4LACC

Crystal structure of protein phosphatase 2a (pp2a) and pp2a phosphatase activator (ptpa) complex with atpgammas
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
290
Chain Sequence
KVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/signaling protein
molecule keywords Serine/threonine-protein phosphatase 2A activator
publication title Structural basis of PP2A activation by PTPA, an ATP-dependent activation chaperone.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 290
sequence length 290
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4lacC00
1OI8A 4G9JA 4UT3B 1Z2WA 4DHLA 3K7WC 2WDEA 4UT2A 3HVQA 5DNYA 5B8IA 3JYFA 4V0VA 2NPPC 4FBQA 4O24A 4MP0A 2GJUA 2HYPA 3GVEA 3C5WC 3RL5A 1T70A 3DSDA 2ZBMA 3H66A 5EQVA 4DSYA 3KBPA 4KKZA 4OR9A 3TGHA 2HY1A 2NYLC 4H2GA 3CK2A 4ZX2A 3FGAC 3P71C 1NNWA 1USHA 4MOVA 4UWQA 3EGGA 3E7AA 1HP1A 3EGHA 3H69A 4FBWA 1MF8A 3H60A 1SU1A 2IAEC 2IE4C 3AUZA 4H2IA 4O5GA 3THOB 1W24A 5JPFA 2A22A 2CV9A 2WDFA 1WARA 4ORCA 5IOHA 4H1YP 2QFPA 4WWLA 1U32A 5JPEA 3T1IA 2WDDA 4F0ZA 1FJMA 2BQ8X 3IB8A 3RQZA 4H2FA 3RL3A 3PSNA 4IYPC 1UTEA 4ORAA 1S8EA 3H68A 4UT3A 1XM7A 2HYOA 2QFRA 4H2BA 4ZVZA 1M63A 4LTYA 4YKEA 4ORBA 5C1VA 3IVEA 1S3LA 2Q8UA 3N5UA 4JA7A 1WAO1 4M0VA 2JOGA 1UF3A 3RL4A 4JA9A 3ICFA 4LACC 3ZU0A 2YVTA 4DT2A 1T71A 1G5BA 3QFOA 4O43A 1Z2XA 2AHDA 2KKNA 3IB7A 1XZWA 2Z1AA 3PSOA 4J6OA 1OIEA 5INBA 2O8GA 3THNA 2WDCA 3DW8C 4O4KA 4HD0A 4V0WA 4TUIA 5F3WA 3K7VC 1V73A 2BCDA 2Z72A 5JJTA 4KBPA 2IE3C 2Z06A 1HPUA 3AV0A 1TCOA 3QFKA 3H67A 1JK7A 3H62B 1S3MA 4TUGA 4LU9A 1S3NA 3QFMA 3QFNA 4Q7FA 4I5NC 4NZVA 2NYMC 1AUIA 4MOYA 2USHA 4XPNA 3ZTVA 4I5LC 2NXFA 5HPEA 3E7BA 1OIDA 2O8AA 4FBKA 1II7A 3V4YA 3IVDA 1IT6A 1HO5A 4H1SA 4B2OA 3C9FA 1S70A 2BDXA 3H63A 3H61A 1QHWA 3QG5C 1S95A 4FCXA 4V0XA 1KBPA 1QFCA 2P6BA 2QJCA 2R17A 3LL8A 5J28A 4IL1A 2XMOA 3DSCA 5GTUA 3H64A 2DFJA
chains in the Genus database with same CATH superfamily
1OI8A 4G9JA 4UT3B 1Z2WA 4DHLA 3K7WC 2WDEA 4UT2A 3HVQA 5DNYA 5B8IA 3JYFA 2DXLA 4V0VA 2NPPC 4FBQA 4O24A 4MP0A 2GJUA 2HYPA 3GVEA 3C5WC 3RL5A 2ZO9B 1T70A 3DSDA 2YEQA 2ZBMA 3H66A 5EQVA 4DSYA 3KBPA 4KKZA 4OR9A 3TGHA 2HY1A 2NYLC 4H2GA 3CK2A 4ZX2A 3FGAC 3P71C 1NNWA 1USHA 4MOVA 4UWQA 3EGGA 3E7AA 1HP1A 3EGHA 3H69A 4FBWA 1MF8A 3H60A 1SU1A 2IAEC 2IE4C 3AUZA 4H2IA 4O5GA 3THOB 1W24A 5JPFA 2A22A 2CV9A 3D03A 2WDFA 1WARA 4ORCA 5IOHA 4H1YP 3FLOA 2QFPA 4WWLA 1U32A 5JPEA 3T1IA 2WDDA 4F0ZA 1FJMA 2BQ8X 3IB8A 3RQZA 4H2FA 3RL3A 3PSNA 4IYPC 1UTEA 4ORAA 1S8EA 3H68A 4UT3A 1XM7A 2HYOA 2QFRA 4H2BA 4ZVZA 1M63A 4LTYA 4YKEA 4ORBA 5C1VA 2ZOAA 3IVEA 1S3LA 2Q8UA 3N5UA 4JA7A 1WAO1 4M0VA 2JOGA 1UF3A 3RL4A 4JA9A 3ICFA 4LACC 3ZU0A 2YVTA 4DT2A 1T71A 1G5BA 3QFOA 4O43A 1Z2XA 2AHDA 2KKNA 3IB7A 1XZWA 2Z1AA 3PSOA 4J6OA 1OIEA 5INBA 2O8GA 3THNA 2WDCA 3DW8C 4O4KA 4HD0A 4V0WA 2DXNA 4TUIA 5F3WA 3K7VC 1V73A 2BCDA 2Z72A 5JJTA 4KBPA 2IE3C 2Z06A 1HPUA 3AV0A 1TCOA 3QFKA 3H67A 1JK7A 3H62B 1S3MA 4TUGA 4LU9A 1S3NA 3QFMA 3QFNA 4Q7FA 4I5NC 4NZVA 2NYMC 1AUIA 4MOYA 2USHA 4XPNA 3ZTVA 4I5LC 2NXFA 5HPEA 3E7BA 1OIDA 2O8AA 4FBKA 1II7A 3V4YA 3IVDA 1IT6A 1HO5A 4H1SA 3E0JA 4B2OA 3C9FA 1S70A 2BDXA 3H63A 3H61A 1QHWA 3QG5C 1S95A 4FCXA 4V0XA 1KBPA 1QFCA 2P6BA 2QJCA 2R17A 3LL8A 5J28A 4IL1A 2XMOA 3DSCA 5GTUA 3H64A 2DFJA
chains in the Genus database with same CATH topology
1OI8A 4G9JA 4UT3B 1Z2WA 4DHLA 3K7WC 2WDEA 4UT2A 3HVQA 5DNYA 5B8IA 3JYFA 2DXLA 4V0VA 2NPPC 4FBQA 4O24A 4MP0A 2GJUA 2HYPA 3GVEA 3C5WC 3RL5A 2ZO9B 1T70A 3DSDA 2YEQA 2ZBMA 3H66A 5EQVA 4DSYA 3KBPA 4KKZA 4OR9A 3TGHA 2HY1A 2NYLC 4H2GA 3CK2A 4ZX2A 3FGAC 3P71C 1NNWA 1USHA 4MOVA 4UWQA 3EGGA 3E7AA 1HP1A 3EGHA 3H69A 4FBWA 1MF8A 3H60A 1SU1A 2IAEC 2IE4C 3AUZA 4H2IA 4O5GA 3THOB 1W24A 5JPFA 2A22A 2CV9A 3D03A 2WDFA 1WARA 4ORCA 5IOHA 4H1YP 3FLOA 2QFPA 4WWLA 1U32A 5JPEA 3T1IA 2WDDA 4F0ZA 1FJMA 2BQ8X 3IB8A 3RQZA 4H2FA 3RL3A 3PSNA 4IYPC 1UTEA 4ORAA 1S8EA 3H68A 4UT3A 1XM7A 2HYOA 2QFRA 4H2BA 4ZVZA 1M63A 4LTYA 4YKEA 4ORBA 5C1VA 2ZOAA 3IVEA 1S3LA 2Q8UA 3N5UA 4JA7A 1WAO1 4M0VA 2JOGA 1UF3A 3RL4A 4JA9A 3ICFA 4LACC 3ZU0A 2YVTA 4DT2A 1T71A 1G5BA 3QFOA 4O43A 1Z2XA 2AHDA 2KKNA 3IB7A 1XZWA 2Z1AA 3PSOA 4J6OA 1OIEA 5INBA 2O8GA 3THNA 2WDCA 3DW8C 4O4KA 4HD0A 4V0WA 2DXNA 4TUIA 5F3WA 3K7VC 1V73A 2BCDA 2Z72A 5JJTA 4KBPA 2IE3C 2Z06A 1HPUA 3AV0A 1TCOA 3QFKA 3H67A 1JK7A 3H62B 1S3MA 4TUGA 4LU9A 1S3NA 3QFMA 3QFNA 4Q7FA 4I5NC 4NZVA 2NYMC 1AUIA 4MOYA 2USHA 4XPNA 3ZTVA 4I5LC 2NXFA 5HPEA 3E7BA 1OIDA 2O8AA 4FBKA 1II7A 3V4YA 3IVDA 1IT6A 1HO5A 4H1SA 3E0JA 4B2OA 3C9FA 1S70A 2BDXA 3H63A 3H61A 1QHWA 3QG5C 1S95A 4FCXA 4V0XA 1KBPA 1QFCA 2P6BA 2QJCA 2R17A 3LL8A 5J28A 4IL1A 2XMOA 3DSCA 5GTUA 3H64A 2DFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OI8 A;  4G9J A;  4UT3 B;  1Z2W A;  4DHL A;  3K7W C;  2WDE A;  4UT2 A;  3HVQ A;  5DNY A;  5B8I A;  3JYF A;  4V0V A;  2NPP C;  4FBQ A;  4O24 A;  4MP0 A;  2GJU A;  2HYP A;  3GVE A;  3C5W C;  3RL5 A;  1T70 A;  3DSD A;  2ZBM A;  3H66 A;  5EQV A;  4DSY A;  3KBP A;  4KKZ A;  4OR9 A;  3TGH A;  2HY1 A;  2NYL C;  4H2G A;  3CK2 A;  4ZX2 A;  3FGA C;  3P71 C;  1NNW A;  1USH A;  4MOV A;  4UWQ A;  3EGG A;  3E7A A;  1HP1 A;  3EGH A;  3H69 A;  4FBW A;  1MF8 A;  3H60 A;  1SU1 A;  2IAE C;  2IE4 C;  3AUZ A;  4H2I A;  4O5G A;  3THO B;  1W24 A;  5JPF A;  2A22 A;  2CV9 A;  2WDF A;  1WAR A;  4ORC A;  5IOH A;  4H1Y P;  2QFP A;  4WWL A;  1U32 A;  5JPE A;  3T1I A;  2WDD A;  4F0Z A;  1FJM A;  2BQ8 X;  3IB8 A;  3RQZ A;  4H2F A;  3RL3 A;  3PSN A;  4IYP C;  1UTE A;  4ORA A;  1S8E A;  3H68 A;  4UT3 A;  1XM7 A;  2HYO A;  2QFR A;  4H2B A;  4ZVZ A;  1M63 A;  4LTY A;  4YKE A;  4ORB A;  5C1V A;  3IVE A;  1S3L A;  2Q8U A;  3N5U A;  4JA7 A;  1WAO 1;  4M0V A;  2JOG A;  1UF3 A;  3RL4 A;  4JA9 A;  3ICF A;  4LAC C;  3ZU0 A;  2YVT A;  4DT2 A;  1T71 A;  1G5B A;  3QFO A;  4O43 A;  1Z2X A;  2AHD A;  2KKN A;  3IB7 A;  1XZW A;  2Z1A A;  3PSO A;  4J6O A;  1OIE A;  5INB A;  2O8G A;  3THN A;  2WDC A;  3DW8 C;  4O4K A;  4HD0 A;  4V0W A;  4TUI A;  5F3W A;  3K7V C;  1V73 A;  2BCD A;  2Z72 A;  5JJT A;  4KBP A;  2IE3 C;  2Z06 A;  1HPU A;  3AV0 A;  1TCO A;  3QFK A;  3H67 A;  1JK7 A;  3H62 B;  1S3M A;  4TUG A;  4LU9 A;  1S3N A;  3QFM A;  3QFN A;  4Q7F A;  4I5N C;  4NZV A;  2NYM C;  1AUI A;  4MOY A;  2USH A;  4XPN A;  3ZTV A;  4I5L C;  2NXF A;  5HPE A;  3E7B A;  1OID A;  2O8A A;  4FBK A;  1II7 A;  3V4Y A;  3IVD A;  1IT6 A;  1HO5 A;  4H1S A;  4B2O A;  3C9F A;  1S70 A;  2BDX A;  3H63 A;  3H61 A;  1QHW A;  3QG5 C;  1S95 A;  4FCX A;  4V0X A;  1KBP A;  1QFC A;  2P6B A;  2QJC A;  2R17 A;  3LL8 A;  5J28 A;  4IL1 A;  2XMO A;  3DSC A;  5GTU A;  3H64 A;  2DFJ A; 
#chains in the Genus database with same CATH topology
 1OI8 A;  4G9J A;  4UT3 B;  1Z2W A;  4DHL A;  3K7W C;  2WDE A;  4UT2 A;  3HVQ A;  5DNY A;  5B8I A;  3JYF A;  2DXL A;  4V0V A;  2NPP C;  4FBQ A;  4O24 A;  4MP0 A;  2GJU A;  2HYP A;  3GVE A;  3C5W C;  3RL5 A;  2ZO9 B;  1T70 A;  3DSD A;  2YEQ A;  2ZBM A;  3H66 A;  5EQV A;  4DSY A;  3KBP A;  4KKZ A;  4OR9 A;  3TGH A;  2HY1 A;  2NYL C;  4H2G A;  3CK2 A;  4ZX2 A;  3FGA C;  3P71 C;  1NNW A;  1USH A;  4MOV A;  4UWQ A;  3EGG A;  3E7A A;  1HP1 A;  3EGH A;  3H69 A;  4FBW A;  1MF8 A;  3H60 A;  1SU1 A;  2IAE C;  2IE4 C;  3AUZ A;  4H2I A;  4O5G A;  3THO B;  1W24 A;  5JPF A;  2A22 A;  2CV9 A;  3D03 A;  2WDF A;  1WAR A;  4ORC A;  5IOH A;  4H1Y P;  3FLO A;  2QFP A;  4WWL A;  1U32 A;  5JPE A;  3T1I A;  2WDD A;  4F0Z A;  1FJM A;  2BQ8 X;  3IB8 A;  3RQZ A;  4H2F A;  3RL3 A;  3PSN A;  4IYP C;  1UTE A;  4ORA A;  1S8E A;  3H68 A;  4UT3 A;  1XM7 A;  2HYO A;  2QFR A;  4H2B A;  4ZVZ A;  1M63 A;  4LTY A;  4YKE A;  4ORB A;  5C1V A;  2ZOA A;  3IVE A;  1S3L A;  2Q8U A;  3N5U A;  4JA7 A;  1WAO 1;  4M0V A;  2JOG A;  1UF3 A;  3RL4 A;  4JA9 A;  3ICF A;  4LAC C;  3ZU0 A;  2YVT A;  4DT2 A;  1T71 A;  1G5B A;  3QFO A;  4O43 A;  1Z2X A;  2AHD A;  2KKN A;  3IB7 A;  1XZW A;  2Z1A A;  3PSO A;  4J6O A;  1OIE A;  5INB A;  2O8G A;  3THN A;  2WDC A;  3DW8 C;  4O4K A;  4HD0 A;  4V0W A;  2DXN A;  4TUI A;  5F3W A;  3K7V C;  1V73 A;  2BCD A;  2Z72 A;  5JJT A;  4KBP A;  2IE3 C;  2Z06 A;  1HPU A;  3AV0 A;  1TCO A;  3QFK A;  3H67 A;  1JK7 A;  3H62 B;  1S3M A;  4TUG A;  4LU9 A;  1S3N A;  3QFM A;  3QFN A;  4Q7F A;  4I5N C;  4NZV A;  2NYM C;  1AUI A;  4MOY A;  2USH A;  4XPN A;  3ZTV A;  4I5L C;  2NXF A;  5HPE A;  3E7B A;  1OID A;  2O8A A;  4FBK A;  1II7 A;  3V4Y A;  3IVD A;  1IT6 A;  1HO5 A;  4H1S A;  3E0J A;  4B2O A;  3C9F A;  1S70 A;  2BDX A;  3H63 A;  3H61 A;  1QHW A;  3QG5 C;  1S95 A;  4FCX A;  4V0X A;  1KBP A;  1QFC A;  2P6B A;  2QJC A;  2R17 A;  3LL8 A;  5J28 A;  4IL1 A;  2XMO A;  3DSC A;  5GTU A;  3H64 A;  2DFJ A; 
#chains in the Genus database with same CATH homology
 1OI8 A;  4G9J A;  4UT3 B;  1Z2W A;  4DHL A;  3K7W C;  2WDE A;  4UT2 A;  3HVQ A;  5DNY A;  5B8I A;  3JYF A;  2DXL A;  4V0V A;  2NPP C;  4FBQ A;  4O24 A;  4MP0 A;  2GJU A;  2HYP A;  3GVE A;  3C5W C;  3RL5 A;  2ZO9 B;  1T70 A;  3DSD A;  2YEQ A;  2ZBM A;  3H66 A;  5EQV A;  4DSY A;  3KBP A;  4KKZ A;  4OR9 A;  3TGH A;  2HY1 A;  2NYL C;  4H2G A;  3CK2 A;  4ZX2 A;  3FGA C;  3P71 C;  1NNW A;  1USH A;  4MOV A;  4UWQ A;  3EGG A;  3E7A A;  1HP1 A;  3EGH A;  3H69 A;  4FBW A;  1MF8 A;  3H60 A;  1SU1 A;  2IAE C;  2IE4 C;  3AUZ A;  4H2I A;  4O5G A;  3THO B;  1W24 A;  5JPF A;  2A22 A;  2CV9 A;  3D03 A;  2WDF A;  1WAR A;  4ORC A;  5IOH A;  4H1Y P;  3FLO A;  2QFP A;  4WWL A;  1U32 A;  5JPE A;  3T1I A;  2WDD A;  4F0Z A;  1FJM A;  2BQ8 X;  3IB8 A;  3RQZ A;  4H2F A;  3RL3 A;  3PSN A;  4IYP C;  1UTE A;  4ORA A;  1S8E A;  3H68 A;  4UT3 A;  1XM7 A;  2HYO A;  2QFR A;  4H2B A;  4ZVZ A;  1M63 A;  4LTY A;  4YKE A;  4ORB A;  5C1V A;  2ZOA A;  3IVE A;  1S3L A;  2Q8U A;  3N5U A;  4JA7 A;  1WAO 1;  4M0V A;  2JOG A;  1UF3 A;  3RL4 A;  4JA9 A;  3ICF A;  4LAC C;  3ZU0 A;  2YVT A;  4DT2 A;  1T71 A;  1G5B A;  3QFO A;  4O43 A;  1Z2X A;  2AHD A;  2KKN A;  3IB7 A;  1XZW A;  2Z1A A;  3PSO A;  4J6O A;  1OIE A;  5INB A;  2O8G A;  3THN A;  2WDC A;  3DW8 C;  4O4K A;  4HD0 A;  4V0W A;  2DXN A;  4TUI A;  5F3W A;  3K7V C;  1V73 A;  2BCD A;  2Z72 A;  5JJT A;  4KBP A;  2IE3 C;  2Z06 A;  1HPU A;  3AV0 A;  1TCO A;  3QFK A;  3H67 A;  1JK7 A;  3H62 B;  1S3M A;  4TUG A;  4LU9 A;  1S3N A;  3QFM A;  3QFN A;  4Q7F A;  4I5N C;  4NZV A;  2NYM C;  1AUI A;  4MOY A;  2USH A;  4XPN A;  3ZTV A;  4I5L C;  2NXF A;  5HPE A;  3E7B A;  1OID A;  2O8A A;  4FBK A;  1II7 A;  3V4Y A;  3IVD A;  1IT6 A;  1HO5 A;  4H1S A;  3E0J A;  4B2O A;  3C9F A;  1S70 A;  2BDX A;  3H63 A;  3H61 A;  1QHW A;  3QG5 C;  1S95 A;  4FCX A;  4V0X A;  1KBP A;  1QFC A;  2P6B A;  2QJC A;  2R17 A;  3LL8 A;  5J28 A;  4IL1 A;  2XMO A;  3DSC A;  5GTU A;  3H64 A;  2DFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...