4LACC

Crystal structure of protein phosphatase 2a (pp2a) and pp2a phosphatase activator (ptpa) complex with atpgammas
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
290
Chain Sequence
KVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A activator
publication title Structural basis of PP2A activation by PTPA, an ATP-dependent activation chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
total genus 104
structure length 290
sequence length 290
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4lacC00
4ORAA 3FGAC 1T71A 4FBQA 2HYOA 4O4KA 3T1IA 2Z1AA 3H68A 4B2OA 2Z72A 2NPPC 5C1VA 1HP1A 4XPNA 4TUGA 2NYMC 3HVQA 3E7BA 4IL1A 3E7AA 4H2BA 3GVEA 1S8EA 2NYLC 1UTEA 3P71C 1SU1A 1Z2XA 3H63A 4G9JA 4O24A 2USHA 4UT3A 3KBPA 2P6BA 4LTYA 2Q8UA 2HYPA 4IYPC 1XM7A 1W24A 1Z2WA 2JOGA 4KBPA 2DFJA 3PSNA 3AV0A 3QFMA 4I5NC 1OI8A 5J28A 1WARA 2CV9A 2WDDA 1S3NA 4ORCA 5JPEA 4MOVA 5DNYA 3QFOA 3THNA 2WDFA 4LACC 4M0VA 4MP0A 2BCDA 4H1YP 4Q7FA 4H2FA 5F3WA 2WDCA 1JK7A 2IE4C 3QG5C 2A22A 3LL8A 3AUZA 3EGGA 3IB7A 3EGHA 3DW8C 1IT6A 1S70A 4ZVZA 1MF8A 3THOB 3V4YA 2IAEC 2NXFA 5GTUA 3ZU0A 2BQ8X 1S3LA 2GJUA 4H1SA 2O8AA 3PSOA 3ZTVA 5INBA 3H66A 5HPEA 1UF3A 1HPUA 4F0ZA 2WDEA 4LU9A 4ORBA 4FCXA 3ICFA 5IOHA 2KKNA 5JPFA 2Z06A 4UT2A 3C5WC 3K7WC 4FBKA 4H2GA 3CK2A 4HD0A 3DSDA 2ZBMA 3IVDA 3TGHA 4FBWA 4ZX2A 4DSYA 1NNWA 3JYFA 4OR9A 5JJTA 4V0VA 1T70A 4JA7A 3H64A 1AUIA 4YKEA 4O43A 4J6OA 3C9FA 1M63A 1HO5A 1U32A 3H61A 3IVEA 3QFNA 1QFCA 3K7VC 4DT2A 2QFRA 4NZVA 1TCOA 1WAO1 1II7A 1QHWA 1OIEA 2QJCA 4UT3B 3RL4A 3DSCA 3QFKA 2BDXA 3RL3A 5EQVA 3IB8A 1S95A 4TUIA 2QFPA 4MOYA 1XZWA 1USHA 4V0XA 3H67A 3RL5A 1G5BA 1OIDA 1V73A 2YVTA 4KKZA 1KBPA 4JA9A 2R17A 2O8GA 1FJMA 4V0WA 2XMOA 3N5UA 3RQZA 3H62B 2HY1A 4UWQA 4WWLA 1S3MA 4O5GA 4DHLA 3H69A 4I5LC 2AHDA 5B8IA 2IE3C 4H2IA 3H60A
chains in the Genus database with same CATH superfamily
4ORAA 3FGAC 2ZOAA 1T71A 4FBQA 2HYOA 2YEQA 4O4KA 3T1IA 2Z1AA 3H68A 2DXLA 2Z72A 2NPPC 5C1VA 1HP1A 4XPNA 4B2OA 4TUGA 2NYMC 3HVQA 3E7BA 4IL1A 3E7AA 4H2BA 3GVEA 1S8EA 2NYLC 1UTEA 3P71C 1SU1A 1Z2XA 3H63A 4G9JA 4O24A 2USHA 4UT3A 3KBPA 2P6BA 4LTYA 2Q8UA 2HYPA 4IYPC 1XM7A 1W24A 1Z2WA 2JOGA 4KBPA 2DFJA 3PSNA 3AV0A 3QFMA 4I5NC 1OI8A 5J28A 1WARA 2CV9A 2WDDA 1S3NA 4ORCA 5JPEA 4MOVA 5DNYA 3QFOA 3THNA 2WDFA 4LACC 4M0VA 4MP0A 2ZO9B 2BCDA 4H1YP 4Q7FA 4H2FA 5F3WA 2WDCA 1JK7A 2IE4C 3QG5C 2A22A 3LL8A 3AUZA 3EGGA 3IB7A 3EGHA 3DW8C 1IT6A 1S70A 4ZVZA 1MF8A 3THOB 3V4YA 2IAEC 2NXFA 5GTUA 3ZU0A 2BQ8X 1S3LA 2GJUA 4H1SA 2O8AA 3PSOA 3ZTVA 5INBA 3H66A 5HPEA 1UF3A 1HPUA 4F0ZA 2WDEA 4LU9A 4ORBA 4FCXA 3ICFA 3D03A 5IOHA 2KKNA 3FLOA 5JPFA 2Z06A 4UT2A 3C5WC 3K7WC 4FBKA 4H2GA 3CK2A 4HD0A 3DSDA 2ZBMA 3IVDA 3TGHA 4FBWA 4ZX2A 4DSYA 1NNWA 3JYFA 4OR9A 5JJTA 4V0VA 3E0JA 1T70A 4JA7A 3H64A 1AUIA 4YKEA 4O43A 4J6OA 3C9FA 1M63A 1HO5A 1U32A 3H61A 3IVEA 3QFNA 1QFCA 3K7VC 4DT2A 2QFRA 4NZVA 1TCOA 1WAO1 1II7A 1QHWA 1OIEA 2QJCA 4UT3B 3RL4A 3DSCA 3QFKA 2BDXA 3RL3A 5EQVA 2DXNA 3IB8A 1S95A 4TUIA 2QFPA 4MOYA 1XZWA 1USHA 4V0XA 3H67A 3RL5A 1G5BA 1OIDA 1V73A 2YVTA 4KKZA 1KBPA 4JA9A 2R17A 2O8GA 1FJMA 4V0WA 2XMOA 3N5UA 3RQZA 3H62B 2HY1A 4UWQA 4WWLA 1S3MA 4O5GA 4DHLA 3H69A 4I5LC 2AHDA 5B8IA 2IE3C 4H2IA 3H60A
chains in the Genus database with same CATH topology
4ORAA 3FGAC 2ZOAA 1T71A 4FBQA 2HYOA 2YEQA 4O4KA 3T1IA 2Z1AA 3H68A 2DXLA 2Z72A 2NPPC 5C1VA 1HP1A 4XPNA 4B2OA 4TUGA 2NYMC 3HVQA 3E7BA 4IL1A 3E7AA 4H2BA 3GVEA 1S8EA 2NYLC 1UTEA 3P71C 1SU1A 1Z2XA 3H63A 4G9JA 4O24A 2USHA 4UT3A 3KBPA 2P6BA 4LTYA 2Q8UA 2HYPA 4IYPC 1XM7A 1W24A 1Z2WA 2JOGA 4KBPA 2DFJA 3PSNA 3AV0A 3QFMA 4I5NC 1OI8A 5J28A 1WARA 2CV9A 2WDDA 1S3NA 4ORCA 5JPEA 4MOVA 5DNYA 3QFOA 3THNA 2WDFA 4LACC 4M0VA 4MP0A 2ZO9B 2BCDA 4H1YP 4Q7FA 4H2FA 5F3WA 2WDCA 1JK7A 2IE4C 3QG5C 2A22A 3LL8A 3AUZA 3EGGA 3IB7A 3EGHA 3DW8C 1IT6A 1S70A 4ZVZA 1MF8A 3THOB 3V4YA 2IAEC 2NXFA 5GTUA 3ZU0A 2BQ8X 1S3LA 2GJUA 4H1SA 2O8AA 3PSOA 3ZTVA 5INBA 3H66A 5HPEA 1UF3A 1HPUA 4F0ZA 2WDEA 4LU9A 4ORBA 4FCXA 3ICFA 3D03A 5IOHA 2KKNA 3FLOA 5JPFA 2Z06A 4UT2A 3C5WC 3K7WC 4FBKA 4H2GA 3CK2A 4HD0A 3DSDA 2ZBMA 3IVDA 3TGHA 4FBWA 4ZX2A 4DSYA 1NNWA 3JYFA 4OR9A 5JJTA 4V0VA 3E0JA 1T70A 4JA7A 3H64A 1AUIA 4YKEA 4O43A 4J6OA 3C9FA 1M63A 1HO5A 1U32A 3H61A 3IVEA 3QFNA 1QFCA 3K7VC 4DT2A 2QFRA 4NZVA 1TCOA 1WAO1 1II7A 1QHWA 1OIEA 2QJCA 4UT3B 3RL4A 3DSCA 3QFKA 2BDXA 3RL3A 5EQVA 2DXNA 3IB8A 1S95A 4TUIA 2QFPA 4MOYA 1XZWA 1USHA 4V0XA 3H67A 3RL5A 1G5BA 1OIDA 1V73A 2YVTA 4KKZA 1KBPA 4JA9A 2R17A 2O8GA 1FJMA 4V0WA 2XMOA 3N5UA 3RQZA 3H62B 2HY1A 4UWQA 4WWLA 1S3MA 4O5GA 4DHLA 3H69A 4I5LC 2AHDA 5B8IA 2IE3C 4H2IA 3H60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORA A;  3FGA C;  1T71 A;  4FBQ A;  2HYO A;  4O4K A;  3T1I A;  2Z1A A;  3H68 A;  4B2O A;  2Z72 A;  2NPP C;  5C1V A;  1HP1 A;  4XPN A;  4TUG A;  2NYM C;  3HVQ A;  3E7B A;  4IL1 A;  3E7A A;  4H2B A;  3GVE A;  1S8E A;  2NYL C;  1UTE A;  3P71 C;  1SU1 A;  1Z2X A;  3H63 A;  4G9J A;  4O24 A;  2USH A;  4UT3 A;  3KBP A;  2P6B A;  4LTY A;  2Q8U A;  2HYP A;  4IYP C;  1XM7 A;  1W24 A;  1Z2W A;  2JOG A;  4KBP A;  2DFJ A;  3PSN A;  3AV0 A;  3QFM A;  4I5N C;  1OI8 A;  5J28 A;  1WAR A;  2CV9 A;  2WDD A;  1S3N A;  4ORC A;  5JPE A;  4MOV A;  5DNY A;  3QFO A;  3THN A;  2WDF A;  4LAC C;  4M0V A;  4MP0 A;  2BCD A;  4H1Y P;  4Q7F A;  4H2F A;  5F3W A;  2WDC A;  1JK7 A;  2IE4 C;  3QG5 C;  2A22 A;  3LL8 A;  3AUZ A;  3EGG A;  3IB7 A;  3EGH A;  3DW8 C;  1IT6 A;  1S70 A;  4ZVZ A;  1MF8 A;  3THO B;  3V4Y A;  2IAE C;  2NXF A;  5GTU A;  3ZU0 A;  2BQ8 X;  1S3L A;  2GJU A;  4H1S A;  2O8A A;  3PSO A;  3ZTV A;  5INB A;  3H66 A;  5HPE A;  1UF3 A;  1HPU A;  4F0Z A;  2WDE A;  4LU9 A;  4ORB A;  4FCX A;  3ICF A;  5IOH A;  2KKN A;  5JPF A;  2Z06 A;  4UT2 A;  3C5W C;  3K7W C;  4FBK A;  4H2G A;  3CK2 A;  4HD0 A;  3DSD A;  2ZBM A;  3IVD A;  3TGH A;  4FBW A;  4ZX2 A;  4DSY A;  1NNW A;  3JYF A;  4OR9 A;  5JJT A;  4V0V A;  1T70 A;  4JA7 A;  3H64 A;  1AUI A;  4YKE A;  4O43 A;  4J6O A;  3C9F A;  1M63 A;  1HO5 A;  1U32 A;  3H61 A;  3IVE A;  3QFN A;  1QFC A;  3K7V C;  4DT2 A;  2QFR A;  4NZV A;  1TCO A;  1WAO 1;  1II7 A;  1QHW A;  1OIE A;  2QJC A;  4UT3 B;  3RL4 A;  3DSC A;  3QFK A;  2BDX A;  3RL3 A;  5EQV A;  3IB8 A;  1S95 A;  4TUI A;  2QFP A;  4MOY A;  1XZW A;  1USH A;  4V0X A;  3H67 A;  3RL5 A;  1G5B A;  1OID A;  1V73 A;  2YVT A;  4KKZ A;  1KBP A;  4JA9 A;  2R17 A;  2O8G A;  1FJM A;  4V0W A;  2XMO A;  3N5U A;  3RQZ A;  3H62 B;  2HY1 A;  4UWQ A;  4WWL A;  1S3M A;  4O5G A;  4DHL A;  3H69 A;  4I5L C;  2AHD A;  5B8I A;  2IE3 C;  4H2I A;  3H60 A; 
#chains in the Genus database with same CATH topology
 4ORA A;  3FGA C;  2ZOA A;  1T71 A;  4FBQ A;  2HYO A;  2YEQ A;  4O4K A;  3T1I A;  2Z1A A;  3H68 A;  2DXL A;  2Z72 A;  2NPP C;  5C1V A;  1HP1 A;  4XPN A;  4B2O A;  4TUG A;  2NYM C;  3HVQ A;  3E7B A;  4IL1 A;  3E7A A;  4H2B A;  3GVE A;  1S8E A;  2NYL C;  1UTE A;  3P71 C;  1SU1 A;  1Z2X A;  3H63 A;  4G9J A;  4O24 A;  2USH A;  4UT3 A;  3KBP A;  2P6B A;  4LTY A;  2Q8U A;  2HYP A;  4IYP C;  1XM7 A;  1W24 A;  1Z2W A;  2JOG A;  4KBP A;  2DFJ A;  3PSN A;  3AV0 A;  3QFM A;  4I5N C;  1OI8 A;  5J28 A;  1WAR A;  2CV9 A;  2WDD A;  1S3N A;  4ORC A;  5JPE A;  4MOV A;  5DNY A;  3QFO A;  3THN A;  2WDF A;  4LAC C;  4M0V A;  4MP0 A;  2ZO9 B;  2BCD A;  4H1Y P;  4Q7F A;  4H2F A;  5F3W A;  2WDC A;  1JK7 A;  2IE4 C;  3QG5 C;  2A22 A;  3LL8 A;  3AUZ A;  3EGG A;  3IB7 A;  3EGH A;  3DW8 C;  1IT6 A;  1S70 A;  4ZVZ A;  1MF8 A;  3THO B;  3V4Y A;  2IAE C;  2NXF A;  5GTU A;  3ZU0 A;  2BQ8 X;  1S3L A;  2GJU A;  4H1S A;  2O8A A;  3PSO A;  3ZTV A;  5INB A;  3H66 A;  5HPE A;  1UF3 A;  1HPU A;  4F0Z A;  2WDE A;  4LU9 A;  4ORB A;  4FCX A;  3ICF A;  3D03 A;  5IOH A;  2KKN A;  3FLO A;  5JPF A;  2Z06 A;  4UT2 A;  3C5W C;  3K7W C;  4FBK A;  4H2G A;  3CK2 A;  4HD0 A;  3DSD A;  2ZBM A;  3IVD A;  3TGH A;  4FBW A;  4ZX2 A;  4DSY A;  1NNW A;  3JYF A;  4OR9 A;  5JJT A;  4V0V A;  3E0J A;  1T70 A;  4JA7 A;  3H64 A;  1AUI A;  4YKE A;  4O43 A;  4J6O A;  3C9F A;  1M63 A;  1HO5 A;  1U32 A;  3H61 A;  3IVE A;  3QFN A;  1QFC A;  3K7V C;  4DT2 A;  2QFR A;  4NZV A;  1TCO A;  1WAO 1;  1II7 A;  1QHW A;  1OIE A;  2QJC A;  4UT3 B;  3RL4 A;  3DSC A;  3QFK A;  2BDX A;  3RL3 A;  5EQV A;  2DXN A;  3IB8 A;  1S95 A;  4TUI A;  2QFP A;  4MOY A;  1XZW A;  1USH A;  4V0X A;  3H67 A;  3RL5 A;  1G5B A;  1OID A;  1V73 A;  2YVT A;  4KKZ A;  1KBP A;  4JA9 A;  2R17 A;  2O8G A;  1FJM A;  4V0W A;  2XMO A;  3N5U A;  3RQZ A;  3H62 B;  2HY1 A;  4UWQ A;  4WWL A;  1S3M A;  4O5G A;  4DHL A;  3H69 A;  4I5L C;  2AHD A;  5B8I A;  2IE3 C;  4H2I A;  3H60 A; 
#chains in the Genus database with same CATH homology
 4ORA A;  3FGA C;  2ZOA A;  1T71 A;  4FBQ A;  2HYO A;  2YEQ A;  4O4K A;  3T1I A;  2Z1A A;  3H68 A;  2DXL A;  2Z72 A;  2NPP C;  5C1V A;  1HP1 A;  4XPN A;  4B2O A;  4TUG A;  2NYM C;  3HVQ A;  3E7B A;  4IL1 A;  3E7A A;  4H2B A;  3GVE A;  1S8E A;  2NYL C;  1UTE A;  3P71 C;  1SU1 A;  1Z2X A;  3H63 A;  4G9J A;  4O24 A;  2USH A;  4UT3 A;  3KBP A;  2P6B A;  4LTY A;  2Q8U A;  2HYP A;  4IYP C;  1XM7 A;  1W24 A;  1Z2W A;  2JOG A;  4KBP A;  2DFJ A;  3PSN A;  3AV0 A;  3QFM A;  4I5N C;  1OI8 A;  5J28 A;  1WAR A;  2CV9 A;  2WDD A;  1S3N A;  4ORC A;  5JPE A;  4MOV A;  5DNY A;  3QFO A;  3THN A;  2WDF A;  4LAC C;  4M0V A;  4MP0 A;  2ZO9 B;  2BCD A;  4H1Y P;  4Q7F A;  4H2F A;  5F3W A;  2WDC A;  1JK7 A;  2IE4 C;  3QG5 C;  2A22 A;  3LL8 A;  3AUZ A;  3EGG A;  3IB7 A;  3EGH A;  3DW8 C;  1IT6 A;  1S70 A;  4ZVZ A;  1MF8 A;  3THO B;  3V4Y A;  2IAE C;  2NXF A;  5GTU A;  3ZU0 A;  2BQ8 X;  1S3L A;  2GJU A;  4H1S A;  2O8A A;  3PSO A;  3ZTV A;  5INB A;  3H66 A;  5HPE A;  1UF3 A;  1HPU A;  4F0Z A;  2WDE A;  4LU9 A;  4ORB A;  4FCX A;  3ICF A;  3D03 A;  5IOH A;  2KKN A;  3FLO A;  5JPF A;  2Z06 A;  4UT2 A;  3C5W C;  3K7W C;  4FBK A;  4H2G A;  3CK2 A;  4HD0 A;  3DSD A;  2ZBM A;  3IVD A;  3TGH A;  4FBW A;  4ZX2 A;  4DSY A;  1NNW A;  3JYF A;  4OR9 A;  5JJT A;  4V0V A;  3E0J A;  1T70 A;  4JA7 A;  3H64 A;  1AUI A;  4YKE A;  4O43 A;  4J6O A;  3C9F A;  1M63 A;  1HO5 A;  1U32 A;  3H61 A;  3IVE A;  3QFN A;  1QFC A;  3K7V C;  4DT2 A;  2QFR A;  4NZV A;  1TCO A;  1WAO 1;  1II7 A;  1QHW A;  1OIE A;  2QJC A;  4UT3 B;  3RL4 A;  3DSC A;  3QFK A;  2BDX A;  3RL3 A;  5EQV A;  2DXN A;  3IB8 A;  1S95 A;  4TUI A;  2QFP A;  4MOY A;  1XZW A;  1USH A;  4V0X A;  3H67 A;  3RL5 A;  1G5B A;  1OID A;  1V73 A;  2YVT A;  4KKZ A;  1KBP A;  4JA9 A;  2R17 A;  2O8G A;  1FJM A;  4V0W A;  2XMO A;  3N5U A;  3RQZ A;  3H62 B;  2HY1 A;  4UWQ A;  4WWL A;  1S3M A;  4O5G A;  4DHL A;  3H69 A;  4I5L C;  2AHD A;  5B8I A;  2IE3 C;  4H2I A;  3H60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...