4TUGA

Crystal structure of mjmre11-dna2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
molecule keywords DNA double-strand break repair protein Mre11
total genus 100
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tugA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tugA01
4UT3B 2USHA 2KKNA 1HO5A 4HD0A 3H63A 3P71C 4IL1A 4LU9A 4TUIA 2JOGA 4J6OA 4ORCA 1T71A 2BQ8X 3EGGA 3H64A 3ZU0A 2NYMC 4XPNA 2NYLC 1OIEA 4MP0A 3QFOA 4JA9A 3FGAC 3H66A 4M0VA 5JPFA 3EGHA 1KBPA 2QJCA 2WDCA 2ZBMA 1U32A 4H1SA 1S3LA 2IAEC 3E7BA 1HPUA 3RQZA 2XMOA 4F0ZA 1UTEA 4UT3A 2IE4C 2A22A 5C1VA 3RL5A 3LL8A 3DSCA 3H69A 3DSDA 2WDFA 2QFPA 3E7AA 3GVEA 3H60A 5INBA 4H2IA 4OR9A 2NXFA 1S8EA 4DHLA 4O24A 4DT2A 2GJUA 3H68A 4I5LC 5DNYA 1S95A 1Z2XA 4O5GA 4ORAA 3RL4A 1XM7A 1AUIA 1V73A 3ZTVA 1OIDA 1HP1A 4TUGA 5HPEA 1Z2WA 1W24A 3QFNA 5IOHA 3H67A 3AV0A 3RL3A 3PSOA 3KBPA 3C9FA 1FJMA 3TGHA 1IT6A 2CV9A 4I5NC 3JYFA 5GTUA 4H2FA 4KKZA 2WDEA 2O8GA 1NNWA 3IVEA 4Q7FA 4YKEA 4O43A 1XZWA 1QHWA 3K7WC 1S3MA 4MOYA 2BCDA 2HYPA 3H62B 1OI8A 4DSYA 3V4YA 3THOB 5B8IA 3H61A 3T1IA 1USHA 4H2GA 1II7A 1WAO1 1MF8A 2HY1A 3ICFA 5JJTA 1S3NA 3DW8C 2YVTA 4LACC 4KBPA 1WARA 2WDDA 1JK7A 3PSNA 3QFKA 2Z06A 1SU1A 4H2BA 4O4KA 4IYPC 1QFCA 5JPEA 3IB7A 3IB8A 2BDXA 1UF3A 1S70A 3CK2A 2O8AA 2P6BA 2QFRA 4NZVA 3N5UA 1M63A 4MOVA 4H1YP 3THNA 4FBKA 4FBQA 4UWQA 2AHDA 2Z72A 5F3WA 1TCOA 5EQVA 3HVQA 2Z1AA 4V0XA 3QFMA 1T70A 4G9JA 3C5WC 2R17A 2IE3C 4ORBA 2HYOA 2NPPC 2Q8UA 4V0VA 3IVDA 3QG5C 4V0WA 4FBWA 4B2OA 4WWLA 2DFJA 4ZVZA 4ZX2A 4FCXA 3AUZA 1G5BA 4LTYA 4JA7A 5J28A 4UT2A 3K7VC
chains in the Genus database with same CATH superfamily
4ZYEA 2EMWA 2NABA 5IWAE 2WBSA 4JI3E 2ZM6E 3H63A 2EN7A 4IL1A 2EPRA 2HGHA 4TUIA 4DR7E 3J80C 1X6FA 2BQ8X 2YSPA 2EPKX 3KZYA 3H64A 2EPXA 1OIEA 4MP0A 4BC9A 1T38A 2NUFA 2KOUA 2UXBE 3H66A 1BBOA 5JPFA 3EGHA 4YY3E 1KBPA 4DR3E 2YWQA 3E7BA 4DKKA 2EM2A 1UTEA 2DMYA 3F6HA 4UT3A 3RL5A 3LL8A 4DV3E 2WDFA 2QFPA 2EMLA 4M30A 1XNRE 2RQLA 2YZTA 3DSDA 3HQ1A 4H2IA 4DV0E 2NXFA 3KWRA 1EH6A 1FKAE 4DHLA 4O24A 2EMBA 2UU9E 5DNYA 1S95A 3RL4A 2EMIA 5IV8B 3HPSA 1AUIA 4TUGA 4Q35B 2M4IA 3DJWA 2EOMA 4LFBE 1A1HA 3EPJA 4KHPE 5A6BD 5IOHA 1L4SA 2CPNA 1PJQA 3H67A 3HPZA 1YPNA 4WYQB 1X6EA 1FJMA 2ENAA 3LLHA 4I5NC 4H2FA 2ELZA 4IS1C 4R2EA 2M7QA 1NNWA 2YTGA 1RC7A 3ADLA 1WJPA 3IVEA 4Q7FA 4YKEA 3KZZA 2BB8A 1EKZA 1QHWA 1PDAA 2ZO9B 1WHQA 2LBSB 1ZU1A 3K7WC 4WSGA 4WSPA 3OTOE 2R76A 2BBGA 3ECRA 3JU0A 3H62B 4Q28A 1DQ3A 1OI8A 4DSYA 2EMAA 1ZBQA 4X66E 3ADIA 4BHCA 3H61A 1II7A 5AASA 4JI0E 2EN4A 2EN1A 2EOEA 1TF3A 2HY1A 2YVTA 2HJJA 2WDDA 2YTJA 3BBGA 2Z06A 4O4KA 2UXCE 4GKKE 4R8OA 3JTZA 1QFCA 5JPEA 3BIDA 3IB7A 2BDXA 2PRTA 2EN6A 1S70A 2MC5A 1F2IG 4DV7E 4KZSA 2EM4A 4WX9A 2LJHA 3THNA 4JYAE 4JI5E 4R2PA 2EQ1A 2RSMA 2V86A 1QNTA 2EZ6A 4V0XA 2JOBA 4G9JA 2EPOA 2YTIA 4ORBA 2GHFA 1UN6B 1WHNA 2M1SA 2YSOA 3ADJA 4FBWA 2DRPA 4DUYE 1YYKA 1P47A 2DFJA 3F6GA 3P1XA 3AUZA 2EQ3A 3ADGA 3BF2A 5KL6A 4UT2A 2N3HA 1UBDC 4B3ME 2ADRA 1HO5A 2KKNA 2LV2A 1WRJA 4B3RE 2G7HA 2L6MA 4DR4E 2EOHA 2EPPA 4J6OA 4WXDA 4K0KE 4ORCA 2V87A 5AC5A 4BCAA 2ENCA 2LT7A 3EGGA 3ZU0A 1X47A 4X8WA 2EM5A 5A6AA 2NYMC 4XPNA 2NYLC 1PKPA 4AQYE 2EJ4A 3FGAC 1JK1A 2FTXB 1ZAAC 2LUPB 4LF9E 2WZOA 2WDCA 1A1GA 2B9DA 2YT4A 1IMUA 3RQZA 1HPUA 2DLKA 4B3SE 1IBME 4X9JA 4HEIA 3J7AG 2A22A 3RMPA 3DSCA 2LO3A 4DUZE 4OR9A 3IWBA 3H68A 4I5LC 5AE1A 4ORAA 1Z2XA 1V73A 1J5EE 1HP1A 1YZ9A 4RH8A 2LUQA 2LRSA 1GTKA 4L5NC 4F9AB 1TN9A 5AE2A 3QFNA 1T4LB 5GTUA 4DV2E 3JYFA 2WDEA 2O8GA 2EL5A 4LF8E 4DR6E 1S3MA 2WCC3 4X62E 1STUA 1A1FA 2JPAA 2MKDA 2EM3A 2I9IA 2K4VA 4F54A 4MLVA 3V4YA 2IHR1 1ZR9A 3BGHA 3IWCA 3FLOA 2ODRC 2EN8A 2L2KB 4R2RA 1MF8A 2EM6A 3EPLA 5JJTA 3DW8C 5A6BA 4FK5C 2MDRA 1Z1BA 4JI1E 2EOYA 3PSNA 3EPKA 5LMNE 3QFKA 1AAYA 4H2BA 2EORA 2EPUA 2YTQA 5IT9C 2YTFA 4NXNE 1RMDA 2MDGA 4JI8E 2P6BA 1A1JA 2L2MA 2B7TA 1KYQA 5CFFE 1A1KA 2B3TB 1X49A 4H1YP 2YU5A 2EOQA 3D03A 4FBKA 2AHDA 2RTXA 1HNWE 2Z1AA 3QFMA 5LL6R 2JR1A 2YRHA 4I8OA 1N33E 2EM7A 1HNXE 2YRKA 2IE3C 1WXRA 5A2QC 3QG5C 5IXMB 2NUEA 2L8TA 1X5WA 4ZVZA 4OOGC 1G5BA 4JA7A 3VYXA 1PJSA 2N3GA 2LVHA 5J28A 3T1YE 2EL4A 2V89A 4M9VC 1O0WA 2K7IA 3VK6A 4F9BB 1XMQE 1YUIA 3P71C 4ZYDA 2EE8A 4KWYA 5A6KA 4P7DA 1XNQE 2VE7C 2EOSA 2DLQA 1GZ6A 2J7JA 2EPCA 3QFOA 4JA9A 2EM0A 2FGGA 4DR5E 2QJCA 2YRMA 2ZBMA 2L2NA 2CT1A 2V85A 4H1SA 1I94E 1S3LA 2EMXA 2IAEC 2I13A 2CTDA 5KL5A 1SR9A 2NA2A 2XMOA 4F0ZA 2YEQA 4R2QA 2RS7A 3H69A 2EOJA 3GVEA 3MHHC 3H60A 5INBA 4P78A 4DV1E 1S8EA 4DT2A 2FV4B 2GJUA 1IQOA 3UK3C 2HC5A 2YU8A 2EPZA 3H09A 1EH7A 4GEQB 1YUJA 1OIDA 1BBGA 2VRDA 5HPEA 5LMUE 4R2CA 1W24A 1DGCA 2RSIA 1JK2A 3PSOA 3KBPA 2MC6A 3C9FA 1IT6A 4LF6E 1X3CA 2EMFA 4KKZA 2VF1A 1BB8A 1HR0E 2ENHA 1PJTA 2L92A 4N4RB 3K6QA 1T4NA 2EPMX 2EMGA 2F8BA 4MOYA 5ADZA 2VQFE 2L3CA 2BCDA 2WBTA 1UHZA 2JXPA 3E0JA 1TF6A 2LTSA 3L00A 3THOB 1XMOE 4LF4E 2YTOA 4F6NA 2JY9A 4H2GA 3LMLA 2YTPA 1N3GA 5AE3A 3J81C 5KL3A 1S3NA 2E72A 4LACC 2EPNA 2V8QB 3MSWA 4DV4E 1RQ0A 1WARA 2E5LE 1J26A 1JK7A 4OX9E 3OMLA 4LFCE 1SU1A 1EH8A 4IJDA 3C4BA 1N32E 4NXME 5KL4A 3IB8A 5LLQA 1UF3A 4X64E 3FIGA 4WXCA 1YYOA 2JP9A 2UXDE 3CK2A 4BMJA 4R2DA 2O8AA 2QFRA 4NZVA 2EPLX 2MKNA 2EMHA 3DF6A 1M63A 1NEIA 2EOIA 3VYYA 1N36E 2Z72A 5F3WA 1TCOA 3HVQA 2EM9A 3ZOQB 3J7Yp 1T70A 2ELYA 2EQ0A 2R17A 2DGCA 2HYOA 2KHXA 4V0VA 3T1HE 2DMIA 4WWLA 2ZOAA 2HHHE 4LTYA 4JI6E 4BBYA 2RS6A 3C6KA 1QU6A 4UT3B 2USHA 4HD0A 2DSYA 2YTDA 1IBKE 4LU9A 2EP3A 1KJKA 2JOGA 1T71A 4LF5E 2EPAA 2E1MA 3C6MA 4YHHE 1N34E 1FJGE 2DXNA 1B69A 2DXLA 3HTXA 4M0VA 1YFHA 1SFEA 1GQEA 1YYWA 2B7VA 1NCSA 2YPNA 1U32A 4F6MA 2EOOA 2D9HA 2KONA 4JI2E 1A1IA 2YTEA 2UUCE 1HNZE 1IQSA 2UUBE 2IE4C 5C1VA 3C4TA 4RHBB 4ZYHA 3E7AA 1X6HA 4HTGA 4M2ZA 2EN2A 2F4VE 5KL2A 4GKJE 3VHTB 1T39A 2DIXA 2YTNA 2JOXA 4O5GA 4DMIA 4R2SA 4F9CB 1DI2A 4MLQA 1XM7A 2EMZA 3ZTVA 2EOZA 2H36X 2LJUA 2VQEE 1Z2WA 2EWLA 3AV0A 3RL3A 4BC7A 3TGHA 2CV9A 4BHBA 2V88A 4R03A 3HXLA 4DR1E 2LTRA 2L3JA 4O43A 4BS9A 1XZWA 2ODRD 1IBLE 1T4OA 2V83A 4WFTA 4ZYGA 2EOFA 2WBUA 1ZBTA 4B3TE 2HYPA 1UILA 5FLXC 2CSHA 2DB2A 2EM8A 1A1LA 2LMZA 4NHRA 5KL7A 1X48A 5B8IA 4X65E 2JYAA 2M9AA 4L8NA 4DR2E 2JVAA 4GZNC 1USHA 1WAO1 3T1IA 1MGTA 3M99B 3ICFA 2R1FA 3MHSC 3EPHA 4JI4E 2NUGA 5AC4A 3JAMC 4KBPA 3TQMA 5BR8E 4J8ZA 4WPYA 5A69A 1G2FC 4LFAE 4LF7E 2A25A 1LLMC 2L33A 4IYPC 2LCEA 1YSAC 3EQ1A 2EMKA 4DV5E 2EMCA 4F2JC 2N8XA 2UUAE 4DV6E 2JWOA 4JI7E 4R2AA 3N5UA 2EL6A 1MEYC 1AH5A 4MOVA 2EN3A 2GLIA 2GPIA 4FBQA 4UWQA 2EOXA 5EQVA 5TSEA 4JV5E 2EMYA 3C5WC 5A6JA 3IWDA 2NPPC 2Q8UA 3IVDA 4V0WA 4B2OA 2LE2A 5T6JA 4FCXA 4ZX2A 1G2DC 2RPCA 3K7VC
chains in the Genus database with same CATH topology
5IWAE 4JI3E 2ZM6E 3H63A 4IL1A 4TUIA 4DR7E 3J80C 2BQ8X 3H64A 1OIEA 4MP0A 4BC9A 2NUFA 2KOUA 2UXBE 3H66A 5JPFA 3EGHA 4YY3E 1KBPA 4DR3E 3E7BA 4DKKA 1UTEA 2DMYA 3F6HA 4UT3A 3RL5A 3LL8A 4DV3E 2WDFA 2QFPA 1XNRE 4M30A 3DSDA 2YZTA 3HQ1A 4H2IA 4DV0E 2NXFA 3KWRA 1FKAE 4DHLA 4O24A 2UU9E 5DNYA 1S95A 3RL4A 3HPSA 1AUIA 4TUGA 2M4IA 3DJWA 4LFBE 4KHPE 5IOHA 2CPNA 3H67A 3HPZA 4WYQB 1FJMA 3LLHA 4I5NC 4H2FA 2M7QA 3IVEA 1NNWA 3ADLA 1RC7A 4Q7FA 4YKEA 1EKZA 1QHWA 2ZO9B 3K7WC 1WHQA 2LBSB 4WSPA 3OTOE 3JU0A 3H62B 4Q28A 1DQ3A 1OI8A 4DSYA 1ZBQA 4X66E 3ADIA 3H61A 1II7A 5AASA 4JI0E 2HY1A 2YVTA 2WDDA 2Z06A 4O4KA 2UXCE 4GKKE 4R8OA 3JTZA 1QFCA 5JPEA 3IB7A 2BDXA 1S70A 2MC5A 4DV7E 4KZSA 2LJHA 3THNA 4JYAE 4JI5E 2RSMA 2V86A 2EZ6A 4V0XA 2JOBA 4G9JA 4ORBA 1WHNA 2M1SA 3ADJA 4FBWA 4DUYE 1YYKA 2DFJA 3F6GA 3P1XA 3AUZA 3ADGA 4UT2A 2N3HA 4B3ME 2KKNA 1HO5A 4B3RE 2G7HA 2L6MA 4DR4E 4J6OA 4K0KE 4ORCA 2V87A 4BCAA 3EGGA 3ZU0A 1X47A 4X8WA 2NYMC 4XPNA 2NYLC 1PKPA 4AQYE 3FGAC 2FTXB 2LUPB 4LF9E 2WZOA 2WDCA 2B9DA 2YT4A 3RQZA 1HPUA 4B3SE 1IBME 3J7AG 2A22A 3RMPA 3DSCA 4DUZE 4OR9A 3IWBA 3H68A 4I5LC 5AE1A 4ORAA 1Z2XA 1V73A 1J5EE 1HP1A 1YZ9A 2LUQA 2LRSA 4L5NC 4F9AB 5AE2A 3QFNA 1T4LB 5GTUA 4DV2E 3JYFA 2WDEA 2O8GA 4LF8E 4DR6E 1S3MA 4X62E 1STUA 2K4VA 4F54A 3V4YA 2IHR1 3IWCA 3FLOA 2ODRC 2L2KB 1MF8A 5JJTA 3DW8C 2MDRA 4JI1E 3PSNA 5LMNE 3QFKA 4H2BA 5IT9C 4NXNE 4JI8E 2P6BA 2L2MA 2B7TA 5CFFE 2B3TB 1X49A 4H1YP 3D03A 4FBKA 2AHDA 2RTXA 1HNWE 2Z1AA 3QFMA 5LL6R 2JR1A 4I8OA 1N33E 1HNXE 2IE3C 1WXRA 5A2QC 3QG5C 2NUEA 2L8TA 4ZVZA 4OOGC 1G5BA 4JA7A 3VYXA 5J28A 2N3GA 3T1YE 2V89A 1O0WA 3VK6A 4F9BB 1XMQE 3P71C 4P7DA 1XNQE 2VE7C 1GZ6A 3QFOA 4JA9A 2FGGA 4DR5E 2QJCA 2ZBMA 2L2NA 2V85A 4H1SA 1I94E 1S3LA 2IAEC 1SR9A 2NA2A 2XMOA 4F0ZA 2YEQA 2RS7A 3H69A 3GVEA 3H60A 5INBA 4P78A 4DV1E 1S8EA 4DT2A 2FV4B 2GJUA 3H09A 4GEQB 1OIDA 5HPEA 5LMUE 1W24A 3PSOA 3KBPA 2MC6A 3C9FA 1IT6A 4LF6E 4KKZA 2VF1A 1HR0E 2L92A 3K6QA 1T4NA 2F8BA 4MOYA 5ADZA 2VQFE 2L3CA 2BCDA 1UHZA 3E0JA 2LTSA 3THOB 1XMOE 4LF4E 2JY9A 4H2GA 3LMLA 5AE3A 3J81C 1S3NA 4LACC 4DV4E 2V8QB 3MSWA 1RQ0A 1WARA 2E5LE 1J26A 1JK7A 4OX9E 3OMLA 4LFCE 1SU1A 3C4BA 1N32E 4NXME 3IB8A 1UF3A 4X64E 3FIGA 1YYOA 2UXDE 3CK2A 4BMJA 2O8AA 2QFRA 4NZVA 3DF6A 1M63A 3VYYA 1N36E 2Z72A 5F3WA 1TCOA 3HVQA 3ZOQB 3J7Yp 1T70A 2R17A 2HYOA 2KHXA 4V0VA 3T1HE 4WWLA 2ZOAA 2HHHE 4LTYA 4JI6E 4BBYA 2RS6A 1QU6A 4UT3B 2USHA 4HD0A 2DSYA 1IBKE 4LU9A 2JOGA 1T71A 4LF5E 2E1MA 4YHHE 1N34E 1FJGE 2DXNA 2DXLA 3HTXA 4M0VA 1GQEA 1YYWA 2B7VA 1U32A 2KONA 4JI2E 2UUCE 1HNZE 2IE4C 2UUBE 5C1VA 3C4TA 3E7AA 4M2ZA 2F4VE 4GKJE 2DIXA 4O5GA 2JOXA 4DMIA 4F9CB 1DI2A 1XM7A 3ZTVA 2H36X 2VQEE 1Z2WA 2EWLA 3AV0A 3RL3A 4BC7A 3TGHA 2CV9A 2V88A 4R03A 3HXLA 4DR1E 2LTRA 2L3JA 4BS9A 1XZWA 4O43A 2ODRD 1IBLE 1T4OA 2V83A 4WFTA 1ZBTA 4B3TE 2HYPA 1UILA 5FLXC 2DB2A 2LMZA 1X48A 5B8IA 4X65E 4DR2E 4L8NA 3T1IA 1USHA 2JVAA 1WAO1 3ICFA 4JI4E 2NUGA 4KBPA 3JAMC 5BR8E 4J8ZA 4WPYA 4LFAE 4LF7E 2L33A 4IYPC 4DV5E 2UUAE 4DV6E 2JWOA 4JI7E 3N5UA 4MOVA 4FBQA 4UWQA 5EQVA 4JV5E 3C5WC 3IWDA 2NPPC 2Q8UA 3IVDA 4V0WA 4B2OA 2LE2A 5T6JA 4FCXA 4ZX2A 3K7VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UT3 B;  2USH A;  2KKN A;  1HO5 A;  4HD0 A;  3H63 A;  3P71 C;  4IL1 A;  4LU9 A;  4TUI A;  2JOG A;  4J6O A;  4ORC A;  1T71 A;  2BQ8 X;  3EGG A;  3H64 A;  3ZU0 A;  2NYM C;  4XPN A;  2NYL C;  1OIE A;  4MP0 A;  3QFO A;  4JA9 A;  3FGA C;  3H66 A;  4M0V A;  5JPF A;  3EGH A;  1KBP A;  2QJC A;  2WDC A;  2ZBM A;  1U32 A;  4H1S A;  1S3L A;  2IAE C;  3E7B A;  1HPU A;  3RQZ A;  2XMO A;  4F0Z A;  1UTE A;  4UT3 A;  2IE4 C;  2A22 A;  5C1V A;  3RL5 A;  3LL8 A;  3DSC A;  3H69 A;  3DSD A;  2WDF A;  2QFP A;  3E7A A;  3GVE A;  3H60 A;  5INB A;  4H2I A;  4OR9 A;  2NXF A;  1S8E A;  4DHL A;  4O24 A;  4DT2 A;  2GJU A;  3H68 A;  4I5L C;  5DNY A;  1S95 A;  1Z2X A;  4O5G A;  4ORA A;  3RL4 A;  1XM7 A;  1AUI A;  1V73 A;  3ZTV A;  1OID A;  1HP1 A;  4TUG A;  5HPE A;  1Z2W A;  1W24 A;  3QFN A;  5IOH A;  3H67 A;  3AV0 A;  3RL3 A;  3PSO A;  3KBP A;  3C9F A;  1FJM A;  3TGH A;  1IT6 A;  2CV9 A;  4I5N C;  3JYF A;  5GTU A;  4H2F A;  4KKZ A;  2WDE A;  2O8G A;  1NNW A;  3IVE A;  4Q7F A;  4YKE A;  4O43 A;  1XZW A;  1QHW A;  3K7W C;  1S3M A;  4MOY A;  2BCD A;  2HYP A;  3H62 B;  1OI8 A;  4DSY A;  3V4Y A;  3THO B;  5B8I A;  3H61 A;  3T1I A;  1USH A;  4H2G A;  1II7 A;  1WAO 1;  1MF8 A;  2HY1 A;  3ICF A;  5JJT A;  1S3N A;  3DW8 C;  2YVT A;  4LAC C;  4KBP A;  1WAR A;  2WDD A;  1JK7 A;  3PSN A;  3QFK A;  2Z06 A;  1SU1 A;  4H2B A;  4O4K A;  4IYP C;  1QFC A;  5JPE A;  3IB7 A;  3IB8 A;  2BDX A;  1UF3 A;  1S70 A;  3CK2 A;  2O8A A;  2P6B A;  2QFR A;  4NZV A;  3N5U A;  1M63 A;  4MOV A;  4H1Y P;  3THN A;  4FBK A;  4FBQ A;  4UWQ A;  2AHD A;  2Z72 A;  5F3W A;  1TCO A;  5EQV A;  3HVQ A;  2Z1A A;  4V0X A;  3QFM A;  1T70 A;  4G9J A;  3C5W C;  2R17 A;  2IE3 C;  4ORB A;  2HYO A;  2NPP C;  2Q8U A;  4V0V A;  3IVD A;  3QG5 C;  4V0W A;  4FBW A;  4B2O A;  4WWL A;  2DFJ A;  4ZVZ A;  4ZX2 A;  4FCX A;  3AUZ A;  1G5B A;  4LTY A;  4JA7 A;  5J28 A;  4UT2 A;  3K7V C; 
#chains in the Genus database with same CATH topology
 4ZYE A;  2EMW A;  2NAB A;  5IWA E;  2WBS A;  4JI3 E;  2ZM6 E;  3H63 A;  2EN7 A;  4IL1 A;  2EPR A;  2HGH A;  4TUI A;  4DR7 E;  3J80 C;  1X6F A;  2BQ8 X;  2YSP A;  2EPK X;  3KZY A;  3H64 A;  2EPX A;  1OIE A;  4MP0 A;  4BC9 A;  1T38 A;  2NUF A;  2KOU A;  2UXB E;  3H66 A;  1BBO A;  5JPF A;  3EGH A;  4YY3 E;  1KBP A;  4DR3 E;  2YWQ A;  3E7B A;  4DKK A;  2EM2 A;  1UTE A;  2DMY A;  3F6H A;  4UT3 A;  3RL5 A;  3LL8 A;  4DV3 E;  2WDF A;  2QFP A;  2EML A;  4M30 A;  1XNR E;  2RQL A;  2YZT A;  3DSD A;  3HQ1 A;  4H2I A;  4DV0 E;  2NXF A;  3KWR A;  1EH6 A;  1FKA E;  4DHL A;  4O24 A;  2EMB A;  2UU9 E;  5DNY A;  1S95 A;  3RL4 A;  2EMI A;  5IV8 B;  3HPS A;  1AUI A;  4TUG A;  4Q35 B;  2M4I A;  3DJW A;  2EOM A;  4LFB E;  1A1H A;  3EPJ A;  4KHP E;  5A6B D;  5IOH A;  1L4S A;  2CPN A;  1PJQ A;  3H67 A;  3HPZ A;  1YPN A;  4WYQ B;  1X6E A;  1FJM A;  2ENA A;  3LLH A;  4I5N C;  4H2F A;  2ELZ A;  4IS1 C;  4R2E A;  2M7Q A;  1NNW A;  2YTG A;  1RC7 A;  3ADL A;  1WJP A;  3IVE A;  4Q7F A;  4YKE A;  3KZZ A;  2BB8 A;  1EKZ A;  1QHW A;  1PDA A;  2ZO9 B;  1WHQ A;  2LBS B;  1ZU1 A;  3K7W C;  4WSG A;  4WSP A;  3OTO E;  2R76 A;  2BBG A;  3ECR A;  3JU0 A;  3H62 B;  4Q28 A;  1DQ3 A;  1OI8 A;  4DSY A;  2EMA A;  1ZBQ A;  4X66 E;  3ADI A;  4BHC A;  3H61 A;  1II7 A;  5AAS A;  4JI0 E;  2EN4 A;  2EN1 A;  2EOE A;  1TF3 A;  2HY1 A;  2YVT A;  2HJJ A;  2WDD A;  2YTJ A;  3BBG A;  2Z06 A;  4O4K A;  2UXC E;  4GKK E;  4R8O A;  3JTZ A;  1QFC A;  5JPE A;  3BID A;  3IB7 A;  2BDX A;  2PRT A;  2EN6 A;  1S70 A;  2MC5 A;  1F2I G;  4DV7 E;  4KZS A;  2EM4 A;  4WX9 A;  2LJH A;  3THN A;  4JYA E;  4JI5 E;  4R2P A;  2EQ1 A;  2RSM A;  2V86 A;  1QNT A;  2EZ6 A;  4V0X A;  2JOB A;  4G9J A;  2EPO A;  2YTI A;  4ORB A;  2GHF A;  1UN6 B;  1WHN A;  2M1S A;  2YSO A;  3ADJ A;  4FBW A;  2DRP A;  4DUY E;  1YYK A;  1P47 A;  2DFJ A;  3F6G A;  3P1X A;  3AUZ A;  2EQ3 A;  3ADG A;  3BF2 A;  5KL6 A;  4UT2 A;  2N3H A;  1UBD C;  4B3M E;  2ADR A;  1HO5 A;  2KKN A;  2LV2 A;  1WRJ A;  4B3R E;  2G7H A;  2L6M A;  4DR4 E;  2EOH A;  2EPP A;  4J6O A;  4WXD A;  4K0K E;  4ORC A;  2V87 A;  5AC5 A;  4BCA A;  2ENC A;  2LT7 A;  3EGG A;  3ZU0 A;  1X47 A;  4X8W A;  2EM5 A;  5A6A A;  2NYM C;  4XPN A;  2NYL C;  1PKP A;  4AQY E;  2EJ4 A;  3FGA C;  1JK1 A;  2FTX B;  1ZAA C;  2LUP B;  4LF9 E;  2WZO A;  2WDC A;  1A1G A;  2B9D A;  2YT4 A;  1IMU A;  3RQZ A;  1HPU A;  2DLK A;  4B3S E;  1IBM E;  4X9J A;  4HEI A;  3J7A G;  2A22 A;  3RMP A;  3DSC A;  2LO3 A;  4DUZ E;  4OR9 A;  3IWB A;  3H68 A;  4I5L C;  5AE1 A;  4ORA A;  1Z2X A;  1V73 A;  1J5E E;  1HP1 A;  1YZ9 A;  4RH8 A;  2LUQ A;  2LRS A;  1GTK A;  4L5N C;  4F9A B;  1TN9 A;  5AE2 A;  3QFN A;  1T4L B;  5GTU A;  4DV2 E;  3JYF A;  2WDE A;  2O8G A;  2EL5 A;  4LF8 E;  4DR6 E;  1S3M A;  2WCC 3;  4X62 E;  1STU A;  1A1F A;  2JPA A;  2MKD A;  2EM3 A;  2I9I A;  2K4V A;  4F54 A;  4MLV A;  3V4Y A;  2IHR 1;  1ZR9 A;  3BGH A;  3IWC A;  3FLO A;  2ODR C;  2EN8 A;  2L2K B;  4R2R A;  1MF8 A;  2EM6 A;  3EPL A;  5JJT A;  3DW8 C;  5A6B A;  4FK5 C;  2MDR A;  1Z1B A;  4JI1 E;  2EOY A;  3PSN A;  3EPK A;  5LMN E;  3QFK A;  1AAY A;  4H2B A;  2EOR A;  2EPU A;  2YTQ A;  5IT9 C;  2YTF A;  4NXN E;  1RMD A;  2MDG A;  4JI8 E;  2P6B A;  1A1J A;  2L2M A;  2B7T A;  1KYQ A;  5CFF E;  1A1K A;  2B3T B;  1X49 A;  4H1Y P;  2YU5 A;  2EOQ A;  3D03 A;  4FBK A;  2AHD A;  2RTX A;  1HNW E;  2Z1A A;  3QFM A;  5LL6 R;  2JR1 A;  2YRH A;  4I8O A;  1N33 E;  2EM7 A;  1HNX E;  2YRK A;  2IE3 C;  1WXR A;  5A2Q C;  3QG5 C;  5IXM B;  2NUE A;  2L8T A;  1X5W A;  4ZVZ A;  4OOG C;  1G5B A;  4JA7 A;  3VYX A;  1PJS A;  2N3G A;  2LVH A;  5J28 A;  3T1Y E;  2EL4 A;  2V89 A;  4M9V C;  1O0W A;  2K7I A;  3VK6 A;  4F9B B;  1XMQ E;  1YUI A;  3P71 C;  4ZYD A;  2EE8 A;  4KWY A;  5A6K A;  4P7D A;  1XNQ E;  2VE7 C;  2EOS A;  2DLQ A;  1GZ6 A;  2J7J A;  2EPC A;  3QFO A;  4JA9 A;  2EM0 A;  2FGG A;  4DR5 E;  2QJC A;  2YRM A;  2ZBM A;  2L2N A;  2CT1 A;  2V85 A;  4H1S A;  1I94 E;  1S3L A;  2EMX A;  2IAE C;  2I13 A;  2CTD A;  5KL5 A;  1SR9 A;  2NA2 A;  2XMO A;  4F0Z A;  2YEQ A;  4R2Q A;  2RS7 A;  3H69 A;  2EOJ A;  3GVE A;  3MHH C;  3H60 A;  5INB A;  4P78 A;  4DV1 E;  1S8E A;  4DT2 A;  2FV4 B;  2GJU A;  1IQO A;  3UK3 C;  2HC5 A;  2YU8 A;  2EPZ A;  3H09 A;  1EH7 A;  4GEQ B;  1YUJ A;  1OID A;  1BBG A;  2VRD A;  5HPE A;  5LMU E;  4R2C A;  1W24 A;  1DGC A;  2RSI A;  1JK2 A;  3PSO A;  3KBP A;  2MC6 A;  3C9F A;  1IT6 A;  4LF6 E;  1X3C A;  2EMF A;  4KKZ A;  2VF1 A;  1BB8 A;  1HR0 E;  2ENH A;  1PJT A;  2L92 A;  4N4R B;  3K6Q A;  1T4N A;  2EPM X;  2EMG A;  2F8B A;  4MOY A;  5ADZ A;  2VQF E;  2L3C A;  2BCD A;  2WBT A;  1UHZ A;  2JXP A;  3E0J A;  1TF6 A;  2LTS A;  3L00 A;  3THO B;  1XMO E;  4LF4 E;  2YTO A;  4F6N A;  2JY9 A;  4H2G A;  3LML A;  2YTP A;  1N3G A;  5AE3 A;  3J81 C;  5KL3 A;  1S3N A;  2E72 A;  4LAC C;  2EPN A;  2V8Q B;  3MSW A;  4DV4 E;  1RQ0 A;  1WAR A;  2E5L E;  1J26 A;  1JK7 A;  4OX9 E;  3OML A;  4LFC E;  1SU1 A;  1EH8 A;  4IJD A;  3C4B A;  1N32 E;  4NXM E;  5KL4 A;  3IB8 A;  5LLQ A;  1UF3 A;  4X64 E;  3FIG A;  4WXC A;  1YYO A;  2JP9 A;  2UXD E;  3CK2 A;  4BMJ A;  4R2D A;  2O8A A;  2QFR A;  4NZV A;  2EPL X;  2MKN A;  2EMH A;  3DF6 A;  1M63 A;  1NEI A;  2EOI A;  3VYY A;  1N36 E;  2Z72 A;  5F3W A;  1TCO A;  3HVQ A;  2EM9 A;  3ZOQ B;  3J7Y p;  1T70 A;  2ELY A;  2EQ0 A;  2R17 A;  2DGC A;  2HYO A;  2KHX A;  4V0V A;  3T1H E;  2DMI A;  4WWL A;  2ZOA A;  2HHH E;  4LTY A;  4JI6 E;  4BBY A;  2RS6 A;  3C6K A;  1QU6 A;  4UT3 B;  2USH A;  4HD0 A;  2DSY A;  2YTD A;  1IBK E;  4LU9 A;  2EP3 A;  1KJK A;  2JOG A;  1T71 A;  4LF5 E;  2EPA A;  2E1M A;  3C6M A;  4YHH E;  1N34 E;  1FJG E;  2DXN A;  1B69 A;  2DXL A;  3HTX A;  4M0V A;  1YFH A;  1SFE A;  1GQE A;  1YYW A;  2B7V A;  1NCS A;  2YPN A;  1U32 A;  4F6M A;  2EOO A;  2D9H A;  2KON A;  4JI2 E;  1A1I A;  2YTE A;  2UUC E;  1HNZ E;  1IQS A;  2UUB E;  2IE4 C;  5C1V A;  3C4T A;  4RHB B;  4ZYH A;  3E7A A;  1X6H A;  4HTG A;  4M2Z A;  2EN2 A;  2F4V E;  5KL2 A;  4GKJ E;  3VHT B;  1T39 A;  2DIX A;  2YTN A;  2JOX A;  4O5G A;  4DMI A;  4R2S A;  4F9C B;  1DI2 A;  4MLQ A;  1XM7 A;  2EMZ A;  3ZTV A;  2EOZ A;  2H36 X;  2LJU A;  2VQE E;  1Z2W A;  2EWL A;  3AV0 A;  3RL3 A;  4BC7 A;  3TGH A;  2CV9 A;  4BHB A;  2V88 A;  4R03 A;  3HXL A;  4DR1 E;  2LTR A;  2L3J A;  4O43 A;  4BS9 A;  1XZW A;  2ODR D;  1IBL E;  1T4O A;  2V83 A;  4WFT A;  4ZYG A;  2EOF A;  2WBU A;  1ZBT A;  4B3T E;  2HYP A;  1UIL A;  5FLX C;  2CSH A;  2DB2 A;  2EM8 A;  1A1L A;  2LMZ A;  4NHR A;  5KL7 A;  1X48 A;  5B8I A;  4X65 E;  2JYA A;  2M9A A;  4L8N A;  4DR2 E;  2JVA A;  4GZN C;  1USH A;  1WAO 1;  3T1I A;  1MGT A;  3M99 B;  3ICF A;  2R1F A;  3MHS C;  3EPH A;  4JI4 E;  2NUG A;  5AC4 A;  3JAM C;  4KBP A;  3TQM A;  5BR8 E;  4J8Z A;  4WPY A;  5A69 A;  1G2F C;  4LFA E;  4LF7 E;  2A25 A;  1LLM C;  2L33 A;  4IYP C;  2LCE A;  1YSA C;  3EQ1 A;  2EMK A;  4DV5 E;  2EMC A;  4F2J C;  2N8X A;  2UUA E;  4DV6 E;  2JWO A;  4JI7 E;  4R2A A;  3N5U A;  2EL6 A;  1MEY C;  1AH5 A;  4MOV A;  2EN3 A;  2GLI A;  2GPI A;  4FBQ A;  4UWQ A;  2EOX A;  5EQV A;  5TSE A;  4JV5 E;  2EMY A;  3C5W C;  5A6J A;  3IWD A;  2NPP C;  2Q8U A;  3IVD A;  4V0W A;  4B2O A;  2LE2 A;  5T6J A;  4FCX A;  4ZX2 A;  1G2D C;  2RPC A;  3K7V C; 
#chains in the Genus database with same CATH homology
 5IWA E;  4JI3 E;  2ZM6 E;  3H63 A;  4IL1 A;  4TUI A;  4DR7 E;  3J80 C;  2BQ8 X;  3H64 A;  1OIE A;  4MP0 A;  4BC9 A;  2NUF A;  2KOU A;  2UXB E;  3H66 A;  5JPF A;  3EGH A;  4YY3 E;  1KBP A;  4DR3 E;  3E7B A;  4DKK A;  1UTE A;  2DMY A;  3F6H A;  4UT3 A;  3RL5 A;  3LL8 A;  4DV3 E;  2WDF A;  2QFP A;  1XNR E;  4M30 A;  3DSD A;  2YZT A;  3HQ1 A;  4H2I A;  4DV0 E;  2NXF A;  3KWR A;  1FKA E;  4DHL A;  4O24 A;  2UU9 E;  5DNY A;  1S95 A;  3RL4 A;  3HPS A;  1AUI A;  4TUG A;  2M4I A;  3DJW A;  4LFB E;  4KHP E;  5IOH A;  2CPN A;  3H67 A;  3HPZ A;  4WYQ B;  1FJM A;  3LLH A;  4I5N C;  4H2F A;  2M7Q A;  3IVE A;  1NNW A;  3ADL A;  1RC7 A;  4Q7F A;  4YKE A;  1EKZ A;  1QHW A;  2ZO9 B;  3K7W C;  1WHQ A;  2LBS B;  4WSP A;  3OTO E;  3JU0 A;  3H62 B;  4Q28 A;  1DQ3 A;  1OI8 A;  4DSY A;  1ZBQ A;  4X66 E;  3ADI A;  3H61 A;  1II7 A;  5AAS A;  4JI0 E;  2HY1 A;  2YVT A;  2WDD A;  2Z06 A;  4O4K A;  2UXC E;  4GKK E;  4R8O A;  3JTZ A;  1QFC A;  5JPE A;  3IB7 A;  2BDX A;  1S70 A;  2MC5 A;  4DV7 E;  4KZS A;  2LJH A;  3THN A;  4JYA E;  4JI5 E;  2RSM A;  2V86 A;  2EZ6 A;  4V0X A;  2JOB A;  4G9J A;  4ORB A;  1WHN A;  2M1S A;  3ADJ A;  4FBW A;  4DUY E;  1YYK A;  2DFJ A;  3F6G A;  3P1X A;  3AUZ A;  3ADG A;  4UT2 A;  2N3H A;  4B3M E;  2KKN A;  1HO5 A;  4B3R E;  2G7H A;  2L6M A;  4DR4 E;  4J6O A;  4K0K E;  4ORC A;  2V87 A;  4BCA A;  3EGG A;  3ZU0 A;  1X47 A;  4X8W A;  2NYM C;  4XPN A;  2NYL C;  1PKP A;  4AQY E;  3FGA C;  2FTX B;  2LUP B;  4LF9 E;  2WZO A;  2WDC A;  2B9D A;  2YT4 A;  3RQZ A;  1HPU A;  4B3S E;  1IBM E;  3J7A G;  2A22 A;  3RMP A;  3DSC A;  4DUZ E;  4OR9 A;  3IWB A;  3H68 A;  4I5L C;  5AE1 A;  4ORA A;  1Z2X A;  1V73 A;  1J5E E;  1HP1 A;  1YZ9 A;  2LUQ A;  2LRS A;  4L5N C;  4F9A B;  5AE2 A;  3QFN A;  1T4L B;  5GTU A;  4DV2 E;  3JYF A;  2WDE A;  2O8G A;  4LF8 E;  4DR6 E;  1S3M A;  4X62 E;  1STU A;  2K4V A;  4F54 A;  3V4Y A;  2IHR 1;  3IWC A;  3FLO A;  2ODR C;  2L2K B;  1MF8 A;  5JJT A;  3DW8 C;  2MDR A;  4JI1 E;  3PSN A;  5LMN E;  3QFK A;  4H2B A;  5IT9 C;  4NXN E;  4JI8 E;  2P6B A;  2L2M A;  2B7T A;  5CFF E;  2B3T B;  1X49 A;  4H1Y P;  3D03 A;  4FBK A;  2AHD A;  2RTX A;  1HNW E;  2Z1A A;  3QFM A;  5LL6 R;  2JR1 A;  4I8O A;  1N33 E;  1HNX E;  2IE3 C;  1WXR A;  5A2Q C;  3QG5 C;  2NUE A;  2L8T A;  4ZVZ A;  4OOG C;  1G5B A;  4JA7 A;  3VYX A;  5J28 A;  2N3G A;  3T1Y E;  2V89 A;  1O0W A;  3VK6 A;  4F9B B;  1XMQ E;  3P71 C;  4P7D A;  1XNQ E;  2VE7 C;  1GZ6 A;  3QFO A;  4JA9 A;  2FGG A;  4DR5 E;  2QJC A;  2ZBM A;  2L2N A;  2V85 A;  4H1S A;  1I94 E;  1S3L A;  2IAE C;  1SR9 A;  2NA2 A;  2XMO A;  4F0Z A;  2YEQ A;  2RS7 A;  3H69 A;  3GVE A;  3H60 A;  5INB A;  4P78 A;  4DV1 E;  1S8E A;  4DT2 A;  2FV4 B;  2GJU A;  3H09 A;  4GEQ B;  1OID A;  5HPE A;  5LMU E;  1W24 A;  3PSO A;  3KBP A;  2MC6 A;  3C9F A;  1IT6 A;  4LF6 E;  4KKZ A;  2VF1 A;  1HR0 E;  2L92 A;  3K6Q A;  1T4N A;  2F8B A;  4MOY A;  5ADZ A;  2VQF E;  2L3C A;  2BCD A;  1UHZ A;  3E0J A;  2LTS A;  3THO B;  1XMO E;  4LF4 E;  2JY9 A;  4H2G A;  3LML A;  5AE3 A;  3J81 C;  1S3N A;  4LAC C;  4DV4 E;  2V8Q B;  3MSW A;  1RQ0 A;  1WAR A;  2E5L E;  1J26 A;  1JK7 A;  4OX9 E;  3OML A;  4LFC E;  1SU1 A;  3C4B A;  1N32 E;  4NXM E;  3IB8 A;  1UF3 A;  4X64 E;  3FIG A;  1YYO A;  2UXD E;  3CK2 A;  4BMJ A;  2O8A A;  2QFR A;  4NZV A;  3DF6 A;  1M63 A;  3VYY A;  1N36 E;  2Z72 A;  5F3W A;  1TCO A;  3HVQ A;  3ZOQ B;  3J7Y p;  1T70 A;  2R17 A;  2HYO A;  2KHX A;  4V0V A;  3T1H E;  4WWL A;  2ZOA A;  2HHH E;  4LTY A;  4JI6 E;  4BBY A;  2RS6 A;  1QU6 A;  4UT3 B;  2USH A;  4HD0 A;  2DSY A;  1IBK E;  4LU9 A;  2JOG A;  1T71 A;  4LF5 E;  2E1M A;  4YHH E;  1N34 E;  1FJG E;  2DXN A;  2DXL A;  3HTX A;  4M0V A;  1GQE A;  1YYW A;  2B7V A;  1U32 A;  2KON A;  4JI2 E;  2UUC E;  1HNZ E;  2IE4 C;  2UUB E;  5C1V A;  3C4T A;  3E7A A;  4M2Z A;  2F4V E;  4GKJ E;  2DIX A;  4O5G A;  2JOX A;  4DMI A;  4F9C B;  1DI2 A;  1XM7 A;  3ZTV A;  2H36 X;  2VQE E;  1Z2W A;  2EWL A;  3AV0 A;  3RL3 A;  4BC7 A;  3TGH A;  2CV9 A;  2V88 A;  4R03 A;  3HXL A;  4DR1 E;  2LTR A;  2L3J A;  4BS9 A;  1XZW A;  4O43 A;  2ODR D;  1IBL E;  1T4O A;  2V83 A;  4WFT A;  1ZBT A;  4B3T E;  2HYP A;  1UIL A;  5FLX C;  2DB2 A;  2LMZ A;  1X48 A;  5B8I A;  4X65 E;  4DR2 E;  4L8N A;  3T1I A;  1USH A;  2JVA A;  1WAO 1;  3ICF A;  4JI4 E;  2NUG A;  4KBP A;  3JAM C;  5BR8 E;  4J8Z A;  4WPY A;  4LFA E;  4LF7 E;  2L33 A;  4IYP C;  4DV5 E;  2UUA E;  4DV6 E;  2JWO A;  4JI7 E;  3N5U A;  4MOV A;  4FBQ A;  4UWQ A;  5EQV A;  4JV5 E;  3C5W C;  3IWD A;  2NPP C;  2Q8U A;  3IVD A;  4V0W A;  4B2O A;  2LE2 A;  5T6J A;  4FCX A;  4ZX2 A;  3K7V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...