 A;  3QFK A;  4KHP E;  5JJT A;  4J8Z A;  5AE1 A;  5FLX C;  4DUZ E;  1UHZ A;  3MSW A;  3HXL A;  4P7D A;  3ZOQ B;  2JOX A;  5ADZ A;  5DNY A;  2Z06 A;  3HQ1 A;  5JPF A;  4R03 A;  2DXN A;  1WHQ A;  3H63 A;  2LUQ A;  3DSC A;  2E5L E;  4JA7 A;  3LL8 A;  5BR8 E;  4O5G A;  2RSM A;  1SU1 A;  3JTZ A;  2L6M A;  2ODR C;  3H69 A;  1HP1 A;  1XZW A;  1W24 A;  1XNQ E;  3VYY A;  4JI6 E;  1GQE A;  2M7Q A;  4M30 A;  3IB8 A;  1YYW A;  4GKJ E;  4NXM E;  2MDR A;  4F9A B;  3RL5 A;  3T1H E;  1X48 A;  3P1X A;  4OOG C;  1S70 A;  2R17 A;  1J5E E;  2CV9 A;  3IWB A;  2BQ8 X;  4J6O A;  4LF7 E;  2NUF A;  2V89 A;  4B3S E;  3RMP A;  3H66 A;  4B3R E;  4BS9 A;  1WHN A;  3QG5 C;  2ZO9 B;  2N3H A;  5IWA E;  1OI8 A;  3ZTV A;  1AUI A;  4B3M E;  4TUI A;  2VQE E;  3ZU0 A;  5HPE A;  3H68 A;  4H2B A;  1UF3 A;  3KBP A;  1MF8 A;  4X65 E;  4DV1 E;  1HNW E;  1DI2 A;  4WWL A;  3IWC A;  1XMQ E;  2NYM C;  1WXR A;  3FGA C;  2VE7 C;  2NXF A;  3E0J A;  2N3G A;  3E7B A;  3T1Y E;  3GVE A;  2YZT A;  4JI0 E;  4YKE A;  3DJW A;  4BMJ A;  4IL1 A;  3LML A;  2HYO A;  4FBK A;  2JOB A;  4DR2 E;  5A2Q C;  2WDD A;  1T71 A;  2DFJ A;  4KZS A;  2O8G A;  2ODR D;  1OID A;  3C9F A;  3VK6 A;  2V8Q B;  2QFR A;  4DV0 E;  4H1S A;  4HD0 A;  4OR9 A;  4F9B B;  2EZ6 A;  3IWD A;  4DKK A;  4LTY A;  2UUC E;  2JR1 A;  4DR6 E;  1T4N A;  2WDE A;  3IVE A;  3ADJ A;  4BCA A;  5INB A;  4DV5 E;  4DR5 E;  4V0V A;  4DT2 A;  2LTR A;  1WAR A;  2B3T B;  4AQY E;  4LFA E;  1O0W A;  2KON A;  4Q28 A;  1HR0 E;  2K4V A;  2BDX A;  3ADI A;  2JY9 A;  1SR9 A;  1T70 A;  1I94 E;  1IBK E;  1S8E A;  3HPS A;  5GTU A;  3IVD A;  2LRS A;  3J7A G;  2FGG A;  4Q7F A;  4F0Z A;  2NUG A;  3QFM A;  5LMN E;  4L8N A;  2E1M A;  1IT6 A;  4X8W A;  4UT3 B;  2LTS A;  2V85 A;  2RTX A;  4H2I A;  5IOH A;  4I5L C;  2L33 A;  3JU0 A;  3P71 C;  4WPY A;  2DSY A;  4LF6 E;  3HTX A;  3ADL A;  4R8O A;  4JI2 E;  1N34 E;  2F4V E;  2NYL C;  4DSY A;  5LL6 R;  1Z2X A;  3QFN A;  1V73 A;  4ZVZ A;  2IAE C;  3H67 A;  2NUE A;  4DR4 E;  1N33 E;  1G5B A;  4O43 A;  1HO5 A;  4LF8 E;  2IHR 1;  4H1Y P;  4DV3 E;  5AAS A;  3H61 A;  4MOV A;  2BCD A;  3HPZ A;  1XNR E;  3PSN A;  2LJH A;  4YY3 E;  3CK2 A;  4KKZ A;  2DB2 A;  2XMO A;  2HYP A;  1N32 E;  2G7H A;  4V0X A;  4UT2 A;  2MC5 A;  2B7V A;  4X64 E;  1FJG E;  1S3M A;  3FLO A;  4X62 E;  3LLH A;  1M63 A;  1UIL A;  4JI7 E;  1X49 A;  4F9C B;  4DR3 E;  1N36 E;  4JV5 E;  3RL4 A;  1USH A;  1XM7 A;  1OIE A;  3E7A A;  3J7Y p;  4JI4 E;  4DV7 E;  3H60 A;  3N5U A;  2O8A A;  4UWQ A;  4B3T E;  2Z72 A;  2FV4 B;  2WDC A;  2AHD A;  1UTE A;  3IB7 A;  2FTX B;  5CFF E;  4H2G A;  1JK7 A;  5JPE A;  2ZM6 E;  2F8B A;  4P78 A;  4DV4 E;  4L5N C;  4KBP A;  5EQV A;  2UUA E;  2ZBM A;  1HPU A;  3JYF A;  4DUY E;  3THO B;  3H09 A;  1ZBQ A;  4LF4 E;  1J26 A;  4M0V A;  3AV0 A;  4DHL A;  2KKN A;  4K0K E;  3F6H A;  4LU9 A;  3H64 A;  5C1V A;  3J81 C;  4DV2 E;  3VYX A;  2IE4 C;  3EGH A;  2YVT A;  3EGG A;  2UXD E;  2B9D A;  3DW8 C;  3K7W C;  2V83 A;  1YYO A;  2CPN A;  2L2K B;  4FCX A;  2Q8U A;  4DR1 E;  4BC7 A;  4B2O A;  1RQ0 A;  3ICF A;  4I8O A;  4H2F A;  3T1I A;  5IT9 C;  4XPN A;  2RS7 A;  5F3W A;  3V4Y A;  3QFO A;  4V0W A;  5AE3 A;  2JOG A;  1DQ3 A;  1QHW A;  2YEQ A;  1RC7 A;  1GZ6 A;  4LAC C;  2L8T A;  4WYQ B;  2JVA A;  4O24 A;  2UU9 E;  2NA2 A;  3J80 C;  2VF1 A;  4LFB E;  4ORB A;  4JA9 A;  4X66 E;  2V87 A;  4UT3 A;  3DF6 A;  4JI1 E;  2V86 A;  3H62 B;  5J28 A;  4F54 A;  2HHH E;  2KHX A;  2ZOA A;  4ORA A;  3C4T A;  2LE2 A;  3D03 A;  1HNZ E;  4YHH E;  4NXN E;  2QJC A;  4DMI A;  2GJU A;  1X47 A;  4DR7 E;  3K6Q A;  2JWO A;  2Z1A A;  4TUG A;  4G9J A;  4FBW A;  3F6G A;  4O4K A;  3THN A;  2UUB E;  4LF5 E;  3PSO A;  2YT4 A;  4ORC A;  2NPP C;  4IYP C;  4MOY A;  4M2Z A;  1PKP A;  1YZ9 A;  1TCO A;  1WAO 1;  1IBM E;  2L92 A;  4I5N C;  2L2M A;  1FKA E;  4BC9 A;  4JI3 E;  1S95 A;  3JAM C;  2LMZ A;  1T4L B;  2M1S A;  1NNW A;  5LMU E;  4ZX2 A;  3FIG A;  3KWR A;  4GEQ B;  2DXL A;  1S3N A;  1QFC A;  2IE3 C;  2L3J A;  3OTO E;  4BBY A;  1U32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...