4TUGA

Crystal structure of mjmre11-dna2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
total genus 100
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tugA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tugA01
3JYFA 4H2GA 5JJTA 1Z2WA 2NYMC 1NNWA 1UTEA 2QFPA 2BCDA 3IVEA 3QFOA 4O43A 3RL5A 4H1SA 5F3WA 3K7WC 2Z1AA 2BQ8X 3N5UA 2O8GA 4FBQA 4O4KA 1M63A 4M0VA 4TUIA 1U32A 4KKZA 2JOGA 4ZX2A 3ZTVA 4JA7A 2Q8UA 4H2BA 2YVTA 4J6OA 2AHDA 1MF8A 3IB8A 4I5LC 3H64A 2WDFA 4LU9A 1UF3A 1S95A 2QJCA 4UT2A 2A22A 2QFRA 4H1YP 4OR9A 4UT3A 3H63A 3QFMA 2HYPA 3RQZA 4HD0A 4O24A 3RL4A 5DNYA 2IAEC 4DT2A 4ORAA 2Z72A 1S8EA 3HVQA 1JK7A 2NXFA 1XM7A 3EGGA 1Z2XA 3K7VC 2DFJA 5GTUA 4IYPC 2R17A 4DHLA 5B8IA 5EQVA 1V73A 2CV9A 2IE3C 3KBPA 4H2FA 4IL1A 1HP1A 2IE4C 5INBA 4YKEA 1II7A 4Q7FA 3IB7A 1SU1A 2WDDA 4KBPA 1T70A 1KBPA 3PSOA 3TGHA 2WDCA 1WARA 2P6BA 3P71C 4MOVA 3QG5C 4JA9A 4ORBA 3FGAC 1OIDA 3GVEA 4V0WA 3ICFA 5HPEA 4V0VA 4FCXA 5IOHA 4V0XA 1S3NA 3C9FA 1XZWA 3H68A 3H67A 4F0ZA 4UWQA 4TUGA 1S3MA 3QFKA 4FBWA 4O5GA 2O8AA 2BDXA 3H66A 3H69A 5JPEA 4B2OA 1OI8A 3QFNA 2HY1A 3THNA 4UT3B 3V4YA 1FJMA 1IT6A 1HO5A 1AUIA 2ZBMA 3RL3A 2HYOA 2NYLC 4MOYA 4DSYA 3DSCA 3AUZA 4XPNA 4NZVA 4LACC 3PSNA 4WWLA 2GJUA 3EGHA 4FBKA 1OIEA 4H2IA 1QFCA 1S70A 3H61A 1W24A 3E7AA 5JPFA 2Z06A 3H62B 4MP0A 1QHWA 1G5BA 3T1IA 2USHA 3IVDA 1TCOA 1S3LA 2WDEA 2NPPC 2KKNA 3E7BA 4ORCA 4ZVZA 3DSDA 3THOB 1HPUA 3AV0A 3H60A 4I5NC 1USHA 3C5WC 1WAO1 1T71A 3DW8C 4LTYA 5C1VA 5J28A 3ZU0A 3LL8A 4G9JA 3CK2A 2XMOA
chains in the Genus database with same CATH superfamily
3JYFA 4NXME 2JPAA 4B3ME 4DV7E 1J5EE 1Z2WA 1PDAA 2EP3A 1IBKE 2EPPA 2QFPA 2EM4A 2EE8A 3C4TA 3N5UA 4O4KA 2EPUA 2L3CA 4KHPE 2EORA 2LUPB 4ZYDA 2JOBA 1YYKA 2EMBA 4JA7A 4LFBE 2AHDA 2YSPA 1MF8A 2DLQA 3H64A 4UT2A 2ELZA 3H09A 1S95A 3IWBA 4R2AA 2L8TA 5A69A 2RPCA 1N33E 4UT3A 1T4LB 2RS7A 1BB8A 2LJUA 2EPRA 2FGGA 1YUJA 2EOSA 4HD0A 3VHTB 5DNYA 2EPKX 1IBME 2DB2A 2ADRA 3HVQA 2EQ3A 4OX9E 4ZYEA 2EMKA 4NHRA 1KJKA 2DFJA 1QU6A 2UXBE 1ZR9A 2UUCE 5EQVA 1V73A 2CV9A 1LLMC 4DUYE 2LO3A 4F6NA 3ADIA 1HP1A 2LVHA 2K4VA 2IE4C 4YKEA 5INBA 1PKPA 4Q7FA 1X6HA 2GLIA 1YFHA 2NUGA 1SU1A 4KBPA 2EQ0A 1KBPA 3PSOA 3TGHA 2WDCA 4R2SA 2NABA 2EM8A 1YYWA 3FGAC 1N32E 3UK3C 2EN6A 2EM5A 1GQEA 4F9CB 2EPZA 2EN7A 4B3TE 5IOHA 2YPNA 3QFKA 2BDXA 2UU9E 2ENCA 4WPYA 4L5NC 5T6JA 3QFNA 3MHSC 3THNA 4DV5E 2LBSB 2EM7A 2EM0A 2BBGA 1G2FC 4UT3B 3V4YA 2ZBMA 1HO5A 1HNWE 2HYOA 2LV2A 2NYLC 3DSCA 4M30A 4WXCA 3E0JA 4XPNA 2L2KB 2EMAA 4J8ZA 3H61A 1JK1A 3KZYA 3E7AA 2GHFA 2MDGA 2I13A 2FTXB 1QHWA 2YWQA 5KL2A 2EL6A 4X62E 1S3LA 2EOEA 4WXDA 3VYYA 3H60A 1T39A 3C5WC 3DF6A 1WJPA 3DJWA 2EPXA 2KONA 5AC5A 3LL8A 1UILA 4G9JA 2YTOA 1IBLE 2LTRA 3JAMC 4WX9A 1NCSA 2KOUA 3BBGA 2RTXA 1WHNA 3QFOA 1ZU1A 2YTFA 2RSIA 2B3TB 1P47A 5A6BA 4JI1E 1X47A 3K7WC 2BQ8X 4FBQA 4JI4E 4YY3E 4R2CA 3T1YE 1YZ9A 4KZSA 4ZX2A 3ZTVA 1TF6A 2F4VE 4IS1C 2EMGA 2YVTA 3BGHA 2E5LE 3EPJA 2GPIA 3IB8A 4LU9A 4Q35B 4X65E 4LF9E 5AE3A 2FV4B 2R1FA 1RMDA 1N36E 4OR9A 5A6BD 3RQZA 2H36X 3KWRA 1ZBTA 3P1XA 1XMQE 4AQYE 2EN1A 4O24A 2YTDA 2JP9A 4LF5E 4L8NA 2VE7C 4I8OA 3C6KA 4DV1E 2RS6A 4F2JC 1XM7A 3J7AG 1Z2XA 4WYQB 5AASA 5KL3A 5GTUA 3BF2A 1A1KA 1DQ3A 2EJ4A 4IYPC 4B3RE 5A2QC 2EPNA 4K0KE 3KBPA 4H2FA 2YTQA 1KYQA 2YU5A 4WFTA 2BB8A 3FLOA 3VK6A 3JU0A 2L3JA 4LF8E 2DLKA 1A1IA 2EOYA 2YZTA 1T70A 2WCC3 2P6BA 2LT7A 1WRJA 4V0WA 1TF3A 5HPEA 1MGTA 4IJDA 1BBGA 2EM9A 3LMLA 1N34E 4V0XA 2JOXA 4DR4E 5LL6R 1S3NA 2ODRD 3C9FA 4F0ZA 2EOIA 3HXLA 4Q28A 2O8AA 2CPNA 4B2OA 1EH8A 2YTIA 1X48A 1XNRE 3ECRA 4DR3E 3VYXA 2EL4A 1B69A 3RL3A 4F54A 1HNZE 5IT9C 2EOJA 4BCAA 4LF7E 4NZVA 3HTXA 4HTGA 1OIEA 4BC9A 3J81C 1S70A 2MC5A 2MC6A 2M1SA 2DMIA 4R2DA 3F6HA 4GEQB 4MP0A 2MKNA 3OTOE 4JI0E 2EM2A 2YRKA 4RH8A 2L33A 3IVDA 2YRHA 2K7IA 2YU8A 4X8WA 4BBYA 4DV4E 3JTZA 2HC5A 1TCOA 1G2DC 2NPPC 3E7BA 1FKAE 4DR7E 3AV0A 1HPUA 1AH5A 2L6MA 3ADLA 2EL5A 5AC4A 1IMUA 5C1VA 1SFEA 1T4NA 2EOMA 3OMLA 2EMLA 2HHHE 2VQFE 2CT1A 2XMOA 2EN4A 2YTJA 5JJTA 4P7DA 2EZ6A 3FIGA 2NYMC 1NNWA 1UTEA 2EPOA 2BCDA 2N3GA 3EPHA 2DGCA 1RC7A 3RL5A 5F3WA 2B7TA 3IWCA 2HJJA 1TN9A 3KZZA 5BR8E 1M63A 1U32A 1A1GA 3EQ1A 2YT4A 2JOGA 2Q8UA 1X49A 2LUQA 4I5LC 2YTGA 1STUA 5LLQA 1WXRA 2WDFA 2QJCA 2EPMX 2CSHA 3BIDA 4DKKA 1ZBQA 4MLQA 2UXCE 4H1YP 5A6KA 4HEIA 5IXMB 4LFCE 3H63A 2M9AA 3QFMA 2HYPA 5IV8B 4OOGC 2IAEC 4DT2A 4JI7E 2WZOA 4FK5C 3RMPA 2Z72A 4ORAA 3C6MA 5LMUE 1S8EA 1T4OA 1GZ6A 2EMYA 2EN8A 2D9HA 3K6QA 4DR2E 4LFAE 2NXFA 5KL7A 2ZO9B 2PRTA 3K7VC 2CTDA 4ZYHA 2RSMA 2A25A 5ADZA 4KWYA 2LMZA 2MDRA 2EMXA 1DGCA 1F2IG 4IL1A 1I94E 2LCEA 4NXNE 4ZYGA 2UXDE 2EM3A 5AE1A 1O0WA 2YRMA 1II7A 4BHCA 1UN6B 2EOQA 2E72A 4BMJA 2EMFA 2V8QB 1GTKA 2NUEA 1MEYC 3QG5C 4JA9A 1OIDA 3GVEA 2YTPA 4RHBB 3ICFA 3D03A 2V83A 2EOZA 2L92A 4V0VA 1X5WA 4FCXA 3EPKA 2NA2A 2EMCA 1XZWA 2HGHA 4FBWA 4O5GA 1XMOE 2MKDA 3H69A 5JPEA 2EOFA 1OI8A 2HY1A 2EMZA 2ZM6E 1N3GA 2EQ1A 2LTSA 1XNQE 1PJSA 1AUIA 4MOYA 5KL6A 2JVAA 3AUZA 4JI3E 2V87A 3PSNA 4H2IA 3EGHA 4FBKA 3T1HE 1QFCA 4DMIA 1SR9A 1W24A 3ZOQB 5JPFA 2V88A 2ZOAA 2ENAA 2LRSA 3F6GA 3LLHA 1G5BA 3T1IA 1YPNA 1PJQA 4R2EA 4MLVA 3EPLA 1X6FA 1A1HA 4WSGA 4ZVZA 3THOB 4R8OA 4I5NC 2B9DA 4F6MA 2ELYA 1WAO1 1T71A 4M2ZA 4P78A 4LTYA 5J28A 3ADJA 5KL5A 4WWLA 1YUIA 2EMIA 1PJTA 2YSOA 2EPCA 2VRDA 4H2GA 1DI2A 4O43A 4GZNC 3IVEA 2EPAA 4DR5E 4H1SA 2JYAA 3MHHC 4R2QA 2Z1AA 2O8GA 3HQ1A 2LE2A 1HNXE 3HPSA 4M0VA 4TUIA 4DV3E 2DXNA 4KKZA 2N3HA 4JI5E 2DSYA 1IQSA 4DV2E 4H2BA 4J6OA 4M9VC 1UF3A 2A22A 3C4BA 2DRPA 4JI8E 2QFRA 1FJGE 2IHR1 2JXPA 5A6JA 2ENHA 2EN3A 3RL4A 2G7HA 4F9BB 3MSWA 5IWAE 2ODRC 2J7JA 2F8BA 2N8XA 2EMWA 2YTEA 1JK7A 4BC7A 1A1FA 2DXLA 2R76A 2YEQA 3EGGA 5KL4A 4R03A 2B7VA 2R17A 4DHLA 5B8IA 2EOXA 4LF4E 2IE3C 1IQOA 4DV6E 2YTNA 4X9JA 2EMHA 1QNTA 2V85A 3ADGA 3HPZA 2EOHA 2EPLX 1T38A 1EH6A 3IB7A 2WDDA 2EM6A 4X64E 1UHZA 4YHHE 2EOOA 1L4SA 1YYOA 2DIXA 3TQMA 2L2NA 4DR1E 1WARA 1ZAAC 3P71C 4MOVA 4DV0E 3J80C 4ORBA 4GKKE 1BBOA 3L00A 5FLXC 1Z1BA 1HR0E 1WHQA 3H67A 3H68A 2VF1A 4UWQA 1AAYA 4TUGA 2E1MA 1S3MA 2UUBE 4JI2E 3H66A 5LMNE 2M4IA 2WBSA 2V86A 4WSPA 5TSEA 4N4RB 4R2RA 4DUZE 2EWLA 3CK2A 2M7QA 5CFFE 1FJMA 4GKJE 1IT6A 1X6EA 1EKZA 4DSYA 1A1LA 4JYAE 1RQ0A 2RQLA 4F9AB 3M99B 4DR6E 4LACC 2GJUA 2JY9A 2UUAE 4JI6E 1UBDC 2EN2A 2KHXA 2Z06A 3H62B 2WBTA 1A1JA 2I9IA 4R2PA 2DMYA 1J26A 4LF6E 2USHA 2WBUA 1EH7A 1NEIA 2NUFA 4BS9A 2WDEA 3J7Yp 4ORCA 2KKNA 2L2MA 1JK2A 3DSDA 2JR1A 1YSAC 5A6AA 4X66E 1USHA 3DW8C 4B3SE 2LJHA 5AE2A 4BHBA 4JV5E 2V89A 3ZU0A 3IWDA 2JWOA 1X3CA 2VQEE
chains in the Genus database with same CATH topology
3JYFA 4NXME 4B3ME 4DV7E 1J5EE 1Z2WA 2QFPA 1IBKE 3C4TA 3N5UA 4O4KA 2L3CA 4KHPE 2LUPB 2JOBA 1YYKA 4JA7A 4LFBE 2AHDA 1MF8A 3H64A 4UT2A 3H09A 1S95A 3IWBA 2L8TA 1N33E 4UT3A 1T4LB 2RS7A 2FGGA 4HD0A 5DNYA 1IBME 2DB2A 3HVQA 4OX9E 2DFJA 1QU6A 2UXBE 2UUCE 5EQVA 1V73A 2CV9A 4DUYE 3ADIA 1HP1A 2IE4C 2K4VA 5INBA 4YKEA 1PKPA 4Q7FA 2NUGA 1SU1A 4KBPA 1KBPA 3PSOA 3TGHA 2WDCA 1YYWA 3FGAC 1N32E 1GQEA 4F9CB 4B3TE 5IOHA 3QFKA 2BDXA 2UU9E 4WPYA 4L5NC 5T6JA 3QFNA 4DV5E 3THNA 2LBSB 4UT3B 3V4YA 2ZBMA 1HO5A 1HNWE 2HYOA 2NYLC 3DSCA 4M30A 3E0JA 4XPNA 2L2KB 4J8ZA 3H61A 3E7AA 2FTXB 1QHWA 4X62E 1S3LA 3VYYA 3H60A 3C5WC 3DF6A 3DJWA 2KONA 3LL8A 1UILA 4G9JA 1IBLE 2LTRA 3JAMC 2KOUA 2RTXA 1WHNA 3QFOA 2B3TB 4JI1E 1X47A 3K7WC 2BQ8X 4FBQA 4JI4E 4YY3E 3T1YE 1YZ9A 4KZSA 4ZX2A 3ZTVA 2F4VE 2YVTA 2E5LE 3IB8A 4LU9A 4X65E 4LF9E 5AE3A 2FV4B 1N36E 4OR9A 3RQZA 2H36X 3KWRA 1ZBTA 3P1XA 1XMQE 4AQYE 4O24A 4LF5E 4L8NA 2VE7C 4I8OA 4DV1E 2RS6A 1XM7A 3J7AG 1Z2XA 4WYQB 5AASA 5GTUA 1DQ3A 4IYPC 4B3RE 5A2QC 4K0KE 3KBPA 4H2FA 4WFTA 3FLOA 3VK6A 3JU0A 2L3JA 4LF8E 1T70A 2YZTA 2P6BA 4V0WA 5HPEA 3LMLA 1N34E 4V0XA 2JOXA 4DR4E 5LL6R 1S3NA 2ODRD 3C9FA 4F0ZA 3HXLA 4Q28A 2O8AA 2CPNA 4B2OA 1X48A 1XNRE 4DR3E 3VYXA 3RL3A 4F54A 1HNZE 5IT9C 4BCAA 4LF7E 4NZVA 3HTXA 1OIEA 4BC9A 3J81C 1S70A 2MC5A 2MC6A 2M1SA 3F6HA 4GEQB 4MP0A 3OTOE 4JI0E 2L33A 3IVDA 1TCOA 4X8WA 4BBYA 4DV4E 3JTZA 2NPPC 3E7BA 1FKAE 4DR7E 3AV0A 1HPUA 2L6MA 3ADLA 5C1VA 1T4NA 3OMLA 2HHHE 2VQFE 2XMOA 5JJTA 4P7DA 2EZ6A 3FIGA 2NYMC 1NNWA 1UTEA 2BCDA 2N3GA 1RC7A 3RL5A 5F3WA 2B7TA 3IWCA 5BR8E 1M63A 1U32A 2JOGA 2YT4A 2Q8UA 1X49A 2LUQA 4I5LC 1STUA 1WXRA 2WDFA 2QJCA 4DKKA 1ZBQA 2UXCE 4H1YP 4LFCE 3H63A 3QFMA 2HYPA 4OOGC 2IAEC 4DT2A 4JI7E 2WZOA 3RMPA 4ORAA 2Z72A 5LMUE 1S8EA 1T4OA 1GZ6A 3K6QA 4DR2E 4LFAE 2NXFA 2ZO9B 3K7VC 2RSMA 5ADZA 2LMZA 2MDRA 4IL1A 1I94E 4NXNE 2UXDE 5AE1A 1O0WA 1II7A 4BMJA 2V8QB 2NUEA 3QG5C 4JA9A 1OIDA 3GVEA 3ICFA 3D03A 2V83A 2L92A 4V0VA 4FCXA 2NA2A 1XZWA 4FBWA 1XMOE 4O5GA 3H69A 5JPEA 1OI8A 2HY1A 2ZM6E 1XNQE 2LTSA 1AUIA 4MOYA 2JVAA 3AUZA 4JI3E 2V87A 3PSNA 4H2IA 3EGHA 4FBKA 3T1HE 1QFCA 4DMIA 1SR9A 1W24A 3ZOQB 5JPFA 2V88A 2ZOAA 3F6GA 2LRSA 3LLHA 1G5BA 3T1IA 4ZVZA 3THOB 4R8OA 4I5NC 2B9DA 1WAO1 1T71A 4M2ZA 4P78A 4LTYA 5J28A 3ADJA 4WWLA 4H2GA 1DI2A 3IVEA 4O43A 4DR5E 4H1SA 2Z1AA 2O8GA 3HQ1A 2LE2A 1HNXE 3HPSA 4M0VA 4TUIA 4DV3E 2DXNA 4KKZA 2N3HA 4JI5E 2DSYA 4DV2E 4H2BA 4J6OA 1UF3A 2A22A 3C4BA 4JI8E 2QFRA 1FJGE 2IHR1 3RL4A 2G7HA 4F9BB 3MSWA 5IWAE 2ODRC 2F8BA 1JK7A 4BC7A 2DXLA 2YEQA 3EGGA 4R03A 2B7VA 2R17A 4DHLA 5B8IA 4LF4E 2IE3C 4DV6E 2V85A 3ADGA 3HPZA 3IB7A 2WDDA 4X64E 4YHHE 1UHZA 1YYOA 2DIXA 4DR1E 2L2NA 1WARA 3P71C 4MOVA 4ORBA 4DV0E 3J80C 4GKKE 5FLXC 1HR0E 1WHQA 3H67A 3H68A 2VF1A 4UWQA 4TUGA 2E1MA 1S3MA 2UUBE 4JI2E 3H66A 5LMNE 2M4IA 2V86A 4WSPA 4DUZE 2EWLA 3CK2A 2M7QA 5CFFE 1FJMA 4GKJE 1IT6A 1EKZA 4DSYA 4JYAE 1RQ0A 4F9AB 4DR6E 4LACC 2GJUA 2JY9A 2UUAE 4JI6E 2KHXA 2Z06A 3H62B 2DMYA 1J26A 4LF6E 2USHA 2NUFA 4BS9A 2WDEA 3J7Yp 4ORCA 2KKNA 2L2MA 3DSDA 2JR1A 4X66E 1USHA 3DW8C 4B3SE 2LJHA 5AE2A 4JV5E 2V89A 3ZU0A 3IWDA 2JWOA 2VQEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYF A;  4H2G A;  5JJT A;  1Z2W A;  2NYM C;  1NNW A;  1UTE A;  2QFP A;  2BCD A;  3IVE A;  3QFO A;  4O43 A;  3RL5 A;  4H1S A;  5F3W A;  3K7W C;  2Z1A A;  2BQ8 X;  3N5U A;  2O8G A;  4FBQ A;  4O4K A;  1M63 A;  4M0V A;  4TUI A;  1U32 A;  4KKZ A;  2JOG A;  4ZX2 A;  3ZTV A;  4JA7 A;  2Q8U A;  4H2B A;  2YVT A;  4J6O A;  2AHD A;  1MF8 A;  3IB8 A;  4I5L C;  3H64 A;  2WDF A;  4LU9 A;  1UF3 A;  1S95 A;  2QJC A;  4UT2 A;  2A22 A;  2QFR A;  4H1Y P;  4OR9 A;  4UT3 A;  3H63 A;  3QFM A;  2HYP A;  3RQZ A;  4HD0 A;  4O24 A;  3RL4 A;  5DNY A;  2IAE C;  4DT2 A;  4ORA A;  2Z72 A;  1S8E A;  3HVQ A;  1JK7 A;  2NXF A;  1XM7 A;  3EGG A;  1Z2X A;  3K7V C;  2DFJ A;  5GTU A;  4IYP C;  2R17 A;  4DHL A;  5B8I A;  5EQV A;  1V73 A;  2CV9 A;  2IE3 C;  3KBP A;  4H2F A;  4IL1 A;  1HP1 A;  2IE4 C;  5INB A;  4YKE A;  1II7 A;  4Q7F A;  3IB7 A;  1SU1 A;  2WDD A;  4KBP A;  1T70 A;  1KBP A;  3PSO A;  3TGH A;  2WDC A;  1WAR A;  2P6B A;  3P71 C;  4MOV A;  3QG5 C;  4JA9 A;  4ORB A;  3FGA C;  1OID A;  3GVE A;  4V0W A;  3ICF A;  5HPE A;  4V0V A;  4FCX A;  5IOH A;  4V0X A;  1S3N A;  3C9F A;  1XZW A;  3H68 A;  3H67 A;  4F0Z A;  4UWQ A;  4TUG A;  1S3M A;  3QFK A;  4FBW A;  4O5G A;  2O8A A;  2BDX A;  3H66 A;  3H69 A;  5JPE A;  4B2O A;  1OI8 A;  3QFN A;  2HY1 A;  3THN A;  4UT3 B;  3V4Y A;  1FJM A;  1IT6 A;  1HO5 A;  1AUI A;  2ZBM A;  3RL3 A;  2HYO A;  2NYL C;  4MOY A;  4DSY A;  3DSC A;  3AUZ A;  4XPN A;  4NZV A;  4LAC C;  3PSN A;  4WWL A;  2GJU A;  3EGH A;  4FBK A;  1OIE A;  4H2I A;  1QFC A;  1S70 A;  3H61 A;  1W24 A;  3E7A A;  5JPF A;  2Z06 A;  3H62 B;  4MP0 A;  1QHW A;  1G5B A;  3T1I A;  2USH A;  3IVD A;  1TCO A;  1S3L A;  2WDE A;  2NPP C;  2KKN A;  3E7B A;  4ORC A;  4ZVZ A;  3DSD A;  3THO B;  1HPU A;  3AV0 A;  3H60 A;  4I5N C;  1USH A;  3C5W C;  1WAO 1;  1T71 A;  3DW8 C;  4LTY A;  5C1V A;  5J28 A;  3ZU0 A;  3LL8 A;  4G9J A;  3CK2 A;  2XMO A; 
#chains in the Genus database with same CATH topology
 3JYF A;  4NXM E;  2JPA A;  4B3M E;  4DV7 E;  1J5E E;  1Z2W A;  1PDA A;  2EP3 A;  1IBK E;  2EPP A;  2QFP A;  2EM4 A;  2EE8 A;  3C4T A;  3N5U A;  4O4K A;  2EPU A;  2L3C A;  4KHP E;  2EOR A;  2LUP B;  4ZYD A;  2JOB A;  1YYK A;  2EMB A;  4JA7 A;  4LFB E;  2AHD A;  2YSP A;  1MF8 A;  2DLQ A;  3H64 A;  4UT2 A;  2ELZ A;  3H09 A;  1S95 A;  3IWB A;  4R2A A;  2L8T A;  5A69 A;  2RPC A;  1N33 E;  4UT3 A;  1T4L B;  2RS7 A;  1BB8 A;  2LJU A;  2EPR A;  2FGG A;  1YUJ A;  2EOS A;  4HD0 A;  3VHT B;  5DNY A;  2EPK X;  1IBM E;  2DB2 A;  2ADR A;  3HVQ A;  2EQ3 A;  4OX9 E;  4ZYE A;  2EMK A;  4NHR A;  1KJK A;  2DFJ A;  1QU6 A;  2UXB E;  1ZR9 A;  2UUC E;  5EQV A;  1V73 A;  2CV9 A;  1LLM C;  4DUY E;  2LO3 A;  4F6N A;  3ADI A;  1HP1 A;  2LVH A;  2K4V A;  2IE4 C;  4YKE A;  5INB A;  1PKP A;  4Q7F A;  1X6H A;  2GLI A;  1YFH A;  2NUG A;  1SU1 A;  4KBP A;  2EQ0 A;  1KBP A;  3PSO A;  3TGH A;  2WDC A;  4R2S A;  2NAB A;  2EM8 A;  1YYW A;  3FGA C;  1N32 E;  3UK3 C;  2EN6 A;  2EM5 A;  1GQE A;  4F9C B;  2EPZ A;  2EN7 A;  4B3T E;  5IOH A;  2YPN A;  3QFK A;  2BDX A;  2UU9 E;  2ENC A;  4WPY A;  4L5N C;  5T6J A;  3QFN A;  3MHS C;  3THN A;  4DV5 E;  2LBS B;  2EM7 A;  2EM0 A;  2BBG A;  1G2F C;  4UT3 B;  3V4Y A;  2ZBM A;  1HO5 A;  1HNW E;  2HYO A;  2LV2 A;  2NYL C;  3DSC A;  4M30 A;  4WXC A;  3E0J A;  4XPN A;  2L2K B;  2EMA A;  4J8Z A;  3H61 A;  1JK1 A;  3KZY A;  3E7A A;  2GHF A;  2MDG A;  2I13 A;  2FTX B;  1QHW A;  2YWQ A;  5KL2 A;  2EL6 A;  4X62 E;  1S3L A;  2EOE A;  4WXD A;  3VYY A;  3H60 A;  1T39 A;  3C5W C;  3DF6 A;  1WJP A;  3DJW A;  2EPX A;  2KON A;  5AC5 A;  3LL8 A;  1UIL A;  4G9J A;  2YTO A;  1IBL E;  2LTR A;  3JAM C;  4WX9 A;  1NCS A;  2KOU A;  3BBG A;  2RTX A;  1WHN A;  3QFO A;  1ZU1 A;  2YTF A;  2RSI A;  2B3T B;  1P47 A;  5A6B A;  4JI1 E;  1X47 A;  3K7W C;  2BQ8 X;  4FBQ A;  4JI4 E;  4YY3 E;  4R2C A;  3T1Y E;  1YZ9 A;  4KZS A;  4ZX2 A;  3ZTV A;  1TF6 A;  2F4V E;  4IS1 C;  2EMG A;  2YVT A;  3BGH A;  2E5L E;  3EPJ A;  2GPI A;  3IB8 A;  4LU9 A;  4Q35 B;  4X65 E;  4LF9 E;  5AE3 A;  2FV4 B;  2R1F A;  1RMD A;  1N36 E;  4OR9 A;  5A6B D;  3RQZ A;  2H36 X;  3KWR A;  1ZBT A;  3P1X A;  1XMQ E;  4AQY E;  2EN1 A;  4O24 A;  2YTD A;  2JP9 A;  4LF5 E;  4L8N A;  2VE7 C;  4I8O A;  3C6K A;  4DV1 E;  2RS6 A;  4F2J C;  1XM7 A;  3J7A G;  1Z2X A;  4WYQ B;  5AAS A;  5KL3 A;  5GTU A;  3BF2 A;  1A1K A;  1DQ3 A;  2EJ4 A;  4IYP C;  4B3R E;  5A2Q C;  2EPN A;  4K0K E;  3KBP A;  4H2F A;  2YTQ A;  1KYQ A;  2YU5 A;  4WFT A;  2BB8 A;  3FLO A;  3VK6 A;  3JU0 A;  2L3J A;  4LF8 E;  2DLK A;  1A1I A;  2EOY A;  2YZT A;  1T70 A;  2WCC 3;  2P6B A;  2LT7 A;  1WRJ A;  4V0W A;  1TF3 A;  5HPE A;  1MGT A;  4IJD A;  1BBG A;  2EM9 A;  3LML A;  1N34 E;  4V0X A;  2JOX A;  4DR4 E;  5LL6 R;  1S3N A;  2ODR D;  3C9F A;  4F0Z A;  2EOI A;  3HXL A;  4Q28 A;  2O8A A;  2CPN A;  4B2O A;  1EH8 A;  2YTI A;  1X48 A;  1XNR E;  3ECR A;  4DR3 E;  3VYX A;  2EL4 A;  1B69 A;  3RL3 A;  4F54 A;  1HNZ E;  5IT9 C;  2EOJ A;  4BCA A;  4LF7 E;  4NZV A;  3HTX A;  4HTG A;  1OIE A;  4BC9 A;  3J81 C;  1S70 A;  2MC5 A;  2MC6 A;  2M1S A;  2DMI A;  4R2D A;  3F6H A;  4GEQ B;  4MP0 A;  2MKN A;  3OTO E;  4JI0 E;  2EM2 A;  2YRK A;  4RH8 A;  2L33 A;  3IVD A;  2YRH A;  2K7I A;  2YU8 A;  4X8W A;  4BBY A;  4DV4 E;  3JTZ A;  2HC5 A;  1TCO A;  1G2D C;  2NPP C;  3E7B A;  1FKA E;  4DR7 E;  3AV0 A;  1HPU A;  1AH5 A;  2L6M A;  3ADL A;  2EL5 A;  5AC4 A;  1IMU A;  5C1V A;  1SFE A;  1T4N A;  2EOM A;  3OML A;  2EML A;  2HHH E;  2VQF E;  2CT1 A;  2XMO A;  2EN4 A;  2YTJ A;  5JJT A;  4P7D A;  2EZ6 A;  3FIG A;  2NYM C;  1NNW A;  1UTE A;  2EPO A;  2BCD A;  2N3G A;  3EPH A;  2DGC A;  1RC7 A;  3RL5 A;  5F3W A;  2B7T A;  3IWC A;  2HJJ A;  1TN9 A;  3KZZ A;  5BR8 E;  1M63 A;  1U32 A;  1A1G A;  3EQ1 A;  2YT4 A;  2JOG A;  2Q8U A;  1X49 A;  2LUQ A;  4I5L C;  2YTG A;  1STU A;  5LLQ A;  1WXR A;  2WDF A;  2QJC A;  2EPM X;  2CSH A;  3BID A;  4DKK A;  1ZBQ A;  4MLQ A;  2UXC E;  4H1Y P;  5A6K A;  4HEI A;  5IXM B;  4LFC E;  3H63 A;  2M9A A;  3QFM A;  2HYP A;  5IV8 B;  4OOG C;  2IAE C;  4DT2 A;  4JI7 E;  2WZO A;  4FK5 C;  3RMP A;  2Z72 A;  4ORA A;  3C6M A;  5LMU E;  1S8E A;  1T4O A;  1GZ6 A;  2EMY A;  2EN8 A;  2D9H A;  3K6Q A;  4DR2 E;  4LFA E;  2NXF A;  5KL7 A;  2ZO9 B;  2PRT A;  3K7V C;  2CTD A;  4ZYH A;  2RSM A;  2A25 A;  5ADZ A;  4KWY A;  2LMZ A;  2MDR A;  2EMX A;  1DGC A;  1F2I G;  4IL1 A;  1I94 E;  2LCE A;  4NXN E;  4ZYG A;  2UXD E;  2EM3 A;  5AE1 A;  1O0W A;  2YRM A;  1II7 A;  4BHC A;  1UN6 B;  2EOQ A;  2E72 A;  4BMJ A;  2EMF A;  2V8Q B;  1GTK A;  2NUE A;  1MEY C;  3QG5 C;  4JA9 A;  1OID A;  3GVE A;  2YTP A;  4RHB B;  3ICF A;  3D03 A;  2V83 A;  2EOZ A;  2L92 A;  4V0V A;  1X5W A;  4FCX A;  3EPK A;  2NA2 A;  2EMC A;  1XZW A;  2HGH A;  4FBW A;  4O5G A;  1XMO E;  2MKD A;  3H69 A;  5JPE A;  2EOF A;  1OI8 A;  2HY1 A;  2EMZ A;  2ZM6 E;  1N3G A;  2EQ1 A;  2LTS A;  1XNQ E;  1PJS A;  1AUI A;  4MOY A;  5KL6 A;  2JVA A;  3AUZ A;  4JI3 E;  2V87 A;  3PSN A;  4H2I A;  3EGH A;  4FBK A;  3T1H E;  1QFC A;  4DMI A;  1SR9 A;  1W24 A;  3ZOQ B;  5JPF A;  2V88 A;  2ZOA A;  2ENA A;  2LRS A;  3F6G A;  3LLH A;  1G5B A;  3T1I A;  1YPN A;  1PJQ A;  4R2E A;  4MLV A;  3EPL A;  1X6F A;  1A1H A;  4WSG A;  4ZVZ A;  3THO B;  4R8O A;  4I5N C;  2B9D A;  4F6M A;  2ELY A;  1WAO 1;  1T71 A;  4M2Z A;  4P78 A;  4LTY A;  5J28 A;  3ADJ A;  5KL5 A;  4WWL A;  1YUI A;  2EMI A;  1PJT A;  2YSO A;  2EPC A;  2VRD A;  4H2G A;  1DI2 A;  4O43 A;  4GZN C;  3IVE A;  2EPA A;  4DR5 E;  4H1S A;  2JYA A;  3MHH C;  4R2Q A;  2Z1A A;  2O8G A;  3HQ1 A;  2LE2 A;  1HNX E;  3HPS A;  4M0V A;  4TUI A;  4DV3 E;  2DXN A;  4KKZ A;  2N3H A;  4JI5 E;  2DSY A;  1IQS A;  4DV2 E;  4H2B A;  4J6O A;  4M9V C;  1UF3 A;  2A22 A;  3C4B A;  2DRP A;  4JI8 E;  2QFR A;  1FJG E;  2IHR 1;  2JXP A;  5A6J A;  2ENH A;  2EN3 A;  3RL4 A;  2G7H A;  4F9B B;  3MSW A;  5IWA E;  2ODR C;  2J7J A;  2F8B A;  2N8X A;  2EMW A;  2YTE A;  1JK7 A;  4BC7 A;  1A1F A;  2DXL A;  2R76 A;  2YEQ A;  3EGG A;  5KL4 A;  4R03 A;  2B7V A;  2R17 A;  4DHL A;  5B8I A;  2EOX A;  4LF4 E;  2IE3 C;  1IQO A;  4DV6 E;  2YTN A;  4X9J A;  2EMH A;  1QNT A;  2V85 A;  3ADG A;  3HPZ A;  2EOH A;  2EPL X;  1T38 A;  1EH6 A;  3IB7 A;  2WDD A;  2EM6 A;  4X64 E;  1UHZ A;  4YHH E;  2EOO A;  1L4S A;  1YYO A;  2DIX A;  3TQM A;  2L2N A;  4DR1 E;  1WAR A;  1ZAA C;  3P71 C;  4MOV A;  4DV0 E;  3J80 C;  4ORB A;  4GKK E;  1BBO A;  3L00 A;  5FLX C;  1Z1B A;  1HR0 E;  1WHQ A;  3H67 A;  3H68 A;  2VF1 A;  4UWQ A;  1AAY A;  4TUG A;  2E1M A;  1S3M A;  2UUB E;  4JI2 E;  3H66 A;  5LMN E;  2M4I A;  2WBS A;  2V86 A;  4WSP A;  5TSE A;  4N4R B;  4R2R A;  4DUZ E;  2EWL A;  3CK2 A;  2M7Q A;  5CFF E;  1FJM A;  4GKJ E;  1IT6 A;  1X6E A;  1EKZ A;  4DSY A;  1A1L A;  4JYA E;  1RQ0 A;  2RQL A;  4F9A B;  3M99 B;  4DR6 E;  4LAC C;  2GJU A;  2JY9 A;  2UUA E;  4JI6 E;  1UBD C;  2EN2 A;  2KHX A;  2Z06 A;  3H62 B;  2WBT A;  1A1J A;  2I9I A;  4R2P A;  2DMY A;  1J26 A;  4LF6 E;  2USH A;  2WBU A;  1EH7 A;  1NEI A;  2NUF A;  4BS9 A;  2WDE A;  3J7Y p;  4ORC A;  2KKN A;  2L2M A;  1JK2 A;  3DSD A;  2JR1 A;  1YSA C;  5A6A A;  4X66 E;  1USH A;  3DW8 C;  4B3S E;  2LJH A;  5AE2 A;  4BHB A;  4JV5 E;  2V89 A;  3ZU0 A;  3IWD A;  2JWO A;  1X3C A;  2VQE E; 
#chains in the Genus database with same CATH homology
 3JYF A;  4NXM E;  4B3M E;  4DV7 E;  1J5E E;  1Z2W A;  2QFP A;  1IBK E;  3C4T A;  3N5U A;  4O4K A;  2L3C A;  4KHP E;  2LUP B;  2JOB A;  1YYK A;  4JA7 A;  4LFB E;  2AHD A;  1MF8 A;  3H64 A;  4UT2 A;  3H09 A;  1S95 A;  3IWB A;  2L8T A;  1N33 E;  4UT3 A;  1T4L B;  2RS7 A;  2FGG A;  4HD0 A;  5DNY A;  1IBM E;  2DB2 A;  3HVQ A;  4OX9 E;  2DFJ A;  1QU6 A;  2UXB E;  2UUC E;  5EQV A;  1V73 A;  2CV9 A;  4DUY E;  3ADI A;  1HP1 A;  2IE4 C;  2K4V A;  5INB A;  4YKE A;  1PKP A;  4Q7F A;  2NUG A;  1SU1 A;  4KBP A;  1KBP A;  3PSO A;  3TGH A;  2WDC A;  1YYW A;  3FGA C;  1N32 E;  1GQE A;  4F9C B;  4B3T E;  5IOH A;  3QFK A;  2BDX A;  2UU9 E;  4WPY A;  4L5N C;  5T6J A;  3QFN A;  4DV5 E;  3THN A;  2LBS B;  4UT3 B;  3V4Y A;  2ZBM A;  1HO5 A;  1HNW E;  2HYO A;  2NYL C;  3DSC A;  4M30 A;  3E0J A;  4XPN A;  2L2K B;  4J8Z A;  3H61 A;  3E7A A;  2FTX B;  1QHW A;  4X62 E;  1S3L A;  3VYY A;  3H60 A;  3C5W C;  3DF6 A;  3DJW A;  2KON A;  3LL8 A;  1UIL A;  4G9J A;  1IBL E;  2LTR A;  3JAM C;  2KOU A;  2RTX A;  1WHN A;  3QFO A;  2B3T B;  4JI1 E;  1X47 A;  3K7W C;  2BQ8 X;  4FBQ A;  4JI4 E;  4YY3 E;  3T1Y E;  1YZ9 A;  4KZS A;  4ZX2 A;  3ZTV A;  2F4V E;  2YVT A;  2E5L E;  3IB8 A;  4LU9 A;  4X65 E;  4LF9 E;  5AE3 A;  2FV4 B;  1N36 E;  4OR9 A;  3RQZ A;  2H36 X;  3KWR A;  1ZBT A;  3P1X A;  1XMQ E;  4AQY E;  4O24 A;  4LF5 E;  4L8N A;  2VE7 C;  4I8O A;  4DV1 E;  2RS6 A;  1XM7 A;  3J7A G;  1Z2X A;  4WYQ B;  5AAS A;  5GTU A;  1DQ3 A;  4IYP C;  4B3R E;  5A2Q C;  4K0K E;  3KBP A;  4H2F A;  4WFT A;  3FLO A;  3VK6 A;  3JU0 A;  2L3J A;  4LF8 E;  1T70 A;  2YZT A;  2P6B A;  4V0W A;  5HPE A;  3LML A;  1N34 E;  4V0X A;  2JOX A;  4DR4 E;  5LL6 R;  1S3N A;  2ODR D;  3C9F A;  4F0Z A;  3HXL A;  4Q28 A;  2O8A A;  2CPN A;  4B2O A;  1X48 A;  1XNR E;  4DR3 E;  3VYX A;  3RL3 A;  4F54 A;  1HNZ E;  5IT9 C;  4BCA A;  4LF7 E;  4NZV A;  3HTX A;  1OIE A;  4BC9 A;  3J81 C;  1S70 A;  2MC5 A;  2MC6 A;  2M1S A;  3F6H A;  4GEQ B;  4MP0 A;  3OTO E;  4JI0 E;  2L33 A;  3IVD A;  1TCO A;  4X8W A;  4BBY A;  4DV4 E;  3JTZ A;  2NPP C;  3E7B A;  1FKA E;  4DR7 E;  3AV0 A;  1HPU A;  2L6M A;  3ADL A;  5C1V A;  1T4N A;  3OML A;  2HHH E;  2VQF E;  2XMO A;  5JJT A;  4P7D A;  2EZ6 A;  3FIG A;  2NYM C;  1NNW A;  1UTE A;  2BCD A;  2N3G A;  1RC7 A;  3RL5 A;  5F3W A;  2B7T A;  3IWC A;  5BR8 E;  1M63 A;  1U32 A;  2JOG A;  2YT4 A;  2Q8U A;  1X49 A;  2LUQ A;  4I5L C;  1STU A;  1WXR A;  2WDF A;  2QJC A;  4DKK A;  1ZBQ A;  2UXC E;  4H1Y P;  4LFC E;  3H63 A;  3QFM A;  2HYP A;  4OOG C;  2IAE C;  4DT2 A;  4JI7 E;  2WZO A;  3RMP A;  4ORA A;  2Z72 A;  5LMU E;  1S8E A;  1T4O A;  1GZ6 A;  3K6Q A;  4DR2 E;  4LFA E;  2NXF A;  2ZO9 B;  3K7V C;  2RSM A;  5ADZ A;  2LMZ A;  2MDR A;  4IL1 A;  1I94 E;  4NXN E;  2UXD E;  5AE1 A;  1O0W A;  1II7 A;  4BMJ A;  2V8Q B;  2NUE A;  3QG5 C;  4JA9 A;  1OID A;  3GVE A;  3ICF A;  3D03 A;  2V83 A;  2L92 A;  4V0V A;  4FCX A;  2NA2 A;  1XZW A;  4FBW A;  1XMO E;  4O5G A;  3H69 A;  5JPE A;  1OI8 A;  2HY1 A;  2ZM6 E;  1XNQ E;  2LTS A;  1AUI A;  4MOY A;  2JVA A;  3AUZ A;  4JI3 E;  2V87 A;  3PSN A;  4H2I A;  3EGH A;  4FBK A;  3T1H E;  1QFC A;  4DMI A;  1SR9 A;  1W24 A;  3ZOQ B;  5JPF A;  2V88 A;  2ZOA A;  3F6G A;  2LRS A;  3LLH A;  1G5B A;  3T1I A;  4ZVZ A;  3THO B;  4R8O A;  4I5N C;  2B9D A;  1WAO 1;  1T71 A;  4M2Z A;  4P78 A;  4LTY A;  5J28 A;  3ADJ A;  4WWL A;  4H2G A;  1DI2 A;  3IVE A;  4O43 A;  4DR5 E;  4H1S A;  2Z1A A;  2O8G A;  3HQ1 A;  2LE2 A;  1HNX E;  3HPS A;  4M0V A;  4TUI A;  4DV3 E;  2DXN A;  4KKZ A;  2N3H A;  4JI5 E;  2DSY A;  4DV2 E;  4H2B A;  4J6O A;  1UF3 A;  2A22 A;  3C4B A;  4JI8 E;  2QFR A;  1FJG E;  2IHR 1;  3RL4 A;  2G7H A;  4F9B B;  3MSW A;  5IWA E;  2ODR C;  2F8B A;  1JK7 A;  4BC7 A;  2DXL A;  2YEQ A;  3EGG A;  4R03 A;  2B7V A;  2R17 A;  4DHL A;  5B8I A;  4LF4 E;  2IE3 C;  4DV6 E;  2V85 A;  3ADG A;  3HPZ A;  3IB7 A;  2WDD A;  4X64 E;  4YHH E;  1UHZ A;  1YYO A;  2DIX A;  4DR1 E;  2L2N A;  1WAR A;  3P71 C;  4MOV A;  4ORB A;  4DV0 E;  3J80 C;  4GKK E;  5FLX C;  1HR0 E;  1WHQ A;  3H67 A;  3H68 A;  2VF1 A;  4UWQ A;  4TUG A;  2E1M A;  1S3M A;  2UUB E;  4JI2 E;  3H66 A;  5LMN E;  2M4I A;  2V86 A;  4WSP A;  4DUZ E;  2EWL A;  3CK2 A;  2M7Q A;  5CFF E;  1FJM A;  4GKJ E;  1IT6 A;  1EKZ A;  4DSY A;  4JYA E;  1RQ0 A;  4F9A B;  4DR6 E;  4LAC C;  2GJU A;  2JY9 A;  2UUA E;  4JI6 E;  2KHX A;  2Z06 A;  3H62 B;  2DMY A;  1J26 A;  4LF6 E;  2USH A;  2NUF A;  4BS9 A;  2WDE A;  3J7Y p;  4ORC A;  2KKN A;  2L2M A;  3DSD A;  2JR1 A;  4X66 E;  1USH A;  3DW8 C;  4B3S E;  2LJH A;  5AE2 A;  4JV5 E;  2V89 A;  3ZU0 A;  3IWD A;  2JWO A;  2VQE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...