4TUGA

Crystal structure of mjmre11-dna2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
317
Chain Sequence
RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
molecule keywords DNA double-strand break repair protein Mre11
total genus 100
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tugA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tugA01
2AHDA 4LU9A 4OR9A 4IYPC 4O4KA 4UT3A 3H62B 4V0WA 1T71A 2WDEA 3DW8C 3LL8A 3P71C 2IAEC 3RL5A 4JA9A 4KBPA 3RL4A 4H2IA 1SU1A 2QFPA 1QHWA 3THNA 4IL1A 4LACC 2HY1A 4H1SA 3H67A 3AUZA 1S8EA 5JPFA 5JPEA 1II7A 4XPNA 1S95A 3H63A 5B8IA 4FCXA 1XZWA 4M0VA 4O5GA 3C5WC 4FBQA 1IT6A 4MOYA 4DHLA 3CK2A 2ZBMA 3IVEA 1OIDA 2JOGA 2IE3C 2P6BA 3QFMA 3QFNA 2NYMC 3N5UA 4KKZA 1HPUA 2Z72A 3QG5C 2USHA 4Q7FA 5F3WA 4YKEA 4ZVZA 3QFOA 1M63A 4UT2A 4ORCA 1HP1A 3E7AA 3IVDA 4V0VA 1FJMA 1S70A 4DSYA 1Z2XA 4FBKA 2QFRA 1JK7A 4TUIA 4UT3B 4F0ZA 4UWQA 2YVTA 4HD0A 1UF3A 1XM7A 3K7VC 2BCDA 3V4YA 3EGHA 5DNYA 1OI8A 1T70A 4O24A 2Z06A 3GVEA 3AV0A 1HO5A 2Q8UA 1MF8A 3H69A 4NZVA 3H61A 4J6OA 1U32A 4H2FA 1G5BA 3ICFA 2CV9A 4G9JA 1OIEA 1TCOA 4V0XA 2XMOA 3H64A 4MOVA 4H1YP 5IOHA 2KKNA 1USHA 1S3LA 5INBA 2DFJA 1AUIA 3ZTVA 2BDXA 3TGHA 4H2GA 3T1IA 3JYFA 5GTUA 3RQZA 4ZX2A 3HVQA 1NNWA 1W24A 3C9FA 5HPEA 3RL3A 2WDFA 2NPPC 1WAO1 2WDDA 4ORAA 4MP0A 3K7WC 5JJTA 4O43A 3PSOA 4JA7A 3KBPA 4DT2A 2A22A 3H66A 3DSDA 4H2BA 3DSCA 2HYOA 5J28A 4I5NC 2QJCA 1V73A 1Z2WA 3FGAC 2NXFA 4I5LC 2IE4C 3EGGA 4TUGA 3E7BA 3QFKA 2NYLC 2WDCA 3IB7A 5EQVA 2Z1AA 3THOB 3H60A 2O8GA 4ORBA 5C1VA 1S3MA 3IB8A 3ZU0A 3H68A 1KBPA 1UTEA 2BQ8X 2GJUA 1S3NA 4WWLA 3PSNA 4LTYA 4FBWA 4B2OA 1WARA 2O8AA 2HYPA 2R17A 1QFCA
chains in the Genus database with same CATH superfamily
2CSHA 4LU9A 3UK3C 1JK1A 4IYPC 4UT3A 2ELZA 3H62B 3K6QA 4V0WA 2M9AA 1T71A 4WSPA 1BBGA 3DW8C 2VRDA 3RMPA 4DV1E 2HJJA 4P7DA 2YSOA 4DV5E 1HNWE 4JA9A 1HNXE 2JXPA 3MHHC 4OX9E 1QHWA 4LFCE 2EZ6A 2RTXA 4JI3E 4JI0E 4LACC 2HHHE 3OMLA 1S95A 4X64E 4FCXA 5A6JA 1XZWA 2EMZA 4DMIA 4GEQB 4O5GA 4BBYA 2DMIA 4FK5C 4R2EA 4KHPE 4MOYA 4LF7E 2EMFA 3CK2A 2V8QB 1OIDA 3IVEA 4NHRA 2IE3C 2P6BA 2EN8A 2LE2A 2Z72A 5JPFA 2H36X 5F3WA 4ZVZA 2LRSA 1BBOA 1FJMA 1N32E 1XNQE 1AAYA 2V86A 3C4BA 2VQFE 4F6NA 4JI6E 4GKJE 2I9IA 2B3TB 5AASA 3VK6A 1WHQA 2RSIA 2YZTA 4RHBB 4TUIA 4UT3B 4ZYEA 4L5NC 5A6KA 2YVTA 4N4RB 4Q28A 4DV6E 3K7VC 2E1MA 1EH8A 1RMDA 3BF2A 1ZAAC 2Q8UA 2EOEA 1X6HA 3ECRA 3HPSA 4DR7E 2EOJA 2JVAA 4J6OA 1YUIA 4I8OA 4WSGA 4DR2E 4V0XA 1SR9A 2LVHA 4M9VC 2UXDE 5INBA 3ADIA 1T4LB 1UN6B 4B3RE 4R8OA 5IWAE 3JYFA 4LFAE 3RQZA 4KZSA 2WDFA 3IWDA 4MP0A 1A1KA 5JJTA 2YSPA 4R03A 3J81C 2BBGA 1GQEA 4YHHE 4WXDA 2HYOA 2QJCA 1Z2WA 2NXFA 1J5EE 1UILA 2EE8A 3MHSC 3C4TA 4J8ZA 2RS7A 2EN7A 2WBSA 3E7BA 1HR0E 5AC4A 2WDCA 1EH6A 1IBLE 2O8GA 1X6FA 2LJHA 4ORBA 5C1VA 1DGCA 1S3MA 4BCAA 3IB8A 1GZ6A 1QNTA 2L92A 2PRTA 1T4OA 1YFHA 2RSMA 2EMLA 2DMYA 2LV2A 4JI4E 4LTYA 5KL3A 2L3JA 1G2DC 4BC9A 1EKZA 4OR9A 1PJSA 4GZNC 5CFFE 2EN3A 5T6JA 1B69A 4JI8E 2EMCA 2WDEA 5KL6A 1DQ3A 5TSEA 3RL4A 1YPNA 1PKPA 2QFPA 2YTNA 2YU8A 2V89A 3H67A 2EOHA 2EOFA 5A2QC 1WHNA 2EOSA 3IWBA 5B8IA 3M99B 1JK2A 1KJKA 2EMXA 3C5WC 4DV4E 1N34E 2V87A 4X65E 2JOGA 2E5LE 2NYMC 2UUBE 3QG5C 1HPUA 2EM2A 2JR1A 4IS1C 3QFOA 3EPLA 4B3ME 4ORCA 2ENAA 3IVDA 4V0VA 1IMUA 2ZM6E 4DSYA 4ZYGA 1Z2XA 2QFRA 3LMLA 2G7HA 1BB8A 1LLMC 2JP9A 2WBTA 2YTDA 1A1FA 2R1FA 4WFTA 4WYQB 5AE2A 2YRMA 4R2CA 2L33A 3LLHA 2EMWA 1UF3A 2EN2A 1XM7A 1N3GA 3KWRA 2YEQA 2Z06A 1DI2A 2NUEA 2GHFA 2B9DA 1T39A 2CPNA 2EPUA 1I94E 2D9HA 2LUPB 2R76A 2UU9E 1U32A 5AE1A 3VYXA 1SFEA 2CV9A 1ZU1A 3DJWA 3H64A 3MSWA 3KZYA 4H1YP 2K7IA 4F9BB 1S3LA 2ENHA 4BHCA 2MC5A 2YPNA 3T1IA 4WX9A 2DRPA 3C9FA 2YTEA 2A25A 1T38A 3K7WC 3EQ1A 4O43A 1FJGE 4DUZE 2A22A 3KBPA 4H2BA 3T1HE 2EPCA 5J28A 3FIGA 2EQ3A 3FGAC 2EOXA 4DR5E 3HPZA 4I5LC 1KYQA 2YRKA 3T1YE 4TUGA 2LCEA 2HC5A 4YY3E 2ELYA 2L3CA 1MEYC 2DB2A 1WRJA 2ADRA 1ZBQA 2KHXA 4DR6E 2EOOA 3THOB 2YTQA 4JI7E 2JYAA 1IBKE 3ZU0A 4L8NA 4X66E 2B7VA 4LF8E 2ODRD 2DSYA 2LTSA 2F8BA 2YT4A 1QU6A 2O8AA 2HYPA 2CT1A 4H2FA 4B2OA 1O0WA 3EPJA 4DR1E 1QFCA 4F0ZA 4NXME 1GTKA 1ZR9A 2YTFA 3C6KA 5IV8B 1STUA 2WCC3 5LMUE 3J80C 4LF9E 2EPPA 2L2KB 2M4IA 1A1GA 3BBGA 2M1SA 4F9AB 3LL8A 3RL5A 4BS9A 2DGCA 2R17A 2ZOAA 1YYKA 4H2IA 2VF1A 4KBPA 2EOZA 2GPIA 5A69A 2HY1A 2EN4A 3AUZA 5A6BD 4X8WA 2J7JA 3C6MA 3JAMC 1AH5A 1WJPA 4DUYE 2RS6A 3BGHA 1II7A 5JPEA 4XPNA 2K4VA 4M0VA 4JI2E 1IT6A 4JI1E 5AE3A 3L00A 1FKAE 2ZBMA 5A6BA 3EPKA 4ZYDA 2EL4A 2FGGA 2MDRA 5AC5A 3N5UA 4WXCA 2EM5A 2USHA 2EOIA 2EOMA 1N36E 1HP1A 4F9CB 3FLOA 1JK7A 2EL5A 3HXLA 2BB8A 4R2SA 2L8TA 5FLXC 2EM4A 4JYAE 2EPMX 3E0JA 2YTOA 1YSAC 2L2MA 2MC6A 4Q35B 2NABA 2BCDA 3EGHA 5LMNE 2EPAA 2JOBA 1A1LA 2EM3A 2ODRC 3AV0A 2JPAA 1Z1BA 1MF8A 2JWOA 3HTXA 3H61A 2N3HA 2VQEE 2V85A 3ADJA 2LT7A 1G5BA 2MKDA 2EOQA 2UUAE 4G9JA 1TCOA 2EMGA 4X62E 2EM0A 2EQ0A 1YYOA 2XMOA 1HNZE 2KKNA 1USHA 2YRHA 2EMKA 5ADZA 2EJ4A 3ZTVA 4DV0E 1TF6A 4K0KE 4X9JA 2BDXA 2EPXA 4DKKA 4H2GA 3TGHA 4ZX2A 3HVQA 1NNWA 1X6EA 3RL3A 4LF6E 2NPPC 1WAO1 2WDDA 5IT9C 1PDAA 2IHR1 4R2QA 4HEIA 2DLQA 3DF6A 1G2FC 3PSOA 3DSDA 4DT2A 3H66A 2GLIA 5LLQA 2NA2A 2LMZA 2EMYA 2YU5A 2HGHA 2FTXB 4LFBE 1V73A 4M30A 3J7AG 1XNRE 2EOYA 2IE4C 2FV4B 1PJQA 3QFKA 1ZBTA 2NYLC 4NXNE 2Z1AA 1S8EA 4MLVA 2EPLX 2NUGA 4F54A 1UBDC 1KBPA 1UTEA 2GJUA 1S3NA 3VHTB 3PSNA 2EORA 2L2NA 1T4NA 2WBUA 3D03A 1NEIA 4R2RA 2AHDA 4R2PA 4JV5E 2YTIA 4O4KA 3H09A 1X47A 1A1HA 2JY9A 3ADLA 2EPOA 5KL2A 4P78A 5KL7A 3F6GA 5IXMB 3P71C 2IAEC 2EMAA 1NCSA 4WPYA 4DV3E 2LJUA 5LL6R 2L6MA 1RC7A 1YZ9A 1SU1A 2ENCA 3IWCA 3THNA 2ZO9B 4IL1A 2LUQA 3TQMA 1X5WA 4H1SA 4ZYHA 2RPCA 4LF4E 5KL4A 2KONA 2EQ1A 3H63A 1RQ0A 2B7TA 1A1IA 5A6AA 4FBQA 1EH7A 4DHLA 2EMIA 3QFMA 1P47A 2EN1A 2YWQA 1PJTA 4GKKE 3QFNA 2WZOA 2YTGA 1YYWA 4KKZA 2EMBA 4Q7FA 4YKEA 1TN9A 1UHZA 1M63A 1YUJA 4UT2A 3E7AA 2DLKA 4IJDA 1S70A 2EL6A 2M7QA 2EN6A 4R2DA 4F2JC 4BC7A 2LBSB 4FBKA 2LO3A 5BR8E 2UXBE 2EPNA 1L4SA 1IQOA 4DV2E 4UWQA 2UXCE 4HD0A 2VE7C 4RH8A 1F2IG 4JI5E 2NUFA 1X48A 2YTJA 2LTRA 4OOGC 3V4YA 4B3SE 2V83A 5DNYA 1OI8A 3ZOQB 4BMJA 2EPKX 1T70A 4O24A 2EP3A 1XMQE 2I13A 3GVEA 1HO5A 2UUCE 3EPHA 3BIDA 2F4VE 3H69A 2N8XA 4NZVA 2DXNA 2EWLA 1IBME 3J7Yp 4LF5E 2EPRA 2EM6A 1X3CA 1N33E 3JTZA 3ICFA 4MLQA 3VYYA 1OIEA 1XMOE 3JU0A 4MOVA 2JOXA 5IOHA 3P1XA 4KWYA 2DFJA 1AUIA 2MKNA 2KOUA 4R2AA 5GTUA 1J26A 3ADGA 1W24A 5HPEA 2V88A 4ORAA 1MGTA 2EM8A 4JA7A 2CTDA 1IQSA 5KL5A 1WARA 2E72A 3DSCA 2RQLA 4I5NC 2EM9A 2N3GA 3EGGA 4HTGA 4M2ZA 2DXLA 4AQYE 1TF3A 2DIXA 4DV7E 1X49A 3OTOE 4DR3E 4F6MA 4DR4E 3IB7A 5EQVA 2EMHA 3HQ1A 1A1JA 4B3TE 3H60A 1WXRA 3F6HA 3H68A 2EM7A 2EPZA 2BQ8X 2MDGA 4WWLA 4FBWA 3KZZA 2YTPA 4BHBA
chains in the Genus database with same CATH topology
4LU9A 4IYPC 4UT3A 3H62B 3K6QA 4V0WA 1T71A 4WSPA 3DW8C 3RMPA 4DV1E 4P7DA 1HNWE 4DV5E 4JA9A 1HNXE 4OX9E 1QHWA 4LFCE 2EZ6A 2RTXA 4JI3E 4JI0E 4LACC 2HHHE 3OMLA 1S95A 4X64E 4FCXA 1XZWA 4DMIA 4GEQB 4O5GA 4BBYA 4KHPE 4MOYA 4LF7E 3CK2A 3IVEA 2V8QB 1OIDA 2IE3C 2P6BA 2LE2A 2Z72A 2H36X 5F3WA 4ZVZA 2LRSA 1FJMA 1N32E 1XNQE 2V86A 3C4BA 2VQFE 4JI6E 4GKJE 2B3TB 5AASA 3VK6A 1WHQA 4TUIA 2YZTA 4UT3B 4L5NC 2YVTA 4Q28A 4DV6E 3K7VC 2E1MA 2Q8UA 3HPSA 4DR7E 2JVAA 4J6OA 4I8OA 4DR2E 4V0XA 1SR9A 2UXDE 5INBA 3ADIA 1T4LB 4B3RE 4R8OA 5IWAE 3JYFA 4LFAE 3RQZA 4KZSA 2WDFA 3IWDA 4MP0A 5JJTA 4R03A 3J81C 1GQEA 4YHHE 2HYOA 2QJCA 1Z2WA 2NXFA 1J5EE 1UILA 3C4TA 4J8ZA 2RS7A 3E7BA 1HR0E 2WDCA 1IBLE 2O8GA 2LJHA 4ORBA 5C1VA 1S3MA 3IB8A 4BCAA 1GZ6A 2L92A 1T4OA 2RSMA 2DMYA 4JI4E 4LTYA 2L3JA 4BC9A 1EKZA 4OR9A 5CFFE 5T6JA 4JI8E 2WDEA 1DQ3A 3RL4A 1PKPA 2QFPA 2V89A 3H67A 5A2QC 1WHNA 3IWBA 5B8IA 3C5WC 4DV4E 1N34E 2V87A 4X65E 2JOGA 2E5LE 2NYMC 2UUBE 1HPUA 3QG5C 2JR1A 3QFOA 4B3ME 4ORCA 3IVDA 4V0VA 2ZM6E 4DSYA 1Z2XA 2QFRA 3LMLA 2G7HA 4WFTA 4WYQB 5AE2A 2L33A 3LLHA 1UF3A 1XM7A 3KWRA 2YEQA 2Z06A 1DI2A 2NUEA 2B9DA 2CPNA 1I94E 2LUPB 2UU9E 1U32A 2CV9A 3VYXA 5AE1A 3DJWA 3H64A 3MSWA 4H1YP 4F9BB 1S3LA 2MC5A 3T1IA 3C9FA 3K7WC 4O43A 1FJGE 4DUZE 2A22A 3KBPA 4H2BA 3T1HE 5J28A 3FIGA 3FGAC 4DR5E 3HPZA 4I5LC 3T1YE 4TUGA 4YY3E 2L3CA 2DB2A 4DR6E 1ZBQA 2KHXA 3THOB 4JI7E 1IBKE 3ZU0A 4L8NA 4X66E 2B7VA 4LF8E 2ODRD 2DSYA 2LTSA 2F8BA 2YT4A 1QU6A 2O8AA 2HYPA 4H2FA 4B2OA 1QFCA 1O0WA 4DR1E 4F0ZA 4NXME 4LF9E 1STUA 5LMUE 3J80C 2L2KB 2M4IA 2M1SA 4F9AB 3LL8A 3RL5A 4BS9A 2ZOAA 1YYKA 4H2IA 2VF1A 4KBPA 2HY1A 3AUZA 1S8EA 5JPFA 4X8WA 3JAMC 5JPEA 4DUYE 2RS6A 1II7A 4XPNA 2K4VA 4M0VA 4JI2E 1IT6A 4JI1E 5AE3A 1FKAE 2ZBMA 2MDRA 2FGGA 3N5UA 2USHA 1N36E 1HP1A 4F9CB 3FLOA 1JK7A 3HXLA 2L8TA 5FLXC 4JYAE 3E0JA 2L2MA 2MC6A 2BCDA 3EGHA 5LMNE 2JOBA 2ODRC 3AV0A 1MF8A 2JWOA 3HTXA 3H61A 2N3HA 2VQEE 2V85A 3ADJA 1G5BA 4G9JA 2UUAE 1TCOA 4X62E 2XMOA 1YYOA 1HNZE 2KKNA 1USHA 5ADZA 3ZTVA 4DV0E 4K0KE 2BDXA 3TGHA 4H2GA 4DKKA 4ZX2A 3HVQA 1NNWA 3RL3A 4LF6E 2NPPC 1WAO1 2WDDA 5IT9C 2IHR1 3DF6A 3PSOA 3DSDA 4DT2A 3H66A 2NA2A 2LMZA 2FTXB 4LFBE 1V73A 4M30A 3J7AG 1XNRE 2IE4C 2FV4B 3QFKA 1ZBTA 2NYLC 4NXNE 2Z1AA 2NUGA 4F54A 1UTEA 1KBPA 2GJUA 1S3NA 3PSNA 1T4NA 2L2NA 3D03A 2AHDA 4JV5E 4O4KA 3H09A 1X47A 2JY9A 3ADLA 4P78A 3F6GA 3P71C 2IAEC 4WPYA 4DV3E 5LL6R 2L6MA 1RC7A 1YZ9A 1SU1A 3IWCA 3THNA 2ZO9B 4IL1A 2LUQA 4H1SA 4LF4E 2KONA 3H63A 1RQ0A 2B7TA 4FBQA 4DHLA 3QFMA 3QFNA 4GKKE 4KKZA 2WZOA 1YYWA 4Q7FA 4YKEA 1UHZA 1M63A 4UT2A 3E7AA 1S70A 2M7QA 2LBSB 4BC7A 4FBKA 5BR8E 2UXBE 4DV2E 4UWQA 2UXCE 4HD0A 2VE7C 4JI5E 2NUFA 1X48A 2LTRA 4OOGC 3V4YA 4B3SE 2V83A 5DNYA 1OI8A 3ZOQB 4BMJA 1T70A 4O24A 1XMQE 3GVEA 1HO5A 2UUCE 2F4VE 3H69A 4NZVA 2DXNA 2EWLA 1IBME 3J7Yp 4LF5E 1N33E 3JTZA 3ICFA 3VYYA 1OIEA 1XMOE 3JU0A 4MOVA 2JOXA 5IOHA 3P1XA 2DFJA 1AUIA 2KOUA 5GTUA 1J26A 3ADGA 1W24A 5HPEA 2V88A 4ORAA 4JA7A 3DSCA 4I5NC 2N3GA 3EGGA 4M2ZA 2DXLA 4AQYE 2DIXA 4DV7E 1X49A 3OTOE 4DR3E 4DR4E 3IB7A 5EQVA 3HQ1A 4B3TE 3H60A 1WXRA 3F6HA 3H68A 2BQ8X 4WWLA 4FBWA 1WARA 2R17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHD A;  4LU9 A;  4OR9 A;  4IYP C;  4O4K A;  4UT3 A;  3H62 B;  4V0W A;  1T71 A;  2WDE A;  3DW8 C;  3LL8 A;  3P71 C;  2IAE C;  3RL5 A;  4JA9 A;  4KBP A;  3RL4 A;  4H2I A;  1SU1 A;  2QFP A;  1QHW A;  3THN A;  4IL1 A;  4LAC C;  2HY1 A;  4H1S A;  3H67 A;  3AUZ A;  1S8E A;  5JPF A;  5JPE A;  1II7 A;  4XPN A;  1S95 A;  3H63 A;  5B8I A;  4FCX A;  1XZW A;  4M0V A;  4O5G A;  3C5W C;  4FBQ A;  1IT6 A;  4MOY A;  4DHL A;  3CK2 A;  2ZBM A;  3IVE A;  1OID A;  2JOG A;  2IE3 C;  2P6B A;  3QFM A;  3QFN A;  2NYM C;  3N5U A;  4KKZ A;  1HPU A;  2Z72 A;  3QG5 C;  2USH A;  4Q7F A;  5F3W A;  4YKE A;  4ZVZ A;  3QFO A;  1M63 A;  4UT2 A;  4ORC A;  1HP1 A;  3E7A A;  3IVD A;  4V0V A;  1FJM A;  1S70 A;  4DSY A;  1Z2X A;  4FBK A;  2QFR A;  1JK7 A;  4TUI A;  4UT3 B;  4F0Z A;  4UWQ A;  2YVT A;  4HD0 A;  1UF3 A;  1XM7 A;  3K7V C;  2BCD A;  3V4Y A;  3EGH A;  5DNY A;  1OI8 A;  1T70 A;  4O24 A;  2Z06 A;  3GVE A;  3AV0 A;  1HO5 A;  2Q8U A;  1MF8 A;  3H69 A;  4NZV A;  3H61 A;  4J6O A;  1U32 A;  4H2F A;  1G5B A;  3ICF A;  2CV9 A;  4G9J A;  1OIE A;  1TCO A;  4V0X A;  2XMO A;  3H64 A;  4MOV A;  4H1Y P;  5IOH A;  2KKN A;  1USH A;  1S3L A;  5INB A;  2DFJ A;  1AUI A;  3ZTV A;  2BDX A;  3TGH A;  4H2G A;  3T1I A;  3JYF A;  5GTU A;  3RQZ A;  4ZX2 A;  3HVQ A;  1NNW A;  1W24 A;  3C9F A;  5HPE A;  3RL3 A;  2WDF A;  2NPP C;  1WAO 1;  2WDD A;  4ORA A;  4MP0 A;  3K7W C;  5JJT A;  4O43 A;  3PSO A;  4JA7 A;  3KBP A;  4DT2 A;  2A22 A;  3H66 A;  3DSD A;  4H2B A;  3DSC A;  2HYO A;  5J28 A;  4I5N C;  2QJC A;  1V73 A;  1Z2W A;  3FGA C;  2NXF A;  4I5L C;  2IE4 C;  3EGG A;  4TUG A;  3E7B A;  3QFK A;  2NYL C;  2WDC A;  3IB7 A;  5EQV A;  2Z1A A;  3THO B;  3H60 A;  2O8G A;  4ORB A;  5C1V A;  1S3M A;  3IB8 A;  3ZU0 A;  3H68 A;  1KBP A;  1UTE A;  2BQ8 X;  2GJU A;  1S3N A;  4WWL A;  3PSN A;  4LTY A;  4FBW A;  4B2O A;  1WAR A;  2O8A A;  2HYP A;  2R17 A;  1QFC A; 
#chains in the Genus database with same CATH topology
 2CSH A;  4LU9 A;  3UK3 C;  1JK1 A;  4IYP C;  4UT3 A;  2ELZ A;  3H62 B;  3K6Q A;  4V0W A;  2M9A A;  1T71 A;  4WSP A;  1BBG A;  3DW8 C;  2VRD A;  3RMP A;  4DV1 E;  2HJJ A;  4P7D A;  2YSO A;  4DV5 E;  1HNW E;  4JA9 A;  1HNX E;  2JXP A;  3MHH C;  4OX9 E;  1QHW A;  4LFC E;  2EZ6 A;  2RTX A;  4JI3 E;  4JI0 E;  4LAC C;  2HHH E;  3OML A;  1S95 A;  4X64 E;  4FCX A;  5A6J A;  1XZW A;  2EMZ A;  4DMI A;  4GEQ B;  4O5G A;  4BBY A;  2DMI A;  4FK5 C;  4R2E A;  4KHP E;  4MOY A;  4LF7 E;  2EMF A;  3CK2 A;  2V8Q B;  1OID A;  3IVE A;  4NHR A;  2IE3 C;  2P6B A;  2EN8 A;  2LE2 A;  2Z72 A;  5JPF A;  2H36 X;  5F3W A;  4ZVZ A;  2LRS A;  1BBO A;  1FJM A;  1N32 E;  1XNQ E;  1AAY A;  2V86 A;  3C4B A;  2VQF E;  4F6N A;  4JI6 E;  4GKJ E;  2I9I A;  2B3T B;  5AAS A;  3VK6 A;  1WHQ A;  2RSI A;  2YZT A;  4RHB B;  4TUI A;  4UT3 B;  4ZYE A;  4L5N C;  5A6K A;  2YVT A;  4N4R B;  4Q28 A;  4DV6 E;  3K7V C;  2E1M A;  1EH8 A;  1RMD A;  3BF2 A;  1ZAA C;  2Q8U A;  2EOE A;  1X6H A;  3ECR A;  3HPS A;  4DR7 E;  2EOJ A;  2JVA A;  4J6O A;  1YUI A;  4I8O A;  4WSG A;  4DR2 E;  4V0X A;  1SR9 A;  2LVH A;  4M9V C;  2UXD E;  5INB A;  3ADI A;  1T4L B;  1UN6 B;  4B3R E;  4R8O A;  5IWA E;  3JYF A;  4LFA E;  3RQZ A;  4KZS A;  2WDF A;  3IWD A;  4MP0 A;  1A1K A;  5JJT A;  2YSP A;  4R03 A;  3J81 C;  2BBG A;  1GQE A;  4YHH E;  4WXD A;  2HYO A;  2QJC A;  1Z2W A;  2NXF A;  1J5E E;  1UIL A;  2EE8 A;  3MHS C;  3C4T A;  4J8Z A;  2RS7 A;  2EN7 A;  2WBS A;  3E7B A;  1HR0 E;  5AC4 A;  2WDC A;  1EH6 A;  1IBL E;  2O8G A;  1X6F A;  2LJH A;  4ORB A;  5C1V A;  1DGC A;  1S3M A;  4BCA A;  3IB8 A;  1GZ6 A;  1QNT A;  2L92 A;  2PRT A;  1T4O A;  1YFH A;  2RSM A;  2EML A;  2DMY A;  2LV2 A;  4JI4 E;  4LTY A;  5KL3 A;  2L3J A;  1G2D C;  4BC9 A;  1EKZ A;  4OR9 A;  1PJS A;  4GZN C;  5CFF E;  2EN3 A;  5T6J A;  1B69 A;  4JI8 E;  2EMC A;  2WDE A;  5KL6 A;  1DQ3 A;  5TSE A;  3RL4 A;  1YPN A;  1PKP A;  2QFP A;  2YTN A;  2YU8 A;  2V89 A;  3H67 A;  2EOH A;  2EOF A;  5A2Q C;  1WHN A;  2EOS A;  3IWB A;  5B8I A;  3M99 B;  1JK2 A;  1KJK A;  2EMX A;  3C5W C;  4DV4 E;  1N34 E;  2V87 A;  4X65 E;  2JOG A;  2E5L E;  2NYM C;  2UUB E;  3QG5 C;  1HPU A;  2EM2 A;  2JR1 A;  4IS1 C;  3QFO A;  3EPL A;  4B3M E;  4ORC A;  2ENA A;  3IVD A;  4V0V A;  1IMU A;  2ZM6 E;  4DSY A;  4ZYG A;  1Z2X A;  2QFR A;  3LML A;  2G7H A;  1BB8 A;  1LLM C;  2JP9 A;  2WBT A;  2YTD A;  1A1F A;  2R1F A;  4WFT A;  4WYQ B;  5AE2 A;  2YRM A;  4R2C A;  2L33 A;  3LLH A;  2EMW A;  1UF3 A;  2EN2 A;  1XM7 A;  1N3G A;  3KWR A;  2YEQ A;  2Z06 A;  1DI2 A;  2NUE A;  2GHF A;  2B9D A;  1T39 A;  2CPN A;  2EPU A;  1I94 E;  2D9H A;  2LUP B;  2R76 A;  2UU9 E;  1U32 A;  5AE1 A;  3VYX A;  1SFE A;  2CV9 A;  1ZU1 A;  3DJW A;  3H64 A;  3MSW A;  3KZY A;  4H1Y P;  2K7I A;  4F9B B;  1S3L A;  2ENH A;  4BHC A;  2MC5 A;  2YPN A;  3T1I A;  4WX9 A;  2DRP A;  3C9F A;  2YTE A;  2A25 A;  1T38 A;  3K7W C;  3EQ1 A;  4O43 A;  1FJG E;  4DUZ E;  2A22 A;  3KBP A;  4H2B A;  3T1H E;  2EPC A;  5J28 A;  3FIG A;  2EQ3 A;  3FGA C;  2EOX A;  4DR5 E;  3HPZ A;  4I5L C;  1KYQ A;  2YRK A;  3T1Y E;  4TUG A;  2LCE A;  2HC5 A;  4YY3 E;  2ELY A;  2L3C A;  1MEY C;  2DB2 A;  1WRJ A;  2ADR A;  1ZBQ A;  2KHX A;  4DR6 E;  2EOO A;  3THO B;  2YTQ A;  4JI7 E;  2JYA A;  1IBK E;  3ZU0 A;  4L8N A;  4X66 E;  2B7V A;  4LF8 E;  2ODR D;  2DSY A;  2LTS A;  2F8B A;  2YT4 A;  1QU6 A;  2O8A A;  2HYP A;  2CT1 A;  4H2F A;  4B2O A;  1O0W A;  3EPJ A;  4DR1 E;  1QFC A;  4F0Z A;  4NXM E;  1GTK A;  1ZR9 A;  2YTF A;  3C6K A;  5IV8 B;  1STU A;  2WCC 3;  5LMU E;  3J80 C;  4LF9 E;  2EPP A;  2L2K B;  2M4I A;  1A1G A;  3BBG A;  2M1S A;  4F9A B;  3LL8 A;  3RL5 A;  4BS9 A;  2DGC A;  2R17 A;  2ZOA A;  1YYK A;  4H2I A;  2VF1 A;  4KBP A;  2EOZ A;  2GPI A;  5A69 A;  2HY1 A;  2EN4 A;  3AUZ A;  5A6B D;  4X8W A;  2J7J A;  3C6M A;  3JAM C;  1AH5 A;  1WJP A;  4DUY E;  2RS6 A;  3BGH A;  1II7 A;  5JPE A;  4XPN A;  2K4V A;  4M0V A;  4JI2 E;  1IT6 A;  4JI1 E;  5AE3 A;  3L00 A;  1FKA E;  2ZBM A;  5A6B A;  3EPK A;  4ZYD A;  2EL4 A;  2FGG A;  2MDR A;  5AC5 A;  3N5U A;  4WXC A;  2EM5 A;  2USH A;  2EOI A;  2EOM A;  1N36 E;  1HP1 A;  4F9C B;  3FLO A;  1JK7 A;  2EL5 A;  3HXL A;  2BB8 A;  4R2S A;  2L8T A;  5FLX C;  2EM4 A;  4JYA E;  2EPM X;  3E0J A;  2YTO A;  1YSA C;  2L2M A;  2MC6 A;  4Q35 B;  2NAB A;  2BCD A;  3EGH A;  5LMN E;  2EPA A;  2JOB A;  1A1L A;  2EM3 A;  2ODR C;  3AV0 A;  2JPA A;  1Z1B A;  1MF8 A;  2JWO A;  3HTX A;  3H61 A;  2N3H A;  2VQE E;  2V85 A;  3ADJ A;  2LT7 A;  1G5B A;  2MKD A;  2EOQ A;  2UUA E;  4G9J A;  1TCO A;  2EMG A;  4X62 E;  2EM0 A;  2EQ0 A;  1YYO A;  2XMO A;  1HNZ E;  2KKN A;  1USH A;  2YRH A;  2EMK A;  5ADZ A;  2EJ4 A;  3ZTV A;  4DV0 E;  1TF6 A;  4K0K E;  4X9J A;  2BDX A;  2EPX A;  4DKK A;  4H2G A;  3TGH A;  4ZX2 A;  3HVQ A;  1NNW A;  1X6E A;  3RL3 A;  4LF6 E;  2NPP C;  1WAO 1;  2WDD A;  5IT9 C;  1PDA A;  2IHR 1;  4R2Q A;  4HEI A;  2DLQ A;  3DF6 A;  1G2F C;  3PSO A;  3DSD A;  4DT2 A;  3H66 A;  2GLI A;  5LLQ A;  2NA2 A;  2LMZ A;  2EMY A;  2YU5 A;  2HGH A;  2FTX B;  4LFB E;  1V73 A;  4M30 A;  3J7A G;  1XNR E;  2EOY A;  2IE4 C;  2FV4 B;  1PJQ A;  3QFK A;  1ZBT A;  2NYL C;  4NXN E;  2Z1A A;  1S8E A;  4MLV A;  2EPL X;  2NUG A;  4F54 A;  1UBD C;  1KBP A;  1UTE A;  2GJU A;  1S3N A;  3VHT B;  3PSN A;  2EOR A;  2L2N A;  1T4N A;  2WBU A;  3D03 A;  1NEI A;  4R2R A;  2AHD A;  4R2P A;  4JV5 E;  2YTI A;  4O4K A;  3H09 A;  1X47 A;  1A1H A;  2JY9 A;  3ADL A;  2EPO A;  5KL2 A;  4P78 A;  5KL7 A;  3F6G A;  5IXM B;  3P71 C;  2IAE C;  2EMA A;  1NCS A;  4WPY A;  4DV3 E;  2LJU A;  5LL6 R;  2L6M A;  1RC7 A;  1YZ9 A;  1SU1 A;  2ENC A;  3IWC A;  3THN A;  2ZO9 B;  4IL1 A;  2LUQ A;  3TQM A;  1X5W A;  4H1S A;  4ZYH A;  2RPC A;  4LF4 E;  5KL4 A;  2KON A;  2EQ1 A;  3H63 A;  1RQ0 A;  2B7T A;  1A1I A;  5A6A A;  4FBQ A;  1EH7 A;  4DHL A;  2EMI A;  3QFM A;  1P47 A;  2EN1 A;  2YWQ A;  1PJT A;  4GKK E;  3QFN A;  2WZO A;  2YTG A;  1YYW A;  4KKZ A;  2EMB A;  4Q7F A;  4YKE A;  1TN9 A;  1UHZ A;  1M63 A;  1YUJ A;  4UT2 A;  3E7A A;  2DLK A;  4IJD A;  1S70 A;  2EL6 A;  2M7Q A;  2EN6 A;  4R2D A;  4F2J C;  4BC7 A;  2LBS B;  4FBK A;  2LO3 A;  5BR8 E;  2UXB E;  2EPN A;  1L4S A;  1IQO A;  4DV2 E;  4UWQ A;  2UXC E;  4HD0 A;  2VE7 C;  4RH8 A;  1F2I G;  4JI5 E;  2NUF A;  1X48 A;  2YTJ A;  2LTR A;  4OOG C;  3V4Y A;  4B3S E;  2V83 A;  5DNY A;  1OI8 A;  3ZOQ B;  4BMJ A;  2EPK X;  1T70 A;  4O24 A;  2EP3 A;  1XMQ E;  2I13 A;  3GVE A;  1HO5 A;  2UUC E;  3EPH A;  3BID A;  2F4V E;  3H69 A;  2N8X A;  4NZV A;  2DXN A;  2EWL A;  1IBM E;  3J7Y p;  4LF5 E;  2EPR A;  2EM6 A;  1X3C A;  1N33 E;  3JTZ A;  3ICF A;  4MLQ A;  3VYY A;  1OIE A;  1XMO E;  3JU0 A;  4MOV A;  2JOX A;  5IOH A;  3P1X A;  4KWY A;  2DFJ A;  1AUI A;  2MKN A;  2KOU A;  4R2A A;  5GTU A;  1J26 A;  3ADG A;  1W24 A;  5HPE A;  2V88 A;  4ORA A;  1MGT A;  2EM8 A;  4JA7 A;  2CTD A;  1IQS A;  5KL5 A;  1WAR A;  2E72 A;  3DSC A;  2RQL A;  4I5N C;  2EM9 A;  2N3G A;  3EGG A;  4HTG A;  4M2Z A;  2DXL A;  4AQY E;  1TF3 A;  2DIX A;  4DV7 E;  1X49 A;  3OTO E;  4DR3 E;  4F6M A;  4DR4 E;  3IB7 A;  5EQV A;  2EMH A;  3HQ1 A;  1A1J A;  4B3T E;  3H60 A;  1WXR A;  3F6H A;  3H68 A;  2EM7 A;  2EPZ A;  2BQ8 X;  2MDG A;  4WWL A;  4FBW A;  3KZZ A;  2YTP A;  4BHB A; 
#chains in the Genus database with same CATH homology
 4LU9 A;  4IYP C;  4UT3 A;  3H62 B;  3K6Q A;  4V0W A;  1T71 A;  4WSP A;  3DW8 C;  3RMP A;  4DV1 E;  4P7D A;  1HNW E;  4DV5 E;  4JA9 A;  1HNX E;  4OX9 E;  1QHW A;  4LFC E;  2EZ6 A;  2RTX A;  4JI3 E;  4JI0 E;  4LAC C;  2HHH E;  3OML A;  1S95 A;  4X64 E;  4FCX A;  1XZW A;  4DMI A;  4GEQ B;  4O5G A;  4BBY A;  4KHP E;  4MOY A;  4LF7 E;  3CK2 A;  3IVE A;  2V8Q B;  1OID A;  2IE3 C;  2P6B A;  2LE2 A;  2Z72 A;  2H36 X;  5F3W A;  4ZVZ A;  2LRS A;  1FJM A;  1N32 E;  1XNQ E;  2V86 A;  3C4B A;  2VQF E;  4JI6 E;  4GKJ E;  2B3T B;  5AAS A;  3VK6 A;  1WHQ A;  4TUI A;  2YZT A;  4UT3 B;  4L5N C;  2YVT A;  4Q28 A;  4DV6 E;  3K7V C;  2E1M A;  2Q8U A;  3HPS A;  4DR7 E;  2JVA A;  4J6O A;  4I8O A;  4DR2 E;  4V0X A;  1SR9 A;  2UXD E;  5INB A;  3ADI A;  1T4L B;  4B3R E;  4R8O A;  5IWA E;  3JYF A;  4LFA E;  3RQZ A;  4KZS A;  2WDF A;  3IWD A;  4MP0 A;  5JJT A;  4R03 A;  3J81 C;  1GQE A;  4YHH E;  2HYO A;  2QJC A;  1Z2W A;  2NXF A;  1J5E E;  1UIL A;  3C4T A;  4J8Z A;  2RS7 A;  3E7B A;  1HR0 E;  2WDC A;  1IBL E;  2O8G A;  2LJH A;  4ORB A;  5C1V A;  1S3M A;  3IB8 A;  4BCA A;  1GZ6 A;  2L92 A;  1T4O A;  2RSM A;  2DMY A;  4JI4 E;  4LTY A;  2L3J A;  4BC9 A;  1EKZ A;  4OR9 A;  5CFF E;  5T6J A;  4JI8 E;  2WDE A;  1DQ3 A;  3RL4 A;  1PKP A;  2QFP A;  2V89 A;  3H67 A;  5A2Q C;  1WHN A;  3IWB A;  5B8I A;  3C5W C;  4DV4 E;  1N34 E;  2V87 A;  4X65 E;  2JOG A;  2E5L E;  2NYM C;  2UUB E;  1HPU A;  3QG5 C;  2JR1 A;  3QFO A;  4B3M E;  4ORC A;  3IVD A;  4V0V A;  2ZM6 E;  4DSY A;  1Z2X A;  2QFR A;  3LML A;  2G7H A;  4WFT A;  4WYQ B;  5AE2 A;  2L33 A;  3LLH A;  1UF3 A;  1XM7 A;  3KWR A;  2YEQ A;  2Z06 A;  1DI2 A;  2NUE A;  2B9D A;  2CPN A;  1I94 E;  2LUP B;  2UU9 E;  1U32 A;  2CV9 A;  3VYX A;  5AE1 A;  3DJW A;  3H64 A;  3MSW A;  4H1Y P;  4F9B B;  1S3L A;  2MC5 A;  3T1I A;  3C9F A;  3K7W C;  4O43 A;  1FJG E;  4DUZ E;  2A22 A;  3KBP A;  4H2B A;  3T1H E;  5J28 A;  3FIG A;  3FGA C;  4DR5 E;  3HPZ A;  4I5L C;  3T1Y E;  4TUG A;  4YY3 E;  2L3C A;  2DB2 A;  4DR6 E;  1ZBQ A;  2KHX A;  3THO B;  4JI7 E;  1IBK E;  3ZU0 A;  4L8N A;  4X66 E;  2B7V A;  4LF8 E;  2ODR D;  2DSY A;  2LTS A;  2F8B A;  2YT4 A;  1QU6 A;  2O8A A;  2HYP A;  4H2F A;  4B2O A;  1QFC A;  1O0W A;  4DR1 E;  4F0Z A;  4NXM E;  4LF9 E;  1STU A;  5LMU E;  3J80 C;  2L2K B;  2M4I A;  2M1S A;  4F9A B;  3LL8 A;  3RL5 A;  4BS9 A;  2ZOA A;  1YYK A;  4H2I A;  2VF1 A;  4KBP A;  2HY1 A;  3AUZ A;  1S8E A;  5JPF A;  4X8W A;  3JAM C;  5JPE A;  4DUY E;  2RS6 A;  1II7 A;  4XPN A;  2K4V A;  4M0V A;  4JI2 E;  1IT6 A;  4JI1 E;  5AE3 A;  1FKA E;  2ZBM A;  2MDR A;  2FGG A;  3N5U A;  2USH A;  1N36 E;  1HP1 A;  4F9C B;  3FLO A;  1JK7 A;  3HXL A;  2L8T A;  5FLX C;  4JYA E;  3E0J A;  2L2M A;  2MC6 A;  2BCD A;  3EGH A;  5LMN E;  2JOB A;  2ODR C;  3AV0 A;  1MF8 A;  2JWO A;  3HTX A;  3H61 A;  2N3H A;  2VQE E;  2V85 A;  3ADJ A;  1G5B A;  4G9J A;  2UUA E;  1TCO A;  4X62 E;  2XMO A;  1YYO A;  1HNZ E;  2KKN A;  1USH A;  5ADZ A;  3ZTV A;  4DV0 E;  4K0K E;  2BDX A;  3TGH A;  4H2G A;  4DKK A;  4ZX2 A;  3HVQ A;  1NNW A;  3RL3 A;  4LF6 E;  2NPP C;  1WAO 1;  2WDD A;  5IT9 C;  2IHR 1;  3DF6 A;  3PSO A;  3DSD A;  4DT2 A;  3H66 A;  2NA2 A;  2LMZ A;  2FTX B;  4LFB E;  1V73 A;  4M30 A;  3J7A G;  1XNR E;  2IE4 C;  2FV4 B;  3QFK A;  1ZBT A;  2NYL C;  4NXN E;  2Z1A A;  2NUG A;  4F54 A;  1UTE A;  1KBP A;  2GJU A;  1S3N A;  3PSN A;  1T4N A;  2L2N A;  3D03 A;  2AHD A;  4JV5 E;  4O4K A;  3H09 A;  1X47 A;  2JY9 A;  3ADL A;  4P78 A;  3F6G A;  3P71 C;  2IAE C;  4WPY A;  4DV3 E;  5LL6 R;  2L6M A;  1RC7 A;  1YZ9 A;  1SU1 A;  3IWC A;  3THN A;  2ZO9 B;  4IL1 A;  2LUQ A;  4H1S A;  4LF4 E;  2KON A;  3H63 A;  1RQ0 A;  2B7T A;  4FBQ A;  4DHL A;  3QFM A;  3QFN A;  4GKK E;  4KKZ A;  2WZO A;  1YYW A;  4Q7F A;  4YKE A;  1UHZ A;  1M63 A;  4UT2 A;  3E7A A;  1S70 A;  2M7Q A;  2LBS B;  4BC7 A;  4FBK A;  5BR8 E;  2UXB E;  4DV2 E;  4UWQ A;  2UXC E;  4HD0 A;  2VE7 C;  4JI5 E;  2NUF A;  1X48 A;  2LTR A;  4OOG C;  3V4Y A;  4B3S E;  2V83 A;  5DNY A;  1OI8 A;  3ZOQ B;  4BMJ A;  1T70 A;  4O24 A;  1XMQ E;  3GVE A;  1HO5 A;  2UUC E;  2F4V E;  3H69 A;  4NZV A;  2DXN A;  2EWL A;  1IBM E;  3J7Y p;  4LF5 E;  1N33 E;  3JTZ A;  3ICF A;  3VYY A;  1OIE A;  1XMO E;  3JU0 A;  4MOV A;  2JOX A;  5IOH A;  3P1X A;  2DFJ A;  1AUI A;  2KOU A;  5GTU A;  1J26 A;  3ADG A;  1W24 A;  5HPE A;  2V88 A;  4ORA A;  4JA7 A;  3DSC A;  4I5N C;  2N3G A;  3EGG A;  4M2Z A;  2DXL A;  4AQY E;  2DIX A;  4DV7 E;  1X49 A;  3OTO E;  4DR3 E;  4DR4 E;  3IB7 A;  5EQV A;  3HQ1 A;  4B3T E;  3H60 A;  1WXR A;  3F6H A;  3H68 A;  2BQ8 X;  4WWL A;  4FBW A;  1WAR A;  2R17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...