4TUGA

Crystal structure of mjmre11-dna2 complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
317
Chain Sequence
b'RGSHMMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKALRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEIFICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFSYYALGHIHKRILERFNDGILAYSGSTEIIYRNEYEDYKKEGKGFYLVDFSGNDLDISDIEKIDIECREFVEVNIKDKKSFNEAVNKIERCKNKPVVFGKIKREFKPWFDTLKDKILINKAIIVDDEFIDMPDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA double-strand break repair protein Mre11
publication title DNA end recognition by the Mre11 nuclease dimer: insights into resection and repair of damaged DNA.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Dna binding protein/dna
total genus 100
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.600 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4tugA02
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4tugA01
3GVEA 4IYPC 4F0ZA 5F3WA 3PSNA 4UWQA 3K7VC 3V4YA 2NYMC 2USHA 1UTEA 2QFPA 1Z2XA 2WDFA 1HPUA 3E7AA 3JYFA 3QFNA 3AUZA 1XZWA 3IB7A 4ZVZA 1W24A 1U32A 1JK7A 1V73A 3P71C 4FBWA 3H69A 4YKEA 2GJUA 2ZBMA 4MOYA 2QJCA 1IT6A 2Z72A 4J6OA 5DNYA 4KKZA 5JJTA 3DSCA 2NYLC 3QG5C 4TUIA 4MP0A 3THOB 2WDEA 1UF3A 3QFOA 4MOVA 1USHA 4O43A 4TUGA 1QFCA 3T1IA 2BCDA 2HYPA 1S3NA 3IVDA 4H1SA 4M0VA 2HYOA 4DT2A 2Z1AA 4ORAA 1S3LA 5EQVA 3H60A 2Q8UA 4DSYA 3E7BA 5IOHA 4V0VA 4JA9A 1TCOA 1OI8A 2HY1A 2A22A 4HD0A 4UT3B 3EGHA 3FGAC 5JPFA 3ZTVA 4H2IA 5INBA 2WDCA 1M63A 4FBQA 2IE3C 4LACC 1S70A 3C9FA 3TGHA 3ICFA 3DSDA 2JOGA 3RL4A 3AV0A 2YVTA 2NXFA 3H63A 3ZU0A 2O8GA 1II7A 3LL8A 4ZX2A 4DHLA 2QFRA 4Q7FA 1OIEA 2NPPC 3HVQA 2KKNA 3N5UA 1XM7A 1HP1A 3H61A 2IAEC 1HO5A 3H67A 4G9JA 4O4KA 3RL5A 1FJMA 1MF8A 3H62B 3DW8C 4H2FA 1SU1A 4H2GA 4ORBA 3EGGA 4FBKA 3KBPA 2BQ8X 4H1YP 1AUIA 1OIDA 1QHWA 1S3MA 1T70A 2P6BA 2AHDA 3THNA 2DFJA 4WWLA 4B2OA 2WDDA 3QFKA 4V0XA 3RQZA 5HPEA 4UT2A 3C5WC 5C1VA 4UT3A 3H64A 1T71A 4I5LC 1KBPA 2CV9A 3RL3A 4ORCA 2Z06A 1NNWA 1G5BA 3QFMA 5GTUA 3H66A 4XPNA 2IE4C 5B8IA 1S95A 3K7WC 4LU9A 1Z2WA 2R17A 4LTYA 3CK2A 4I5NC 4H2BA 4FCXA 4JA7A 4NZVA 4V0WA 4KBPA 3H68A 3IB8A 3PSOA 1S8EA 1WAO1 4O5GA 5J28A 2O8AA 3IVEA 4O24A 2BDXA 4IL1A 1WARA 2XMOA 4OR9A 5JPEA
chains in the Genus database with same CATH superfamily
3GVEA 4BHBA 5F3WA 4F0ZA 2USHA 3QFNA 3E7AA 1X6HA 3AUZA 1XZWA 3BGHA 3C6MA 4WX9A 2UXBE 2VRDA 1U32A 4FBWA 3P71C 3DF6A 4X65E 2EPUA 5LMUE 2ZBMA 1ZBTA 3F6GA 4MOYA 5LLQA 2V89A 4NXME 3HXLA 5JJTA 2EOSA 2WDEA 4MOVA 1USHA 1EH6A 2EE8A 3VYYA 2WCC3 3KZYA 5AC4A 4R2CA 3BIDA 2JP9A 2HYOA 2DSYA 4DT2A 4WSGA 2EMCA 1XMOE 2EM5A 4ORAA 1IMUA 3H60A 3HQ1A 4DSYA 2YT4A 1PDAA 1X47A 1N32E 4V0VA 2YTOA 1TCOA 4K0KE 2L2MA 1OI8A 4ZYHA 2EMFA 4HD0A 2YWQA 2EMAA 3FGAC 2EJ4A 4GKJE 5INBA 2WDCA 1M63A 2EPRA 1A1KA 1IQSA 1I94E 1S70A 4R2QA 1UILA 2BB8A 4RHBB 3AV0A 2HGHA 2YVTA 3ZU0A 4JYAE 3JU0A 4LFBE 2QFRA 4BCAA 1OIEA 2NPPC 2BBGA 1BBOA 3H61A 4OX9E 1HNXE 3RL5A 2EN3A 1HR0E 1MF8A 3DW8C 2HC5A 2I9IA 4H2GA 3EGGA 4B3ME 1YUIA 2BQ8X 4F9BB 3ADJA 4DR4E 1QU6A 1PJQA 2YU8A 2JPAA 2UUCE 2JR1A 2DFJA 4HEIA 4WSPA 3QFKA 1MGTA 2EMXA 2EMHA 4V0XA 3EPJA 2ZOAA 2L3CA 3VK6A 1YFHA 3C5WC 3JTZA 5A6BD 4ZYEA 1WJPA 3RMPA 5KL2A 2YRMA 2YTDA 2MC6A 5KL4A 3J7Yp 2F8BA 1KBPA 2CV9A 4JI1E 4ORCA 2LUQA 2MKDA 2LVHA 2EWLA 2EL6A 3FIGA 3K7WC 1Z2WA 1BBGA 2R17A 2WZOA 5CFFE 1P47A 5ADZA 4JI0E 4H2BA 4JA7A 3ECRA 1T4OA 4KBPA 2EOJA 5J28A 2L6MA 2RQLA 2NA2A 4IL1A 1WARA 2WBTA 2XMOA 2EN7A 3K7VC 1ZR9A 4BS9A 2EPNA 4JI7E 2FGGA 3JYFA 1UTEA 1HNWE 2QFPA 4DR1E 2EPKX 1N3GA 1N33E 5KL3A 4DV5E 4R2EA 2M4IA 4DR2E 1A1GA 2LTSA 5DNYA 4KKZA 3C4BA 1A1IA 3THOB 2RS6A 1UF3A 2B7TA 3QFOA 3FLOA 4O43A 2RSMA 4X66E 2DMYA 1QFCA 2RSIA 5AE1A 2UUAE 2ZO9B 2EQ1A 1B69A 2HYPA 2K7IA 2LUPB 3IVDA 4M0VA 2LE2A 2EMIA 1X6FA 1YUJA 4J8ZA 2Z1AA 3VYXA 3D03A 2EL5A 1YYOA 5EQVA 2DMIA 1N34E 5AE3A 4B3RE 3E7BA 2EOQA 5IOHA 5IXMB 4JA9A 2UUBE 2A22A 4AQYE 3J81C 5JPFA 2UU9E 4H2IA 2IE3C 2EM8A 2B7VA 4F9AB 4DR6E 2YRKA 4F6NA 2V83A 2YSPA 5IWAE 1YPNA 1XNRE 4DV4E 3RL4A 2EPLX 4M30A 4DMIA 1IQOA 3H63A 3EPHA 1WXRA 1GZ6A 2KONA 5AASA 2EM4A 4JI8E 3HVQA 4KZSA 3N5UA 1MEYC 1XM7A 2LO3A 3MHSC 4RH8A 4DV0E 3H67A 1HO5A 3P1XA 4FK5C 2EPMX 3ADIA 3C6KA 2EOFA 2DLKA 4MLQA 1F2IG 2G7HA 2V87A 1SU1A 2EMYA 4LF7E 2EOXA 4FBKA 4R2RA 4R03A 3L00A 1ZBQA 1QHWA 3HPZA 4B3SE 1S3MA 2B9DA 2UXDE 2LT7A 2YPNA 2AHDA 2VQFE 2EOMA 2EOOA 4B2OA 1YZ9A 2GLIA 1RQ0A 2YSOA 2CTDA 2DLQA 1UN6B 2V88A 4X8WA 4UT3A 4DUZE 3EQ1A 1NEIA 4I8OA 4M2ZA 4WFTA 2FV4B 2I13A 2MKNA 1EKZA 2NUFA 4LF9E 2EM9A 3H66A 1AAYA 1NCSA 2E72A 4LTYA 1O0WA 2D9HA 2WBSA 2YTNA 2JOXA 2HHHE 3VHTB 1WAO1 4F9CB 5AE2A 2YTJA 3C4TA 2O8AA 2LTRA 3T1HE 1JK1A 5FLXC 2JXPA 4L5NC 1X3CA 3OMLA 3LMLA 1RMDA 2M7QA 2RS7A 2EOHA 2EOYA 4IYPC 3H09A 3OTOE 3PSNA 3EPLA 2PRTA 1GQEA 2EQ0A 1QNTA 2NYMC 2WDFA 1Z2XA 1KYQA 1KJKA 5T6JA 2YTQA 2E5LE 3IB7A 4ZVZA 1W24A 1IBLE 2N3HA 1WHNA 4DR5E 2EN1A 1ZU1A 3IWCA 2B3TB 1IT6A 3E0JA 2CPNA 2N8XA 4BBYA 2Z72A 4P78A 1EH8A 5BR8E 2NYLC 4MP0A 4TUIA 4ZYGA 3MSWA 2M9AA 4JI3E 2CSHA 2JVAA 3T1IA 4R2DA 4GKKE 3KZZA 1DGCA 2JY9A 1RC7A 1UHZA 1TF3A 1TF6A 4NXNE 2EM2A 2EPOA 2Q8UA 1XMQE 2RPCA 2LCEA 5A6KA 4DV7E 1J26A 5KL5A 2HY1A 4UT3B 2MDGA 4L8NA 3EGHA 1T4NA 1G2FC 3MHHC 5A2QC 2EMLA 3C9FA 2YTEA 4DV3E 4LFAE 3ICFA 3DSDA 4JI4E 2L8TA 2MC5A 4F54A 4YY3E 2VQEE 2M1SA 2EL4A 2UXCE 2EPCA 1Z1BA 4ZX2A 3HTXA 1WHQA 2KKNA 3UK3C 2EPXA 2EP3A 1X49A 1IBME 5TSEA 4G9JA 4WXCA 2K4VA 1ZAAC 2LV2A 2LBSB 2DXLA 2ELZA 2YEQA 2R1FA 3KBPA 1AUIA 2YU5A 2YZTA 1T70A 1STUA 2P6BA 3THNA 3T1YE 2L33A 4WWLA 2EMKA 2DGCA 3K6QA 5HPEA 3J7AG 1HNZE 2EMWA 2RTXA 2ZM6E 5A6BA 1DI2A 4DV1E 3H64A 5IV8B 1YYKA 3RL3A 2WBUA 2Z06A 4GZNC 1NNWA 3QFMA 1AH5A 1BB8A 2EM0A 4R2AA 5B8IA 3ADGA 4LU9A 2LJHA 1L4SA 5AC5A 4I5NC 1X48A 2FTXB 1JK2A 3H68A 1XNQE 3IB8A 3PSOA 1S8EA 4O5GA 1IBKE 1PJSA 4DKKA 4LF6E 2YTPA 2MDRA 2EN6A 1A1HA 2N3GA 3EPKA 5JPEA 2IHR1 2YTGA 3IWDA 2EOZA 4UWQA 3V4YA 2EM7A 3TQMA 4KHPE 2EOIA 1HPUA 2EN8A 1G2DC 3BF2A 3HPSA 1JK7A 1V73A 2A25A 1SR9A 2HJJA 4BMJA 3H69A 4YKEA 2GJUA 4LF4E 2QJCA 4BC7A 4J6OA 4F6MA 2LRSA 3DSCA 3QG5C 4R2PA 5KL7A 3LLHA 2EQ3A 2R76A 2CT1A 4TUGA 2BCDA 1S3NA 4DV2E 2DIXA 3ZOQB 4H1SA 2V8QB 4GEQB 2NUGA 4DR3E 4OOGC 3J80C 2ENAA 1UBDC 1S3LA 2L92A 3IWBA 1YSAC 4R8OA 4R2SA 3ADLA 2KOUA 1EH7A 3KWRA 2F4VE 1GTKA 4DR7E 5KL6A 1T39A 2EMBA 2EOEA 4YHHE 3ZTVA 2DRPA 2EPPA 2JOBA 4JI2E 2EZ6A 4FBQA 4BC9A 1A1LA 1TN9A 4LACC 2DXNA 1X6EA 2EPAA 2L2NA 2YRHA 2H36X 4DUYE 4F2JC 4IS1C 4B3TE 3TGHA 1PKPA 4LFCE 2JOGA 2J7JA 2JYAA 2V86A 5LL6R 1T4LB 2NXFA 1J5EE 2O8GA 2VE7C 2L2KB 4BHCA 1N36E 1II7A 4WXDA 2ODRC 3LL8A 4DHLA 4Q7FA 3M99B 1DQ3A 3BBGA 2E1MA 1HP1A 1X5WA 2IAEC 4O4KA 4NHRA 4Q28A 3DJWA 3F6HA 1FJMA 3H62B 5A69A 2ENHA 4H2FA 4Q35B 2VF1A 4WPYA 4LF8E 2EPZA 4ORBA 2EN4A 4N4RB 4ZYDA 2ODRD 4JV5E 4P7DA 2ENCA 1FJGE 4H1YP 2LMZA 1OIDA 5IT9C 2EM6A 1A1JA 2L3JA 2EM3A 2WDDA 5A6AA 3RQZA 4JI6E 4UT2A 2ELYA 5A6JA 4KWYA 5C1VA 4MLVA 4DV6E 5LMNE 1T71A 1LLMC 2ADRA 2NABA 1PJTA 4I5LC 2EMGA 4WYQB 4X64E 2V85A 1G5BA 5GTUA 4XPNA 2EMZA 2YTIA 2NUEA 2IE4C 1S95A 2KHXA 1T38A 4JI5E 3CK2A 4V0WA 4NZVA 4FCXA 3JAMC 2EN2A 2YTFA 4M9VC 1FKAE 2DB2A 2GPIA 2GHFA 1A1FA 2JWOA 1WRJA 4IJDA 3IVEA 4O24A 2BDXA 2LJUA 4LF5E 4HTGA 4X9JA 4X62E 4OR9A 2EORA 1YYWA 1SFEA
chains in the Genus database with same CATH topology
3GVEA 4F0ZA 5F3WA 2USHA 3QFNA 3E7AA 3AUZA 1XZWA 2UXBE 1U32A 4FBWA 3P71C 3DF6A 4X65E 5LMUE 2ZBMA 1ZBTA 3F6GA 4MOYA 2V89A 4NXME 3HXLA 5JJTA 2WDEA 4MOVA 1USHA 3VYYA 2HYOA 2DSYA 4DT2A 1XMOE 4ORAA 3H60A 3HQ1A 4DSYA 2YT4A 1X47A 1N32E 4V0VA 1TCOA 4K0KE 2L2MA 1OI8A 4HD0A 3FGAC 4GKJE 5INBA 2WDCA 1M63A 1I94E 1S70A 1UILA 3AV0A 2YVTA 3ZU0A 4JYAE 3JU0A 4LFBE 2QFRA 4BCAA 1OIEA 2NPPC 3H61A 4OX9E 1HNXE 3RL5A 1HR0E 1MF8A 3DW8C 4H2GA 3EGGA 4B3ME 2BQ8X 4F9BB 3ADJA 4DR4E 1QU6A 2UUCE 2JR1A 2DFJA 4WSPA 3QFKA 4V0XA 2ZOAA 2L3CA 3VK6A 3C5WC 3JTZA 3RMPA 2MC6A 3J7Yp 2F8BA 1KBPA 2CV9A 4JI1E 4ORCA 2LUQA 3FIGA 2EWLA 3K7WC 1Z2WA 2R17A 2WZOA 5CFFE 4JI0E 5ADZA 4H2BA 4JA7A 1T4OA 4KBPA 5J28A 2L6MA 2NA2A 4IL1A 1WARA 2XMOA 3K7VC 4BS9A 4JI7E 2FGGA 3JYFA 1UTEA 1HNWE 2QFPA 4DR1E 1N33E 4DV5E 2M4IA 4DR2E 2LTSA 5DNYA 4KKZA 3C4BA 3THOB 2RS6A 1UF3A 2B7TA 3QFOA 3FLOA 4O43A 2RSMA 4X66E 2DMYA 1QFCA 2ZO9B 5AE1A 2UUAE 2HYPA 2LUPB 3IVDA 4M0VA 2LE2A 4J8ZA 2Z1AA 3VYXA 3D03A 1YYOA 5EQVA 1N34E 5AE3A 4B3RE 3E7BA 5IOHA 4JA9A 2UUBE 2A22A 4AQYE 3J81C 5JPFA 2UU9E 4H2IA 2IE3C 2B7VA 4F9AB 4DR6E 2V83A 5IWAE 1XNRE 4DV4E 3RL4A 4M30A 4DMIA 3H63A 1WXRA 1GZ6A 2KONA 5AASA 4JI8E 3HVQA 4KZSA 3N5UA 1XM7A 4DV0E 3H67A 1HO5A 3P1XA 3ADIA 2G7HA 2V87A 1SU1A 4LF7E 4FBKA 4R03A 1ZBQA 1QHWA 3HPZA 4B3SE 1S3MA 2B9DA 2UXDE 2AHDA 2VQFE 4B2OA 1YZ9A 1RQ0A 2V88A 4X8WA 4UT3A 4DUZE 4I8OA 4M2ZA 4WFTA 2FV4B 1EKZA 2NUFA 4LF9E 3H66A 4LTYA 1O0WA 2JOXA 2HHHE 1WAO1 4F9CB 5AE2A 3C4TA 2O8AA 2LTRA 3T1HE 5FLXC 4L5NC 3OMLA 3LMLA 2M7QA 2RS7A 4IYPC 3H09A 3OTOE 3PSNA 1GQEA 2NYMC 2WDFA 1Z2XA 5T6JA 2E5LE 3IB7A 4ZVZA 1W24A 1IBLE 2N3HA 1WHNA 4DR5E 3IWCA 2B3TB 1IT6A 3E0JA 2CPNA 4BBYA 2Z72A 4P78A 5BR8E 2NYLC 4MP0A 4TUIA 3MSWA 4JI3E 2JVAA 3T1IA 4GKKE 2JY9A 1RC7A 1UHZA 4NXNE 2Q8UA 1XMQE 4DV7E 1J26A 2HY1A 4UT3B 4L8NA 3EGHA 1T4NA 5A2QC 3C9FA 4DV3E 3ICFA 4LFAE 3DSDA 4JI4E 2L8TA 2MC5A 4F54A 4YY3E 2VQEE 2M1SA 4ZX2A 2UXCE 3HTXA 1WHQA 2KKNA 1X49A 1IBME 4G9JA 2K4VA 2LBSB 2DXLA 2YEQA 3KBPA 1AUIA 2YZTA 1T70A 1STUA 2P6BA 3THNA 3T1YE 2L33A 4WWLA 3K6QA 5HPEA 3J7AG 1HNZE 2RTXA 2ZM6E 1DI2A 4DV1E 3H64A 1YYKA 3RL3A 2Z06A 1NNWA 3QFMA 5B8IA 3ADGA 4LU9A 2LJHA 4I5NC 1X48A 2FTXB 3H68A 1XNQE 3IB8A 3PSOA 1S8EA 4O5GA 1IBKE 4DKKA 4LF6E 2MDRA 2N3GA 5JPEA 2IHR1 3IWDA 4UWQA 3V4YA 4KHPE 1HPUA 3HPSA 1JK7A 1V73A 1SR9A 4BMJA 3H69A 4YKEA 2GJUA 4LF4E 2QJCA 4BC7A 4J6OA 2LRSA 3DSCA 3QG5C 3LLHA 4TUGA 2BCDA 1S3NA 4DV2E 2DIXA 3ZOQB 4H1SA 2V8QB 4GEQB 2NUGA 4DR3E 4OOGC 3J80C 1S3LA 2L92A 3IWBA 4R8OA 3ADLA 2KOUA 3KWRA 2F4VE 4DR7E 4YHHE 3ZTVA 2JOBA 2EZ6A 4JI2E 4FBQA 4BC9A 4LACC 2DXNA 2L2NA 4B3TE 2H36X 4DUYE 3TGHA 1PKPA 4LFCE 2JOGA 2V86A 5LL6R 1T4LB 2NXFA 1J5EE 2O8GA 1II7A 2VE7C 2L2KB 1N36E 3LL8A 4DHLA 2ODRC 4Q7FA 1DQ3A 2E1MA 1HP1A 2IAEC 4O4KA 4Q28A 3DJWA 3F6HA 1FJMA 3H62B 4H2FA 2VF1A 4WPYA 4LF8E 4ORBA 4JV5E 2ODRD 4P7DA 1FJGE 4H1YP 2LMZA 1OIDA 5IT9C 2L3JA 2WDDA 3RQZA 4JI6E 4UT2A 5C1VA 4DV6E 5LMNE 1T71A 4I5LC 4WYQB 4X64E 2V85A 1G5BA 5GTUA 4XPNA 2IE4C 2NUEA 1S95A 2KHXA 4JI5E 3CK2A 4V0WA 4FCXA 4NZVA 3JAMC 1FKAE 2DB2A 2JWOA 3IVEA 4O24A 2BDXA 4LF5E 4X62E 4OR9A 1YYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVE A;  4IYP C;  4F0Z A;  5F3W A;  3PSN A;  4UWQ A;  3K7V C;  3V4Y A;  2NYM C;  2USH A;  1UTE A;  2QFP A;  1Z2X A;  2WDF A;  1HPU A;  3E7A A;  3JYF A;  3QFN A;  3AUZ A;  1XZW A;  3IB7 A;  4ZVZ A;  1W24 A;  1U32 A;  1JK7 A;  1V73 A;  3P71 C;  4FBW A;  3H69 A;  4YKE A;  2GJU A;  2ZBM A;  4MOY A;  2QJC A;  1IT6 A;  2Z72 A;  4J6O A;  5DNY A;  4KKZ A;  5JJT A;  3DSC A;  2NYL C;  3QG5 C;  4TUI A;  4MP0 A;  3THO B;  2WDE A;  1UF3 A;  3QFO A;  4MOV A;  1USH A;  4O43 A;  4TUG A;  1QFC A;  3T1I A;  2BCD A;  2HYP A;  1S3N A;  3IVD A;  4H1S A;  4M0V A;  2HYO A;  4DT2 A;  2Z1A A;  4ORA A;  1S3L A;  5EQV A;  3H60 A;  2Q8U A;  4DSY A;  3E7B A;  5IOH A;  4V0V A;  4JA9 A;  1TCO A;  1OI8 A;  2HY1 A;  2A22 A;  4HD0 A;  4UT3 B;  3EGH A;  3FGA C;  5JPF A;  3ZTV A;  4H2I A;  5INB A;  2WDC A;  1M63 A;  4FBQ A;  2IE3 C;  4LAC C;  1S70 A;  3C9F A;  3TGH A;  3ICF A;  3DSD A;  2JOG A;  3RL4 A;  3AV0 A;  2YVT A;  2NXF A;  3H63 A;  3ZU0 A;  2O8G A;  1II7 A;  3LL8 A;  4ZX2 A;  4DHL A;  2QFR A;  4Q7F A;  1OIE A;  2NPP C;  3HVQ A;  2KKN A;  3N5U A;  1XM7 A;  1HP1 A;  3H61 A;  2IAE C;  1HO5 A;  3H67 A;  4G9J A;  4O4K A;  3RL5 A;  1FJM A;  1MF8 A;  3H62 B;  3DW8 C;  4H2F A;  1SU1 A;  4H2G A;  4ORB A;  3EGG A;  4FBK A;  3KBP A;  2BQ8 X;  4H1Y P;  1AUI A;  1OID A;  1QHW A;  1S3M A;  1T70 A;  2P6B A;  2AHD A;  3THN A;  2DFJ A;  4WWL A;  4B2O A;  2WDD A;  3QFK A;  4V0X A;  3RQZ A;  5HPE A;  4UT2 A;  3C5W C;  5C1V A;  4UT3 A;  3H64 A;  1T71 A;  4I5L C;  1KBP A;  2CV9 A;  3RL3 A;  4ORC A;  2Z06 A;  1NNW A;  1G5B A;  3QFM A;  5GTU A;  3H66 A;  4XPN A;  2IE4 C;  5B8I A;  1S95 A;  3K7W C;  4LU9 A;  1Z2W A;  2R17 A;  4LTY A;  3CK2 A;  4I5N C;  4H2B A;  4FCX A;  4JA7 A;  4NZV A;  4V0W A;  4KBP A;  3H68 A;  3IB8 A;  3PSO A;  1S8E A;  1WAO 1;  4O5G A;  5J28 A;  2O8A A;  3IVE A;  4O24 A;  2BDX A;  4IL1 A;  1WAR A;  2XMO A;  4OR9 A;  5JPE A; 
#chains in the Genus database with same CATH topology
 3GVE A;  4BHB A;  5F3W A;  4F0Z A;  2USH A;  3QFN A;  3E7A A;  1X6H A;  3AUZ A;  1XZW A;  3BGH A;  3C6M A;  4WX9 A;  2UXB E;  2VRD A;  1U32 A;  4FBW A;  3P71 C;  3DF6 A;  4X65 E;  2EPU A;  5LMU E;  2ZBM A;  1ZBT A;  3F6G A;  4MOY A;  5LLQ A;  2V89 A;  4NXM E;  3HXL A;  5JJT A;  2EOS A;  2WDE A;  4MOV A;  1USH A;  1EH6 A;  2EE8 A;  3VYY A;  2WCC 3;  3KZY A;  5AC4 A;  4R2C A;  3BID A;  2JP9 A;  2HYO A;  2DSY A;  4DT2 A;  4WSG A;  2EMC A;  1XMO E;  2EM5 A;  4ORA A;  1IMU A;  3H60 A;  3HQ1 A;  4DSY A;  2YT4 A;  1PDA A;  1X47 A;  1N32 E;  4V0V A;  2YTO A;  1TCO A;  4K0K E;  2L2M A;  1OI8 A;  4ZYH A;  2EMF A;  4HD0 A;  2YWQ A;  2EMA A;  3FGA C;  2EJ4 A;  4GKJ E;  5INB A;  2WDC A;  1M63 A;  2EPR A;  1A1K A;  1IQS A;  1I94 E;  1S70 A;  4R2Q A;  1UIL A;  2BB8 A;  4RHB B;  3AV0 A;  2HGH A;  2YVT A;  3ZU0 A;  4JYA E;  3JU0 A;  4LFB E;  2QFR A;  4BCA A;  1OIE A;  2NPP C;  2BBG A;  1BBO A;  3H61 A;  4OX9 E;  1HNX E;  3RL5 A;  2EN3 A;  1HR0 E;  1MF8 A;  3DW8 C;  2HC5 A;  2I9I A;  4H2G A;  3EGG A;  4B3M E;  1YUI A;  2BQ8 X;  4F9B B;  3ADJ A;  4DR4 E;  1QU6 A;  1PJQ A;  2YU8 A;  2JPA A;  2UUC E;  2JR1 A;  2DFJ A;  4HEI A;  4WSP A;  3QFK A;  1MGT A;  2EMX A;  2EMH A;  4V0X A;  3EPJ A;  2ZOA A;  2L3C A;  3VK6 A;  1YFH A;  3C5W C;  3JTZ A;  5A6B D;  4ZYE A;  1WJP A;  3RMP A;  5KL2 A;  2YRM A;  2YTD A;  2MC6 A;  5KL4 A;  3J7Y p;  2F8B A;  1KBP A;  2CV9 A;  4JI1 E;  4ORC A;  2LUQ A;  2MKD A;  2LVH A;  2EWL A;  2EL6 A;  3FIG A;  3K7W C;  1Z2W A;  1BBG A;  2R17 A;  2WZO A;  5CFF E;  1P47 A;  5ADZ A;  4JI0 E;  4H2B A;  4JA7 A;  3ECR A;  1T4O A;  4KBP A;  2EOJ A;  5J28 A;  2L6M A;  2RQL A;  2NA2 A;  4IL1 A;  1WAR A;  2WBT A;  2XMO A;  2EN7 A;  3K7V C;  1ZR9 A;  4BS9 A;  2EPN A;  4JI7 E;  2FGG A;  3JYF A;  1UTE A;  1HNW E;  2QFP A;  4DR1 E;  2EPK X;  1N3G A;  1N33 E;  5KL3 A;  4DV5 E;  4R2E A;  2M4I A;  4DR2 E;  1A1G A;  2LTS A;  5DNY A;  4KKZ A;  3C4B A;  1A1I A;  3THO B;  2RS6 A;  1UF3 A;  2B7T A;  3QFO A;  3FLO A;  4O43 A;  2RSM A;  4X66 E;  2DMY A;  1QFC A;  2RSI A;  5AE1 A;  2UUA E;  2ZO9 B;  2EQ1 A;  1B69 A;  2HYP A;  2K7I A;  2LUP B;  3IVD A;  4M0V A;  2LE2 A;  2EMI A;  1X6F A;  1YUJ A;  4J8Z A;  2Z1A A;  3VYX A;  3D03 A;  2EL5 A;  1YYO A;  5EQV A;  2DMI A;  1N34 E;  5AE3 A;  4B3R E;  3E7B A;  2EOQ A;  5IOH A;  5IXM B;  4JA9 A;  2UUB E;  2A22 A;  4AQY E;  3J81 C;  5JPF A;  2UU9 E;  4H2I A;  2IE3 C;  2EM8 A;  2B7V A;  4F9A B;  4DR6 E;  2YRK A;  4F6N A;  2V83 A;  2YSP A;  5IWA E;  1YPN A;  1XNR E;  4DV4 E;  3RL4 A;  2EPL X;  4M30 A;  4DMI A;  1IQO A;  3H63 A;  3EPH A;  1WXR A;  1GZ6 A;  2KON A;  5AAS A;  2EM4 A;  4JI8 E;  3HVQ A;  4KZS A;  3N5U A;  1MEY C;  1XM7 A;  2LO3 A;  3MHS C;  4RH8 A;  4DV0 E;  3H67 A;  1HO5 A;  3P1X A;  4FK5 C;  2EPM X;  3ADI A;  3C6K A;  2EOF A;  2DLK A;  4MLQ A;  1F2I G;  2G7H A;  2V87 A;  1SU1 A;  2EMY A;  4LF7 E;  2EOX A;  4FBK A;  4R2R A;  4R03 A;  3L00 A;  1ZBQ A;  1QHW A;  3HPZ A;  4B3S E;  1S3M A;  2B9D A;  2UXD E;  2LT7 A;  2YPN A;  2AHD A;  2VQF E;  2EOM A;  2EOO A;  4B2O A;  1YZ9 A;  2GLI A;  1RQ0 A;  2YSO A;  2CTD A;  2DLQ A;  1UN6 B;  2V88 A;  4X8W A;  4UT3 A;  4DUZ E;  3EQ1 A;  1NEI A;  4I8O A;  4M2Z A;  4WFT A;  2FV4 B;  2I13 A;  2MKN A;  1EKZ A;  2NUF A;  4LF9 E;  2EM9 A;  3H66 A;  1AAY A;  1NCS A;  2E72 A;  4LTY A;  1O0W A;  2D9H A;  2WBS A;  2YTN A;  2JOX A;  2HHH E;  3VHT B;  1WAO 1;  4F9C B;  5AE2 A;  2YTJ A;  3C4T A;  2O8A A;  2LTR A;  3T1H E;  1JK1 A;  5FLX C;  2JXP A;  4L5N C;  1X3C A;  3OML A;  3LML A;  1RMD A;  2M7Q A;  2RS7 A;  2EOH A;  2EOY A;  4IYP C;  3H09 A;  3OTO E;  3PSN A;  3EPL A;  2PRT A;  1GQE A;  2EQ0 A;  1QNT A;  2NYM C;  2WDF A;  1Z2X A;  1KYQ A;  1KJK A;  5T6J A;  2YTQ A;  2E5L E;  3IB7 A;  4ZVZ A;  1W24 A;  1IBL E;  2N3H A;  1WHN A;  4DR5 E;  2EN1 A;  1ZU1 A;  3IWC A;  2B3T B;  1IT6 A;  3E0J A;  2CPN A;  2N8X A;  4BBY A;  2Z72 A;  4P78 A;  1EH8 A;  5BR8 E;  2NYL C;  4MP0 A;  4TUI A;  4ZYG A;  3MSW A;  2M9A A;  4JI3 E;  2CSH A;  2JVA A;  3T1I A;  4R2D A;  4GKK E;  3KZZ A;  1DGC A;  2JY9 A;  1RC7 A;  1UHZ A;  1TF3 A;  1TF6 A;  4NXN E;  2EM2 A;  2EPO A;  2Q8U A;  1XMQ E;  2RPC A;  2LCE A;  5A6K A;  4DV7 E;  1J26 A;  5KL5 A;  2HY1 A;  4UT3 B;  2MDG A;  4L8N A;  3EGH A;  1T4N A;  1G2F C;  3MHH C;  5A2Q C;  2EML A;  3C9F A;  2YTE A;  4DV3 E;  4LFA E;  3ICF A;  3DSD A;  4JI4 E;  2L8T A;  2MC5 A;  4F54 A;  4YY3 E;  2VQE E;  2M1S A;  2EL4 A;  2UXC E;  2EPC A;  1Z1B A;  4ZX2 A;  3HTX A;  1WHQ A;  2KKN A;  3UK3 C;  2EPX A;  2EP3 A;  1X49 A;  1IBM E;  5TSE A;  4G9J A;  4WXC A;  2K4V A;  1ZAA C;  2LV2 A;  2LBS B;  2DXL A;  2ELZ A;  2YEQ A;  2R1F A;  3KBP A;  1AUI A;  2YU5 A;  2YZT A;  1T70 A;  1STU A;  2P6B A;  3THN A;  3T1Y E;  2L33 A;  4WWL A;  2EMK A;  2DGC A;  3K6Q A;  5HPE A;  3J7A G;  1HNZ E;  2EMW A;  2RTX A;  2ZM6 E;  5A6B A;  1DI2 A;  4DV1 E;  3H64 A;  5IV8 B;  1YYK A;  3RL3 A;  2WBU A;  2Z06 A;  4GZN C;  1NNW A;  3QFM A;  1AH5 A;  1BB8 A;  2EM0 A;  4R2A A;  5B8I A;  3ADG A;  4LU9 A;  2LJH A;  1L4S A;  5AC5 A;  4I5N C;  1X48 A;  2FTX B;  1JK2 A;  3H68 A;  1XNQ E;  3IB8 A;  3PSO A;  1S8E A;  4O5G A;  1IBK E;  1PJS A;  4DKK A;  4LF6 E;  2YTP A;  2MDR A;  2EN6 A;  1A1H A;  2N3G A;  3EPK A;  5JPE A;  2IHR 1;  2YTG A;  3IWD A;  2EOZ A;  4UWQ A;  3V4Y A;  2EM7 A;  3TQM A;  4KHP E;  2EOI A;  1HPU A;  2EN8 A;  1G2D C;  3BF2 A;  3HPS A;  1JK7 A;  1V73 A;  2A25 A;  1SR9 A;  2HJJ A;  4BMJ A;  3H69 A;  4YKE A;  2GJU A;  4LF4 E;  2QJC A;  4BC7 A;  4J6O A;  4F6M A;  2LRS A;  3DSC A;  3QG5 C;  4R2P A;  5KL7 A;  3LLH A;  2EQ3 A;  2R76 A;  2CT1 A;  4TUG A;  2BCD A;  1S3N A;  4DV2 E;  2DIX A;  3ZOQ B;  4H1S A;  2V8Q B;  4GEQ B;  2NUG A;  4DR3 E;  4OOG C;  3J80 C;  2ENA A;  1UBD C;  1S3L A;  2L92 A;  3IWB A;  1YSA C;  4R8O A;  4R2S A;  3ADL A;  2KOU A;  1EH7 A;  3KWR A;  2F4V E;  1GTK A;  4DR7 E;  5KL6 A;  1T39 A;  2EMB A;  2EOE A;  4YHH E;  3ZTV A;  2DRP A;  2EPP A;  2JOB A;  4JI2 E;  2EZ6 A;  4FBQ A;  4BC9 A;  1A1L A;  1TN9 A;  4LAC C;  2DXN A;  1X6E A;  2EPA A;  2L2N A;  2YRH A;  2H36 X;  4DUY E;  4F2J C;  4IS1 C;  4B3T E;  3TGH A;  1PKP A;  4LFC E;  2JOG A;  2J7J A;  2JYA A;  2V86 A;  5LL6 R;  1T4L B;  2NXF A;  1J5E E;  2O8G A;  2VE7 C;  2L2K B;  4BHC A;  1N36 E;  1II7 A;  4WXD A;  2ODR C;  3LL8 A;  4DHL A;  4Q7F A;  3M99 B;  1DQ3 A;  3BBG A;  2E1M A;  1HP1 A;  1X5W A;  2IAE C;  4O4K A;  4NHR A;  4Q28 A;  3DJW A;  3F6H A;  1FJM A;  3H62 B;  5A69 A;  2ENH A;  4H2F A;  4Q35 B;  2VF1 A;  4WPY A;  4LF8 E;  2EPZ A;  4ORB A;  2EN4 A;  4N4R B;  4ZYD A;  2ODR D;  4JV5 E;  4P7D A;  2ENC A;  1FJG E;  4H1Y P;  2LMZ A;  1OID A;  5IT9 C;  2EM6 A;  1A1J A;  2L3J A;  2EM3 A;  2WDD A;  5A6A A;  3RQZ A;  4JI6 E;  4UT2 A;  2ELY A;  5A6J A;  4KWY A;  5C1V A;  4MLV A;  4DV6 E;  5LMN E;  1T71 A;  1LLM C;  2ADR A;  2NAB A;  1PJT A;  4I5L C;  2EMG A;  4WYQ B;  4X64 E;  2V85 A;  1G5B A;  5GTU A;  4XPN A;  2EMZ A;  2YTI A;  2NUE A;  2IE4 C;  1S95 A;  2KHX A;  1T38 A;  4JI5 E;  3CK2 A;  4V0W A;  4NZV A;  4FCX A;  3JAM C;  2EN2 A;  2YTF A;  4M9V C;  1FKA E;  2DB2 A;  2GPI A;  2GHF A;  1A1F A;  2JWO A;  1WRJ A;  4IJD A;  3IVE A;  4O24 A;  2BDX A;  2LJU A;  4LF5 E;  4HTG A;  4X9J A;  4X62 E;  4OR9 A;  2EOR A;  1YYW A;  1SFE A; 
#chains in the Genus database with same CATH homology
 3GVE A;  4F0Z A;  5F3W A;  2USH A;  3QFN A;  3E7A A;  3AUZ A;  1XZW A;  2UXB E;  1U32 A;  4FBW A;  3P71 C;  3DF6 A;  4X65 E;  5LMU E;  2ZBM A;  1ZBT A;  3F6G A;  4MOY A;  2V89 A;  4NXM E;  3HXL A;  5JJT A;  2WDE A;  4MOV A;  1USH A;  3VYY A;  2HYO A;  2DSY A;  4DT2 A;  1XMO E;  4ORA A;  3H60 A;  3HQ1 A;  4DSY A;  2YT4 A;  1X47 A;  1N32 E;  4V0V A;  1TCO A;  4K0K E;  2L2M A;  1OI8 A;  4HD0 A;  3FGA C;  4GKJ E;  5INB A;  2WDC A;  1M63 A;  1I94 E;  1S70 A;  1UIL A;  3AV0 A;  2YVT A;  3ZU0 A;  4JYA E;  3JU0 A;  4LFB E;  2QFR A;  4BCA A;  1OIE A;  2NPP C;  3H61 A;  4OX9 E;  1HNX E;  3RL5 A;  1HR0 E;  1MF8 A;  3DW8 C;  4H2G A;  3EGG A;  4B3M E;  2BQ8 X;  4F9B B;  3ADJ A;  4DR4 E;  1QU6 A;  2UUC E;  2JR1 A;  2DFJ A;  4WSP A;  3QFK A;  4V0X A;  2ZOA A;  2L3C A;  3VK6 A;  3C5W C;  3JTZ A;  3RMP A;  2MC6 A;  3J7Y p;  2F8B A;  1KBP A;  2CV9 A;  4JI1 E;  4ORC A;  2LUQ A;  3FIG A;  2EWL A;  3K7W C;  1Z2W A;  2R17 A;  2WZO A;  5CFF E;  4JI0 E;  5ADZ A;  4H2B A;  4JA7 A;  1T4O A;  4KBP A;  5J28 A;  2L6M A;  2NA2 A;  4IL1 A;  1WAR A;  2XMO A;  3K7V C;  4BS9 A;  4JI7 E;  2FGG A;  3JYF A;  1UTE A;  1HNW E;  2QFP A;  4DR1 E;  1N33 E;  4DV5 E;  2M4I A;  4DR2 E;  2LTS A;  5DNY A;  4KKZ A;  3C4B A;  3THO B;  2RS6 A;  1UF3 A;  2B7T A;  3QFO A;  3FLO A;  4O43 A;  2RSM A;  4X66 E;  2DMY A;  1QFC A;  2ZO9 B;  5AE1 A;  2UUA E;  2HYP A;  2LUP B;  3IVD A;  4M0V A;  2LE2 A;  4J8Z A;  2Z1A A;  3VYX A;  3D03 A;  1YYO A;  5EQV A;  1N34 E;  5AE3 A;  4B3R E;  3E7B A;  5IOH A;  4JA9 A;  2UUB E;  2A22 A;  4AQY E;  3J81 C;  5JPF A;  2UU9 E;  4H2I A;  2IE3 C;  2B7V A;  4F9A B;  4DR6 E;  2V83 A;  5IWA E;  1XNR E;  4DV4 E;  3RL4 A;  4M30 A;  4DMI A;  3H63 A;  1WXR A;  1GZ6 A;  2KON A;  5AAS A;  4JI8 E;  3HVQ A;  4KZS A;  3N5U A;  1XM7 A;  4DV0 E;  3H67 A;  1HO5 A;  3P1X A;  3ADI A;  2G7H A;  2V87 A;  1SU1 A;  4LF7 E;  4FBK A;  4R03 A;  1ZBQ A;  1QHW A;  3HPZ A;  4B3S E;  1S3M A;  2B9D A;  2UXD E;  2AHD A;  2VQF E;  4B2O A;  1YZ9 A;  1RQ0 A;  2V88 A;  4X8W A;  4UT3 A;  4DUZ E;  4I8O A;  4M2Z A;  4WFT A;  2FV4 B;  1EKZ A;  2NUF A;  4LF9 E;  3H66 A;  4LTY A;  1O0W A;  2JOX A;  2HHH E;  1WAO 1;  4F9C B;  5AE2 A;  3C4T A;  2O8A A;  2LTR A;  3T1H E;  5FLX C;  4L5N C;  3OML A;  3LML A;  2M7Q A;  2RS7 A;  4IYP C;  3H09 A;  3OTO E;  3PSN A;  1GQE A;  2NYM C;  2WDF A;  1Z2X A;  5T6J A;  2E5L E;  3IB7 A;  4ZVZ A;  1W24 A;  1IBL E;  2N3H A;  1WHN A;  4DR5 E;  3IWC A;  2B3T B;  1IT6 A;  3E0J A;  2CPN A;  4BBY A;  2Z72 A;  4P78 A;  5BR8 E;  2NYL C;  4MP0 A;  4TUI A;  3MSW A;  4JI3 E;  2JVA A;  3T1I A;  4GKK E;  2JY9 A;  1RC7 A;  1UHZ A;  4NXN E;  2Q8U A;  1XMQ E;  4DV7 E;  1J26 A;  2HY1 A;  4UT3 B;  4L8N A;  3EGH A;  1T4N A;  5A2Q C;  3C9F A;  4DV3 E;  3ICF A;  4LFA E;  3DSD A;  4JI4 E;  2L8T A;  2MC5 A;  4F54 A;  4YY3 E;  2VQE E;  2M1S A;  4ZX2 A;  2UXC E;  3HTX A;  1WHQ A;  2KKN A;  1X49 A;  1IBM E;  4G9J A;  2K4V A;  2LBS B;  2DXL A;  2YEQ A;  3KBP A;  1AUI A;  2YZT A;  1T70 A;  1STU A;  2P6B A;  3THN A;  3T1Y E;  2L33 A;  4WWL A;  3K6Q A;  5HPE A;  3J7A G;  1HNZ E;  2RTX A;  2ZM6 E;  1DI2 A;  4DV1 E;  3H64 A;  1YYK A;  3RL3 A;  2Z06 A;  1NNW A;  3QFM A;  5B8I A;  3ADG A;  4LU9 A;  2LJH A;  4I5N C;  1X48 A;  2FTX B;  3H68 A;  1XNQ E;  3IB8 A;  3PSO A;  1S8E A;  4O5G A;  1IBK E;  4DKK A;  4LF6 E;  2MDR A;  2N3G A;  5JPE A;  2IHR 1;  3IWD A;  4UWQ A;  3V4Y A;  4KHP E;  1HPU A;  3HPS A;  1JK7 A;  1V73 A;  1SR9 A;  4BMJ A;  3H69 A;  4YKE A;  2GJU A;  4LF4 E;  2QJC A;  4BC7 A;  4J6O A;  2LRS A;  3DSC A;  3QG5 C;  3LLH A;  4TUG A;  2BCD A;  1S3N A;  4DV2 E;  2DIX A;  3ZOQ B;  4H1S A;  2V8Q B;  4GEQ B;  2NUG A;  4DR3 E;  4OOG C;  3J80 C;  1S3L A;  2L92 A;  3IWB A;  4R8O A;  3ADL A;  2KOU A;  3KWR A;  2F4V E;  4DR7 E;  4YHH E;  3ZTV A;  2JOB A;  2EZ6 A;  4JI2 E;  4FBQ A;  4BC9 A;  4LAC C;  2DXN A;  2L2N A;  4B3T E;  2H36 X;  4DUY E;  3TGH A;  1PKP A;  4LFC E;  2JOG A;  2V86 A;  5LL6 R;  1T4L B;  2NXF A;  1J5E E;  2O8G A;  1II7 A;  2VE7 C;  2L2K B;  1N36 E;  3LL8 A;  4DHL A;  2ODR C;  4Q7F A;  1DQ3 A;  2E1M A;  1HP1 A;  2IAE C;  4O4K A;  4Q28 A;  3DJW A;  3F6H A;  1FJM A;  3H62 B;  4H2F A;  2VF1 A;  4WPY A;  4LF8 E;  4ORB A;  4JV5 E;  2ODR D;  4P7D A;  1FJG E;  4H1Y P;  2LMZ A;  1OID A;  5IT9 C;  2L3J A;  2WDD A;  3RQZ A;  4JI6 E;  4UT2 A;  5C1V A;  4DV6 E;  5LMN E;  1T71 A;  4I5L C;  4WYQ B;  4X64 E;  2V85 A;  1G5B A;  5GTU A;  4XPN A;  2IE4 C;  2NUE A;  1S95 A;  2KHX A;  4JI5 E;  3CK2 A;  4V0W A;  4FCX A;  4NZV A;  3JAM C;  1FKA E;  2DB2 A;  2JWO A;  3IVE A;  4O24 A;  2BDX A;  4LF5 E;  4X62 E;  4OR9 A;  1YYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...